1FE2A

Crystal structure of dihomo-gamma-linoleic acid bound in the cyclooxygenase channel of prostaglandin endoperoxide h synthase-1.
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
553
structure length
553
Chain Sequence
PVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutational and X-ray crystallographic analysis of the interaction of dihomo-gamma -linolenic acid with prostaglandin endoperoxide H synthases.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROSTAGLANDIN ENDOPEROXIDE H SYNTHASE-1
total genus 173
structure length 553
sequence length 553
ec nomenclature ec 1.14.99.1: Prostaglandin-endoperoxide synthase.
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF03098 An_peroxidase Animal haem peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.640.10 Mainly Alpha Orthogonal Bundle Myeloperoxidase, subunit C Haem peroxidase domain superfamily, animal type 1fe2A02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1fe2A01
5E8DA 3GCXE 2RA0L 3QCWA 5JB9E 1EPIA 2VJ3A 1NPEB 3K9XA 4ISHL 4ZHAB 2EHAA 1LPZA 1PXXA 2W26B 3LC3B 1JV2B 3N8YB 2CJIB 2OYUP 3KCGL 4Z0LA 2WYGB 4X8TL 1DNUC 1EMNA 1FFMA 5FF1A 3ENSA 1HREA 1IVOC 4YT6L 1SZBA 1HAFA 1WHEA 1EQGA 4YZUB 4BTTA 4RUTA 3OGWA 2J4IB 1IGXA 2K2SB 2RHPA 3UBAA 4ZXYL 5CISA 5HPWA 1MYPC 4MMYB 1J9CL 2M74A 3N8VA 1IOEL 4KSZA 2W2PE 1YUFA 2P16L 3MQEA 2J94B 2XBYL 3ZS1C 4RRXA 1EPJA 1LPKA 1IQFL 1NFWB 4CUDA 4QJQA 2H9EL 2D1JB 3TZIA 2TGFA 3RKEA 1CX2A 1IQNL 2Y7XB 4LJJA 1HCGB 1HJ7A 1PRHA 1FF7A 3BT2A 1D5LC 4PNXA 3GISX 5I46L 1NFUB 2VWOL 4C1MC 2Z5ZA 5L2ZL 5KIRA 2KL7A 3TH3L 3V64C 1IJQA 2J38B 4HHRA 1KLJL 3Q3KB 4X8VL 1YUGA 4M11A 3ASIA 4DL1C 1KSNB 4Z0KB 3ZS0C 3SOVA 4Y55A 3R05A 2PR3B 1PFXL 2P3TA 2P3FL 1F7MA 2I9AA 1DX5I 3NAKA 4CSYA 4X8UL 2EI7B 3NYHA 3LC5B 2QRBA 2WPIE 3R5OA 4M10A 3KL6B 4O1ZA 2PHBB 5IKRA 3CFWA 2FLRL 4NT3A 2YGOA 1IOXA 1IQIL 4Y7BB 1IQJL 4XLWA 2WFXB 4O02B 3SOBB 4CUFA 1FSBA 3NT1A 3HO3A 2K2TA 4NA9L 3KQBL 4RRYA 2IPSA 1FE2A 4GN6A 4AQTA 3MDLA 1Z6CA 2EI8B 3BT1A 4Y76B 1IQGL 4JYUL 1XFEA 1IQHL 1UZQA 2GD4A 3CENL 1BF9A 2BQ7A 3ZYGA 1ADXA 4JZDL 3LN0A 4FM5A 3LTGD 1N1IA 6COXA 2XBWL 3ZYIB 1X7AL 4YT7L 3TK6B 1F7EA 3NIUA 4HHSA 1O5DL 2Y80B 5GLSA 2PUQL 3KQCL 1G1RA 1EBVA 1P0SL 3IITB 4BDXA 1EPHA 1K36A 3U7UG 5IKVA 1YO8A 2J2UB 4C16A 1M1XB 4N7AA 1QFKL 2VWLL 2B7DL 2Y5GL 3OLTA 1L5GB 5JVYA 2NPRA 4COXA 1EQHA 1F0RB 1W7XL 4RS0A 2BOKL 1IQEL 5CKQA 5L2YL 3N8WA 1D7WC 3LAQA 2QPKA 2UWLB 3R5QA 2VVVL 3SW2A 3LTFB 1TPGA 2O86A 4MMXB 1C5MF 4JYVL 2W2OE 4IG5A 3M37L 1DVAL 4JZEL 2NQXA 3KQDL 1GK5A 5EGMB 3HS5A 1NT0A 3BPSE 1IGZA 3KRQA 1K37A 3KQEL 3HO4A 1B9WA 2BOHA 2ADXA 2VWMK 1FJSL 3H5CB 1W8BL 2W2NE 1HZ8A 1NFXB 3FNLA 3QL6A 3ERHA 1JL9A 2J95B 1UZJA 2MGPA 1U67A 1NFYB 3FCSB 2PT3A 5CKMA 2FLBL 2AYLA 3ZYJB 2BO2A 5CKNA 4Y71B 5L30L 2BOUA 1LMJA 3F1SB 3I6NA 2MHPA 1NZIA 1D2VC 1G2LB 2WG3C 4E1GA 3QF1A 1XDTR 3KK6A 2P94L 3BXIA 3FAQA 2XBXL 1CEJA 1ZAQA 2EI6B 3P5BL 3R55A 4PH9A 2G00L 2VH0B 4NGAL 4CUEA 1HX2A 1F0SB 2Y81B 2F9BL 3HS6A 2DDUA 4BTIA 2FD6A 4BXSA 4ISIL 5JBCE 1ATEA 1UZPA 1G1TA 1IQML 4XL1A 4BXWA 1P9JA 2MGRA 3SOQA 3GCKA 2E9EA 3GC1A 4KVKA 2IKCA 3QMOA 4RRWA 1PGEA 4ZXXL 1ATBA 1HAEA 2VWNL 1TOZA 1XKAL 3LIWB 2WFTA 4OTYA 1DNWC 1ATAA 4OEKA 1CCVA 2OJVA 3RR3A 3KRKA 4MMZB 2P28B 2W3KB 3N8YA 1XKBA 2BZ6L 4NG9L 4RRZA 2I9BA 3OLUA 1CQEA 1MQ5L 2FZZL 2WYJB 4KVLA 2W2QE 2XBVL 3ERIA 3Q7DA 3HPTA 1MQ6L 3SXVA 1I0UA 2Y5FL 2P3UA 1Q4GA 1UZKA 5COXA 2P26A 4LORA 1G2MB 3FFGL 3LN1A 4Y6DB 1ATDA 5JW1A 1KIGL 2BMGA 4ZAEB 3V6QA 3NJPC 3EGFA 