1FE3A

Crystal structure of human brain fatty acid binding protein oleic acid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
131
structure length
131
Chain Sequence
b'VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FATTY ACID-BINDING PROTEIN, BRAIN
publication title Crystal structure and thermodynamic analysis of human brain fatty acid-binding protein.
pubmed rcsb
molecule tags Lipid binding protein
total genus 23
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1fe3A00
1IFBA 2W2AA 3UEWA 5HZ6A 3TGBA 4QYPA 1DF3A 2JU8A 1KT5A 5LJHA 1HMSA 4KIIA 3UEXA 3G7XA 5FAZA 1TVQA 5HA0A 2X46A 2Q39A 1X8OA 3FIQA 1HMTA 1JV4A 1QG5A 4OMWA 5D48A 4EEJA 4GH7A 1KZWA 3ZUOA 4QGXA 3FEKA 5F6ZA 2R73A 1EQDA 3CBCA 2CBRA 3APWA 3AKMA 2PY1A 1VYFA 1LICA 3FR5A 5EDCA 4A1HA 4ZGUA 2ALLX 2G79A 1YWAA 2LKKA 2MO5A 3FW5A 2RD7C 4R0BA 5H9NA 1FENA 1N0SA 4Y0QA 4OS3A 2XKLA 5H8TA 4YGHA 4YH0A 2QOSC 3PP6A 1E5PA 4ZCBA 4ZHFA 1KOIA 3CWKA 2LBAA 3CQNA 4HPAA 4A60A 3O19A 1X8NA 4CK4A 1GT5A 1U17A 4QGWA 5H9KA 4M6SA 2ASNX 1XCAA 5F7GA 2L5PA 5LJGA 2A0AA 3RSWA 3MBTA 2JN3A 1U18A 4BOEA 3BS2A 2L68A 4NNTA 4YGZA 3VG5A 1BSQA 1SXUA 3WJBA 2LFOA 4NYRA 4EDEA 3BX8A 5JR8A 3CR6A 1E02A 1S7DA 1TXLA 4YKMA 5HCEC 3IA8A 2CM9A 5HTEA 4GE1A 1QABE 3KQ0A 1VYGA 5D4AA 1GM6A 1EIIA 1SY0A 5F1EA 1YP6A 1KXOA 3APXA 1DZJA 2P8GA 3JS1A 4NYQA 1NP4A 5CE4A 4D6BA 4Y0RA 1GKAA 5HZ5A 1YWBA 3EBWA 2HZRA 1OBUA 4GETA 2R74A 5HZ9A 1BRQA 2OFMX 3FA8A 4D6AA 1X89A 1DZMA 3FR4A 2AT6X 3I0AA 3NR3A 2AT3X 4Y0PA 4TKBA 4EXZA 2FRSA 1NP1A 5HCDC 1GGLA 1RBPA 5LJKA 1JYDA 3WJGA 5HAEA 3WJEA 4K19A 1CBIA 1I06A 1ICNA 4YGGA 2L9CA 2K23A 1GT4A 2DM5A 4MVLA 4ORRA 4ZHCA 1G7NA 1BLRA 4I9SA 1MUPA 4YMYA 1ZNLA 1S2PA 2MM3A 3VG4A 1O8VA 4DQ4A 4XMEA 2FR2A 4YDBA 4IAXA 2G7BA 4TQ2A 1G85A 3RZYA 3P6HA 3NQ9A 2WUTA 4GRJA 2QO6A 4IB6A 3L4RA 1ERXA 3FA9A 5IO6A 4RUUA 4Y0SA 2FS6A 3EMMA 1MVGA 3FELA 3ELXA 4AW8A 1DV9A 4YBUA 3BLGA 1D2UA 1EPAA 1T0VA 2YG2A 2WQ9A 4AZMA 4AYHA 2A2GA 2AT0X 4GNYA 3D97A 1O1VA 4ORWA 3TZSA 4YBPA 1DZKA 3WJCA 4ORSA 1OEKA 4YKOA 1G5WA 5LKEA 1KQWA 4YDAA 2BLGA 3I17A 4ZR2A 3PPTA 2QM9A 4UU3A 1LF7A 1I04A 5H9LA 1LPJA 3DTQA 4QAEA 2QO5A 3HWDA 2HZQA 3KZAA 1BEBA 3WJFA 3PH6A 2KTDA 5D47A 1HBQA 1AVGI 3S26A 1LIBA 2RA6A 4O9SA 2GTFX 2CBSA 3HWEA 5EEEA 2FR3A 2G78A 1EW3A 1T68X 1SY1A 3NX2A 3NADA 1U0XA 5HBSA 2Q4NA 5FFHA 3APUA 1LIEA 2FT9A 1A3YA 3KFGA 3ZQ3A 1B8EA 4HPBA 1IW2A 1MDCA 1EALA 4WFUA 2OVEA 4OS0A 3F9DA 1CBRA 2AMMX 5LJDA 1QFTA 2N93A 1JYJA 4ORUA 1L6MA 2QO4A 5KICA 4TKJA 3TF6A 3ZUIA 3U0DA 2E4JA 2OVAA 5D8JA 5D45A 5AQ6A 3U03A 1TW4A 5BVQA 4ALBA 5B29A 5HCCC 1GKAB 1PEEA 1JJXA 4TNNA 4TKHA 1B0OA 2K62A 4QZTA 2LBVA 1HN2A 1AELA 1QY1A 3AKNA 2WEXA 2POAA 1A18A 1BJ7A 1VPRA 1Z24A 4HFOA 4YFQA 4AZRA 5F6BA 1YP7A 4ZH9A 3HK1A 1CJ5A 2OVDA 4NP1A 1GT1A 2A3FX 3FLLA 3WVMA 3O2YA 2RCTA 1GX9A 1JJJA 1SY2A 1EPBA 1SXXA 2W2FA 2WEWA 2ACPX 4XMHA 4LZVA 1LFOA 5L8IA 1SXWA 1H91A 3C78X 4MVIA 1ICMA 3ELZA 4I3DA 4QYNA 1O1UA 1QQSA 4NLJA 2MJIA 4ZHGA 1EIOA 2KT4B 4XMCA 1PBOA 1QY0A 3TGCA 1E06A 2NNEA 5EDBA 3GAQA 3CBSA 3PH5A 4YCHA 3CMPA 1FDQA 2CZTA 3C76X 2A2UA 3P6EA 1FE3A 3PECA 2L67A 1OEEA 1OPBA 3B2KA 3T1DA 1QWDA 1ML7A 3VG2A 2NP1A 4NLIA 4LKTA 4MVKA 1S44A 4TJZA 1JBHA 1YWDA 1BM5A 1GT3A 2HYSA 5DPQA 1QFVA 3Q6LA 5HA1A 4RUNA 3NX1A 2GJ5A 2AKQA 3MVFA 1RLBE 2WWPA 1EUOA 1ACDA 1X8QA 4ORYA 5L8NA 3DSZA 4TLJA 2A13A 5IO5A 3NQ3A 1A2DA 1FEMA 3D96A 1IKJA 4IB8A 1D3SA 4DQ3A 4I9RA 1GX8A 1OEJA 5C0NA 3UEUA 2HLVA 3BDRA 4YFRA 4IMNA 5LJEA 3C77X 3BY0A 1ZNEA 1KT7A 2LB6A 5KHPA 2GC9A 2ACOA 3EYCA 2AH7X 4A8ZA 1UREA 2AL0X 3JSQA 3F8AA 4YFPA 2FS7A 5EZ2A 1KT4A 