1FDBA

Crystal structures of oxidized and reduced azotobacter vinelandii ferredoxin at ph 8 and ph 6
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of oxidized and reduced Azotobacter vinelandii ferredoxin at pH 8 and 6.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport(iron-sulfur)
molecule keywords FERREDOXIN
total genus 32
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fdbA00
2VPWB 3MM5B 1FRMA 2C3UA 4OV1A 1FXRA 4OMFG 2C3YA 1BD6A 1VJWA 2VKRA 4RKUC 3IR5B 2WSCC 3MM5A 1DURA 2WSFC 4CI0B 1BLUA 3IR6B 1H7XA 1C4AA 3MMAA 4Y28C 3MMAB 1KQGB 5L8RC 1FRXA 6FDRA 6FD1A 3MMCB 3MM6A 3MMBB 3GYXB 1H7WA 1FRLA 1H98A 3OR2A 1A6LA 1H0HB 1SIWB 2Z8QA 5E7OB 2O01C 3PNIA 4XK8C 1BC6A 1Y5LB 3MM9B 1Y5IB 1D3WA 2WB1D 1PC4A 1GTHA 1GTEA 1ROFA 1SJ1A 2ZVSA 3OR1B 1JNRB 2FJDB 1FDDA 2C3PA 4KT0C 1FTCA 1FRKA 2FGOA 1R27B 1FF2A 2C3OA 5CHCB 1B0TA 2FJBB 2V4JB 2PA8D 5BYSA 2PDAA 1Y5NB 1FDNA 1B0PA 7FD1A 3MM8B 4L6V3 1SIZA 3MM7B 2XSJB 3EUNA 4XDCA 1AXQA 5BYQA 1KQFB 4AYBD 3MM8A 1F2GA 2C42A 1GAOA 1FRJA 3IR7B 3MM7A 3OR2B 1Y4ZB 3EGWB 2FD2A 2GMJA 3LW5C 2XSJA 1DAXA 3MMBA 1FEHA 4YDDB 1G6BA 3MM6B 1DFDA 2FJEB 2FJAB 1HFEL 3OR1A 1IR0A 5BYRA 1RGVA 5CH7B 2V2KA 1B0VA 2C3MA 2IVFB 1FRHA 1C4CA 2WSEC 2UZAA 1XERA 2VPZB 1JB0C 1BQXA 3C8YA 1Q16B 1FCAA 2PMZD 1WTFA 1FXDA 1G3OA 1K0TA 4DHVA 3MM9A 1IQZA 2WAQD 1CLFA 2GMHA 3EXYA 4ID8A 2VPXB 3HKZD 1JNZB 1F5BA 4XDDA 2V4JA 1BWEA 1FERA 5FD1A 2FDNA 1FD2A 1GT8A 1FDAA 2VPYB 7FDRA 1KEKA 1FDBA 1F5CA 1PC5A 1FRIA 3MMCA 2Y0SD
chains in the Genus database with same CATH superfamily
3QWPA 4TXSA 1N54B 1TUGB 3W5ZA 1FWLA 2C3UA 1A9NB 2DGXA 3W8GA 3W60A 3HX9A 3UCZP 2LQ5A 5T14A 1IWGA 2CZVC 3HFVA 5D4NA 2GVZB 2VKRA 3GJTB 1JLQA 1PG5B 3H7HB 3FZBA 4ES2A 2MJUA 2P6SA 4K5RA 2EFQA 2WB4A 3H5SA 3NGRA 1RTHB 3D66A 3GTYX 4DV4J 1VC5A 1C0TA 1JLGB 4ELTA 4OZ5A 3CCMS 3HMJG 4W92B 4OQJA 4OYIA 4DR5J 1X4AA 2ZWPA 1NKCA 4Y28C 4USVA 3CCRS 2IIHA 1WOPA 2NUUG 2AP6A 5IWAJ 1SI9A 2MGZB 2RDJA 3LGHA 4DR2F 2OEKA 1L3TA 3KNAA 2CPJA 1RAFB 5LM7E 2QGFB 1JLAB 4NRUA 4DPOA 3OVAA 3FEYB 4DL3A 1RADB 2W2NP 4GMKA 1S7IA 4F67A 4X4NA 4L72B 4MMOA 1JLCB 5J2PB 4WPAA 3HK2A 3BEGB 2F8HA 5F9NA 1FKPB 2H5IB 1QD1A 1RBLA 2CQIA 1UETA 2HAIA 3IWNC 2MHNA 1OYDA 1RTDA 3G9CA 1GX6A 4M5IA 2B6AA 1HD0A 3HSZA 5KFEA 5LMUJ 3SI8A 1XC9A 1G2EA 3KXDA 4CYUA 3KK3B 4RW9B 4ELVA 4Y2AA 1JX4A 3R5CA 4P71A 1XQIA 1DTTB 1NDKA 4YS2A 2D7SA 2UP1A 3HT0A 4KQZA 3ILIA 2MSTA 3SSSA 3C3LA 2UV8G 2NPFA 1VRTA 4W90B 1G7CB 3GU0A 2ZE2B 4CLSA 4ZP9A 3G96A 3AH6A 3K8VA 2WBMA 2R9LA 3KMQA 1TL3A 5I42B 2M88A 2XMAA 2JSXA 4F50A 1T7PA 3DLEB 2NR0A 1FHTA 2V4JB 1SH0A 2PA8D 2XZWA 2EFNA 4NZ7A 5KG6A 4B17A 1SL2A 4J9SA 1UWBB 1YIJS 1S1UB 1S4FA 2KT2A 3LANA 2CYYA 5LL6d 4OYAA 5J1EA 3MGJA 1VK8A 3UE2A 2YNFB 2W9CA 2NCKL 2X1FA 3HSGA 3ZTOA 3LQVA 2LXUA 2LA4A 1O5JA 2C2RA 2QYCA 1NB2A 3VAJA 4QIVA 3KNGA 2AJQA 3PIOQ 2LEPA 4C4WA 1CSJA 3MM8A 5SUHA 3KJVA 1ZOTA 4DWIA 2WONB 5DDRC 3VZIA 1TP7A 1XNQF 2X3GA 1R6VA 1Z2LA 4WP8A 3R8YA 4V19X 1AROP 1BQNA 3IA0A 3H5UA 2MKJA 5D6GA 1FEHA 2ZOFA 3MM6B 5D0EA 3ZXWA 1RTDB 2FJEB 1NRKA 1R3NA 2GJ2A 4A47A 4CCHA 4DR7F 1QM9A 2PFFB 2CFXA 5F8GA 1IR0A 2XMUA 2E1RA 1NHUA 3R2CJ 1TKTB 4JV5J 1U2RA 2QSWA 2H1YA 4PWDB 2AEFA 5KFOA 4UY85 3HHLC 3O1LA 4DFJA 3WDOA 2YKOA 1HWIA 4J9MA 2MY8A 2YPYA 3I5AA 2KKHA 4DHVA 1JIHA 3DYAA 3LA0A 3OL8A 4GO7X 3C14B 2OD6A 5L1IA 4LFCF 1C0TB 3IBWA 2FC8A 2R7OA 2X1GA 4ID8A 4ZVEA 1D9FA 4QCLA 4DFMA 2CQ2A 4ZCLA 5EHHA 4Y6IA 4JI6J 4B9VA 3BS9A 4QIGA 3D6FB 4JI5J 2CQGA 3PTWA 4NEYA 3BN4A 1HWUA 3CIZA 2QEXS 4LF9J 1HNIA 2B0GA 4K7QA 1FDBA 3PW7A 2NREA 2XBPA 3KFWX 3A8JA 2BANA 5JMNA 1KLMB 1S9EB 2K1RA 2RRNA 1UVNA 1C0UB 1RXOB 2BOAA 2DXDA 2L48A 1RAJA 4YHHF 4PCQA 4L3NA 1RA7A 1WDDA 1ZM2A 2EFOA 3J7YI 4J9NA 4AQYJ 1OIAA 3MHYA 4PXDA 5EWEA 1N33J 4JI0F 2J9DA 2UXCF 2BW7A 3MPYA 2D1CA 2OP5A 1TELA 4JV1A 3CC7S 3FKBA 2XYGB 1KLNA 1YJ9S 2XS5A 2HEKA 3VAHA 1G1XA 4HACB 4ZPCA 3CD7A 4CLZA 1X9WA 1VRQC 1UVIA 2AEMA 3MAAB 1HYSA 5DG8A 1BWVA 1SKWA 1RHUB 2HRYA 2R42A 4MYTA 3K8WA 3B4MA 2CQBA 4C6AA 3TYTA 2O5DA 2QA1A 2DIVA 1CLFA 4HTJA 3LTOA 4KH0B 1AFIA 3D7SB 4Q43A 4DL6A 4DV1J 5ETPA 4CNYA 3W65A 4IRCA 4O4GA 1S9FA 3QRPA 4K4ZA 5IT9U 3RB3A 2Z8QA 3TX0A 2ZJPQ 2OGUA 2Z2YB 2Y1LB 2MZ1A 5KT3A 4O3PA 1GX5A 1W25A 3M6WA 5FDLB 4F4YA 2AYGA 5GMEA 1AZSA 5AXNA 4OZNA 3MECA 1GTHA 1ROFA 2V6AA 2J9EA 4OHWA 4PPZA 4B3TF 3CTRA 1EARA 4U9RA 2M4MA 4OHZA 1D9AA 5HVGA 2B4UA 2W9BB 3VALA 1TV6B 1M1KT 3DI6B 4C8KA 2Y8YA 4OHVA 1T11A 3RBZA 2B7BB 4IFVB 1T8EA 4LF6F 4KY3A 1CJUA 4YB1P 2AT1B 2VFVA 2YWKA 4DPWA 4DS4A 2VG7B 2AJFE 4Q5VA 2QZ8A 4AL5A 4ITSA 4NA1A 3Q22A 1HNVB 4RNHA 1HARA 1KTQA 3DGPB 4X65F 1V6HA 2HS0A 3CCLS 7FD1A 2A1BA 4I69A 4P2FA 5ETVA 2WK4A 5B7WA 4DL0C 3M9OB 4FNIA 1JLEA 2GCFA 3FFIB 3DN9A 1F6TA 2RKIB 2W4CA 2YNHB 5BYQA 4MK7A 3P49B 4BBYA 2Q66A 2HPUA 1YJUA 1B64A 1IBKJ 1AYEA 1I51B 1XMOF 5J1EB 2ZH2A 1N6QA 1FNXH 4KV8A 1QDUB 4K4UA 4DMZA 2XMWA 5BXIA 4WFZA 3KLHB 2HVHA 1KWMA 2BV3A 2B43A 4CLTA 3NY0A 2AIRB 2WCXA 3ETMA 4USIA 5I4MA 1B4SA 4O3RA 4LFBF 5D8HB 2CNOB 4IUFA 4OYBA 3BPSP 1TK8A 5DM7Q 1NBEB 4ZCKA 5BYRA 3DLEA 4DG1B 5CH7B 4DUTA 4M5HA 1RHRB 2MJNA 1DTTA 