2VH6B 3HS7A 3CA7A 5F1AA 5IKTA 2W3IB 2XC4L 3V65B 5JBAE 2VVUL 5B72A 3HO5A 1CXPC 4BDWA 4JZFL 5KN5C 2W2ME 1KLIL 1EGFA 1PTHA 1TLEA 3S4FA 3NTGA 2WG4B 1RFNB 3TK5B 3N8FA 4MSFA 1EPGA 2P93L 2Y38A 4D0EA 1A3PA 4D0FA 3F9PC 1L3YA 2XC0L 1APQA 5JBBE 1CVUA 3GCJA 1MOXC 1AUTL 3CS7L 2YGPA 4NJBA 2FLGA 1APOA 3POYA 1CVWL 4TGFA 3N8XA 2Y7ZB 1EZQB 5IKQA 3ELAL 2PUMA 4A7IA 4D90A 1DDXA 1EAIC 1YUKB 1DIYA 1JBUL 5K0HB 2WPKE 4Y79B 2R5LA 4LMFA 3Q9KA 1NQLB 2P95L 2RNLA 2J34B 5FIWC 2WPLE 3FBYA 5JVZA 2UWOB 2Y5HL 2BQ6A 3N8ZA 1HT8A 2P3FN 1YGCL 3GCLA 2QQTA 1LQDA 1IQLL 1OB1C 4G1MB 2W86A 3U73A 4X8SL 4BTUA 2Q1JB 1MHLC 1V3XB 4KVJA 1G1SA 2XC5L 1WHFA 1FAXL 2WPJE 1WU1B 4QYQA 3C9AC 2KV4A 3M36L 1IQKL 3TGFA 5FDQA 1IP0A 3IJEB 1N7DA 4OTJA 2WPME 2Y82B 4ZH8B 1EMOA 3NTBA 5GH0A 3F6UL 3GCWE 1FAKL 1Z6EL 1U8CB 5JB8E 1G1QA 3PY4A 2UWPB 4Z6AL 3QH0A 2OYEP 2JKHL 4XBMA 1HRFA 4GM7A 1DQBA 3DEMA 2EFBA 2KB9A 2GJMA 3R4XA 2VVCK 1HT5A 3N8WB 3PGHA 4Y7AB 2BQWA 1KLOA 2WPHE 3TBDA 1COUA 2BOXA 1LPGA 1CCFA 3TGYA 5F19A 1URKA
chains in the Genus database with same CATH superfamily
2KNIA 5E8DA 3GCXE 2RA0L 3QCWA 5JB9E 1EPIA 2VJ3A 1NPEB 3K9XA 4ISHL 4ZHAB 2EHAA 1LPZA 1PXXA 2W26B 3LC3B 1JV2B 3N8YB 2CJIB 2BSFA 2OYUP 3KCGL 4Z0LA 2WYGB 4X8TL 1DNUC 1EMNA 1FFMA 5FF1A 3ENSA 1HREA 1IVOC 4YT6L 1SZBA 1HAFA 1WHEA 1EQGA 4YZUB 4BTTA 4RUTA 2VRSA 3OGWA 2J4IB 1IGXA 2K2SB 2RHPA 3UBAA 4ZXYL 5CISA 5HPWA 1MYPC 4MMYB 1J9CL 2M74A 3N8VA 1IOEL 4KSZA 2W2PE 1YUFA 2P16L 3MQEA 2J94B 2XBYL 3ZS1C 4RRXA 1EPJA 1LPKA 2YGQA 1IQFL 1NFWB 4CUDA 4QJQA 2H9EL 2D1JB 3TZIA 2TGFA 2HOXA 3RKEA 1CX2A 1IQNL 2Y7XB 4LJJA 1HCGB 1HJ7A 1PRHA 1FF7A 3BT2A 1D5LC 4PNXA 3GISX 5I46L 1NFUB 2VWOL 4C1MC 4GU4A 2Z5ZA 5L2ZL 5KIRA 2KL7A 3TH3L 3V64C 1IJQA 2J38B 4HHRA 1KLJL 3Q3KB 4X8VL 1YUGA 4M11A 3ASIA 4DL1C 1KSNB 4Z0KB 4A94C 3ZS0C 3SOVA 4Y55A 3R05A 2PR3B 2H9EC 1PFXL 2P3TA 2P3FL 1F7MA 2I9AA 1DX5I 3NAKA 4CSYA 4X8UL 2EI7B 3NYHA 3LC5B 2QRBA 2WPIE 3R5OA 4M10A 3KL6B 4O1ZA 2PHBB 5IKRA 3CFWA 2FLRL 4NT3A 2YGOA 1IOXA 1IQIL 2BT7A 4Y7BB 1IQJL 4XLWA 2WFXB 4O02B 3SOBB 4CUFA 1FSBA 2JJLA 3NT1A 3HO3A 2K2TA 4NA9L 3KQBL 4RRYA 2IPSA 1FE2A 4GN6A 4AQTA 3MDLA 1Z6CA 2EI8B 3BT1A 4Y76B 1IQGL 4JYUL 1XFEA 1IQHL 1UZQA 2GD4A 3CENL 1BF9A 2BQ7A 3ZYGA 1ADXA 4JZDL 3LN0A 4FM5A 3LTGD 1N1IA 6COXA 2XBWL 3ZYIB 1X7AL 4YT7L 3TK6B 1F7EA 3NIUA 4HHSA 1O5DL 2Y80B 5GLSA 2PUQL 3KQCL 1G1RA 1EBVA 1P0SL 3IITB 4BDXA 1EPHA 1K36A 3U7UG 5IKVA 1YO8A 2J2UB 4C16A 1M1XB 4N7AA 1QFKL 2VWLL 2B7DL 2Y5GL 3OLTA 1L5GB 5JVYA 2NPRA 4COXA 1EQHA 1F0RB 1W7XL 4RS0A 2BOKL 1IQEL 5CKQA 5L2YL 3N8WA 1D7WC 4GU3A 3LAQA 2QPKA 2UWLB 3R5QA 2VVVL 3SW2A 3LTFB 1TPGA 2O86A 4MMXB 1C5MF 4JYVL 2W2OE 4IG5A 3M37L 1DVAL 4JZEL 2NQXA 3KQDL 1GK5A 5EGMB 3HS5A 1NT0A 3BPSE 1IGZA 3KRQA 1K37A 3KQEL 3HO4A 1B9WA 2BOHA 2ADXA 2VWMK 1FJSL 3H5CB 1W8BL 2W2NE 1HZ8A 1NFXB 3FNLA 3QL6A 3ERHA 1JL9A 2J95B 1UZJA 2MGPA 1U67A 1NFYB 3FCSB 2PT3A 5CKMA 2FLBL 2AYLA 3ZYJB 2BO2A 5CKNA 4Y71B 5L30L 2BOUA 1LMJA 1V1HA 3F1SB 3I6NA 2MHPA 1NZIA 1D2VC 1G2LB 2WG3C 4E1GA 3QF1A 1XDTR 3KK6A 2P94L 3BXIA 3FAQA 1KKEA 2XBXL 1CEJA 1ZAQA 2EI6B 3P5BL 3R55A 4PH9A 2G00L 2VH0B 4NGAL 4CUEA 1HX2A 1F0SB 2Y81B 2F9BL 3HS6A 2DDUA 4BTIA 2FD6A 4BXSA 4ISIL 5JBCE 1ATEA 1UZPA 1G1TA 1IQML 4XL1A 4BXWA 1P9JA 2MGRA 3SOQA 3GCKA 2E9EA 3GC1A 4KVKA 2IKCA 3QMOA 4RRWA 1PGEA 4ZXXL 1ATBA 1HAEA 2VWNL 1TOZA 1XKAL 3LIWB 2WFTA 4OTYA 1DNWC 1ATAA 4OEKA 1CCVA 2OJVA 3RR3A 3KRKA 4MMZB 2P28B 2W3KB 3N8YA 1XKBA 2BZ6L 4NG9L 4RRZA 2I9BA 3OLUA 1CQEA 1MQ5L 2FZZL 2WYJB 4KVLA 2W2QE 2XBVL 3ERIA 3Q7DA 3HPTA 