1ALBA 1UZ2X 5EPQA 5F58A 3K3LA 1X71A 1SXYA 1T8VA 2FWVA 3KFIA 1KGLA 2Q9SA 3QKGA 3CQRA 4N7DA 2IFBA 3VG6A 4IB7A 3B2HA 3VG3A 1P6PA 4OMXA 2CM4A 4XMGA 3BRNA 1I05A 2EU7X 4WFVA 1ZNGA 2W2BA 5HTDA 3BU1A 1MX7A 3SAOA 2NNQA 1OBPA 4GNWA 1TOWA 2WR6A 2RCQA 4ZH6A 3BX7A 1ADLA 1ERBA 3APVA 4HPCA 3BU9A 2HNXA 3B2LA 4GKCA 1SY3A 1KT6A 4AZNA 1G74A 1LKEA 3WJDA 4N7CA 4ORXA 3EM0A 4UU2A 5DG4A 1BWYA 3KFFA 3NPOA 2Q2PA 1SA8A 5IO7A 2WSJA 4LKPA 3B2IA 1A57A 1KQXA 1XKIA 4ZHDA 1QY2A 1TOUA 1DZPA 2OZQA 4XMDA 2CZUA 5L8OA 4OS8A 5LJCA 4ZFXA 2AT5X 4AZQA 1IKEA 3PEDA 1CRBA 1PMPA 4BQUA 3OJYC 2R56A 1JZUA 1E00A 3HWFA 3O22A 1KT3A 1YWCA 2WQAE 1R0UA 3UEVA 1LIDA 2X45A 5H9AA 3IFBA 1FELA 4HPDA 5BVTA 1MX8A 2JU7A 3P6DA 1AB0A 3B2JA 3FENA 4IB9A 4IBAA 2ANSA 3EBKA 3FA7A 1ZNKA 5LJBA 1AQBA 1FTPA 5BVSA 3STKA 5FENA 3TGAA 1DFVA 4I3CA 5K06A 2AT8X 3FR2A 5HZ8A 1BSOA 3P6GA 1ZNDA 4ZJ0A 2XSTA 3KFHA 3WXQA 4YCEA 1X8UA 3STMX 1OBQA 2NNDA 5B27A 2JOZA 1BBPA 4PSQA 2FTBA 4ALOA 1B4MA 3FA6A 1HBPA 1HQPA 1PM1X 2F73A 4BVMA 3BSZE 2RQ0A 3P6CA 3U9PC 1LIFA 4A1YA 4XMFA 3STNA 1NGLA 3WBGA 4LZUA 2HMBA 4EFGA 4ZHHA 1BRPA 1GXAA 1IFCA 1LNMA 1KZXA 3D95A 3HWGA 1BSYA 1ZNHA 4ODDA 2Q2MA 4AZPA 1B56A 5KIDA 4M7MA 1X8PA 4QGVA 3FEPA 4QZUA 1EXSA 4IAWA 3P6FA 5EEDA 4ES7A 1YIVA 5HZQA 2OFRX 4WBKA 1HMRA 1OPAA 2O62A 1I4UA 2FLJA 3VG7A 4AZOA 3FMZA 1DC9A 3NP1A 2JU3A 1CBQA 5LKFA 3FW4A 4ARHA 4NNSA 4IMOA 1YUPA 1IIUA 1CBSA 5HWZA 1ZRYA 4I3BA
chains in the Genus database with same CATH superfamily
1IFBA 3WOVA 2W2AA 2X34A 1I9HA 3UEWA 5HZ6A 1AVEA 1W5RA 4ID2A 4QYPA 3TGBA 1DF3A 5B3MO 2JU8A 1KT5A 1VWGB 1LCVA 1Y52X 5LJHA 4CSBA 2X8SA 1LCZA 1HMSA 4KIIA 3UEXA 3G7XA 3S5VA 5FAZA 1TVQA 5HA0A 2X46A 2Q39A 1X8OA 3FIQA 1HMTA 1JV4A 1QG5A 2IZFB 3P02A 4OMWA 5D48A 2QOMA 4GH7A 3ZUOA 4QGXA 4EEJA 1KZWA 3FEKA 5F6ZA 4OEMA 2G5LA 3SZJA 3FIDA 3VPJE 4BX7A 2R73A 1EQDA 2ZAGA 1HXLA 3CBCA 1SRFA 1JJUA 2CBRA 3APWA 1MK5A 2RTKA 3AKMA 2FHLA 2C1QA 1VYFA 2PY1A 1LICA 3FR5A 5EDCA 4A1HA 4ZGUA 2ALLX 2G79A 1YWAA 2LKKA 2MO5A 3FW5A 2RD7C 4R0BA 5H9NA 1FENA 1N0SA 4IABA 2BT9A 4Y0QA 1EI5A 1K24A 4OS3A 2XKLA 1RXKA 3F6ZB 4OELA 5H8TA 4JGLA 4YGHA 4YH0A 2HKDA 1SLGB 3RY2A 3SLOA 1SWBA 2QOSC 1E5PA 3PP6A 4I60A 4ZCBA 4ZHFA 1KOIA 3CWKA 2LBAA 3CQNA 4HPAA 2UYWA 2FGSA 1JIWI 4A60A 3O19A 1SREA 1X8NA 4CK4A 2MHDA 1VWAB 1GT5A 1U17A 2OF9A 4QGWA 5H9KA 4HWMA 4M6SA 5IRWA 2ASNX 1XCAA 4BGFA 2LA7A 5F7GA 2L5PA 2A5CA 2IZAA 5LJGA 2A0AA 3RSWA 3MBTA 2JN3A 1SWHA 1U18A 3S5XA 1SWEA 3BS2A 2L68A 4NNTA 4YGZA 2X8FA 3VG5A 4BOEA 1BSQA 3QQ2A 1SXUA 2VFBA 2LFOA 4NYRA 3WJBA 3X00A 1VWLB 4EDEA 3BX8A 5JR8A 3CR6A 3P24A 2GTLO 1E02A 3OE3A 1S7DA 1TXLA 4YKMA 3HTYA 4GGZA 5HCEC 3IA8A 2CM9A 5HTEA 4GE1A 4GDAA 1QABE 2RTBB 1VYGA 3KQ0A 1GM6A 1SWRA 3HOEA 2Z4IA 5D4AA 3SLJA 1EIIA 1SWSA 1SY0A 2AF5A 5F1EA 4BJ8A 4NV7A 1YP6A 5BYPA 1KXOA 1SRGA 3APXA 1DZJA 2P8GA 3JS1A 4NYQA 2YMSA 1NP4A 5CE4A 4D6BA 2ZSCA 4Y0RA 1GKAA 5HZ5A 1YWBA 3CKFA 3EBWA 2I5VO 2HZRA 5AEOA 1OBUA 4FBRA 4GETA 2R74A 2IZJA 3WZQA 4O3ZA 5HZ9A 2JGSA 3RDMA 1BRQA 4ML7B 2OFMX 3FA8A 4O49A 4D6AA 1X89A 4JNJA 1DZMA 5JD2A 4GJSA 4O3WA 3FR4A 1WBIA 2AT6X 3I0AA 3NR3A 4Y59A 5CHKA 5FQ7E 2AT3X 4Y0PA 4BX5A 4TKBA 4EXZA 2FRSA 1NP1A 5HCDC 1GGLA 4KC8A 1RBPA 4O3YA 4QNIA 1JYDA 5LJKA 1VWRB 3WJGA 3RDOA 1JMXA 3WJEA 4K19A 5HAEA 2RTPB 3LHNA 1CBIA 1I06A 1ICNA 4YGGA 4FGIB 2L9CA 2K23A 1GT4A 2DM5A 2IZHB 4MVLA 4ORRA 1G7NA 2OFBA 4ZHCA 1RXJA 1BLRA 2RTFB 3AUMO 2A8GA 1STSB 4I9SA 4O4OA 1MUPA 4YMYA 4WHIA 3CKGA 1ZNLA 1S2PA 2MM3A 3VG4A 1O8VA 4DQ4A 1UYOX 2DJGA 2FR2A 4XMEA 4YDBA 2G8CO 4GUZA 4IAXA 2G7BA 4TQ2A 1G85A 1OSPO 2I5ZO 3PQUA 4BCSA 3RZYA 3P6HA 