1YWXA 3MOJB 3I55S 3CJTA 2GIFA 1S6QB 4C0HA 1VRTB 4ECQA 4IG0A 4JOUA 5AXMA 2HGNA 1I1GA 4RZRA 1JLFB 1IBLF 2ZE2A 2IDEA 3N5FA 4DCJB 1N5QA 2C28A 1TFWA 1G3OA 1YKWA 3OW2R 3HSJA 2DNMA 4UOCA 2VG6A 2NZ4A 2GJIA 4IRDA 1N5VA 3DGVA 3RZAA 1Q78A 2Q6CA 4LF2A 2VPXB 2DGQA 3DGPA 3H42A 3L09A 1REGX 3FSXA 2UV8A 3C6UA 3TEGA 3EVWA 4B9LA 2RE1A 1F5CA 3CXCR 2VPWB 4O23A 3KLIB 2FHKA 3BZQA 3RR7A 1IR1A 3MM5B 5LSLA 2VJVA 1NB7A 3M1VB 3R3TA 4N76A 1X0PA 3NGTA 1IWAA 5EWFA 1OSCA 5HATA 4EO8A 4L3KA 1WG5A 4OMFG 2BE7D 4KPCA 4TQSA 3T1YF 1U1LA 2CG4A 4K50A 3M30A 3J7AN 1C0UA 5CYMA 1RT7A 2HKEA 4ZS6A 4G1QB 4X4RA 1FE4A 4NCGB 2KFYA 2EKNA 2CG8A 1UPPA 1DARA 2YWEA 1D09B 3NGUA 3UN5A 3KLFB 2E9RX 3UCUP 3UO0A 5JJBA 4CO3A 1C1BA 3QLHA 3VV2B 3TUZC 4X65J 3VGUA 3KLGA 3D4JA 3LP2B 2PA3A 3LP1A 4USKA 3Q89A 4M95A 1NZ8A 2MPUA 5C7PA 3IXQA 3SEOA 2KT5A 2LKZA 2RU9A 3C14A 3NLCA 5LSRA 5H1SV 4DV0J 3TAMB 1N5SA 3T1HJ 2W2QP 1GXUA 2M0GB 3D6HB 4I2PB 4XK8C 3PW0A 5B09A 3OVSA 4C7QA 2D9PA 2GO9A 4H4MA 3SSQA 1SXLA 1Q86T 2IJNA 1SJ1A 1O0PA 1FJGJ 4QZVB 5HO4A 5KG3A 1YI2S 2F5GA 2U1AA 4DZDA 5HJYA 5HSPA 4YY3J 1RP5A 5GMDA 4NE9C 2QLBB 3HXMA 3RB0A 1FKOA 3NXZA 4UW2A 3TWZA 4EI2A 4WIQA 2CJQA 3W2VB 5BJRA 4Y2MA 3Q8RB 1B0TA 1EZZB 2BJ9A 3HSDA 1Z1ZA 3OL7A 1S0NA 2YKMB 2FJBB 2LA6A 1VQKS 2Y3YA 4RWXA 1PAEX 4ZJQA 4ECUA 1IBMJ 3DRSB 4AFFA 2DBBA 1T03B 2CZ9A 4ZVOB 1RUSA 2QFJA 5KFKA 3IS9B 2YVSA 4CWBA 4PPDA 4XIUA 3BPDA 3MUVP 2I1RA 1IKYB 2WVDA 4YR0A 4CH1A 4RW7B 1S1VB 2DNYA 2E29A 1XMQF 4LF5F 3R7BB 2ZBRA 1N0UA 2AX0A 2HS3A 5ETLA 4Z7CA 1U48A 3W7BA 3DLLQ 3NOGA 3NNAA 2EKYA 4UQTA 4FKXA 4YEAA 2ERRA 2DCUB 3D68A 4KTQA 4RW6B 3PDNA 4ZIVA 1RDRA 2DGTA 3DC2A 3V5RA 2DR8A 2J6SA 3LW5C 1DAXA 2JHEA 3DXSX 2I5JB 4FPIA 4PAAA 1RT5B 2N82B 4Q8EA 2KG1A 1RGVA 2MHEA 3AQPA 2ZH8A 5IS2A 2KXNB 2F9JA 4I4BA 1FJEB 3CB4A 1VC6A 2E7VA 2R3VA 1HWKA 2XMVA 3D1HA 3D1OA 3E01A 3OFFA 4NX9A 5E41A 1N36F 1JQGA 2IJFA 4WKRA 2QMUB 3NCQA 4DSFA 3HZGA 2HBYB 3B54A 3H5YA 4CIOA 2MMYA 4GO5X 2G2YA 1L3SA 2CIMA 5D4LA 3NL0A 3ZNJ1 2HLTA 1IJFB 2G13A 2YNFA 2GMHA 4URGA 3CDBA 2DHSA 1S1WB 3VTIA 3HFZB 2VKZG 2WRMA 4LR9A 4U8YA 1HMVA 2D3OR 1X4BA 3JSBA 5HANA 5KFMA 4I1TA 3PHTA 2BR0A 1B99A 1UVKA 5H9EK 1GT8A 3CCSS 3UR0A 1CEZA 4CTAB 2ZDOA 2A18A 2Y0SD 2ALZA 4Y2CA 2GHVC 1FRMA 3F0NA 5KT6A 2ZM6F 2VOOA 2MQOA 1MN9A 2VBWA 2E5IA 4USWA 2HMIB 3TAMA 2D74B 2VZ9A 2FZGB 4JB8B 4DX8H 3HZEA 3PRVA 1P9QC 1F2HA 1R43A 2EI5A 1H6KX 4DV7F 3BR8A 3AA8A 4QPXA 3A8IA 1VK3A 2B6AB 4LR8A 4MK8A 3CNQP 5ETKA 4O3OA 3QAEA 5KFNA 5DG9A 1JJHA 4FVMA 3DM2B 1XR7A 3BO4A 2V2ZA 3KJQB 1R6YA 3PVXA 2LU1A 5HROB 2Z2LA 3UDLA 1X4CA 2X51A 4FPRA 5HQMA 5M2RA 3C66A 5A76A 2ROPA 4GVBA 1FRXA 3HVTA 3DOKB 1VMBA 3JSRA 1T05B 1T9XA 5B0AA 3MMBB 3D0HE 3WIVA 3CE8A 1Y9OA 1GXTA 4OX8A 5B0FA 4QQBA 4DPUA 3OR2A 4LBIA 4MKAA 3GZ7A 4EGLA 4XPCA 4TU8A 4B3TJ 3MD1A 2VFUA 3GG0A 3ENAA 2KN4A 4DR6F 4DN0A 3C6UB 2B7CB 3CJ4A 5E7OB 4UZBA 1RAEB 1RT1B 2XC9A 1CJKB 2B9YA 3DMJB 1KLMA 1L5UA 3PFOA 5KFRA 4WBFA 1R0BG 3PEHA 3BO2A 2PI5A 2GHPA 3J7A1 4ZK7M 2HYIB 4NXMF 3NGSA 1LFPA 3H2VE 4FF3A 1SCJB 2NPIA 1HQ2A 3L7PA 3QO9B 5GAGI 2ZJRQ 1YZ6A 3DCAA 2AZ1A 3CJ5A 4N8OA 5HL7Q 4ZVRB 4ZVTB 1T94A 1D1UA 3H20A 3BKTA 3U02A 3J81Y 3MCOA 1RISA 2DNPA 3QRQA 4BDPA 4IQXA 1O51A 2A6MA 2J9CA 3LOUA 4ENOA 2L9WA 5HMWA 1YBAA 5GADU 3G6ES 1TUWA 4IO9Q 4NLDA 3GG1A 3PO4A 2X3DA 4DV2J 1BUXA 4ZPTR 1SIZA 4RW4A 1OPZA 2R2SA 1HNXF 1MWYA 1U4BA 4JI0J 3DRPB 2RS2A 3BV8A 1ZPVA 4OX7A 3MEDA 5A8KB 5BR8F 2VHGA 1N33F 3QFHA 5EX0A 2YQ3A 2QA4S 1U0HB 2HHSA 3M8ZA 3WX4A 2IAJA 2UXBJ 2MB0B 3H2LA 3D6TB 5DDQC 4ES1A 4PWDA 2KM8B 4RW4B 4DSEA 4USTA 5FDLA 4RW8A 2HWTA 4B3OB 4AUKA 4DQSA 3CJQA 2MQQA 2UUBJ 4NRTA 4NLYA 1EP4B 4CLLA 2QO3A 3MCSA 3MTKA 4Y0FA 2DGSA 3QYYA 2MKKA 2E44A 1UCNA 3BR9A 3I6PA 4KAIA 1L3VA 1GNKA 5G4DA 4ZMMA 4YQWA 2Y9HA 2RQ4A 4KBIA 4LRFA 1MWQA 1Q79A 1IKXB 1HNVA 2CQHA 3KDNA 3NP5A 1J5OA 1X5PA 1URNA 1SH3A 1X8DA 3QJLA 2AYMA 2P9EA 4K8RA 3NMAA 2OPSA 3CCUS 4IH5A 2E5LF 3UW1A 4N7TA 3H2UB 2EK1A 2CPHA 3H40A 4LF7F 3HKWA 4K4TA 2NLWA 3T9NA 5LJ5Y 2I6WA 1WORA 5HAOA 2I0XA 4LR7A 1LWFB 1UFLA 3G86A 1IBKF 2J76E 2RILA 3RU0A 3OPKA 4WK3A 4J91A 3TVKA 2F4VJ 4YOEA 1S7HA 4OV6A 5K8MA 4J9QA 2JL9A 3ZZYA 5KG7A 1UEVA 1RWWB 5FLXU 4X4PA 5HVFA 2R2RA 3POTB 5E3QA 4PQUB 1VRUA 2QLWA 2Z4PA 1UA1A 4TU9A 5FJ4A 2ZH9A 1QSLA 4JI8J 2B9EA 3HHLB 3LGNA 4HLBA 1MMLA 2K3KA 2KYXA 1PJ6A 4LIWA 3TAQA 2E1MC 2DHHA 5JVGQ 2RRBA 4DU7A 1SL0A 2BKPA 3KHRA 5D3GA 1VLYA 1FJGF 2IJRA 1F3FA 4TNOA 4QWBA 2BE2A 3DLKB 3CMES 1IKWA 3EVOA 5F9LA 2ZJQQ 1R89A 2QRRA 1NK8A 2IYGA 3MMCB 4ED5A 2DNZA 1QTNB 3MM6A 3CDAA 1QVFR 1KHVA 2M3DA 1JLBA 3ENVA 2VF3A 4ICLB 3NAIA 3G6XA 1X0FA 1GQEA 2V8VA 2HRTA 5HROA 2ACMA 2X1AA 3H98A 5K14A 3V4IA 1SIWB 3GR0A 2AKWB 2EWHA 4ZITA 2W7PA 1SPBP 2O01C 1O8BA 2QLXA 4J9UE 5JXSA 2QV6A 3VVUA 4NASA 5LMUF 4IR1A 3MM9B 2RAQA 3FRYA 2B4OA 3LF0A 4DQQA 3P8BB 3V6DA 1ELOA 1UJ5A 5HK4A 3HJVA 1W2IA 2A3JA 1OY8A 1X4GA 3IBCB 4CO4A 4N56A 2YX4A 2I8EA 3KHHA 4KGZB 2CZ4A 2E7WA 1S6PA 4ZP6A 5FIIA 3OJSA 2RDIA 1FX4A 3R6LB 4KC5A 5E5NA 1TL3B 2ZNYA 1Y11A 3MEKA 4AE5A 5I42A 2J7KA 2PDAA 2O1PA 2JWNA 4DR5F 1KOHA 5DM6Q 1WDTA 2XY7A 1BQMA 2BRKA 1WOOA 3LUYA 3QJPA 3OTOF 