1MQ6L 3SXVA 1I0UA 2Y5FL 2P3UA 1Q4GA 1UZKA 5COXA 2P26A 4LORA 1G2MB 3FFGL 3LN1A 4Y6DB 1ATDA 5JW1A 1KIGL 2BMGA 4ZAEB 3V6QA 3NJPC 2WZPP 3EGFA 2VH6B 3HS7A 3CA7A 5F1AA 5IKTA 2W3IB 2XC4L 3V65B 5JBAE 2VVUL 5B72A 3HO5A 1CXPC 4BDWA 4JZFL 5KN5C 2W2ME 1KLIL 1EGFA 1PTHA 1TLEA 3S4FA 3NTGA 2WG4B 1RFNB 3TK5B 3N8FA 4MSFA 1EPGA 2P93L 2Y38A 4D0EA 1A3PA 4D0FA 3F9PC 1L3YA 1V1IA 2XC0L 1APQA 5JBBE 1CVUA 3GCJA 1MOXC 1AUTL 3CS7L 2YGPA 4NJBA 2FLGA 1APOA 3POYA 1CVWL 4TGFA 3N8XA 2Y7ZB 1EZQB 5IKQA 3ELAL 2PUMA 4A7IA 4D90A 1DDXA 1EAIC 1YUKB 1DIYA 1JBUL 5K0HB 2WPKE 4Y79B 2R5LA 1QIUA 4LMFA 3Q9KA 1NQLB 2P95L 2RNLA 2J34B 2HORA 5FIWC 2WPLE 3FBYA 5JVZA 2UWOB 2Y5HL 2BQ6A 3N8ZA 1HT8A 2P3FN 1YGCL 3GCLA 2QQTA 1LQDA 1IQLL 1OB1C 4G1MB 2W86A 3U73A 4X8SL 4BTUA 2Q1JB 1MHLC 1V3XB 4KVJA 1G1SA 2XC5L 1WHFA 1FAXL 2WPJE 1WU1B 4QYQA 3C9AC 2KV4A 3M36L 1IQKL 3S6XA 3TGFA 5FDQA 1LK9A 1IP0A 3IJEB 1N7DA 4OTJA 2WPME 2Y82B 4ZH8B 1EMOA 3NTBA 5GH0A 3F6UL 3GCWE 1FAKL 1Z6EL 1U8CB 5JB8E 1G1QA 3PY4A 2UWPB 2BT8A 4Z6AL 3QH0A 2OYEP 2JKHL 1LMMA 4XBMA 1HRFA 4GM7A 1DQBA 3DEMA 2EFBA 2KB9A 2GJMA 3R4XA 2VVCK 1HT5A 3N8WB 3PGHA 4Y7AB 2BQWA 1KLOA 2WPHE 3TBDA 1COUA 2BOXA 1LPGA 1CCFA 3TGYA 5F19A 1URKA
chains in the Genus database with same CATH topology
2KNIA 5E8DA 3GCXE 2RA0L 3QCWA 5JB9E 1EPIA 2VJ3A 1NPEB 3K9XA 4ISHL 4ZHAB 2EHAA 1LPZA 1PXXA 2W26B 3LC3B 1JV2B 3N8YB 2CJIB 2OYUP 3KCGL 4Z0LA 2WYGB 4X8TL 1DNUC 1EMNA 1FFMA 5FF1A 3ENSA 1HREA 1IVOC 4YT6L 1SZBA 1HAFA 1WHEA 1EQGA 4YZUB 4BTTA 4RUTA 3OGWA 2J4IB 1IGXA 2K2SB 2RHPA 3UBAA 4ZXYL 5CISA 5HPWA 1MYPC 4MMYB 1J9CL 2M74A 3N8VA 1IOEL 4KSZA 2W2PE 1YUFA 2P16L 3MQEA 2J94B 2XBYL 3ZS1C 4RRXA 1EPJA 1LPKA 2YGQA 1IQFL 1NFWB 4CUDA 4QJQA 2H9EL 2D1JB 3TZIA 2TGFA 3RKEA 1CX2A 1IQNL 2Y7XB 4LJJA 1HCGB 1HJ7A 1PRHA 1FF7A 3BT2A 1D5LC 4PNXA 3GISX 5I46L 1NFUB 2VWOL 4C1MC 2Z5ZA 5L2ZL 5KIRA 2KL7A 3TH3L 3V64C 1IJQA 2J38B 4HHRA 1KLJL 3Q3KB 4X8VL 1YUGA 4M11A 3ASIA 4DL1C 1KSNB 4Z0KB 4A94C 3ZS0C 3SOVA 4Y55A 3R05A 2PR3B 2H9EC 1PFXL 2P3TA 2P3FL 1F7MA 2I9AA 1DX5I 3NAKA 4CSYA 4X8UL 2EI7B 3NYHA 3LC5B 2QRBA 2WPIE 3R5OA 4M10A 3KL6B 4O1ZA 2PHBB 5IKRA 3CFWA 2FLRL 4NT3A 2YGOA 1IOXA 1IQIL 4Y7BB 1IQJL 4XLWA 2WFXB 4O02B 3SOBB 4CUFA 1FSBA 3NT1A 3HO3A 2K2TA 4NA9L 3KQBL 4RRYA 2IPSA 1FE2A 4GN6A 4AQTA 3MDLA 1Z6CA 2EI8B 3BT1A 4Y76B 1IQGL 4JYUL 1XFEA 1IQHL 1UZQA 2GD4A 3CENL 1BF9A 2BQ7A 3ZYGA 1ADXA 4JZDL 3LN0A 4FM5A 3LTGD 1N1IA 6COXA 2XBWL 3ZYIB 1X7AL 4YT7L 3TK6B 1F7EA 3NIUA 4HHSA 1O5DL 2Y80B 5GLSA 2PUQL 3KQCL 1G1RA 1EBVA 1P0SL 3IITB 4BDXA 1EPHA 1K36A 3U7UG 5IKVA 1YO8A 2J2UB 4C16A 1M1XB 4N7AA 1QFKL 2VWLL 2B7DL 2Y5GL 3OLTA 1L5GB 5JVYA 2NPRA 4COXA 1EQHA 1F0RB 1W7XL 4RS0A 2BOKL 1IQEL 5CKQA 5L2YL 3N8WA 1D7WC 3LAQA 2QPKA 2UWLB 3R5QA 2VVVL 3SW2A 3LTFB 1TPGA 2O86A 4MMXB 1C5MF 4JYVL 2W2OE 4IG5A 3M37L 1DVAL 4JZEL 2NQXA 3KQDL 1GK5A 5EGMB 3HS5A 1NT0A 3BPSE 1IGZA 3KRQA 1K37A 3KQEL 3HO4A 1B9WA 2BOHA 2ADXA 2VWMK 1FJSL 3H5CB 1W8BL 2W2NE 1HZ8A 1NFXB 3FNLA 3QL6A 3ERHA 1JL9A 2J95B 1UZJA 2MGPA 1U67A 1NFYB 3FCSB 2PT3A 5CKMA 2FLBL 2AYLA 3ZYJB 2BO2A 5CKNA 4Y71B 5L30L 2BOUA 1LMJA 3F1SB 3I6NA 2MHPA 1NZIA 1D2VC 1G2LB 2WG3C 4E1GA 3QF1A 1XDTR 3KK6A 2P94L 3BXIA 3FAQA 2XBXL 1CEJA 1ZAQA 2EI6B 3P5BL 3R55A 4PH9A 2G00L 2VH0B 4NGAL 4CUEA 1HX2A 1F0SB 2Y81B 2F9BL 3HS6A 2DDUA 4BTIA 2FD6A 4BXSA 4ISIL 5JBCE 1ATEA 1UZPA 1G1TA 1IQML 4XL1A 4BXWA 1P9JA 2MGRA 3SOQA 3GCKA 2E9EA 3GC1A 4KVKA 2IKCA 3QMOA 4RRWA 1PGEA 4ZXXL 1ATBA 1HAEA 2VWNL 1TOZA 1XKAL 3LIWB 2WFTA 4OTYA 1DNWC 1ATAA 4OEKA 1CCVA 2OJVA 3RR3A 3KRKA 