3NQ9A 2WUTA 2IZBA 5B11O 4GRJA 2QO6A 4IB6A 4KC7A 3L4RA 3ZWEA 4O4UA 1ERXA 3FA9A 5IO6A 2BSZA 4RUUA 4Y0SA 2FS6A 3EMMA 1GX3A 1MVGA 3FELA 1VWIB 3ELXA 4AW8A 1DV9A 5B10O 1SWNA 4YBUA 3BLGA 1NBXA 1D2UA 5IRUA 1EPAA 1T0VA 2YG2A 2WQ9A 5F2BA 4AZMA 4AYHA 1I78A 4BX7B 1AVDA 2RTAA 2OY1O 2A2GA 2AT0X 4GNYA 3D97A 1O1VA 4ORWA 3TZSA 4YBPA 3WZNA 1DZKA 1SWTA 3VHMA 1W6FA 1N9YA 1SRIA 4ORSA 3WJCA 1OEKA 2QMIA 4YKOA 1G5WA 5LKEA 1KQWA 4YDAA 2BLGA 1RSUB 3I17A 3PPTA 4ZR2A 1VWJB 2QM9A 4UU3A 2DJFA 1LF7A 1I04A 5H9LA 3PDFA 1LPJA 2X32A 4GU8A 2C1SA 3DTQA 4CPHA 4QAEA 4DCBA 1NQMA 2QO5A 5L3YA 3VE1A 1STPA 5FQ6E 4CDFA 3HWDA 2HZQA 4QQ1A 2KTSA 3KZAA 4MIRA 1BEBA 4GD9A 3WJFA 3PH6A 2KTDA 5D47A 1AVGI 1HBQA 5IRAA 1LIBA 4U8UN 2RA6A 3S26A 1SWFA 4O9SA 2GTFX 2CBSA 2RTQB 3HWEA 4U8UO 1LDQA 2FR3A 2G78A 5EEEA 4Z6JA 1KL5A 1EW3A 1T68X 4U9CA 1SY1A 2RTHB 3NX2A 3NADA 1U0XA 5HBSA 3ZW1A 1VWMB 2Q4NA 1SWPA 3APUA 5FFHA 1LIEA 3T6LA 2FT9A 1A3YA 3KFGA 1SLFB 3ZQ3A 1B8EA 1HXZA 4HPBA 1MEPA 1E2TA 2BS5A 1IW2A 1MDCA 3LV4A 4L3RA 1EALA 4WFUA 2OVEA 4OS0A 1SWUA 3F9DA 3FDCA 1CBRA 2AMMX 5LJDA 1WUBA 1QFTA 2N93A 1JYJA 1KL4A 4ORUA 3ZW2A 1LUQA 2OYBO 3RDXA 4ZGFA 1L6MA 2QO4A 5KICA 4TKJA 3TF6A 3ZUIA 3U0DA 2E4JA 1SWCA 2OVAA 5D8JA 5D45A 5AQ6A 3U03A 4Z27A 1TW4A 5BVQA 4ALBA 5B29A 4O4SA 5HCCC 1GKAB 1PEEA 1SWKA 1JJXA 4TNNA 4TKHA 1B0OA 2K62A 4QZTA 2LBVA 1HN2A 1AELA 1QY1A 2OF8A 1SMPI 3PK2A 3AKNA 2WEXA 3NBXX 2VFCA 2POAA 1A18A 1BJ7A 1VPRA 1Z24A 4FBOA 4HFOA 4YFQA 3RKGA 1Y53X 4AZRA 5F6BA 4BX5B 1SWJA 2UZ2A 1YP7A 2IZLB 1VWOB 3HK1A 4ZH9A 3WYQA 1CJ5A 4U8UM 2OVDA 1VWBB 4LQZA 4NP1A 1VWHB 1GT1A 2A3FX 3N91A 3FLLA 3GE2A 3O2YA 2RCTA 1GX9A 3VGWA 3WVMA 1JJJA 1SY2A 1EPBA 1SXXA 2W2FA 2WEWA 3D4RA 4Z2OA 2ACPX 2RTIB 3EW2A 4XMHA 4LZVA 1LFOA 2OL8O 5L8IA 1Y9LA 4MVEA 1SXWA 2Y32A 1H91A 1KL3A 3C78X 3OBLA 5B5FA 1STRB 4GGRA 4MVIA 1ICMA 3ELZA 4I3DA 4QYNA 3MM0A 3VE2A 1O1UA 1QQSA 4NLJA 2MJIA 4ZHGA 1EIOA 5IXGA 2KT4B 4XMCA 1SWLA 1PBOA 1QY0A 1N4JA 1E06A 2NNEA 4NV8A 5EDBA 4CPEA 3GAQA 3CBSA 3TGCA 3MX7A 3PH5A 2CAMA 4YCHA 3CMPA 1FDQA 2CZTA 3C76X 2A2UA 3P6EA 1FE3A 2JMBA 3PECA 3KVNA 3MG5A 2L67A 1VWDB 1OEEA 2WPUA 3FYFA 1OPBA 5AJCA 3B2KA 2KD2A 1QWDA 3T1DA 1ML7A 1Y55X 2OY5O 3VG2A 3T2XA 4I95A 2NP1A 4NLIA 1SRJA 4LKTA 4KCAA 4MVKA 1S44A 4ON1A 4TJZA 3RDUA 1JBHA 1YWDA 2OY8A 1BM5A 1GT3A 1K3BA 1RSTB 1HY2A 1NC9A 2HYSA 1QFVA 3Q6LA 5DPQA 5HA1A 4RUNA 3T6FA 3NX1A 4U46A 2GJ5A 5CSEA 2AKQA 3MVFA 1RLBE 2WWPA 4BBOA 1VWCB 1EUOA 1ACDA 1X8QA 2X55A 4ORYA 3DSZA 4CPHB 5L8NA 2X56A 3WZOA 4TLJA 2RTNB 3ZW0A 2A13A 1JQPA 2X4MA 2A5BA 5IO5A 3NQ3A 1A2DA 1LELA 1FEMA 1LCWA 2X8TA 3D96A 3ZI8A 2RTGB 1W4TA 1IKJA 1VWFB 4IB8A 3AEHA 4Z2VA 1D3SA 2RTDB 4DQ3A 3D9WA 4I9RA 1GX8A 1OEJA 2F09A 5C0NA 3UEUA 2HLVA 3BDRA 4KH8A 4IMNA 4YFRA 5LJEA 1JMZA 3C77X 3BY0A 1ZNEA 1KT7A 2LB6A 3ZW1B 2GC9A 2ACOA 3EYCA 5KHPA 2QCBA 2AH7X 4A8ZA 1UREA 4KT5A 2AL0X 2MF6A 1HQQA 3E3CA 4FBVA 3JSQA 3F8AA 4BX6A 4B55A 4YFPA 4I6SA 3SZIA 2FS7A 5EZ2A 2GH7A 1KT4A 1ALBA 1UYNX 1UZ2X 2OVSA 2RN4A 5EPQA 2FKGA 5F58A 3K3LA 4CPFA 1X71A 5B5GA 1SXYA 1T8VA 1N9MA 2FWVA 3KFIA 1IJ8A 2OFAA 2AVIA 1KGLA 2Q9SA 1MM9A 1PTSA 3CQRA 3QKGA 2F01A 2IFBA 4N7DA 3VG6A 4O3XB 4IB7A 3B2HA 3OD9A 4MEEA 3VG3A 1P6PA 4OMXA 1SRHA 2CM4A 2RTOB 4XMGA 3BRNA 1I05A 2EU7X 4IRWA 4WFVA 1ZNGA 2W2BA 5HTDA 3BU1A 1LDOA 1FJ1E 3VU1A 2OL7A 1MX7A 1VWQB 2BC3A 1SWAA 3SAOA 4Z2PA 2NNQA 1OBPA 2RTEB 4GNWA 1TOWA 2WR6A 4INNA 2RCQA 4ZH6A 3BX7A 1ADLA 1ERBA 2RTCB 3APVA 4HPCA 3BU9A 2HNXA 1NDJA 3B2LA 4GKCA 1SY3A 3RY1A 1KT6A 4AZNA 1G74A 1LKEA 2PI3O 3WJDA 4N7CA 4ORXA 3EM0A 2IZIA 2RTLA 4UU2A 5DG4A 1BWYA 2RTRB 3KFFA 1VWNB 1SA8A 