2XS7A 4AQYF 4GKKF 1NPPA 2AJ1A 2W4PA 3MM7B 4O0NA 1VQSA 2GQ2A 4RR5A 1T02A 3KK3A 3W3SA 2HNDB 3MPDA 8ATCB 5KFDA 2BRLA 3K17A 4FNHA 2F9DA 2MXYA 1TFYA 4R5PA 5K9FA 3LAKA 4U7UD 1HBNB 4I67A 1LW0A 1F9FA 4P2SA 1NJZA 5C42A 3HJFA 1HWJA 4P74A 1FFGB 2EEYA 3W61A 3W5XA 4AYBD 1NK0A 1DY3A 3MD3A 4LRBA 1HNWF 2LQ8A 3SIPB 1Q7YT 1FRJA 2HZCA 4CRJA 1ZTWA 1IBCB 1Y3KA 2RHQB 4CP5A 3PX4A 2BUNA 2Y8WA 2AWZA 2KDOA 2NZCA 2CQ1A 3ZTSA 4U7CA 1EETB 2BJ3A 2XSJA 4YDDB 4DF8A 4DSJA 3MEEA 4K2XA 1U26A 4C98A 2JEFA 3EM1A 5C42B 5DETA 4LFCJ 1KQSR 2KYZA 4P10A 5D77A 5L1KA 5HLFA 4DPYA 4Z2XA 3BQ1A 5IM0A 1T0TV 3CDWA 4LSNA 2YY3A 4KHPJ 4OZ0A 4FXVA 3TUPA 4Q44A 2C2NA 3N0VA 4WTYA 5HQLA 5K8NA 1EX8A 3TAPA 4LFBJ 5AE3A 1Q8BA 5KT7A 1IKYA 1YRXA 3PR4A 4PEOA 4JV5F 1AZSB 4ZVPB 2RVJA 1VI7A 3AXMA 3K89A 3OFHA 3QWUA 4DPTA 1KR4A 1QAJA 1S6UA 5ETTA 5CZVA 4EBEA 1EIYB 1PIEA 2N4CA 2W7AA 2DK2A 3DLJA 4KKOA 3KJNB 2J8AA 3GIIA 3K5MA 3EDQB 1SV5A 5ETSA 4DI6A 2FLPA 1KP6A 4M5DA 4WP3A 2VU5A 1VBKA 3KOAA 1JLCA 4R0EA 3OXGA 3M6XA 4TY8B 2K2PA 2KVQE 2M8DB 4FYXB 4ICLA 3VGSA 5C24B 4MKVA 2GJFA 4OHXA 4J9PA 1M5PC 1RWNB 5L39A 1WHXA 2A6OA 4LMZA 1HKAA 2ILYA 4USMA 2HQ3A 2J9DE 4R25A 1SUQB 2FGCA 3IBFB 4WCEQ 4F8RA 3W8PA 2K7KA 3PRDA 1S49A 5M2UA 3EPGA 4DF4A 1HWLA 4CO0A 1NO8A 4ED3A 2P5VA 4U7UK 1JLGA 1GMUA 4PYDA 5HP1B 1WF1A 3Q83A 3FMWA 2WSFC 1RTHA 4X4QA 1YJNS 5A2QY 4NYOA 3MF5A 4NLWA 1H7XA 4MAKA 4KHPF 4PRFA 4IOAQ 4K4WA 5HLFB 4ZIWA 2LQ9A 2CJYB 3KUGA 3NAHA 4WFAQ 3HHDA 3OLBA 1SJ4P 3TVZA 3MCMA 2MZTA 3CVKA 3MFIA 3R7NB 2XLKA 4FYDA 3QGPA 3R5GA 3W2WB 3QT8A 2V9KA 3QSIA 2X1BA 2QFIA 4WP9A 1XNQJ 4JI7F 2HFVA 4DZ6A 4KR0B 1H0HB 3LP0B 3RTVA 3NNHA 3CCJS 1FNMA 2VQEJ 1TKXA 5DQGA 4B3SJ 4P7VA 5CYMB 2HVIA 2F65A 3RG6A 3ZTPA 1XMBA 2YNGB 4DUYJ 2G2OA 3K7RA 5A8WA 4ELUA 2B3TB 1TU0B 2CJKA 4ED1A 1QUVA 3IGNA 2VB6A 1I5OB 5C25B 2VA2A 4LF1A 3NS7B 2V94A 1S99A 1S1UA 2FZCB 4OZJA 3C16B 4E0DA 3NBPB 2HFOA 4LF6J 1WTBA 2AJ4A 2UVVA 2UXCJ 2OSQA 3GLJA 1B3TA 4RW6A 5CHCB 2XMKA 3OBIA 3BQ2A 1FNOA 4Y2IA 5EN1A 1N88A 4NEZA 3AXKA 5IV4A 3KLHA 1Y5NB 4GKJF 1FDNA 3A3OB 3HI9A 1YRUA 1FESA 1RQ0A 2BABA 3MM8B 4DCOB 2YQ1A 5CXTA 4NMLA 3MEGB 2R7WA 2CPZA 3SV3A 4CM2A 3NRBA 1QVGR 3TW0A 2G1DA 2JC0A 3R1LA 4CYUB 3BBFA 2W1BA 4DPXA 2U2FA 5D0GA 2KU7A 3C15A 4B08A 1RT1A 2KB2A 2V67A 5KT4A 2BX6A 5KFFA 2VFRA 3EX7B 4ECTA 1ZS6A 1QLNA 2WVCA 5LJ3Y 4ZOSA 5HBMA 3HLUA 3PFEA 1MWZA 1S6QA 3Q2SC 2HHQA 3J7YU 3Q8SB 1VDHA 3IN5A 5CCLA 3EPIA 3W2VA 4DL5A 2UVWA 1W7WA 2CNLB 1CJKA 1X5OA 2HS4A 2B9XA 3D6MB 4Z37A 2ZD1A 9ATCB 2ZZTA 4QIFA 3CC4S 4NXNJ 5F8MA 3HCXA 3OJUA 2ZVIA 3R5JB 4MT1A 2MTLA 3TJ8A 3Q8QB 4NXNF 1UWBA 3SBMA 2B4PA 3FQKA 4ANCA 5A8WB 5KOXA 3RYLA 3LP1B 2CA9A 3OQ2A 3WQPA 3V6KA 4MKYA 3R27A 2IRUA 4HHJA 4RBVA 4DV6J 4FBUA 4IYQA 1X4FA 3UI3A 1BQXA 2B51A 2DO4A 1S76D 3CCTA 4CLPA 1HPZA 4LF4F 2VDIA 2RIJA 4X4TA 2OIHA 1X4EA 4QU7A 4HHHA 1HD1A 5KFTA 3SCIE 4JI8F 2CUYA 3WC0A 1NHKL 2ZKTA 2Z56B 1CJTA 3C2PA 1DQ9A 1LXJA 1M5SA 3I4HX 5B0CA 1FD8A 5G0RA 1Q4RA 2KHCA 2MSSA 4H4KA 3I0RA 1IKVA 1REVA 3HKZD 4CM0A 5KFBA 4RNMA 3KMSA 3SYZA 1HYSB 2W2MP 2E5HA 3SFGA 4W98A 3AJDA 2O66A 3IG1B 5FD1A 1FD2A 4U67Q 2XULA 4G1QA 1S72S 1A0OB 1ZM3A 4N47A 2M2BA 1WKLA 4G65A 3GIRA 5KFIA 3ISNC 2V4QA 3I9V9 2R7UA 3SQOP 3LO3A 1RWKB 2ZUGA 4GVBB 3QRRA 1JLQB 4RX6A 1NDCA 4A8FA 1OQ3A 4A8SA 1HI8A 1KONA 2HWIA 3LP2A 3OSNA 1KFSA 4DSLA 4NLGA 4FF4A 5KFVA 1VQ6S 1RTJA 4MFBB 3UNYA 1R0AB 2CXEA 4ZLLA 2XMJA 3TQEA 3JQMA 4LT6A 1RT4B 2ZBQA 1PSDA 4TU7A 2VIHA 2DR9A 4NLQA 1XWLA 4B3RJ 2FIUA 1X4DA 3K5PA 3JAMY 2N7CA 3QZ7A 1NDLA 2C1EB 2I5JA 1RTJB 3VQSA 4R8UB 3TA2A 1KVIA 3GFHA 5HMZA 3N6MA 4RNFA 4Q0BB 4WZMA 4ZP7A 2CQ3A 2JLFA 2PN6A 3FK4A 1UJ6A 2L3MA 1FXLA 5CD4H 3PIPQ 1RT6A 1NK6A 4YB6A 1S1VA 2RHSB 2OELA 2VDHA 4WXOA 1N4LA 1Y5IB 2UU9F 2E9ZA 1PC4A 2Q6BA 3OSPA 2LXIA 4NA2A 4HKQA 2DO0A 1U49A 3TJ9A 1YLXA 4OL8A 1QAYA 1KKHA 1VGYA 2DB1A 3RBDA 2OLWA 1S1WA 4EYHB 1MSWD 3RW7A 1QJHA 2RS8A 1HQEA 2XY6A 1RT2A 4K4XA 3N28A 1HNZF 4EWTA 4B3OA 1U6FA 5ETQA 4GC7A 3CJ2A 3DRRA 5GVQA 1S5ZA 2K3IA 4X84A 3BF4A 1BE4A 1FK9A 3PJ9A 4FYVB 3QAUA 4L74A 4IOCQ 2J0QD 2DXEA 4L6V3 3JAMU 3EGZA 2QJ3A 2EW9A 3GIJA 4B3MF 1B70B 2RB7A 3KUHA 3OTDA 4Y3CA 8RUCA 4X4UA 5F8NA 4OLOA 3MAQA 2W24A 2XG8A 1PBAA 2XWXA 4DSKA 2CPXA 2HNYA 1KQFB 2ZDPA 3QGGA 3FCVA 4DV3F 2DPIA 2V8GA 4ZLPA 2E5LJ 2FVRA 1MU2A 4A8KA 3R5DA 1U8WA 2HVDA 2R8HA 1GAOA 2L08A 2JRSA 5K5MA 1LQ9A 2UUWA 4JI2F 5IOLA 3TJAA 1LWCB 5CQGA 4DX7A 4FP9A 5E0OA 3T19A 2GMJA 2OPRA 3BREA 3M8SA 1DFDA 4OI1A 4OZ2A 2YX1A 1VYAA 1P8GA 3GIKA 1WSVA 4QWCA 2MZJA 3W64A 2BW2A 2RMLA 3JQJA 2ADBA 1TR0A 3ETOA 4OYPA 3QIDA 3UWTA 4ZPAA 2CDRB 2F8MA 3W9HA 1V3RA 3BBBA 2ZBIA 3L9ZA 4DR3F 2Z2ZA 1N34F 1VQ9S 3C8YA 5CAAA 2C2DA 5T7LB 4RBUA 3GJSB 1KVKA 3A8KA 2HHTA 1Y0HA 1YGYA 5EX3A 5I3UB 1U6ZA 1H72C 3D2WA 5EUHA 3HULA 3MFHA 3M9MB 4F4KA 1EJ7L 1C1CB 3MOZA 1K9MT 4K0KF 4AL7A 3TZWA 2R7VA 2MQMA 1JNZB 2K8GA 2NXNA 3O2IA 3ET6B 1JKHB 3CC2S 3HVTB 4NA3A 3PEJA 4HVZA 2Y1IA 2YNIB 1RE1B 1FERA 2FJVA 2FDNA 4C8YA 4WZQA 2V50A 3G6VA 3Q8YA 1VJQA 3MMCA 3DM2A 3M1VA 1NSKL 2HIYA 3R5AA 3WC2A 1IKVB 1REVB 1QY7A 4JI3J 2FZKB 4OZ3A 2VA3A 2BE2B 2LXFA 1UWAA 3DLKA 2YQ0A 1ZA2B 2BMBA 