4MMZB 2P28B 2W3KB 3N8YA 1XKBA 2BZ6L 4NG9L 4RRZA 2I9BA 3OLUA 1CQEA 1MQ5L 2FZZL 2WYJB 4KVLA 2W2QE 2XBVL 3ERIA 3Q7DA 3HPTA 1MQ6L 3SXVA 1I0UA 2Y5FL 2P3UA 1Q4GA 1UZKA 5COXA 2P26A 4LORA 1G2MB 3FFGL 3LN1A 4Y6DB 1ATDA 5JW1A 1KIGL 2BMGA 4ZAEB 3V6QA 3NJPC 2WZPP 3EGFA 2VH6B 3HS7A 3CA7A 5F1AA 5IKTA 2W3IB 2XC4L 3V65B 5JBAE 2VVUL 5B72A 3HO5A 1CXPC 4BDWA 4JZFL 5KN5C 2W2ME 1KLIL 1EGFA 1PTHA 1TLEA 3S4FA 3NTGA 2WG4B 1RFNB 3TK5B 3N8FA 4MSFA 1EPGA 2P93L 2Y38A 4D0EA 1A3PA 4D0FA 3F9PC 1L3YA 2XC0L 1APQA 5JBBE 1CVUA 3GCJA 1MOXC 1AUTL 3CS7L 2YGPA 4NJBA 2FLGA 1APOA 3POYA 1CVWL 4TGFA 3N8XA 2Y7ZB 1EZQB 5IKQA 3ELAL 2PUMA 4A7IA 4D90A 1DDXA 1EAIC 1YUKB 1DIYA 1JBUL 5K0HB 2WPKE 4Y79B 2R5LA 4LMFA 3Q9KA 1NQLB 2P95L 2RNLA 2J34B 5FIWC 2WPLE 3FBYA 5JVZA 2UWOB 2Y5HL 2BQ6A 3N8ZA 1HT8A 2P3FN 1YGCL 3GCLA 2QQTA 1LQDA 1IQLL 1OB1C 4G1MB 2W86A 3U73A 4X8SL 4BTUA 2Q1JB 1MHLC 1V3XB 4KVJA 1G1SA 2XC5L 1WHFA 1FAXL 2WPJE 1WU1B 4QYQA 3C9AC 2KV4A 3M36L 1IQKL 3S6XA 3TGFA 5FDQA 1IP0A 3IJEB 1N7DA 4OTJA 2WPME 2Y82B 4ZH8B 1EMOA 3NTBA 5GH0A 3F6UL 3GCWE 1FAKL 1Z6EL 1U8CB 5JB8E 1G1QA 3PY4A 2UWPB 4Z6AL 3QH0A 2OYEP 2JKHL 1LMMA 4XBMA 1HRFA 4GM7A 1DQBA 3DEMA 2EFBA 2KB9A 2GJMA 3R4XA 2VVCK 1HT5A 3N8WB 3PGHA 4Y7AB 2BQWA 1KLOA 2WPHE 3TBDA 1COUA 2BOXA 1LPGA 1CCFA 3TGYA 5F19A 1URKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E8D A;  3GCX E;  2RA0 L;  3QCW A;  5JB9 E;  1EPI A;  2VJ3 A;  1NPE B;  3K9X A;  4ISH L;  4ZHA B;  2EHA A;  1LPZ A;  1PXX A;  2W26 B;  3LC3 B;  1JV2 B;  3N8Y B;  2CJI B;  2OYU P;  3KCG L;  4Z0L A;  2WYG B;  4X8T L;  1DNU C;  1EMN A;  1FFM A;  5FF1 A;  3ENS A;  1HRE A;  1IVO C;  4YT6 L;  1SZB A;  1HAF A;  1WHE A;  1EQG A;  4YZU B;  4BTT A;  4RUT A;  3OGW A;  2J4I B;  1IGX A;  2K2S B;  2RHP A;  3UBA A;  4ZXY L;  5CIS A;  5HPW A;  1MYP C;  4MMY B;  1J9C L;  2M74 A;  3N8V A;  1IOE L;  4KSZ A;  2W2P E;  1YUF A;  2P16 L;  3MQE A;  2J94 B;  2XBY L;  3ZS1 C;  4RRX A;  1EPJ A;  1LPK A;  1IQF L;  1NFW B;  4CUD A;  4QJQ A;  2H9E L;  2D1J B;  3TZI A;  2TGF A;  3RKE A;  1CX2 A;  1IQN L;  2Y7X B;  4LJJ A;  1HCG B;  1HJ7 A;  1PRH A;  1FF7 A;  3BT2 A;  1D5L C;  4PNX A;  3GIS X;  5I46 L;  1NFU B;  2VWO L;  4C1M C;  2Z5Z A;  5L2Z L;  5KIR A;  2KL7 A;  3TH3 L;  3V64 C;  1IJQ A;  2J38 B;  4HHR A;  1KLJ L;  3Q3K B;  4X8V L;  1YUG A;  4M11 A;  3ASI A;  4DL1 C;  1KSN B;  4Z0K B;  3ZS0 C;  3SOV A;  4Y55 A;  3R05 A;  2PR3 B;  1PFX L;  2P3T A;  2P3F L;  1F7M A;  2I9A A;  1DX5 I;  3NAK A;  4CSY A;  4X8U L;  2EI7 B;  3NYH A;  3LC5 B;  2QRB A;  2WPI E;  3R5O A;  4M10 A;  3KL6 B;  4O1Z A;  2PHB B;  5IKR A;  3CFW A;  2FLR L;  4NT3 A;  2YGO A;  1IOX A;  1IQI L;  4Y7B B;  1IQJ L;  4XLW A;  2WFX B;  4O02 B;  3SOB B;  4CUF A;  1FSB A;  3NT1 A;  3HO3 A;  2K2T A;  4NA9 L;  3KQB L;  4RRY A;  2IPS A;  1FE2 A;  4GN6 A;  4AQT A;  3MDL A;  1Z6C A;  2EI8 B;  3BT1 A;  4Y76 B;  1IQG L;  4JYU L;  1XFE A;  1IQH L;  1UZQ A;  2GD4 A;  3CEN L;  1BF9 A;  2BQ7 A;  3ZYG A;  1ADX A;  4JZD L;  3LN0 A;  4FM5 A;  3LTG D;  1N1I A;  6COX A;  2XBW L;  3ZYI B;  1X7A L;  4YT7 L;  3TK6 B;  1F7E A;  3NIU A;  4HHS A;  1O5D L;  2Y80 B;  5GLS A;  2PUQ L;  3KQC L;  1G1R A;  1EBV A;  1P0S L;  3IIT B;  4BDX A;  1EPH A;  1K36 A;  3U7U G;  5IKV A;  1YO8 A;  2J2U B;  4C16 A;  1M1X B;  4N7A A;  1QFK L;  2VWL L;  2B7D L;  2Y5G L;  3OLT A;  1L5G B;  5JVY A;  2NPR A;  4COX A;  1EQH A;  1F0R B;  1W7X L;  4RS0 A;  2BOK L;  1IQE L;  5CKQ A;  5L2Y L;  3N8W A;  1D7W C;  3LAQ A;  2QPK A;  2UWL B;  3R5Q A;  