2Q2PA 3NPOA 2WSJA 4FQBB 5IO7A 2OL6O 3EW1A 4LKPA 3B2IA 4QRLA 1A57A 1KQXA 1SWGA 1XKIA 4NW4A 5K68A 4ZHDA 1QY2A 1TOUA 1DZPA 4GK9A 3ZZVA 2OZQA 3S60A 2Y3EA 4XMDA 2CZUA 4YVBA 5L8OA 4OS8A 5LJCA 4ZFXA 2AT5X 4CPIA 3HPEA 4AZQA 3PQSA 1IKEA 3PEDA 1CRBA 1PMPA 1SWDA 4BQUA 3OJYC 2R56A 1JZUA 1E00A 2RTMA 4MISA 3HWFA 3O22A 1KT3A 1YWCA 2WQAE 1KFFA 1R0UA 1Y9TA 3EC5A 5CYBA 3UEVA 1LIDA 2X45A 5H9AA 2GTLN 4L1NA 3IFBA 3UAQA 1FELA 2Z4HA 4GJVA 4HPDA 4EQAC 5BVTA 4DNEA 1MX8A 2JU7A 3P6DA 4C5PA 1AB0A 3B2JA 1PBYA 3FENA 4IB9A 2FKJA 1VYOA 4IBAA 2ANSA 3EBKA 3FA7A 1ZNKA 4CDDA 5LJBA 3WZPA 1AQBA 1FTPA 4JO6A 2JW1A 5BVSA 2OY7A 3STKA 5FENA 3TGAA 1DFVA 4I3CA 4Y5DA 3RDQA 5K06A 2AT8X 3FR2A 1VWPB 5HZ8A 2M4LA 1BSOA 3P6GA 4EKVA 3SZHA 3NQKA 1ZNDA 4ZJ0A 2XSTA 3KFHA 4OKAA 3SLTA 3WXQA 4CDCA 4YCEA 1X8UA 3STMX 1OBQA 2NNDA 5B27A 4PJ2A 4ZHHA 3ZW0B 2JOZA 1MOYA 3VHIA 3RWXA 2VDFA 1BBPA 4PSQA 2FTBA 4ALOA 1N43A 3FA6A 1HBPA 1HQPA 2BS6A 1B4MA 3RE6A 2IZCB 2ZAIA 1PM1X 1DF8A 5KIDA 2F73A 2IZDB 4BVMA 3BSZE 2RQ0A 3P6CA 3U9PC 1LIFA 3Q34A 1VWKB 1RXHA 4A1YA 2IZKA 4XMFA 3RBYA 1NGLA 2MWHA 3STNA 3RE5A 4GGTA 4LZUA 2HMBA 3WBGA 4JHQA 1BRPA 1SWOA 3WYPA 1GXAA 1IFCA 1LNMA 4EFGA 3D95A 3HWGA 2GTLM 1BSYA 4GDZA 1KZXA 1Y0GA 4CV7A 1ZNHA 1RAVA 1SLEB 2Q2MA 4ODDA 1B56A 5AJBA 4AZPA 1SLDB 4M7MA 1N7YA 1X8PA 4O4XA 3FEPA 4QGVA 5FQ8E 4QZUA 1EXSA 2IZGB 3JQOA 2FHNX 3P6FA 3LTWA 4IAWA 5EEDA 4ES7A 1YIVA 2RTJA 5HZQA 2OFRX 1SWQA 4WBKA 1HMRA 1OPAA 2KW1A 1I4UA 2FLJA 2O62A 5B2AO 3V8UA 3VG7A 3FMZA 4AZOA 3T2WA 4COTA 3RDSA 3VHHA 1DC9A 3NP1A 2JU3A 4Z28A 1CBQA 4GZVA 5LKFA 3FW4A 4ARHA 1NQNA 1VWEB 4IMOA 3H3IA 4NNSA 2Y3FA 1YUPA 4U3QA 5K67A 2C4IA 3SOTA 1IIUA 1CBSA 4CDEA 2BHVA 5HWZA 2IZEB 1ZRYA 4I3BA 4BX6B 3HOLA
chains in the Genus database with same CATH topology
1IFBA 3WOVA 2W2AA 3UEWA 5HZ6A 3TGBA 4QYPA 4ID2A 1DF3A 2JU8A 1KT5A 5LJHA 4CSBA 2X8SA 1HMSA 4KIIA 3UEXA 3G7XA 3S5VA 5FAZA 1TVQA 5HA0A 2X46A 2Q39A 1X8OA 3FIQA 1HMTA 1JV4A 1QG5A 3P02A 4OMWA 5D48A 4EEJA 4GH7A 1KZWA 3ZUOA 4QGXA 3FEKA 5F6ZA 3VPJE 2R73A 1EQDA 2ZAGA 3CBCA 2CBRA 3APWA 3AKMA 2PY1A 1VYFA 1LICA 3FR5A 5EDCA 4A1HA 4ZGUA 2ALLX 2G79A 1YWAA 2LKKA 2MO5A 3FW5A 2RD7C 4R0BA 5H9NA 1FENA 1N0SA 4IABA 2BT9A 4Y0QA 1EI5A 4OS3A 2XKLA 3F6ZB 5H8TA 4JGLA 4YGHA 4YH0A 2QOSC 3PP6A 1E5PA 4ZCBA 4ZHFA 1KOIA 3CWKA 2LBAA 3CQNA 4HPAA 1JIWI 4A60A 3O19A 1X8NA 4CK4A 2MHDA 1GT5A 1U17A 4QGWA 5H9KA 4HWMA 4M6SA 2ASNX 1XCAA 2LA7A 5F7GA 2L5PA 5LJGA 2A0AA 3RSWA 3MBTA 2JN3A 1U18A 3S5XA 4BOEA 3BS2A 2L68A 4NNTA 4YGZA 2X8FA 3VG5A 1BSQA 1SXUA 3WJBA 2LFOA 4NYRA 4EDEA 3BX8A 5JR8A 3CR6A 3P24A 2GTLO 1E02A 3OE3A 1S7DA 1TXLA 4YKMA 3HTYA 5HCEC 3IA8A 2CM9A 5HTEA 4GE1A 1QABE 3KQ0A 1VYGA 5D4AA 1GM6A 3HOEA 2Z4IA 1EIIA 1SY0A 5F1EA 1YP6A 5BYPA 1KXOA 3APXA 1DZJA 2P8GA 3JS1A 4NYQA 2YMSA 1NP4A 5CE4A 4D6BA 4Y0RA 1GKAA 5HZ5A 1YWBA 3EBWA 2HZRA 5AEOA 1OBUA 4FBRA 4GETA 2R74A 5HZ9A 4O3ZA 1BRQA 4ML7B 2OFMX 3FA8A 4O49A 4D6AA 1X89A 1DZMA 4O3WA 3FR4A 2AT6X 3I0AA 3NR3A 5FQ7E 2AT3X 4Y0PA 4TKBA 4EXZA 2FRSA 1NP1A 5HCDC 1GGLA 4KC8A 1RBPA 4O3YA 4QNIA 1JYDA 5LJKA 3WJGA 5HAEA 3WJEA 4K19A 3LHNA 1CBIA 1I06A 1ICNA 4YGGA 4FGIB 2L9CA 2K23A 1GT4A 2DM5A 4MVLA 4ORRA 4ZHCA 1G7NA 1BLRA 4I9SA 4O4OA 1MUPA 4YMYA 4WHIA 1ZNLA 1S2PA 2MM3A 3VG4A 1O8VA 4DQ4A 4XMEA 2FR2A 4YDBA 4IAXA 2G7BA 4TQ2A 1G85A 3PQUA 3RZYA 3P6HA 3NQ9A 2WUTA 4GRJA 2QO6A 4IB6A 4KC7A 3L4RA 3ZWEA 4O4UA 1ERXA 3FA9A 5IO6A 4RUUA 4Y0SA 2FS6A 3EMMA 1MVGA 3FELA 3ELXA 4AW8A 1DV9A 4YBUA 3BLGA 1D2UA 1EPAA 1T0VA 2YG2A 2WQ9A 4AZMA 4AYHA 2A2GA 2AT0X 4GNYA 3D97A 1O1VA 4ORWA 3TZSA 4YBPA 1DZKA 3WJCA 4ORSA 1OEKA 2QMIA 