1GK8A 2HK2A 1YVFA 1UEKA 3UVJA 4LF8F 4WE1A 2YWWA 3UN2A 2PMHA 1CULA 3IR5B 2UUCJ 3EGNA 2FQQB 4ERDA 3BBCA 4FS1A 4B9UA 3T41A 2CJ9A 2Z57B 1WHWA 4F04B 1RT7B 3AT1B 2NSBA 5DS7A 5DRKA 5K14B 3TOQA 2XO6A 2C22A 2D3UA 4XO0A 1S97A 4RL1A 4EZ6A 2GS8A 3UVJB 4K4SA 2FY1A 1K44A 4LRDA 3PHEA 1KBRA 1MROA 1U0SA 3BGRB 4DFPA 1AB8A 3VAFA 1S9GA 4HT7A 5H9FJ 2Z0GA 5T41A 2AJ0A 1E6VB 1YQHA 3M2VB 4PG7A 5IQQA 2BXJA 4EEYA 3L7UA 3GP9A 2XB2D 1SL1A 2BA9A 3OV7A 1OS5A 3PXGa 5B0EA 4DV2F 4DR1F 3PNIA 1ZZFA 3AY0A 4I56A 5D78A 4J9KA 4KSEB 1V5VA 4Y65A 3A12A 3ITHA 5D0HA 2PO4A 4DS5A 1XMQJ 1S6OA 4DDFA 2YWHA 3NWGA 1D9DA 3ADAC 3FJ2A 4ILMA 4M5JA 3DLGB 2A2DA 2YXLA 3C6TB 1APSA 1KNZA 1WI8A 2GVDB 5I3QA 3MURP 2PD1A 1X60A 1VQOS 4EO6A 3M8RA 3PYDA 4KGMA 1JXVA 3DU6A 3QGIA 4ZA1A 3R9LA 1FX2A 2E66A 4DV7J 4F02A 4DXLA 1BHNA 1FF2A 1KC8T 4NLXA 3VWSA 3HM9A 1HR0F 4PXEA 3CULA 3EVMA 3IRXB 4NXMJ 3QJJA 2HW3A 2G2ZA 3CJKB 2B8QA 5BYSA 1NNDA 5CA5A 4A4JA 2ZHAA 1NJXA 2H48B 1X31C 2Q1LA 3C46A 3ICLA 2KFNA 4CO5A 2LECA 4MH8A 2H54B 1E6YB 2FHOB 3OT9A 3K57A 3PW5A 2D41A 1T3NA 1AXQA 1NDPA 5IT0A 2HFSA 1XK8A 2NSCA 2R7RA 2FLLA 4BS2A 1BXNA 1T3OA 1RT6B 3TVYA 2PGCA 3FGVA 4KV8B 2JEIA 3D0GE 4OI3A 3NGKA 3TZZA 5DDPC 3KLVA 4F4ZA 4M63A 4JI1J 4KPYA 1RK8A 4DR4J 1FFSB 3V81A 2A2CA 2XTJP 5IZHA 4M94A 4UTGA 5LSOA 2ZH7A 3RBEA 2VV5A 3HVAA 1Q0NA 2QTWA 1ZA1B 4KO0A 3ZZUA 3DLHA 2OPPA 1N5YA 3VCDA 4L73A 1L3KA 3CMQA 1S1XA 2DEJA 4CLUA 4WFNQ 3VGVA 4LREA 3AD7C 3FBEA 3RB6A 1J5EJ 1U1OA 2OFGX 2G9OA 2PT0A 2CWXA 4PQAA 1YX2A 5DZ6A 2WSEC 3OHAA 3KJVB 3W1YC 3X3UA 2ROEA 1HQEB 2HZVA 4W4MA 2GHWA 2GMLA 2DD8S 3TZYA 5ITHA 5KG2A 2QA4G 4J9LA 1LW0B 1WC5A 2IC3B 2MKYA 4NI2A 4OFZA 5IC4B 5H9EJ 2IYIA 1AT1B 1WKJA 3I96A 3PY8A 1WF0A 4LSLA 2HVZA 2D3ZA 4BLGA 3V6JA 4ECRA 4X64F 2G0CA 5D3GB 1WG1A 1JLAA 3M8PA 2JFDA 4JV0A 2QL7B 3I4PA 5J2NA 4LBPA 1HQUB 4NMXA 2COLA 3DOKA 1TMMA 2KXHA 1ZM9A 3PX0A 5ETMA 4X4VA 2V4JA 2PSZA 4P72A 5F0WA 4ZVHA 4PG5A 1NM2A 1HI0P 1KEKA 1FVQA 3I9ZA 2KO1A 1KTVA 4OZ1A 3UDCA 2RNEA 5DG7A 3R7SB 1YG0A 5DZ7A 1LOUA 1CC7A 1LWFA 2CDQA 1WELA 4B9TA 3KLFA 1PGZA 4UY8T 4OV1A 1FXRA 2HMIA 1VJWA 2QL9B 4NL5A 5F8HA 3RAQA 1N32F 5HJXA 4CT9A 1S0VA 4QWEA 4YN3B 5GAHI 4IO1A 3V4IB 3VAKA 4ALZA 3KLIA 5KFSA 5JUMA 3G6YA 1P27B 2W2PP 4Q2LA 3MWBA 1FWPA 1URRA 2N7YA 4J90A 3VZHA 3G8QA 1JKHA 3P4UB 3B8HA 4PWWA 2RH3A 4H54A 5C24A 2V4RA 1RT3B 3QSYB 5I3UA 4UOHA 1PJ7A 1KQKA 4J9VA 4IDKA 5HQ8A 4LRAA 1AFJA 1TMJA 1VS3A 4RUBA 4ED0A 1IM6A 2LYVA 4GRSA 3DDKA 1RU1A 2NXEA 4ED2A 3TI0A 2V5HG 4CLYA 4QWAA 5B0DA 1Y5LB 5E33A 4IH7A 1D3WA 4P9SA 4WE1B 4CZCA 3VAMA 3NG8A 2M9KA 4JI4F 2UUTA 3JTOA 3Q23A 1RB0A 1FTCA 2ZM6J 2ADCA 1SC1B 1SC6A 1RBAA 4OJGA 1KS2A 3DOLB 1NJIT 2KRBA 1TK0A 5KFWA 4PG6A 1LWEB 2IRXA 3OVBA 3QT6A 3PW2A 3KK1B 3CO9A 3SCKE 2AYEA 1R7IA 2AV5A 4WFYA 5HVHA 5LMNF 4OLPA 5KFLA 4M5LA 1K1QA 3HHLD 2XI3A 4WYWA 4U6PA 2BZ2A 3R97A 1P9YA 4RUAA 2AX1A 2PC6A 2I9SA 2LQBA 3H25A 2PI4A 1XNRF 2XMTA 5J1NA 4KGXB 2ASDA 2IPOB 3P5BP 3T1HF 1QAIA 3IRXA 4RW7A 2QLJB 4FYYB 4OI6A 2HBRB 5DGBA 2E9TA 3E51A 2XI2A 1VHIA 1U6BA 1T9UA 4M5KA 4NI2B 2CQCA 2WOMA 2DITA 2XLJA 4S0MA 2BYCA 3CMAS 1IR2A 2B9WA 4DQIA 1EB0A 3OXFA 4NWBA 1SJRA 3EGVA 1OQ6A 5IT4A 2MKIA 3S7RA 1UZDA 4DJBA 2FVCA 4C8MA 3E2EA 2DGUA 1A7GE 4HH0A 1UPMB 2NYIA 4RUHA 1X9SA 3PG9A 3W66A 2R7SA 2XEXA 3HD1A 3AA9A 5SZTA 2J8SA 2OPQB 4N41A 2ZH5A 4LF7J 2OTLS 4I2PA 1JB0C 1UW4A 4ZPBA 1YJVA 1Q8KA 1FCAA 3P5TL 1WG4A 2HQGA 1U0HA 1TKXB 4A48A 1GFWB 4ZKAA 2B8PA 4C2MA 1FJCA 1B7FA 3KK1A 4QW8A 1U09A 5AJ3J 4EZ9A 4O0IA 3CJ8A 1CQNA 2GAGC 1ZYQA 3EXYA 3M2UB 3FZ2A 5F3ZA 5F8JA 3MPWA 2V8HA 5GMKa 1U02A 1HW8A 4A8XA 1IQTA 3H90A 4TKTA 1S0MA 2XGPA 1RT4A 1IXKA 2B56A 4C0BA 1BWEA 4G1IA 3FUYA 2LEAA 2JOQA 2FHJD 5KG5A 1RACB 1FRIA 2EG1A 2CNKB 1RLCL 3G8SA 3KG0A 2P9GA 1RT3A 1PO6A 4Q8FA 2HQIA 2KI2A 1WC1A 4LFAJ 3SQGA 4C9DA 3H8YA 4H4KC 4ZPVR 3TO8A 3K5LA 1SC4B 1JXLA 3M8YA 2VC0A 2AGPA 1L3UA 2GQQA 4CNZA 3KLEB 2DRAA 2DY9A 3ENQA 4IFYA 1J5OB 5GAHU 2ALYB 2WSCC 2VBZA 3G4SS 1NK4A 1OY6A 1FEEA 1N8RT 2W8KA 5LMNJ 4DLEA 1BLUA 4WFXA 2BQ3A 1C4AA 2JVOA 3LPEA 4J7CA 2WVEA 4Y2KA 1HNXJ 2ZUAA 4AD6A 1UP1A 1LEOA 2WW8A 2FC9A 3FBCA 1YBUA 2IC3A 3MMAB 3RUBL 4DL2A 2R8IA 4B3MJ 2AZ3A 1RU2A 3BH6B 4ED7A 4DR7J 3ZZRA 1XMOJ 4JP8A 4O3QA 3CCWA 3JB9k 4WFBQ 1FRLA 2WW4A 3DOMA 3L95X 4OZLA 4BCAA 3MAHA 4RPFA 3TP2A 2PEHA 4PABA 3CEDA 4FXWA 1N48A 4ER8A 1TKZA 4CQ1A 3S1TA 4NCGA 2QT7A 3L4BC 4C97A 4CH0S 1RTIA 4RU2A 5J2NB 4ECWA 2HIQA 2H4WB 2JLEA 2M52A 2BQRA 2F3JA 2VG6B 4M5GA 3CCVS 1BC6A 5L9XA 6AT1B 4CDIA 2DY1A 4WKYA 5KFYA 1ZETA 2MDAA 1NSQA 3US5A 3GB0A 1RSCA 3OR1B 1VISA 5DQHA 5DDOC 1XEZA 2MZRA 2HURA 3NGDA 2FLOA 4QOTA 1NH7A 2M8HA 3KK2A 2MQPA 4FZVA 4F4WA 2FGOA 1S4EA 4DR6J 4E98A 1U2CA 3QNWB 2MLZA 4QYRA 1UMJA 1LWCA 3E8OA 4DUZJ 4G6VB 1ZTTA 3GSDA 2XZTB 1F0XA 4L76A 4ZCMA 2DNQA 2BJDA 3O8WA 2DPJA 2YNIA 3HO1A 5B08A 1OWXA 3ZFVA 1N32J 1QAXA 5F41A 3NS6A 3UQSA 1MNEA 5HMXA 1Q5VA 3DXBA 4KGVB 3SDEA 3JYTB 3ISZA 4QU6A 5KFXA 2L9DA 1ZPWX 3UN3A 3G71S 3CUNA 2XO7A 2JDJA 4JI6F 2HHHJ 2IVMA 4HR2A 1ZAVA 2YTCA 2V9WA 4EU0A 4KYZA 1RWVB 2UUCF 3KWMA 1EP4A 1HHTP 3K2YA 2ZEJA 4OYOA 1LK5A 4F2RA 4YMEA 3CDUA 4OYWA 1NZAA 