2VVV L;  3SW2 A;  3LTF B;  1TPG A;  2O86 A;  4MMX B;  1C5M F;  4JYV L;  2W2O E;  4IG5 A;  3M37 L;  1DVA L;  4JZE L;  2NQX A;  3KQD L;  1GK5 A;  5EGM B;  3HS5 A;  1NT0 A;  3BPS E;  1IGZ A;  3KRQ A;  1K37 A;  3KQE L;  3HO4 A;  1B9W A;  2BOH A;  2ADX A;  2VWM K;  1FJS L;  3H5C B;  1W8B L;  2W2N E;  1HZ8 A;  1NFX B;  3FNL A;  3QL6 A;  3ERH A;  1JL9 A;  2J95 B;  1UZJ A;  2MGP A;  1U67 A;  1NFY B;  3FCS B;  2PT3 A;  5CKM A;  2FLB L;  2AYL A;  3ZYJ B;  2BO2 A;  5CKN A;  4Y71 B;  5L30 L;  2BOU A;  1LMJ A;  3F1S B;  3I6N A;  2MHP A;  1NZI A;  1D2V C;  1G2L B;  2WG3 C;  4E1G A;  3QF1 A;  1XDT R;  3KK6 A;  2P94 L;  3BXI A;  3FAQ A;  2XBX L;  1CEJ A;  1ZAQ A;  2EI6 B;  3P5B L;  3R55 A;  4PH9 A;  2G00 L;  2VH0 B;  4NGA L;  4CUE A;  1HX2 A;  1F0S B;  2Y81 B;  2F9B L;  3HS6 A;  2DDU A;  4BTI A;  2FD6 A;  4BXS A;  4ISI L;  5JBC E;  1ATE A;  1UZP A;  1G1T A;  1IQM L;  4XL1 A;  4BXW A;  1P9J A;  2MGR A;  3SOQ A;  3GCK A;  2E9E A;  3GC1 A;  4KVK A;  2IKC A;  3QMO A;  4RRW A;  1PGE A;  4ZXX L;  1ATB A;  1HAE A;  2VWN L;  1TOZ A;  1XKA L;  3LIW B;  2WFT A;  4OTY A;  1DNW C;  1ATA A;  4OEK A;  1CCV A;  2OJV A;  3RR3 A;  3KRK A;  4MMZ B;  2P28 B;  2W3K B;  3N8Y A;  1XKB A;  2BZ6 L;  4NG9 L;  4RRZ A;  2I9B A;  3OLU A;  1CQE A;  1MQ5 L;  2FZZ L;  2WYJ B;  4KVL A;  2W2Q E;  2XBV L;  3ERI A;  3Q7D A;  3HPT A;  1MQ6 L;  3SXV A;  1I0U A;  2Y5F L;  2P3U A;  1Q4G A;  1UZK A;  5COX A;  2P26 A;  4LOR A;  1G2M B;  3FFG L;  3LN1 A;  4Y6D B;  1ATD A;  5JW1 A;  1KIG L;  2BMG A;  4ZAE B;  3V6Q A;  3NJP C;  3EGF A;  2VH6 B;  3HS7 A;  3CA7 A;  5F1A A;  5IKT A;  2W3I B;  2XC4 L;  3V65 B;  5JBA E;  2VVU L;  5B72 A;  3HO5 A;  1CXP C;  4BDW A;  4JZF L;  5KN5 C;  2W2M E;  1KLI L;  1EGF A;  1PTH A;  1TLE A;  3S4F A;  3NTG A;  2WG4 B;  1RFN B;  3TK5 B;  3N8F A;  4MSF A;  1EPG A;  2P93 L;  2Y38 A;  4D0E A;  1A3P A;  4D0F A;  3F9P C;  1L3Y A;  2XC0 L;  1APQ A;  5JBB E;  1CVU A;  3GCJ A;  1MOX C;  1AUT L;  3CS7 L;  2YGP A;  4NJB A;  2FLG A;  1APO A;  3POY A;  1CVW L;  4TGF A;  3N8X A;  2Y7Z B;  1EZQ B;  5IKQ A;  3ELA L;  2PUM A;  4A7I A;  4D90 A;  1DDX A;  1EAI C;  1YUK B;  1DIY A;  1JBU L;  5K0H B;  2WPK E;  4Y79 B;  2R5L A;  4LMF A;  3Q9K A;  1NQL B;  2P95 L;  2RNL A;  2J34 B;  5FIW C;  2WPL E;  3FBY A;  5JVZ A;  2UWO B;  2Y5H L;  2BQ6 A;  3N8Z A;  1HT8 A;  2P3F N;  1YGC L;  3GCL A;  2QQT A;  1LQD A;  1IQL L;  1OB1 C;  4G1M B;  2W86 A;  3U73 A;  4X8S L;  4BTU A;  2Q1J B;  1MHL C;  1V3X B;  4KVJ A;  1G1S A;  2XC5 L;  1WHF A;  1FAX L;  2WPJ E;  1WU1 B;  4QYQ A;  3C9A C;  2KV4 A;  3M36 L;  1IQK L;  3TGF A;  5FDQ A;  1IP0 A;  3IJE B;  1N7D A;  4OTJ A;  2WPM E;  2Y82 B;  4ZH8 B;  1EMO A;  3NTB A;  5GH0 A;  3F6U L;  3GCW E;  1FAK L;  1Z6E L;  1U8C B;  5JB8 E;  1G1Q A;  3PY4 A;  2UWP B;  4Z6A L;  3QH0 A;  2OYE P;  2JKH L;  4XBM A;  1HRF A;  4GM7 A;  1DQB A;  3DEM A;  2EFB A;  2KB9 A;  2GJM A;  3R4X A;  2VVC K;  1HT5 A;  3N8W B;  3PGH A;  4Y7A B;  2BQW A;  1KLO A;  2WPH E;  3TBD A;  1COU A;  2BOX A;  1LPG A;  1CCF A;  3TGY A;  5F19 A;  1URK A; 
#chains in the Genus database with same CATH topology