4YKOA 1G5WA 5LKEA 1KQWA 4YDAA 2BLGA 3I17A 4ZR2A 3PPTA 2QM9A 4UU3A 1LF7A 1I04A 5H9LA 1LPJA 4GU8A 3DTQA 4QAEA 2QO5A 3VE1A 5FQ6E 3HWDA 2HZQA 4QQ1A 2KTSA 3KZAA 4MIRA 1BEBA 3WJFA 3PH6A 2KTDA 5D47A 1HBQA 1AVGI 3S26A 1LIBA 4U8UN 2RA6A 4O9SA 2GTFX 2CBSA 3HWEA 4U8UO 5EEEA 2FR3A 2G78A 1EW3A 1T68X 4U9CA 1SY1A 3NX2A 3ZW1A 3NADA 1U0XA 5HBSA 2Q4NA 5FFHA 3APUA 1LIEA 2FT9A 1A3YA 3KFGA 3ZQ3A 1B8EA 4HPBA 2BS5A 1IW2A 1MDCA 3LV4A 4L3RA 1EALA 4WFUA 2OVEA 4OS0A 3F9DA 1CBRA 2AMMX 5LJDA 1QFTA 2N93A 1JYJA 4ORUA 3ZW2A 4ZGFA 1L6MA 2QO4A 5KICA 4TKJA 3TF6A 3ZUIA 3U0DA 2E4JA 2OVAA 5D8JA 5D45A 5AQ6A 3U03A 1TW4A 5BVQA 4ALBA 5B29A 4O4SA 5HCCC 1GKAB 1PEEA 1JJXA 4TNNA 4TKHA 1B0OA 2K62A 4QZTA 2LBVA 1HN2A 1AELA 1QY1A 1SMPI 3AKNA 2WEXA 3NBXX 2POAA 1A18A 1BJ7A 1VPRA 1Z24A 4FBOA 4HFOA 4YFQA 3RKGA 4AZRA 5F6BA 1YP7A 4ZH9A 3HK1A 1CJ5A 4U8UM 2OVDA 4NP1A 4LQZA 1GT1A 2A3FX 3N91A 3FLLA 3GE2A 3O2YA 2RCTA 1GX9A 3WVMA 1JJJA 1SY2A 1EPBA 1SXXA 2W2FA 2WEWA 3D4RA 2ACPX 4XMHA 4LZVA 1LFOA 5L8IA 1Y9LA 4MVEA 1SXWA 1H91A 3C78X 3OBLA 4MVIA 1ICMA 3ELZA 4I3DA 4QYNA 3VE2A 1O1UA 1QQSA 4NLJA 2MJIA 4ZHGA 1EIOA 2KT4B 4XMCA 1PBOA 1QY0A 3TGCA 1E06A 2NNEA 5EDBA 3GAQA 3CBSA 3MX7A 3PH5A 4YCHA 3CMPA 1FDQA 2CZTA 3C76X 2A2UA 3P6EA 1FE3A 2JMBA 3PECA 2L67A 1OEEA 3FYFA 1OPBA 5AJCA 3B2KA 2KD2A 1QWDA 3T1DA 1ML7A 3VG2A 4I95A 2NP1A 4NLIA 4LKTA 4KCAA 4MVKA 1S44A 4ON1A 4TJZA 1JBHA 1YWDA 1BM5A 1GT3A 2HYSA 5DPQA 1QFVA 3Q6LA 5HA1A 4RUNA 3NX1A 2GJ5A 2AKQA 3MVFA 1RLBE 2WWPA 1EUOA 1ACDA 1X8QA 4ORYA 5L8NA 3DSZA 4TLJA 3ZW0A 2A13A 5IO5A 3NQ3A 1A2DA 3ZI8A 1FEMA 2X8TA 3D96A 1IKJA 4IB8A 1D3SA 4DQ3A 4I9RA 1GX8A 1OEJA 2F09A 5C0NA 3UEUA 2HLVA 3BDRA 4KH8A 4IMNA 4YFRA 5LJEA 3C77X 3BY0A 1ZNEA 1KT7A 2LB6A 3ZW1B 2GC9A 2ACOA 3EYCA 5KHPA 2AH7X 4A8ZA 1UREA 4KT5A 2AL0X 3E3CA 4FBVA 3JSQA 3F8AA 4YFPA 4I6SA 2FS7A 5EZ2A 1KT4A 1ALBA 1UZ2X 2RN4A 2OVSA 5EPQA 5F58A 3K3LA 1X71A 1SXYA 1T8VA 2FWVA 3KFIA 1KGLA 2Q9SA 3QKGA 3CQRA 4N7DA 2IFBA 3VG6A 4O3XB 4IB7A 3B2HA 3OD9A 3VG3A 1P6PA 4OMXA 2CM4A 4XMGA 3BRNA 1I05A 2EU7X 4WFVA 1ZNGA 2W2BA 5HTDA 3BU1A 3VU1A 1MX7A 3SAOA 2NNQA 1OBPA 4GNWA 4INNA 1TOWA 2WR6A 2RCQA 4ZH6A 3BX7A 1ADLA 1ERBA 3APVA 4HPCA 3BU9A 2HNXA 3B2LA 4GKCA 1SY3A 1KT6A 4AZNA 1G74A 1LKEA 3WJDA 4N7CA 4ORXA 3EM0A 4UU2A 5DG4A 1BWYA 3KFFA 3NPOA 2Q2PA 1SA8A 5IO7A 2WSJA 4FQBB 4LKPA 3B2IA 4QRLA 1A57A 1KQXA 1XKIA 4NW4A 4ZHDA 1QY2A 1TOUA 1DZPA 4GK9A 3ZZVA 2OZQA 3S60A 4XMDA 2CZUA 5L8OA 4OS8A 5LJCA 4ZFXA 2AT5X 4AZQA 3PQSA 1IKEA 3PEDA 1CRBA 1PMPA 4BQUA 3OJYC 2R56A 1JZUA 1E00A 4MISA 3HWFA 3O22A 1KT3A 1YWCA 2WQAE 1R0UA 1Y9TA 5CYBA 3UEVA 1LIDA 2X45A 5H9AA 2GTLN 4L1NA 3IFBA 3UAQA 1FELA 2Z4HA 4HPDA 4EQAC 5BVTA 1MX8A 2JU7A 3P6DA 1AB0A 3B2JA 3FENA 4IB9A 4IBAA 2ANSA 3EBKA 3FA7A 1ZNKA 5LJBA 1AQBA 1FTPA 2JW1A 5BVSA 3STKA 5FENA 3TGAA 1DFVA 4I3CA 5K06A 2AT8X 3FR2A 5HZ8A 2M4LA 1BSOA 3P6GA 3NQKA 1ZNDA 4ZJ0A 2XSTA 3KFHA 3WXQA 4YCEA 1X8UA 3STMX 1OBQA 2NNDA 5B27A 4PJ2A 3ZW0B 2JOZA 3RWXA 1BBPA 4PSQA 2FTBA 4ALOA 1B4MA 3FA6A 1HBPA 1HQPA 2BS6A 2ZAIA 1PM1X 2F73A 4BVMA 3BSZE 2RQ0A 3P6CA 3U9PC 1LIFA 4A1YA 4XMFA 3RBYA 1NGLA 2MWHA 3STNA 3WBGA 4LZUA 2HMBA 4EFGA 4ZHHA 1BRPA 1GXAA 1IFCA 1LNMA 1KZXA 3D95A 3HWGA 2GTLM 1BSYA 4GDZA 4CV7A 1ZNHA 4ODDA 2Q2MA 4AZPA 1B56A 5AJBA 5KIDA 4M7MA 1X8PA 4O4XA 4QGVA 3FEPA 5FQ8E 4QZUA 1EXSA 4IAWA 3JQOA 3P6FA 5EEDA 4ES7A 1YIVA 5HZQA 2OFRX 4WBKA 1HMRA 1OPAA 2KW1A 1I4UA 2FLJA 2O62A 3V8UA 3VG7A 4AZOA 3FMZA 4COTA 1DC9A 3NP1A 2JU3A 1CBQA 4GZVA 5LKFA 3FW4A 4ARHA 4NNSA 4IMOA 3H3IA 1YUPA 4U3QA 3SOTA 1IIUA 1CBSA 5HWZA 2BHVA 1ZRYA 4I3BA 3HOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFB A;  2W2A A;  3UEW A;  5HZ6 A;  3TGB A;  4QYP A;  1DF3 A;  2JU8 A;  1KT5 A;  5LJH A;  1HMS A;  4KII A;  3UEX A;  3G7X A;  5FAZ A;  1TVQ A;  5HA0 A;  2X46 A;  2Q39 A;  1X8O A;  3FIQ A;  1HMT A;  1JV4 A;  1QG5 A;  4OMW A;  5D48 A;  4EEJ A;  4GH7 A;  1KZW A;  3ZUO A;  4QGX A;  3FEK A;  5F6Z A;  2R73 A;  1EQD A;  3CBC A;  2CBR A;  3APW A;  3AKM A;  2PY1 A;  1VYF A;  1LIC A;  3FR5 A;  5EDC A;  4A1H A;  4ZGU A;  2ALL X;  2G79 A;  1YWA A;  2LKK A;  2MO5 A;  3FW5 A;  2RD7 C;  4R0B A;  5H9N A;  1FEN A;  1N0S A;  4Y0Q A;  4OS3 A;  2XKL A;  5H8T A;  4YGH A;  4YH0 A;  2QOS C;  3PP6 A;  1E5P A;  4ZCB A;  4ZHF A;  1KOI A;  3CWK A;  2LBA A;  3CQN A;  4HPA A;  4A60 A;  3O19 A;  1X8N A;  4CK4 A;  1GT5 A;  1U17 A;  4QGW A;  5H9K A;  4M6S A;  2ASN X;  1XCA A;  5F7G A;  2L5P A;  5LJG A;  2A0A A;  3RSW A;  3MBT A;  2JN3 A;  1U18 A;  4BOE A;  3BS2 A;  2L68 A;  4NNT A;  4YGZ A;  3VG5 A;  1BSQ A;  1SXU A;  3WJB A;  2LFO A;  4NYR A;  4EDE A;  3BX8 A;  5JR8 A;  3CR6 A;  1E02 A;  1S7D A;  1TXL A;  4YKM A;  5HCE C;  3IA8 A;  2CM9 A;  5HTE A;  4GE1 A;  1QAB E;  3KQ0 A;  1VYG A;  5D4A A;  1GM6 A;  1EII A;  1SY0 A;  5F1E A;  1YP6 A;  1KXO A;  3APX A;  1DZJ A;  2P8G A;  3JS1 A;  4NYQ A;  1NP4 A;  5CE4 A;  4D6B A;  4Y0R A;  1GKA A;  5HZ5 A;  1YWB A;  3EBW A;  2HZR A;  1OBU A;  4GET A;  2R74 A;  5HZ9 A;  1BRQ A;  2OFM X;  3FA8 A;  4D6A A;  1X89 A;  1DZM A;  3FR4 A;  2AT6 X;  3I0A A;  3NR3 A;  2AT3 X;  4Y0P A;  4TKB A;  4EXZ A;  2FRS A;  1NP1 A;  5HCD C;  1GGL A;  1RBP A;  5LJK A;  1JYD A;  3WJG A;  5HAE A;  3WJE A;  4K19 A;  1CBI A;  1I06 A;  1ICN A;  4YGG A;  2L9C A;  2K23 A;  1GT4 A;  2DM5 A;  4MVL A;  4ORR A;  4ZHC A;  1G7N A;  1BLR A;  4I9S A;  1MUP A;  4YMY A;  1ZNL A;  1S2P A;  2MM3 A;  3VG4 A;  1O8V A;  4DQ4 A;  4XME A;  2FR2 A;  4YDB A;  4IAX A;  2G7B A;  4TQ2 A;  1G85 A;  3RZY A;  3P6H A;  3NQ9 A;  2WUT A;  4GRJ A;  2QO6 A;  4IB6 A;  3L4R A;  1ERX A;  3FA9 A;  5IO6 A;  4RUU A;  4Y0S A;  2FS6 A;  3EMM A;  1MVG A;  3FEL A;  3ELX A;  4AW8 A;  1DV9 A;  4YBU A;  3BLG A;  1D2U A;  1EPA A;  1T0V A;  2YG2 A;  2WQ9 A;  4AZM A;  4AYH A;  2A2G A;  2AT0 X;  4GNY A;  3D97 A;  1O1V A;  4ORW A;  3TZS A;  4YBP A;  1DZK A;  3WJC A;  4ORS A;  1OEK A;  4YKO A;  1G5W A;  5LKE A;  1KQW A;  4YDA A;  2BLG A;  3I17 A;  4ZR2 A;  3PPT A;  2QM9 A;  4UU3 A;  1LF7 A;  1I04 A;  5H9L A;  1LPJ A;  3DTQ A;  4QAE A;  2QO5 A;  3HWD A;  2HZQ A;  3KZA A;  1BEB A;  3WJF A;  3PH6 A;  2KTD A;  5D47 A;  1HBQ A;  1AVG I;  3S26 A;  1LIB A;  2RA6 A;  4O9S A;  2GTF X;  2CBS A;  3HWE A;  5EEE A;  2FR3 A;  2G78 A;  1EW3 A;  1T68 X;  1SY1 A;  3NX2 A;  3NAD A;  1U0X A;  5HBS A;  2Q4N A;  5FFH A;  3APU A;  1LIE A;  2FT9 A;  1A3Y A;  3KFG A;  3ZQ3 A;  1B8E A;  4HPB A;  1IW2 A;  1MDC A;  1EAL A;  4WFU A;  2OVE A;  4OS0 A;  3F9D A;  1CBR A;  2AMM X;  5LJD A;  1QFT A;  2N93 A;  1JYJ A;  4ORU A;  1L6M A;  2QO4 A;  5KIC A;  4TKJ A;  3TF6 A;  3ZUI A;  3U0D A;  2E4J A;  2OVA A;  5D8J A;  5D45 A;  5AQ6 A;  3U03 A;  1TW4 A;  5BVQ A;  4ALB A;  5B29 A;  5HCC C;  1GKA B;  1PEE A;  1JJX A;  4TNN A;  4TKH A;  1B0O A;  2K62 A;  4QZT A;  2LBV A;  1HN2 A;  1AEL A;  1QY1 A;  3AKN A;  2WEX A;  2POA A;  1A18 A;  1BJ7 A;  1VPR A;  1Z24 A;  4HFO A;  4YFQ A;  4AZR A;  5F6B A;  1YP7 A;  4ZH9 A;  3HK1 A;  1CJ5 A;  2OVD A;  4NP1 A;  1GT1 A;  2A3F X;  3FLL A;  3WVM A;  3O2Y A;  2RCT A;  1GX9 A;  1JJJ A;  1SY2 A;  1EPB A;  1SXX A;  2W2F A;  2WEW A;  2ACP X;  4XMH A;  4LZV A;  1LFO A;  5L8I A;  1SXW A;  