3CGIA 3C6TA 3GPAA 2OH2A 2UXDJ 2ROGA 3U27A 4RW8B 2KJVA 3IR7B 5IV3A 2HAFA 3OR2B 4KB7A 3FVYA 3P96A 4J9RA 3ITHB 4H4MB 4QYZK 4LBHA 3ZZTA 1HBOA 2JZ5A 4JYAJ 1T05A 2OTJS 4RNOA 2MGZA 3BGRA 1CQMA 5IWAF 4QWDA 2DXFA 4C3KA 2JEGA 1B0VA 3MTJA 4ZJLA 1UW9A 2DNGA 1FRHA 2OSRA 3BSCA 3FEZA 4TYBA 2N3LA 4UF4A 3V81B 4F3MA 4IR9A 2BEFA 2VFSA 3BYPA 4ANDA 4I2QB 2VC1A 5LOQA 3OUYA 3KK2B 3KHLA 1YBTA 2LEBA 1TK5A 1JWWA 5HI7A 5AE2A 2C2KB 3M05A 2R2UA 5J1PA 4Q45A 4DV5J 2ZC3A 3EXCX 3QIPB 2DNOA 2FVQA 2OI2A 3T5JA 4PUOB 1K47A 3T9ZA 2N3OA 3CPWR 3H59A 1FKPA 4Q0BA 1NAQA 3GV8B 4JV2A 4DR3J 3Q86A 3RRKA 4C8OA 3GIMA 4HDHA 2Y1RI 4HEA9 2ZFHA 4XDDA 1U1KA 3PRBA 2AJ2A 3SFUA 3FQLA 2V2VA 5E3AA 3DRYA 1TUVA 3EICA 4V1Ak 4HH1A 3I5CA 3Q0AA 3T3FA 4P7TA 3SV4A 1XN9A 1TL7B 4U95A 3CSKA 3CJ3A 3DI6A 4OYXA 3DU5A 1VQNS 3IWXA 1JK9B 4JI2J 1MROB 4AL6A 3KJFB 3HHLA 5DQIA 2C3YA 2HLUA 1SUQA 3RR8A 4AT1B 2MYFA 1SBRA 3GV7B 3OTCA 2HK3A 2IVYA 3KDOA 3NKYA 3I0SB 4CI0B 2PFDA 4F26A 1K1SA 2ZHBA 2ATCB 4F4AA 2DVIA 4OX9J 2ZC4A 4HT5A 1SKUB 4DV1F 2ZH3A 3SCJE 1NSPA 1F3VA 4MK9A 4X4SA 2HNZA 1KQGB 2GNKA 3FCWA 4EBCA 5GAEI 1K8AT 2P2CB 1CPZA 3UFCX 3ZZPA 1HBUA 4WWSA 4HHUA 4IG3A 2IM2A 1WC3A 4IKAA 4LIRA 1CVJA 1LNQA 2GX8A 2G1HA 1H98A 3AAWB 5KFGA 1RYRA 4ILLA 2H5JB 3M2UA 2CJAA 3Q8UA 1HQUA 2H51B 2YKNA 2MKSA 3PACA 2MZSA 4RU9A 3CJRA 3JTPA 3V4MA 1LFWA 3N79A 5F3TA 3A1YG 4C3MA 2OKQA 2F7VA 4Y00A 3FNNA 4OIXA 2ZZNA 1TKTA 1QSSA 4E8UA 4DQPA 3KHGA 3HVRA 1T9WA 1V3SA 4DX5A 4WK1A 4ED6A 1R8AA 4OYMA 2Q43A 2DGOA 1OYEA 1RHJB 2C3PA 4DV4F 1HMVB 1WC6A 5IFMA 2FHJA 2C2EA 3J80Y 2ZD1B 1RWMB 4ZVFA 3M8QB 2R4FA 3IFEA 1U1RA 2J7UA 1KVJA 2M7SA 1HLWA 4ES3A 1CJVB 1WSRA 2HWHA 1VBYA 3GR1A 2YKPA 3GONA 2I38A 1N5YB 2WONA 2QSFA 1DZ5A 3QQCD 4N77A 2Q3PA 2GC8A 3N6NA 3PJXA 4NLSA 4QJVA 4UQGA 1VIXA 1R0CB 2IBKA 2HNDA 4LF8J 4KO0B 1KSPA 1S10A 1RCOB 2VG5B 4R5PB 2BKNA 5ETNA 4F2SA 4ECXA 2HBQB 3AB2B 3TA0A 2AU0A 4JI3F 3OLAA 2ABYA 4HTIA 3FSIA 3SXLA 1TL1B 4ZPWR 3J7Z5 4ZJOA 2LDYA 3NS5A 1N0VC 2WVFA 5J2QA 1VQMS 2CPFA 3AB4B 4KHMA 4ZCIA 5IM0B 2Z2MA 2E1AA 2JC1A 3UD5A 1SQEA 1U2FA 4N5SA 2R7TA 4ZDNA 4ILRA 3MMBA 3R2DJ 1RTIB 1VHFA 2BJEA 5KFAA 2XSFA 3EE3A 2ACYA 2PMWA 2F4FA 3ZO7A 2B4VA 2LVWA 3PZPA 3OR1A 4LVNP 3GJRB 1IJEB 4CLKA 2VBYA 2V2KA 4USHA 3WX8A 2ASJA 3DOLA 1HHSA 4NPOA 2VPZB 1RKJA 1GEHA 2DH9A 1VCTA 2NXJA 2DNNA 3DMJA 2MQ8A 4RWWA 4YR3A 3UCGA 1Q16B 2APOA 2BJ8A 2JVRA 1S12A 2KT3A 1SJFA 1IUJA 1FA0A 2UXBF 1MLAA 1WF2A 3BGLA 3D28A 3TEHB 5E2QA 5IXUA 2XCPA 4ZHRA 3W5YA 2DHAA 2XHCA 3Q8VA 5KT5A 3KTQA 4YB5A 3I0SA 2HVEA 1QSYA 3BGFA 2VQFJ 4KFBB 1IBLJ 2R8GA 1H74A 1BMQB 2RD5C 1FFWB 2XNQA 2YKQA 2JFKA 3GFZA 2ZH4A 5JVHQ 1OPIA 2D9OA 3ILOA 4USJC 2VJUA 1KOOA 5ADZA 4DL4A 4IRKA 2IHR1 4X66J 2IA0A 2QX0A 5DJBA 1FDAA 7FDRA 3JXOA 2CJBA 2IFXA 2R7QA 1Q1KA 3HHEA 3JSYA 1PC5A 3M2VA 3NMRA 4X62F 3M6UA 2PEBA 3M2RB 2V34A 3FSYA 3P45B 2EFPA 1Q53A 1I6JA 4TY9A 3TX8A 4WTOB 2QA2A 1C2PA 3MPUB 2DR5A 2LDIA 3WIUA 2YKNB 5J2MB 2HHHF 1HL6A 1KD1T 2GVZA 1WC0A 2QE5A 3NNCA 1ITPA 1SV5B 4B9MA 4OHYA 1RZMA 1HNWJ 1R0AA 2UUBF 2D69A 5G0RB 2WHOA 3E01B 3OHBA 2BDPA 4QR1A 2DTJA 4A46A 5CD4A 1U24A 4MIAA 3IM9A 2SXLA 3ELHA 2RUSA 3PKYA 3RAXA 3GWCA 3BJYA 3ZTQA 1FT8A 2H65B 1LXNA 5L8RC 1IVZA 4QIEA 3QT5A 3H4DA 5DGAA 2CPDA 2FTRA 4QIWD 4GKKJ 4NLRA 4O4RA 2EFVA 4OYZA 4DR2J 3F41A 2ZZMA 1U7LA 2W01A 3EZOA 2V2QA 4MYUA 4DOZA 3NWRA 3O5TB 2XHWA 2WZ1A 3QT7A 5KFUA 2QL5B 4MIBA 3NCRA 1M5OC 3E3XA 2K7JA 1P1LA 1VFJA 2HNYB 1PYTA 4L75A 1WHYA 4RBTA 3T6BA 3I56S 1XIQA 2XNRA 4NLOA 1O6XA 1PYOB 3FEXB 4DFKA 4KIAA 4WU2A 3KKFA 2YH1A 1GTEA 3CJ0A 4DUYF 3H5XA 4USUA 3SCLE 1FKAF 3SMZA 1RAHB 1DJ0A 2FJDB 4J5OA 4A8WA 3BO3A 4KT0C 5E3RA 5K8PA 1IM4A 1FK9B 3W63A 3Q24A 1HI1A 2QN6B 2V69A 4M5NA 2DGWA 2RKIA 2XMMA 5L1JA 2IA6A 2OPPB 2KL8A 4FVCA 1UFKA 3NOCA 1U1NA 1VBXA 2BJ1A 1U1PA 1NKBA 4K4VA 2F40A 4X2BA 2CPEA 2VBXA 3I5BA 4PZVA 3VAIA 1UA0A 1VQ5S 2VL1A 1VQ8S 2FVSA 4WXWA 1FWKA 1TV6A 9RUBA 1M90T 5LXYA 3BN7A 5C25A 4KJIA 2GFFA 5EDWA 5K8OA 3MR2A 2OD4A 3JSMB 1CJUB 3HD2A 1R8BA 4F36A 3O6QA 1KRPA 3N9UC 1S6PB 3I87A 3IC1A 4BHQA 2DHGA 3C19A 1TKDA 4LQ3A 2ZOMA 1GH8A 5KG1A 1MU2B 2MQNA 4Y34A 2UUAJ 4LFAF 5IC6B 4NCBA 5IQ6A 3CCQS 4ATNA 4YR2A 1YITS 2VASA 3FFIA 4UT4A 1FJ7A 1Y4ZB 3PX6A 2FD2A 5AXKA 5CYJA 5GAEU 3HP6A 2EPIA 3IO1A 4NOHA 3UDVA 3DDNA 4PYAA 5DLFA 4DX6A 2FJAB 1Q82T 3D9BA 1HBNA 3C15B 3M4XA 3QO9A 2N4DA 2QLFB 1UKUA 4C8LA 1PYSB 2J6UA 1RHMB 3AQOA 3D54A 1YRTA 1F9EB 2Y0BB 3EWGA 3PYEA 4O3NA 2GGPA 3QPIA 3QZ8A 3CCES 4C8ZA 2G0IA 3V2UC 2XQCA 4EBDA 2VODA 3BKFA 1CS4A 3IP0A 3C16A 2WOMB 1BGXT 3CT9A 1IKWB 3HHKA 1FXDA 5BR8J 2J5AA 3BQ0A 1H73A 4U96A 3THTA 2FJXA 1VQ4S 1NPRA 2WAQD 4G1PA 1WWHA 2F1FA 4PG8A 1WD6A 3M9NB 3IMQJ 1LK7A 2R8KA 3MUMP 4I68A 2BM1A 2QYGA 3LALA 2MZQA 2Q79A 4I6YA 3TA1A 5KFCA 4JYAF 3FMBA 1S9GB 3QMQA 4IFYB 1DTQB 2JX2A 4HDGA 3T6JA 2BVZA 1HNIB 3UD4P 2KHDA 4NYZA 4WU3A 3B4DA 3BGUA 4Q7AA 5CYQB 3T1AA 4PWUA 1MMDA 1S9EA 1PAUB 2K1RB 1N52B 1SC3B 2NUHA 2RQCA 1NK5A 2IDLA 1VQ7S 3K59A 1HA1A 4ANEA 4O4GB 3LAMA 1WNEA 1TKZB 1TTHB 2KXFA 2IM1A 2YWFA 4F0HA 4I7FB 4MFBA 3DOMB 1VQPS 5KAKA 3M2RA 4QYZJ 1EAYC 1CULB 1XBWA 2VH7A 3B78A 5CYQA 1XNRJ 2ASYA 4ZPDA 