 2KNI A;  5E8D A;  3GCX E;  2RA0 L;  3QCW A;  5JB9 E;  1EPI A;  2VJ3 A;  1NPE B;  3K9X A;  4ISH L;  4ZHA B;  2EHA A;  1LPZ A;  1PXX A;  2W26 B;  3LC3 B;  1JV2 B;  3N8Y B;  2CJI B;  2BSF A;  2OYU P;  3KCG L;  4Z0L A;  2WYG B;  4X8T L;  1DNU C;  1EMN A;  1FFM A;  5FF1 A;  3ENS A;  1HRE A;  1IVO C;  4YT6 L;  1SZB A;  1HAF A;  1WHE A;  1EQG A;  4YZU B;  4BTT A;  4RUT A;  2VRS A;  3OGW A;  2J4I B;  1IGX A;  2K2S B;  2RHP A;  3UBA A;  4ZXY L;  5CIS A;  5HPW A;  1MYP C;  4MMY B;  1J9C L;  2M74 A;  3N8V A;  1IOE L;  4KSZ A;  2W2P E;  1YUF A;  2P16 L;  3MQE A;  2J94 B;  2XBY L;  3ZS1 C;  4RRX A;  1EPJ A;  1LPK A;  2YGQ A;  1IQF L;  1NFW B;  4CUD A;  4QJQ A;  2H9E L;  2D1J B;  3TZI A;  2TGF A;  2HOX A;  3RKE A;  1CX2 A;  1IQN L;  2Y7X B;  4LJJ A;  1HCG B;  1HJ7 A;  1PRH A;  1FF7 A;  3BT2 A;  1D5L C;  4PNX A;  3GIS X;  5I46 L;  1NFU B;  2VWO L;  4C1M C;  4GU4 A;  2Z5Z A;  5L2Z L;  5KIR A;  2KL7 A;  3TH3 L;  3V64 C;  1IJQ A;  2J38 B;  4HHR A;  1KLJ L;  3Q3K B;  4X8V L;  1YUG A;  4M11 A;  3ASI A;  4DL1 C;  1KSN B;  4Z0K B;  4A94 C;  3ZS0 C;  3SOV A;  4Y55 A;  3R05 A;  2PR3 B;  2H9E C;  1PFX L;  2P3T A;  2P3F L;  1F7M A;  2I9A A;  1DX5 I;  3NAK A;  4CSY A;  4X8U L;  2EI7 B;  3NYH A;  3LC5 B;  2QRB A;  2WPI E;  3R5O A;  4M10 A;  3KL6 B;  4O1Z A;  2PHB B;  5IKR A;  3CFW A;  2FLR L;  4NT3 A;  2YGO A;  1IOX A;  1IQI L;  2BT7 A;  4Y7B B;  1IQJ L;  4XLW A;  2WFX B;  4O02 B;  3SOB B;  4CUF A;  1FSB A;  2JJL A;  3NT1 A;  3HO3 A;  2K2T A;  4NA9 L;  3KQB L;  4RRY A;  2IPS A;  1FE2 A;  4GN6 A;  4AQT A;  3MDL A;  1Z6C A;  2EI8 B;  3BT1 A;  4Y76 B;  1IQG L;  4JYU L;  1XFE A;  1IQH L;  1UZQ A;  2GD4 A;  3CEN L;  1BF9 A;  2BQ7 A;  3ZYG A;  1ADX A;  4JZD L;  3LN0 A;  4FM5 A;  3LTG D;  1N1I A;  6COX A;  2XBW L;  3ZYI B;  1X7A L;  4YT7 L;  3TK6 B;  1F7E A;  3NIU A;  4HHS A;  1O5D L;  2Y80 B;  5GLS A;  2PUQ L;  3KQC L;  1G1R A;  1EBV A;  1P0S L;  3IIT B;  4BDX A;  1EPH A;  1K36 A;  3U7U G;  5IKV A;  1YO8 A;  2J2U B;  4C16 A;  1M1X B;  4N7A A;  1QFK L;  2VWL L;  2B7D L;  2Y5G L;  3OLT A;  1L5G B;  5JVY A;  2NPR A;  4COX A;  1EQH A;  1F0R B;  1W7X L;  4RS0 A;  2BOK L;  1IQE L;  5CKQ A;  5L2Y L;  3N8W A;  1D7W C;  4GU3 A;  3LAQ A;  2QPK A;  2UWL B;  3R5Q A;  2VVV L;  3SW2 A;  3LTF B;  1TPG A;  2O86 A;  4MMX B;  1C5M F;  4JYV L;  2W2O E;  4IG5 A;  3M37 L;  1DVA L;  4JZE L;  2NQX A;  3KQD L;  1GK5 A;  5EGM B;  3HS5 A;  1NT0 A;  3BPS E;  1IGZ A;  3KRQ A;  1K37 A;  3KQE L;  3HO4 A;  1B9W A;  2BOH A;  2ADX A;  2VWM K;  1FJS L;  3H5C B;  1W8B L;  2W2N E;  1HZ8 A;  1NFX B;  3FNL A;  3QL6 A;  3ERH A;  1JL9 A;  2J95 B;  1UZJ A;  2MGP A;  1U67 A;  1NFY B;  3FCS B;  2PT3 A;  5CKM A;  2FLB L;  2AYL A;  3ZYJ B;  2BO2 A;  5CKN A;  4Y71 B;  5L30 L;  2BOU A;  1LMJ A;  1V1H A;  3F1S B;  3I6N A;  2MHP A;  1NZI A;  1D2V C;  1G2L B;  2WG3 C;  4E1G A;  3QF1 A;  1XDT R;  3KK6 A;  2P94 L;  3BXI A;  3FAQ A;  1KKE A;  2XBX L;  1CEJ A;  1ZAQ A;  2EI6 B;  3P5B L;  3R55 A;  4PH9 A;  2G00 L;  2VH0 B;  4NGA L;  4CUE A;  1HX2 A;  1F0S B;  2Y81 B;  2F9B L;  3HS6 A;  2DDU A;  4BTI A;  2FD6 A;  4BXS A;  4ISI L;  5JBC E;  1ATE A;  1UZP A;  1G1T A;  1IQM L;  4XL1 A;  4BXW A;  1P9J A;  2MGR A;  3SOQ A;  3GCK A;  2E9E A;  3GC1 A;  4KVK A;  2IKC A;  3QMO A;  4RRW A;  1PGE A;  4ZXX L;  1ATB A;  1HAE A;  2VWN L;  1TOZ A;  1XKA L;  3LIW B;  2WFT A;  4OTY A;  1DNW C;  1ATA A;  4OEK A;  1CCV A;  2OJV A;  3RR3 A;  3KRK A;  4MMZ B;  2P28 B;  2W3K B;  3N8Y A;  1XKB A;  2BZ6 L;  4NG9 L;  4RRZ A;  2I9B A;  3OLU A;  1CQE A;  1MQ5 L;  2FZZ L;  2WYJ B;  4KVL A;  2W2Q E;  2XBV L;  3ERI A;  3Q7D A;  3HPT A;  1MQ6 L;  3SXV A;  1I0U A;  2Y5F L;  2P3U A;  1Q4G A;  1UZK A;  5COX A;  2P26 A;  4LOR A;  1G2M B;  3FFG L;  3LN1 A;  4Y6D B;  1ATD A;  5JW1 A;  1KIG L;  2BMG A;  4ZAE B;  3V6Q A;  3NJP C;  2WZP P;  3EGF