1H91 A;  3C78 X;  4MVI A;  1ICM A;  3ELZ A;  4I3D A;  4QYN A;  1O1U A;  1QQS A;  4NLJ A;  2MJI A;  4ZHG A;  1EIO A;  2KT4 B;  4XMC A;  1PBO A;  1QY0 A;  3TGC A;  1E06 A;  2NNE A;  5EDB A;  3GAQ A;  3CBS A;  3PH5 A;  4YCH A;  3CMP A;  1FDQ A;  2CZT A;  3C76 X;  2A2U A;  3P6E A;  1FE3 A;  3PEC A;  2L67 A;  1OEE A;  1OPB A;  3B2K A;  3T1D A;  1QWD A;  1ML7 A;  3VG2 A;  2NP1 A;  4NLI A;  4LKT A;  4MVK A;  1S44 A;  4TJZ A;  1JBH A;  1YWD A;  1BM5 A;  1GT3 A;  2HYS A;  5DPQ A;  1QFV A;  3Q6L A;  5HA1 A;  4RUN A;  3NX1 A;  2GJ5 A;  2AKQ A;  3MVF A;  1RLB E;  2WWP A;  1EUO A;  1ACD A;  1X8Q A;  4ORY A;  5L8N A;  3DSZ A;  4TLJ A;  2A13 A;  5IO5 A;  3NQ3 A;  1A2D A;  1FEM A;  3D96 A;  1IKJ A;  4IB8 A;  1D3S A;  4DQ3 A;  4I9R A;  1GX8 A;  1OEJ A;  5C0N A;  3UEU A;  2HLV A;  3BDR A;  4YFR A;  4IMN A;  5LJE A;  3C77 X;  3BY0 A;  1ZNE A;  1KT7 A;  2LB6 A;  5KHP A;  2GC9 A;  2ACO A;  3EYC A;  2AH7 X;  4A8Z A;  1URE A;  2AL0 X;  3JSQ A;  3F8A A;  4YFP A;  2FS7 A;  5EZ2 A;  1KT4 A;  1ALB A;  1UZ2 X;  5EPQ A;  5F58 A;  3K3L A;  1X71 A;  1SXY A;  1T8V A;  2FWV A;  3KFI A;  1KGL A;  2Q9S A;  3QKG A;  3CQR A;  4N7D A;  2IFB A;  3VG6 A;  4IB7 A;  3B2H A;  3VG3 A;  1P6P A;  4OMX A;  2CM4 A;  4XMG A;  3BRN A;  1I05 A;  2EU7 X;  4WFV A;  1ZNG A;  2W2B A;  5HTD A;  3BU1 A;  1MX7 A;  3SAO A;  2NNQ A;  1OBP A;  4GNW A;  1TOW A;  2WR6 A;  2RCQ A;  4ZH6 A;  3BX7 A;  1ADL A;  1ERB A;  3APV A;  4HPC A;  3BU9 A;  2HNX A;  3B2L A;  4GKC A;  1SY3 A;  1KT6 A;  4AZN A;  1G74 A;  1LKE A;  3WJD A;  4N7C A;  4ORX A;  3EM0 A;  4UU2 A;  5DG4 A;  1BWY A;  3KFF A;  3NPO A;  2Q2P A;  1SA8 A;  5IO7 A;  2WSJ A;  4LKP A;  3B2I A;  1A57 A;  1KQX A;  1XKI A;  4ZHD A;  1QY2 A;  1TOU A;  1DZP A;  2OZQ A;  4XMD A;  2CZU A;  5L8O A;  4OS8 A;  5LJC A;  4ZFX A;  2AT5 X;  4AZQ A;  1IKE A;  3PED A;  1CRB A;  1PMP A;  4BQU A;  3OJY C;  2R56 A;  1JZU A;  1E00 A;  3HWF A;  3O22 A;  1KT3 A;  1YWC A;  2WQA E;  1R0U A;  3UEV A;  1LID A;  2X45 A;  5H9A A;  3IFB A;  1FEL A;  4HPD A;  5BVT A;  1MX8 A;  2JU7 A;  3P6D A;  1AB0 A;  3B2J A;  3FEN A;  4IB9 A;  4IBA A;  2ANS A;  3EBK A;  3FA7 A;  1ZNK A;  5LJB A;  1AQB A;  1FTP A;  5BVS A;  3STK A;  5FEN A;  3TGA A;  1DFV A;  4I3C A;  5K06 A;  2AT8 X;  3FR2 A;  5HZ8 A;  1BSO A;  3P6G A;  1ZND A;  4ZJ0 A;  2XST A;  3KFH A;  3WXQ A;  4YCE A;  1X8U A;  3STM X;  1OBQ A;  2NND A;  5B27 A;  2JOZ A;  1BBP A;  4PSQ A;  2FTB A;  4ALO A;  1B4M A;  3FA6 A;  1HBP A;  1HQP A;  1PM1 X;  2F73 A;  4BVM A;  3BSZ E;  2RQ0 A;  3P6C A;  3U9P C;  1LIF A;  4A1Y A;  4XMF A;  3STN A;  1NGL A;  3WBG A;  4LZU A;  2HMB A;  4EFG A;  4ZHH A;  1BRP A;  1GXA A;  1IFC A;  1LNM A;  1KZX A;  3D95 A;  3HWG A;  1BSY A;  1ZNH A;  4ODD A;  2Q2M A;  4AZP A;  1B56 A;  5KID A;  4M7M A;  1X8P A;  4QGV A;  3FEP A;  4QZU A;  1EXS A;  4IAW A;  3P6F A;  5EED A;  4ES7 A;  1YIV A;  5HZQ A;  2OFR X;  4WBK A;  1HMR A;  1OPA A;  2O62 A;  1I4U A;  2FLJ A;  3VG7 A;  4AZO A;  3FMZ A;  1DC9 A;  3NP1 A;  2JU3 A;  1CBQ A;  5LKF A;  3FW4 A;  4ARH A;  4NNS A;  4IMO A;  1YUP A;  1IIU A;  1CBS A;  5HWZ A;  1ZRY A;  4I3B A; 
#chains in the Genus database with same CATH topology