4CLWA 4UZCA 3DLBA 1WC4A 1WEXA 2HHUA 1AUSL 2IY5B 2H9ZA 2Z58B 4KHRA 4XPEA 2MQLA 4K2JA 3U7JA 4F0MA 1IKXA 2CQ0A 2G0JA 2XYHB 2CRLA 2DH8A 4UOGA 2A0FB 3BM7A 3T5LA 2IM0A 1HBOB 2OPSB 4IQMA 3GYXB 2R2TA 1RAIB 1T9YA 1VQYA 4I6WA 1Y7PA 2OAUA 3DFEA 5ETOA 2YH0A 2DCLA 2IM3A 2DNRA 1DQAA 1TL4A 3QATA 3SSRA 3FBFA 1CJTB 1X9MA 1RYSA 2B5JA 2AYBA 1A6LA 3OTEA 2VQEF 4B3SF 4M5DB 3D67A 2DYAA 1Y10A 3DNCA 4MKBA 5U47A 1RLDA 5A6PA 2ZH1A 2OEJA 1SKRA 1S59A 4E2FB 4P2XA 3NEKA 4URQU 2DR6A 4ZN1A 5C2CA 5ETRA 2C2OB 4X4OA 2ZVSA 3CD0A 1JNRB 2ATLA 4M8LA 2MKCA 5D0RA 4CLFA 4LVOP 4OI4A 1X5TA 4C0OC 2EG2A 3H0PA 4ECYA 2CPIA 1SH2A 3PW4A 1NKEA 4F3OA 1UVJA 5MAOA 1LWXA 3GJQB 4OI2A 3TZXA 3FC9A 5L46A 2GAHC 4JBCA 1DHMA 1S0OA 1XR5A 1YJTA 2LFVA 2XS2A 1PCAA 4M1KA 2RUGA 4DUZF 3PKMA 1RWUA 4EYIB 2V8PA 4DG1A 1DRZA 2IMOA 4FKYA 4DBQA 2BKOA 2DIUA 3THVA 2GGPB 1S1TA 4DV0F 1E6YA 2XLIA 3GFYA 1YZ7A 1DLOA 4LSLB 1TVRB 1HIYA 2GW8A 1NHVA 1UFWA 4MIWA 2YX7A 3UR3C 5M2PA 1PBUA 4K5SA 1CG2A 1N6QB 3QBCA 5DLGA 1WEYA 2AGQA 4DCPB 4CO1A 1RABB 1BQNB 4FDFA 4ETXA 1RAGB 2LP4A 1RCXB 2CQDA 4RO0A 3AHPA 1M5HA 3JS9A 3D3CJ 3UPFA 4DV5F 2F4VF 1ICEB 4BWJA 2W9CB 2E7XA 3N5BA 3M8QA 2JLGA 2CVEA 3K58A 3KG1A 3TQ1A 1H2VZ 3KUEA 3LH2S 5D15A 2D3O1 1NJYA 1CJVA 3X1LB 3I82A 3UDEA 1UTAA 2BE9B 4OJ1A 2IVFB 3T5KA 5LXRA 1S48A 1ZAWA 2GIRA 3NBPA 4XAKA 2MLYA 3P6YC 1U45A 2YNGA 3P3DA 1BY9A 1Q8LA 3IGVA 3LPYA 3MR7A 4URSA 1YJWS 5KFJA 1UVMA 4CO2A 3WHIA 3AOBA 5I3PA 2GA7A 2FLNA 2MLXA 4GC6A 1IQZA 1TQLA 1V5IB 3A13A 5RUBA 1ZZNA 1ZM4A 3V6DB 2O67A 2W4DA 3IM8A 2VUGA 2R7XA 1VIOA 3BKUA 5A8RA 4F0KA 5F0UA 2HHVA 4MTPA 3BSOA 3B82A 4YFUA 1R31A 1N34J 3AOAA 1W2BR 1RBOB 3N4WA 1HBMB 2HNZB 2VPYB 3A3PB 1Y3JA 3LGMA 1C1BB 3QLHB 3FCHA 1HBUB 2FB0A 3AODA 5GADI 1DQ8A 1NU4A 5KTQA 5FLXY 2DGVA 1T9VA 4O3SA 1JJCB 4Q2MA 4KE5A 1RKIA 4DR4F 1JMTA 3PR5B 2LCWA 2O3DA 2OHDA 2FY8A 2BACA 4DU8A 4C11A 1KN6A 2VICA 2HBZB 2QMWA 4XTTA 3R6GB 2GO8A 2HGMA 4JUZA 1JLBB 3BSAA 3VQTA 1RWXB 3BB5A 1DURA 2DRDA 1J27A 3MM5A 1Q81T 2CWKA 4IH6A 4ETZA 5MLCV 1QUPA 1ZBTA 2DT9A 2KZMA 3GYNA 4DEZA 1M0SA 2DKOB 4F25A 4ZHRB 3TUJC 4ZLJA 3DHWC 5KFPA 1H2TZ 3M7VA 4A8QA 3AOCA 3PV8A 2ZH6A 1RHKB 6FDRA 2E1CA 2HG4A 3W9JA 4JI4J 2DJWA 1IBMF 3MZIA 2AW0A 3KYLA 1N56A 1TZ0A 3TNVA 1F5AA 1SVDA 1T9TA 2PIIA 1YTYA 2G4BA 1Q5YA 4EUVA 1EQMA 1HPZB 3GMGA 1NMEB 2OO4A 1DTQA 2X7IA 3I0RB 3GV5B 2DH7A 1NK7A 2C2ZB 4I2QA 3OUYB 4PG4A 4NLPA 3VGTA 1TAQA 4D3HA 3OL6A 4U8VA 4YDXA 4BC7A 4DR1J 1TVRA 3IAM9 3VF0B 2RU3A 4J9OA 1G4CA 3T1YJ 3QIPA 5CCMA 4P73A 4ZVSB 3U1LA 1X7VA 2E5GA 4AXIA 3F73A 2EC0A 4JI1F 2DNLA 4TQRA 3W62A 1R27B 4KFBA 1K73T 1N5TA 2EVZA 1PKUA 2C3OA 3I31A 3CJKA 2XCAA 3R1HA 3A8EA 3K5OA 4P2MA 1LWEA 4ZN3A 5A2QU 1U8SA 4DL7A 1TL1A 2RF2A 5A0YA 4TYAA 3DRSA 4DLGA 1QE1B 2NXCA 2FUG9 3CO0P 3JTNA 3MMJA 2EK6A 1WACA 2LU2A 2VONA 4LSZB 3IS9A 3PM9A 1EETA 1VR6A 2XSJB 3LWMA 3EUNA 2YNHA 2Y1JA 4XDCA 4C8NA 1D0EA 2VOPA 4PUOA 4TLQA 3HPOA 3O44A 1FI4A 3HT3A 3GQCA 2OJ3A 2K06A 3F44A 1F2GA 3DRRB 1RA6A 2B5JB 3S6EA 4X62J 3PO5A 1I94F 4YP3A 1VLOA 3KG4A 3MCNA 3ZZOA 5K20B 2YPZA 1DLOB 1VQLS 3D5MA 3DRPA 4B9NA 3RW6A 1M5KC 1K0TA 4X66F 3HVWA 1H3DA 3M6VA 3GE9A 1RT5A 3ISND 4IFVA 5LT5A 2KH9A 4B9SA 1EHWA 1KFDA 1HHQA 3VR1A 2VG7A 2VQFF 1SJQA 3MXHP 3M32B 2VG5A 5AE1A 2EBEA 1YK9A 3CWJA 5CZXA 4YHHJ 3MR3A 3RGIA 1U47A 2H5EA 1NJWA 2ZOGA 2PMZD 1EKSA 1WTFA 4O44A 3PCOB 1S79A 3J81j 2RJZA 3BSNA 3MECB 1P6TA 2WBRA 1MG7A 3FRZA 4G3IA 1UVLA 2KFZA 1J5EF 3MM9A 3MDFA 4QBUA 3DDIA 4I64A 4R8UA 4B02A 1AA1B 1YJ7A 2RT3A 3AD9C 5THWA 1QE1A 3VHQA 2KM8C 1FVSA 2CNNB 2OMOA 4ID5B 4DV6F 1J2VA 3ONQA 1SQGA 2JEJA 3HHNB 5KG0A 3OL9A 4NZ6A 4YB7A 4EK2A 3HF5A 2L9NA 3JQKA 4I6AA 2GZOA 3F56A 1MMNA 1UEUA 4P75A 2WTFA 1SKSA 2DRBA 1C1CA 1YSJA 3M8PB 1NSAA 3B6BA 1TAUA 4UOFA 1H2UX 2HQFA 1WHVA 3CDEA 3ULHA 2AQ4A 4OI0A 1EQ0A 2AD9A 3KLEA 1XTZA 3POTA 4RKUC 2M70A 1Z4UA 2F63A 4OJHA 1Q95G 1AW0A 2GV1A 4FS2A 3TANA 2XGQA 1OY9A 5D4PA 1ZAXA 3RB4A 3IR6B 3Q8PB 3HDSA 4WIIA 3IRWP 1NPKA 3S8SA 1UAWA 2DISA 4HL9A 5L1LA 5T7LA 2ZITA 3KLGB 4DN9A 1MN7A 4R0JA 6FD1A 2BANB 4GVLA 7AT1B 3W9IA 5C5JA 1NK9A 1H7WA 1HBMA 1R8PA 3GCWP 4P52A 3EMTA 3K0JA 1RWOB 2OUGA 4CTAA 1SB6A 4NLTA 2P6TA 1WOSA 1Z2ZA 2AMCB 3D0IE 5J2MA 2CPYA 1Q8IA 4ECZA 1JLFA 2V68A 2M5YA 5A8RB 4YY3F 1WI6A 4K59A 3ZNUA 2HFNA 2LMIA 3EYZA 3AFGA 2OFHX 1HW9A 1PILA 1AUDA 2CQPA 1U1MA 1W26A 3CJSA 1YJRA 2W7OA 3R5BA 2FJWA 2WB1D 3MI7X 4D3GA 5L9NA 5A6WA 3J81U 4ED8A 5HN0A 2J6TA 2NQPA 1GXLA 5B0GA 4Z7YA 3ET6A 1FRKA 2EC2A 3D3BJ 1UJ4A 4KRWA 1UL3A 4H4OB 4I0WA 3LWLA 1RAOA 4PXCA 1HR0J 3G82A 2YKMA 5KG4A 5E3CA 5KFHA 4EMDA 2ZHOA 3BDPA 2HSEB 4LF9F 3ENWA 3IG1A 4A8MP 1MW7A 5HBMB 5EWGA 2AF6A 2IMWP 2J0WA 2BBEA 1XJWB 4OX9F 5C2GA 3GILA 1T03A 4KKOB 5F8IA 1GMWA 2A10A 2KVIA 4ZP8A 3T5HA 2XYPB 2RQMA 2HQCA 4ZVGA 2BM0A 3SDEB 1Y00A 2H4YB 5KFZA 3EZUA 1FKOB 1NEEA 4A8YA 3J7ZT 1H38A 4O44B 2EFGA 2XWYA 1OJ4A 2QMXA 4TLRA 1S77D 4FN5A 2W9BA 3CF5Q 3Q2TC 2IAJB 3BYRA 4X64J 3IWLA 3DKDA 1OMSA 3MM7A 2OPQA 4LRCA 5HP1A 3MPVA 1JXEA 5EGYA 3EDRB 2CKWA 3AJ2A 3AJ1A 2H3EB 2JH3A 2MY7A 2ASLA 3N6LA 1EKRA 1VC0A 2MEWA 3U1NA 5H9FK 1HFEL 1FTRA 4FXDA 1RAAB 3OTOJ 2FYXA 1D8ZA 4WYLA 