A;  2VH6 B;  3HS7 A;  3CA7 A;  5F1A A;  5IKT A;  2W3I B;  2XC4 L;  3V65 B;  5JBA E;  2VVU L;  5B72 A;  3HO5 A;  1CXP C;  4BDW A;  4JZF L;  5KN5 C;  2W2M E;  1KLI L;  1EGF A;  1PTH A;  1TLE A;  3S4F A;  3NTG A;  2WG4 B;  1RFN B;  3TK5 B;  3N8F A;  4MSF A;  1EPG A;  2P93 L;  2Y38 A;  4D0E A;  1A3P A;  4D0F A;  3F9P C;  1L3Y A;  1V1I A;  2XC0 L;  1APQ A;  5JBB E;  1CVU A;  3GCJ A;  1MOX C;  1AUT L;  3CS7 L;  2YGP A;  4NJB A;  2FLG A;  1APO A;  3POY A;  1CVW L;  4TGF A;  3N8X A;  2Y7Z B;  1EZQ B;  5IKQ A;  3ELA L;  2PUM A;  4A7I A;  4D90 A;  1DDX A;  1EAI C;  1YUK B;  1DIY A;  1JBU L;  5K0H B;  2WPK E;  4Y79 B;  2R5L A;  1QIU A;  4LMF A;  3Q9K A;  1NQL B;  2P95 L;  2RNL A;  2J34 B;  2HOR A;  5FIW C;  2WPL E;  3FBY A;  5JVZ A;  2UWO B;  2Y5H L;  2BQ6 A;  3N8Z A;  1HT8 A;  2P3F N;  1YGC L;  3GCL A;  2QQT A;  1LQD A;  1IQL L;  1OB1 C;  4G1M B;  2W86 A;  3U73 A;  4X8S L;  4BTU A;  2Q1J B;  1MHL C;  1V3X B;  4KVJ A;  1G1S A;  2XC5 L;  1WHF A;  1FAX L;  2WPJ E;  1WU1 B;  4QYQ A;  3C9A C;  2KV4 A;  3M36 L;  1IQK L;  3S6X A;  3TGF A;  5FDQ A;  1LK9 A;  1IP0 A;  3IJE B;  1N7D A;  4OTJ A;  2WPM E;  2Y82 B;  4ZH8 B;  1EMO A;  3NTB A;  5GH0 A;  3F6U L;  3GCW E;  1FAK L;  1Z6E L;  1U8C B;  5JB8 E;  1G1Q A;  3PY4 A;  2UWP B;  2BT8 A;  4Z6A L;  3QH0 A;  2OYE P;  2JKH L;  1LMM A;  4XBM A;  1HRF A;  4GM7 A;  1DQB A;  3DEM A;  2EFB A;  2KB9 A;  2GJM A;  3R4X A;  2VVC K;  1HT5 A;  3N8W B;  3PGH A;  4Y7A B;  2BQW A;  1KLO A;  2WPH E;  3TBD A;  1COU A;  2BOX A;  1LPG A;  1CCF A;  3TGY A;  5F19 A;  1URK A; 
#chains in the Genus database with same CATH homology
 2KNI A;  5E8D A;  3GCX E;  2RA0 L;  3QCW A;  5JB9 E;  1EPI A;  2VJ3 A;  1NPE B;  3K9X A;  4ISH L;  4ZHA B;  2EHA A;  1LPZ A;  1PXX A;  2W26 B;  3LC3 B;  1JV2 B;  3N8Y B;  2CJI B;  2OYU P;  3KCG L;  4Z0L A;  2WYG B;  4X8T L;  1DNU C;  1EMN A;  1FFM A;  5FF1 A;  3ENS A;  1HRE A;  1IVO C;  4YT6 L;  1SZB A;  1HAF A;  1WHE A;  1EQG A;  4YZU B;  4BTT A;  4RUT A;  3OGW A;  2J4I B;  1IGX A;  2K2S B;  2RHP A;  3UBA A;  4ZXY L;  5CIS A;  5HPW A;  1MYP C;  4MMY B;  1J9C L;  2M74 A;  3N8V A;  1IOE L;  4KSZ A;  2W2P E;  1YUF A;  2P16 L;  3MQE A;  2J94 B;  2XBY L;  3ZS1 C;  4RRX A;  1EPJ A;  1LPK A;  2YGQ A;  1IQF L;  1NFW B;  4CUD A;  4QJQ A;  2H9E L;  2D1J B;  3TZI A;  2TGF A;  3RKE A;  1CX2 A;  1IQN L;  2Y7X B;  4LJJ A;  1HCG B;  1HJ7 A;  1PRH A;  1FF7 A;  3BT2 A;  1D5L C;  4PNX A;  3GIS X;  5I46 L;  1NFU B;  2VWO L;  4C1M C;  2Z5Z A;  5L2Z L;  5KIR A;  2KL7 A;  3TH3 L;  3V64 C;  1IJQ A;  2J38 B;  4HHR A;  1KLJ L;  3Q3K B;  4X8V L;  1YUG A;  4M11 A;  3ASI A;  4DL1 C;  1KSN B;  4Z0K B;  4A94 C;  3ZS0 C;  3SOV A;  4Y55 A;  3R05 A;  2PR3 B;  2H9E C;  1PFX L;  2P3T A;  2P3F L;  1F7M A;  2I9A A;  1DX5 I;  3NAK A;  4CSY A;  4X8U L;  2EI7 B;  3NYH A;  3LC5 B;  2QRB A;  2WPI E;  3R5O A;  4M10 A;  3KL6 B;  4O1Z A;  2PHB B;  5IKR A;  3CFW A;  2FLR L;  4NT3 A;  2YGO A;  1IOX A;  1IQI L;  4Y7B B;  1IQJ L;  4XLW A;  2WFX B;  4O02 B;  3SOB B;  4CUF A;  1FSB A;  3NT1 A;  3HO3 A;  2K2T A;  4NA9 L;  3KQB L;  4RRY A;  2IPS A;  1FE2 A;  4GN6 A;  4AQT A;  3MDL A;  1Z6C A;  2EI8 B;  3BT1 A;  4Y76 B;  1IQG L;  4JYU L;  1XFE A;  1IQH L;  1UZQ A;  2GD4 A;  3CEN L;  1BF9 A;  2BQ7 A;  3ZYG A;  1ADX A;  4JZD L;  3LN0 A;  4FM5 A;  3LTG D;  1N1I A;  6COX A;  2XBW L;  3ZYI B;  1X7A L;  4YT7 L;  3TK6 B;  1F7E A;  3NIU A;  4HHS A;  1O5D L;  2Y80 B;  5GLS A;  2PUQ L;  3KQC L;  1G1R A;  1EBV