2RSQA 4WF9Q 3GCXP 2NXUA 2C2MB 4WJBA 1ACMB 3A3NB 1JLEB 2UZAA 3JYTA 4NZ0A 2KTQA 1RT2B 2DEIA 4UUXA 2EXUA 4JI5F 2W9AA 1FO1A 1U1QA 3HFKA 3LP0A 4F3QA 5GAGU 3VVTA 3PJWA 3M8WA 4A8OA 1N36J 3S01A 4LF4J 3DLGA 4BWMA 3ILJA 1RTZA 2GVDA 1YHQS 4QPTA 4FBTA 2GIQA 3ZZ0A 2QIFA 3K5NA 4PKDB 2CADA 4TN2A 1WJ9A 3WZ0A 2E5JA 1F9HA 5CABA 2XM3A 1M5VC 1V3ZA 4PXBA 3UNGC 4C48A 3BH7B 1RI7A 1RHQB 1XR6A 3SQGB 4DV3J 2I2YA 2UXDF 2HGLA 5AXLA 1CBKA 4LF5J 2KJWA 2UVUA 4TY8A 3RAMA 2QG9B 2VFTA 1UZHA 2RRAA 4PR6A 4K0KJ 1R8CA 1I94J 1OO0B 1F60B 4OJ3A 2W2OP 1NLKL 1BD6A 4RW9A 4P6QA 5AT1B 1VRUB 4QW9A 3W2WA 2BQUA 2FHMA 3I32A 2W25A 3A4TA 2DR7A 4IG3B 4CT8A 4LJMA 2J0XA 2RQKA 4FF1A 1NCLA 2CQ4A 4GKJJ 4PQUA 3MMAA 2GQCA 3M32A 3TRGA 1U25A 5J2PA 3DHXA 3GYGA 3G2XA 3OFGA 4ECSA 2AGOA 2AHOB 3QGHA 4NYPA 4HYKA 4YUDA 1DBDA 2HFUA 4ZVUB 1WKKA 2DNHA 2UUAF 1LKZA 1X5SA 1T95A 2OPRB 3PYGA 3L7OA 3ZTRA 1TL5A 2JNJA 3M30B 3PYFA 2V63A 2QC3A 3CD6S 2FPHX 2Z30B 4F7VA 4DSIA 2MKHA 4V19J 3OD2A 3MR5A 4RUCA 2NYHA 4J37A 4ID5A 3TUIC 5L38A 3OXLA 3CW2C 4RNNA 1CS4B 1R8HA 3AD8C 2J0SD 2ZWOA 4LQ9A 3BDEA 8AT1B 1KHWA 4JI7J 1OSDA 3D1QA 1S1XB 2LQJA 2IRYA 3MEGA 1FDDA 3ZZZA 2CAJA 2HZAA 2KG0A 1LV5A 1M1GA 2NS1B 3G87A 2EBGA 2F8EX 4HI1A 4M5MA 4IOBA 3EJMA 3CIMA 1B7YB 3NCPA 3N01A 4QR0A 3UD3P 4B3RF 2KZZA 4NLUA 2IBOA 3MUTP 4HI2A 5IT9Y 4LUBA 3DYAB 2XY5A 3RBXA 3TR5A 1SQFA 2YBVA 3GSIA 2AEJA 1M1HA 1BQMB 1LW2A 3WBZA 2OEMA 3VAGA 1B0PA 3CD5A 5KFQA 3IAS9 4AXJA 1V9OA 3RRGA 3FDSA 4IG0B 2XZDB 4OX6A 1X4HA 2OMLA 4RJVA 3H4BA 4NCAA 3CCZA 1IN0A 1CC8A 4LSNB 2HHXA 2YWGA 2UU9J 1NUEA 1PJ5A 2ZKUA 3O3LA 4KH1B 3JSMA 1HNZJ 1RJJA 5D4OA 3RRHA 1LW2B 2ZNZA 5J2QB 2P8IA 1ZH5A 5B0BA 3OTBA 3L3CA 1D8YA 2C42A 3G8TA 1WUUA 2RDDA 2W8LA 2JJ4D 4ZVQB 2FVPA 2CVIA 2VD3A 1QTMA 2HQDA 1P1TA 3EGWB 4ZLNA 3V6HA 2HHWA 2ZBCA 1G6BA 2WVBA 2ZBPA 4RLEA 2L41A 1I3OB 2POKA 3MEEB 1VBZA 1NXIA 2P9CA 1WEZA 4IDKB 1KDNA 4QR2A 2C3MA 2RF2B 5A0YB 1JJ4A 3GFXA 1JJ2R 2HFZA 1C4CA 2LLZA 4UUWA 5AJ3F 1NH8A 1S1TB 2DNKA 5KOWA 1XERA 3EZ5A 5F8LA 2R8JA 3G82B 1ULRA 2J7WA 2BOPA 4KGKA 4H4OA 4MJKA 4EFAC 1F1BB 1Q7LB 3U1MA 1VOMA 3BGOP 3MAAA 5KT2A 3MEDB 4C11B 1RWPB 5A8KA 3DRXA 2DHXA 4NLVA 2E1PA 5E3PA 3MR6A 4HACA 4CH7A 1S57A 3SZ2A 3J80U 2HRUA 1K0VA 1E6VA 5DO2A 4ED4A 3TARA 2YKAA 4N8NA 1TL7A 3FBBA 2BJ7A 1FE0A 1GMVA 2KRRA 3RJMB 3ZC4A 2UVRA 4BC9A 1F5BA 4I7FA 2PE8A 2V8DA 3THPA 4FYWB 4F4XA 1GMWD 2V0NA 3QFWA 2HHPA 2CJXB 1SJ3P 4FF2A 1YDLA 2ILZA 4TVAB 5HMYA 4K4YA 3ILLA 3OFEA 4DQRA 4ECVA 4C3LA
chains in the Genus database with same CATH topology
3QWPA 4TXSA 1N54B 2C3UA 1A9NB 2DGXA 3HX9A 3UCZP 2LQ5A 5T14A 2CZVC 5D4NA 2VKRA 4ES2A 1JLQA 3FZBA 3PW7A 2MJUA 2P6SA 4K5RA 2EFQA 2WB4A 3H5SA 1VC5A 1RTHB 1C0TA 1JLGB 4ELTA 4OZ5A 3CCMS 3HMJG 4W92B 4OQJA 1X4AA 1NKCA 4Y28C 3CCRS 2NUUG 2RDJA 2AP6A 2MGZB 1SI9A 4DR2F 3KNAA 1L3TA 2CPJA 4DPOA 3OVAA 1JLAB 4NRUA 3FEYB 4DL3A 4GMKA 4X4NA 4F67A 4L72B 4MMOA 1JLCB 5J2PB 3HK2A 3BEGB 2F8HA 5F9NA 1FKPB 2CQIA 1UETA 2HAIA 3IWNC 2MHNA 1RTDA 3G9CA 1GX6A 2B6AA 1HD0A 1XC9A 5KFEA 3SI8A 3KK3B 4RW9B 4ELVA 4Y2AA 1JX4A 3R5CA 1DTTB 2UP1A 2D7SA 3SSSA 4KQZA 3C3LA 2MSTA 4W90B 2UV8G 2NPFA 1VRTA 1G7CB 2ZE2B 4ZP9A 3G96A 3AH6A 3K8VA 2WBMA 2R9LA 3KMQA 1TL3A 5I42B 2M88A 2JSXA 4F50A 1T7PA 3DLEB 2NR0A 1FHTA 2V4JB 1SH0A 2PA8D 2XZWA 2EFNA 4NZ7A 5KG6A 4B17A 1SL2A 4J9SA 1UWBB 1YIJS 1S1UB 1S4FA 2KT2A 3LANA 2CYYA 5LL6d 5J1EA 3MGJA 1VK8A 3UE2A 2YNFB 2W9CA 2X1FA 3LQVA 2LXUA 2LA4A 1O5JA 2C2RA 2QYCA 3VAJA 4QIVA 3KNGA 2AJQA 3PIOQ 2LEPA 4C4WA 1CSJA 3MM8A 5SUHA 3KJVA 1ZOTA 4DWIA 2WONB 5DDRC 3VZIA 1TP7A 1XNQF 2X3GA 1Z2LA 4V19X 1AROP 1BQNA 3IA0A 3H5UA 2MKJA 5D6GA 1FEHA 2ZOFA 3MM6B 1RTDB 2FJEB 1NRKA 1R3NA 2GJ2A 4A47A 4CCHA 4DR7F 1QM9A 2PFFB 2CFXA 5F8GA 1IR0A 2XMUA 2E1RA 1NHUA 1TKTB 1U2RA 2QSWA 4PWDB 5KFOA 4UY85 3HHLC 3O1LA 4DFJA 3WDOA 2YKOA 1HWIA 4J9MA 2MY8A 3I5AA 2KKHA 4DHVA 1JIHA 3DYAA 3OL8A 4GO7X 4LFCF 2OD6A 5L1IA 1C0TB 3IBWA 2FC8A 2R7OA 2X1GA 4ID8A 4ZVEA 1D9FA 4QCLA 4DFMA 2CQ2A 4ZCLA 5EHHA 4Y6IA 4B9VA 3BS9A 4QIGA 2CQGA 2QEXS 3BN4A 1HWUA 3CIZA 1HNIA 2B0GA 2NREA 1FDBA 2XBPA 3KFWX 2BANA 1KLMB 1S9EB 2K1RA 2RRNA 1UVNA 1C0UB 2L48A 1RAJA 4YHHF 4PCQA 4L3NA 1RA7A 1ZM2A 2EFOA 3J7YI 4J9NA 1OIAA 3MHYA 4PXDA 5EWEA 4JI0F 2J9DA 2UXCF 3MPYA 2D1CA 2OP5A 4JV1A 3CC7S 1KLNA 1YJ9S 2XS5A 3VAHA 1G1XA 4ZPCA 3CD7A 1X9WA 1UVIA 1HYSA 5DG8A 1SKWA 2HRYA 4MYTA 3K8WA 3B4MA 2CQBA 3TYTA 2O5DA 2QA1A 2DIVA 4HTJA 1AFIA 4DL6A 4Q43A 4CNYA 4IRCA 4O4GA 1S9FA 4K4ZA 3RB3A 2Z8QA 2ZJPQ 2MZ1A 5KT3A 4O3PA 1GX5A 1W25A 3M6WA 5FDLB 4F4YA 2AYGA 5AXNA 4OZNA 3MECA 1GTHA 1ROFA 2J9EA 4OHWA 4PPZA 4B3TF 3CTRA 4U9RA 2M4MA 4OHZA 1D9AA 2W9BB 2B4UA 3VALA 1M1KT 1TV6B 4C8KA 3DI6B 4OHVA 2B7BB 4IFVB 1T8EA 4LF6F 4DS4A 4YB1P 2VFVA 2YWKA 2VG7B 2AJFE 4Q5VA 2QZ8A 4AL5A 4ITSA 4NA1A 3Q22A 1HNVB 4RNHA 1HARA 1KTQA 4X65F 1V6HA 2HS0A 3CCLS 7FD1A 2A1BA 4I69A 5B7WA 2WK4A 4DL0C 3M9OB 4FNIA 1JLEA 2GCFA 3FFIB 3DN9A 2W4CA 2RKIB 5BYQA 2YNHB 4MK7A 3P49B 4BBYA 2Q66A 2HPUA 1YJUA 1B64A 1XMOF 5J1EB 2ZH2A 1N6QA 1FNXH 4KV8A 4K4UA 4DMZA 2XMWA 2HVHA 4WFZA 3KLHB 2BV3A 2B43A 2WCXA 4O3RA 4USIA 5I4MA 5D8HB 4LFBF 4IUFA 1TK8A 5DM7Q 4ZCKA 5BYRA 3DLEA 4DG1B 5CH7B 2MJNA 1DTTA 1YWXA 3MOJB 3I55S 1S6QB 4C0HA 1VRTB 4ECQA 4IG0A 4JOUA 5AXMA 2HGNA 1I1GA 4RZRA 1JLFB 1IBLF 2ZE2A 3N5FA 2C28A 1N5QA 1TFWA 1G3OA 3OW2R 2DNMA 4UOCA 2VG6A 2NZ4A 2GJIA 4IRDA 1N5VA 3RZAA 1Q78A 2Q6CA 2VPXB 2DGQA 3DGPA 3L09A 3FSXA 2UV8A 3C6UA 4B9LA 2RE1A 1F5CA 2VPWB 4O23A 3KLIB 2FHKA 3BZQA 3RR7A 3MM5B 5LSLA 1NB7A 3M1VB 3R3TA 4N76A 1X0PA 5EWFA 1OSCA 4EO8A 4TQSA 1WG5A 4OMFG 1U1LA 3T1YF 2CG4A 4K50A 3M30A 1C0UA 5CYMA 1RT7A 4ZS6A 4G1QB 4X4RA 1FE4A 4NCGB 2KFYA 2YWEA 3KLFB 1DARA 2E9RX 3UCUP 5JJBA 4CO3A 1C1BA 3QLHA 3KLGA 3TUZC 3LP2B 2PA3A 3LP1A 4M95A 2MPUA 3IXQA 3SEOA 2KT5A 2LKZA 2RU9A 3NLCA 5H1SV 5LSRA 3TAMB 1N5SA 1GXUA 2M0GB 4I2PB 4XK8C 3PW0A 5B09A 3OVSA 4C7QA 2D9PA 2GO9A 4H4MA 3SSQA 1SXLA 1Q86T 2IJNA 1SJ1A 1O0PA 4QZVB 5HO4A 5KG3A 2U1AA 1RP5A 3HXMA 3RB0A 1FKOA 4UW2A 5BJRA 3W2VB 2CJQA 3EYZA 3Q8RB 4Y2MA 2OIHA 1B0TA 1S0NA 3OL7A 1Z1ZA 2YKMB 2FJBB 2LA6A 1VQKS 4RWXA 4ECUA 3DRSB 4AFFA 2DBBA 1T03B 2QFJA 5KFKA 3IS9B 2YVSA 4XIUA 4PPDA 3MUVP 2I1RA 1IKYB 4YR0A 4CH1A 4RW7B 1S1VB 2DNYA 2E29A 1XMQF 4LF5F 1N0UA 2AX0A 2HS3A 1U48A 3W7BA 3DLLQ 3NNAA 2EKYA 4UQTA 2ERRA 4YEAA 2DCUB 4KTQA 4RW6B 3PDNA 1RDRA 2DGTA 3DC2A 3V5RA 2DR8A 2J6SA 3LW5C 1DAXA 2JHEA 3DXSX 2I5JB 1RT5B 2N82B 4Q8EA 2KG1A 1RGVA 2MHEA 3AQPA 2ZH8A 5IS2A 2KXNB 2F9JA 4I4BA 1FJEB 3CB4A 1VC6A 2XMVA 1HWKA 3D1HA 3D1OA 3E01A 4NX9A 3OFFA 5E41A 1N36F 4WKRA 2IJFA 3NCQA 4DSFA 3HZGA 3H5YA 4CIOA 2MMYA 4GO5X 1L3SA 2CIMA 5D4LA 3NL0A 2HLTA 1IJFB 2G13A 2YNFA 2GMHA 4URGA 3CDBA 2DHSA 1S1WB 3VTIA 2VKZG 2WRMA 1HMVA 2D3OR 1X4BA 3JSBA 5KFMA 4I1TA 2BR0A 1UVKA 1GT8A 3CCSS 3UR0A 1CEZA 4CTAB 2ZDOA 2A18A 2Y0SD 2ALZA 4Y2CA 2GHVC 1FRMA 5KT6A 2ZM6F 2VOOA 2MQOA 2VBWA 2E5IA 2HMIB 3TAMA 2D74B 2VZ9A 2ATLA 4Q0BA 4DX8H 3HZEA 1P9QC 1R43A 2EI5A 1H6KX 4DV7F 3BR8A 3AA8A 4QPXA 1VK3A 2B6AB 4MK8A 4O3OA 3QAEA 5KFNA 5DG9A 1JJHA 4FVMA 3DM2B 1XR7A 3BO4A 3PVXA 1R6YA 2LU1A 5HROB 2Z2LA 3UDLA 1X4CA 2X51A 4FPRA 1HR0F 5M2RA 3C66A 2ROPA 1FRXA 3HVTA 3DOKB 1VMBA 3JSRA 1T05B 5B0AA 3MMBB 3D0HE 3CE8A 1Y9OA 1GXTA 4OX8A 5B0FA 4QQBA 4TU8A 3OR2A 4MKAA 4EGLA 3GZ7A 4ELUA 4XPCA 3MD1A 2VFUA 3GG0A 4DR6F 2KN4A 4DN0A 3C6UB 2B7CB 3CJ4A 5E7OB 1RT1B 2XC9A 2B9YA 3DMJB 1KLMA 1L5UA 3PFOA 5KFRA 3BO2A 3PEHA 2PI5A 3J7A1 2GHPA 4ZK7M 2HYIB 4NXMF 1LFPA 3H2VE 4FF3A 2NPIA 3L7PA 3QO9B 5GAGI 2ZJRQ 3DCAA 3CJ5A 4N8OA 5HL7Q 1T94A 1D1UA 3H20A 3U02A 3J81Y 1RISA 2DNPA 4BDPA 4IQXA 1O51A 2J9CA 3LOUA 5HMWA 2L9WA 5GADU 1YBAA 3G6ES 4IO9Q 4NLDA 3GG1A 3PO4A 4ZPTR 1SIZA 4RW4A 1OPZA 2R2SA 1HNXF 1MWYA 1U4BA 3DRPB 2RS2A 1ZPVA 4OX7A 3MEDA 5A8KB 5BR8F 1N33F 5EX0A 2YQ3A 2QA4S 2HHSA 3WX4A 2IAJA 2MB0B 3H2LA 5DDQC 4ES1A 4PWDA 2KM8B 4RW4B 4DSEA 5FDLA 4RW8A 2HWTA 4B3OB 4AUKA 4DQSA 2MQQA 4NRTA 4NLYA 1EP4B 2QO3A 3MCSA 3MTKA 4Y0FA 2DGSA 3QYYA 2MKKA 2E44A 3BR9A 3I6PA 4KAIA 1L3VA 1GNKA 5G4DA 4ZMMA 4YQWA 2RQ4A 4KBIA 1Q79A 1IKXB 1HNVA 2CQHA 3NP5A 1J5OA 1URNA 1X5PA 1SH3A 1X8DA 3QJLA 2AYMA 2P9EA 3NMAA 2OPSA 3CCUS 4IH5A 2E5LF 3UW1A 3H2UB 2EK1A 2CPHA 3H40A 4LF7F 3HKWA 4K4TA 2NLWA 3T9NA 5LJ5Y 2I0XA 1LWFB 1UFLA 3G86A 1IBKF 2J76E 2RILA 3RU0A 3OPKA 4WK3A 4YOEA 3TVKA 1S7HA 5K8MA 4J9QA 2JL9A 3ZZYA 5KG7A 1UEVA 4X4PA 2R2RA 4PQUB 1G2EA 3POTB 5E3QA 1VRUA 2QLWA 2Z4PA 1UA1A 4TU9A 5FJ4A 1QSLA 3LGNA 3HHLB 4HLBA 1MMLA 2K3KA 2KYXA 4LIWA 3TAQA 2E1MC 5JVGQ 2RRBA 1SL0A 3KHRA 5D3GA 1VLYA 1FJGF 4TNOA 4QWBA 2BE2A 3DLKB 3CMES 1IKWA 5F9LA 2ZJQQ 1R89A 2QRRA 1NK8A 2IYGA 3MMCB 4ED5A 2DNZA 3MM6A 3CDAA 1QVFR 1KHVA 2M3DA 1JLBA 3ENVA 4ICLB 3G6XA 3NAIA 1GQEA 2V8VA 5HROA 2X1AA 3H98A 5K14A 3V4IA 1SIWB 3GR0A 2EWHA 2W7PA 2O01C 2QLXA 1O8BA 5JXSA 5LMUF 4IR1A 2QV6A 3MM9B 3FRYA 3LF0A 2B4OA 3V6DA 1ELOA 1UJ5A 1W2IA 2A3JA 1X4GA 4CO4A 4N56A 2YX4A 2I8EA 3KHHA 2CZ4A 2E7WA 1S6PA 4ZP6A 5FIIA 3OJSA 2RDIA 4KC5A 4AE5A 5E5NA 1TL3B 2ZNYA 3MEKA 5I42A 2J7KA 2PDAA 2O1PA 2JWNA 4DR5F 1KOHA 5DM6Q 2XY7A 1BQMA 2BRKA 3LUYA 3QJPA 3OTOF 2XS7A 4AQYF 4GKKF 2AJ1A 3MM7B 2W4PA 1VQSA 2GQ2A 1T02A 3W3SA 2HNDB 2MXYA 5KFDA 2BRLA 4FNHA 2F9DA 1TFYA 4R5PA 5K9FA 3LAKA 1HBNB 4I67A 1LW0A 1F9FA 4P2SA 1NJZA 5C42A 3HJFA 1HWJA 4AYBD 1NK0A 3MD3A 1HNWF 1Q7YT 1FRJA 2HZCA 1ZTWA 1Y3KA 3PX4A 2BUNA 2AWZA 2KDOA 4U7CA 2CQ1A 4DF8A 4DSJA 1EETB 2XSJA 4YDDB 3MEEA 4K2XA 1U26A 4C98A 2JEFA 5C42B 5DETA 1KQSR 2KYZA 5D77A 5L1KA 5HLFA 4Z2XA 3BQ1A 5IM0A 3CDWA 4LSNA 2YY3A 4OZ0A 4FXVA 4Q44A 3N0VA 4WTYA 5K8NA 3TAPA 5AE3A 1Q8BA 5KT7A 1IKYA 1YRXA 3PR4A 4JV5F 2RVJA 1VI7A 3QWUA 3OFHA 1KR4A 1QAJA 1S6UA 4EBEA 5CZVA 2N4CA 2W7AA 2DK2A 3DLJA 4KKOA 3GIIA 2J8AA 3K5MA 1SV5A 2FLPA 4M5DA 3KOAA 1JLCA 4R0EA 3OXGA 3M6XA 4TY8B 2K2PA 2M8DB 4ICLA 5C24B 4OHXA 4J9PA 1M5PC 5L39A 1WHXA 4LMZA 2ILYA 2HQ3A 2J9DE 4R25A 1SUQB 2FGCA 4WCEQ 4F8RA 5M2UA 2K7KA 3PRDA 1S49A 3EPGA 4DF4A 4C9DA 1HWLA 4CO0A 1NO8A 4ED3A 2P5VA 4U7UK 1JLGA 1WF1A 3FMWA 2WSFC 1RTHA 4X4QA 1YJNS 5A2QY 4NYOA 3MF5A 4NLWA 1H7XA 4MAKA 4KHPF 4PRFA 4IOAQ 4K4WA 5HLFB 2LQ9A 3NAHA 4WFAQ 3HHDA 3OLBA 1SJ4P 3TVZA 3MFIA 2MZTA 3CVKA 2XLKA 4FYDA 3QGPA 3W2WB 2V9KA 2X1BA 4JI7F 4KR0B 1H0HB 3LP0B 3RTVA 3NNHA 3CCJS 1FNMA 1TKXA 5DQGA 4P7VA 5CYMB 2HVIA 1XMBA