A;  1P0S L;  3IIT B;  4BDX A;  1EPH A;  1K36 A;  3U7U G;  5IKV A;  1YO8 A;  2J2U B;  4C16 A;  1M1X B;  4N7A A;  1QFK L;  2VWL L;  2B7D L;  2Y5G L;  3OLT A;  1L5G B;  5JVY A;  2NPR A;  4COX A;  1EQH A;  1F0R B;  1W7X L;  4RS0 A;  2BOK L;  1IQE L;  5CKQ A;  5L2Y L;  3N8W A;  1D7W C;  3LAQ A;  2QPK A;  2UWL B;  3R5Q A;  2VVV L;  3SW2 A;  3LTF B;  1TPG A;  2O86 A;  4MMX B;  1C5M F;  4JYV L;  2W2O E;  4IG5 A;  3M37 L;  1DVA L;  4JZE L;  2NQX A;  3KQD L;  1GK5 A;  5EGM B;  3HS5 A;  1NT0 A;  3BPS E;  1IGZ A;  3KRQ A;  1K37 A;  3KQE L;  3HO4 A;  1B9W A;  2BOH A;  2ADX A;  2VWM K;  1FJS L;  3H5C B;  1W8B L;  2W2N E;  1HZ8 A;  1NFX B;  3FNL A;  3QL6 A;  3ERH A;  1JL9 A;  2J95 B;  1UZJ A;  2MGP A;  1U67 A;  1NFY B;  3FCS B;  2PT3 A;  5CKM A;  2FLB L;  2AYL A;  3ZYJ B;  2BO2 A;  5CKN A;  4Y71 B;  5L30 L;  2BOU A;  1LMJ A;  3F1S B;  3I6N A;  2MHP A;  1NZI A;  1D2V C;  1G2L B;  2WG3 C;  4E1G A;  3QF1 A;  1XDT R;  3KK6 A;  2P94 L;  3BXI A;  3FAQ A;  2XBX L;  1CEJ A;  1ZAQ A;  2EI6 B;  3P5B L;  3R55 A;  4PH9 A;  2G00 L;  2VH0 B;  4NGA L;  4CUE A;  1HX2 A;  1F0S B;  2Y81 B;  2F9B L;  3HS6 A;  2DDU A;  4BTI A;  2FD6 A;  4BXS A;  4ISI L;  5JBC E;  1ATE A;  1UZP A;  1G1T A;  1IQM L;  4XL1 A;  4BXW A;  1P9J A;  2MGR A;  3SOQ A;  3GCK A;  2E9E A;  3GC1 A;  4KVK A;  2IKC A;  3QMO A;  4RRW A;  1PGE A;  4ZXX L;  1ATB A;  1HAE A;  2VWN L;  1TOZ A;  1XKA L;  3LIW B;  2WFT A;  4OTY A;  1DNW C;  1ATA A;  4OEK A;  1CCV A;  2OJV A;  3RR3 A;  3KRK A;  4MMZ B;  2P28 B;  2W3K B;  3N8Y A;  1XKB A;  2BZ6 L;  4NG9 L;  4RRZ A;  2I9B A;  3OLU A;  1CQE A;  1MQ5 L;  2FZZ L;  2WYJ B;  4KVL A;  2W2Q E;  2XBV L;  3ERI A;  3Q7D A;  3HPT A;  1MQ6 L;  3SXV A;  1I0U A;  2Y5F L;  2P3U A;  1Q4G A;  1UZK A;  5COX A;  2P26 A;  4LOR A;  1G2M B;  3FFG L;  3LN1 A;  4Y6D B;  1ATD A;  5JW1 A;  1KIG L;  2BMG A;  4ZAE B;  3V6Q A;  3NJP C;  2WZP P;  3EGF A;  2VH6 B;  3HS7 A;  3CA7 A;  5F1A A;  5IKT A;  2W3I B;  2XC4 L;  3V65 B;  5JBA E;  2VVU L;  5B72 A;  3HO5 A;  1CXP C;  4BDW A;  4JZF L;  5KN5 C;  2W2M E;  1KLI L;  1EGF A;  1PTH A;  1TLE A;  3S4F A;  3NTG A;  2WG4 B;  1RFN B;  3TK5 B;  3N8F A;  4MSF A;  1EPG A;  2P93 L;  2Y38 A;  4D0E A;  1A3P A;  4D0F A;  3F9P C;  1L3Y A;  2XC0 L;  1APQ A;  5JBB E;  1CVU A;  3GCJ A;  1MOX C;  1AUT L;  3CS7 L;  2YGP A;  4NJB A;  2FLG A;  1APO A;  3POY A;  1CVW L;  4TGF A;  3N8X A;  2Y7Z B;  1EZQ B;  5IKQ A;  3ELA L;  2PUM A;  4A7I A;  4D90 A;  1DDX A;  1EAI C;  1YUK B;  1DIY A;  1JBU L;  5K0H B;  2WPK E;  4Y79 B;  2R5L A;  4LMF A;  3Q9K A;  1NQL B;  2P95 L;  2RNL A;  2J34 B;  5FIW C;  2WPL E;  3FBY A;  5JVZ A;  2UWO B;  2Y5H L;  2BQ6 A;  3N8Z A;  1HT8 A;  2P3F N;  1YGC L;  3GCL A;  2QQT A;  1LQD A;  1IQL L;  1OB1 C;  4G1M B;  2W86 A;  3U73 A;  4X8S L;  4BTU A;  2Q1J B;  1MHL C;  1V3X B;  4KVJ A;  1G1S A;  2XC5 L;  1WHF A;  1FAX L;  2WPJ E;  1WU1 B;  4QYQ A;  3C9A C;  2KV4 A;  3M36 L;  1IQK L;  3S6X A;  3TGF A;  5FDQ A;  1IP0 A;  3IJE B;  1N7D A;  4OTJ A;  2WPM E;  2Y82 B;  4ZH8 B;  1EMO A;  3NTB A;  5GH0 A;  3F6U L;  3GCW E;  1FAK L;  1Z6E L;  1U8C B;  5JB8 E;  1G1Q A;  3PY4 A;  2UWP B;  4Z6A L;  3QH0 A;  2OYE P;  2JKH L;  1LMM A;  4XBM A;  1HRF A;  4GM7 A;  1DQB A;  3DEM A;  2EFB A;  2KB9 A;  2GJM A;  3R4X A;  2VVC K;  1HT5 A;  3N8W B;  3PGH A;  4Y7A B;  2BQW A;  1KLO A;  2WPH E;  3TBD A;  1COU A;  2BOX A;  1LPG A;  1CCF A;  3TGY A;  5F19 A;  1URK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...