 1IFB A;  3WOV A;  2W2A A;  2X34 A;  1I9H A;  3UEW A;  5HZ6 A;  1AVE A;  1W5R A;  4ID2 A;  4QYP A;  3TGB A;  1DF3 A;  5B3M O;  2JU8 A;  1KT5 A;  1VWG B;  1LCV A;  1Y52 X;  5LJH A;  4CSB A;  2X8S A;  1LCZ A;  1HMS A;  4KII A;  3UEX A;  3G7X A;  3S5V A;  5FAZ A;  1TVQ A;  5HA0 A;  2X46 A;  2Q39 A;  1X8O A;  3FIQ A;  1HMT A;  1JV4 A;  1QG5 A;  2IZF B;  3P02 A;  4OMW A;  5D48 A;  2QOM A;  4GH7 A;  3ZUO A;  4QGX A;  4EEJ A;  1KZW A;  3FEK A;  5F6Z A;  4OEM A;  2G5L A;  3SZJ A;  3FID A;  3VPJ E;  4BX7 A;  2R73 A;  1EQD A;  2ZAG A;  1HXL A;  3CBC A;  1SRF A;  1JJU A;  2CBR A;  3APW A;  1MK5 A;  2RTK A;  3AKM A;  2FHL A;  2C1Q A;  1VYF A;  2PY1 A;  1LIC A;  3FR5 A;  5EDC A;  4A1H A;  4ZGU A;  2ALL X;  2G79 A;  1YWA A;  2LKK A;  2MO5 A;  3FW5 A;  2RD7 C;  4R0B A;  5H9N A;  1FEN A;  1N0S A;  4IAB A;  2BT9 A;  4Y0Q A;  1EI5 A;  1K24 A;  4OS3 A;  2XKL A;  1RXK A;  3F6Z B;  4OEL A;  5H8T A;  4JGL A;  4YGH A;  4YH0 A;  2HKD A;  1SLG B;  3RY2 A;  3SLO A;  1SWB A;  2QOS C;  1E5P A;  3PP6 A;  4I60 A;  4ZCB A;  4ZHF A;  1KOI A;  3CWK A;  2LBA A;  3CQN A;  4HPA A;  2UYW A;  2FGS A;  1JIW I;  4A60 A;  3O19 A;  1SRE A;  1X8N A;  4CK4 A;  2MHD A;  1VWA B;  1GT5 A;  1U17 A;  2OF9 A;  4QGW A;  5H9K A;  4HWM A;  4M6S A;  5IRW A;  2ASN X;  1XCA A;  4BGF A;  2LA7 A;  5F7G A;  2L5P A;  2A5C A;  2IZA A;  5LJG A;  2A0A A;  3RSW A;  3MBT A;  2JN3 A;  1SWH A;  1U18 A;  3S5X A;  1SWE A;  3BS2 A;  2L68 A;  4NNT A;  4YGZ A;  2X8F A;  3VG5 A;  4BOE A;  1BSQ A;  3QQ2 A;  1SXU A;  2VFB A;  2LFO A;  4NYR A;  3WJB A;  3X00 A;  1VWL B;  4EDE A;  3BX8 A;  5JR8 A;  3CR6 A;  3P24 A;  2GTL O;  1E02 A;  3OE3 A;  1S7D A;  1TXL A;  4YKM A;  3HTY A;  4GGZ A;  5HCE C;  3IA8 A;  2CM9 A;  5HTE A;  4GE1 A;  4GDA A;  1QAB E;  2RTB B;  1VYG A;  3KQ0 A;  1GM6 A;  1SWR A;  3HOE A;  2Z4I A;  5D4A A;  3SLJ A;  1EII A;  1SWS A;  1SY0 A;  2AF5 A;  5F1E A;  4BJ8 A;  4NV7 A;  1YP6 A;  5BYP A;  1KXO A;  1SRG A;  3APX A;  1DZJ A;  2P8G A;  3JS1 A;  4NYQ A;  2YMS A;  1NP4 A;  5CE4 A;  4D6B A;  2ZSC A;  4Y0R A;  1GKA A;  5HZ5 A;  1YWB A;  3CKF A;  3EBW A;  2I5V O;  2HZR A;  5AEO A;  1OBU A;  4FBR A;  4GET A;  2R74 A;  2IZJ A;  3WZQ A;  4O3Z A;  5HZ9 A;  2JGS A;  3RDM A;  1BRQ A;  4ML7 B;  2OFM X;  3FA8 A;  4O49 A;  4D6A A;  1X89 A;  4JNJ A;  1DZM A;  5JD2 A;  4GJS A;  4O3W A;  3FR4 A;  1WBI A;  2AT6 X;  3I0A A;  3NR3 A;  4Y59 A;  5CHK A;  5FQ7 E;  2AT3 X;  4Y0P A;  4BX5 A;  4TKB A;  4EXZ A;  2FRS A;  1NP1 A;  5HCD C;  1GGL A;  4KC8 A;  1RBP A;  4O3Y A;  4QNI A;  1JYD A;  5LJK A;  1VWR B;  3WJG A;  3RDO A;  1JMX A;  3WJE A;  4K19 A;  5HAE A;  2RTP B;  3LHN A;  1CBI A;  1I06 A;  1ICN A;  4YGG A;  4FGI B;  2L9C A;  2K23 A;  1GT4 A;  2DM5 A;  2IZH B;  4MVL A;  4ORR A;  1G7N A;  2OFB A;  4ZHC A;  1RXJ A;  1BLR A;  2RTF B;  3AUM O;  2A8G A;  1STS B;  4I9S A;  4O4O A;  1MUP A;  4YMY A;  4WHI A;  3CKG A;  1ZNL A;  1S2P A;  2MM3 A;  3VG4 A;  1O8V A;  4DQ4 A;  1UYO X;  2DJG A;  2FR2 A;  4XME A;  4YDB A;  2G8C O;  4GUZ A;  4IAX A;  2G7B A;  4TQ2 A;  1G85 A;  1OSP O;  2I5Z O;  3PQU A;  4BCS A;  3RZY A;  3P6H A;  3NQ9 A;  2WUT A;  2IZB A;  5B11 O;  4GRJ A;  2QO6 A;  4IB6 A;  4KC7 A;  3L4R A;  3ZWE A;  4O4U A;  1ERX A;  3FA9 A;  5IO6 A;  2BSZ A;  4RUU A;  4Y0S A;  2FS6 A;  3EMM A;  1GX3 A;  1MVG A;  3FEL A;  1VWI B;  3ELX A;  4AW8 A;  1DV9 A;  5B10 O;  1SWN A;  4YBU A;  3BLG A;  1NBX A;  1D2U A;  5IRU A;  1EPA A;  1T0V A;  2YG2 A;  2WQ9 A;  5F2B A;  4AZM A;  4AYH A;  1I78 A;  4BX7 B;  1AVD A;  2RTA A;  2OY1 O;  2A2G A;  2AT0 X;  4GNY A;  3D97 A;  1O1V A;  4ORW A;  3TZS A;  4YBP A;  3WZN A;  1DZK A;  1SWT A;  3VHM A;  1W6F A;  1N9Y A;  1SRI A;  4ORS A;  3WJC A;  1OEK A;  2QMI A;  4YKO A;  1G5W A;  5LKE A;  1KQW A;  4YDA A;  2BLG A;  1RSU B;  3I17 A;  3PPT A;  4ZR2 A;  1VWJ B;  2QM9 A;  4UU3 A;  2DJF A;  1LF7 A;  1I04 A;  5H9L A;  3PDF A;  1LPJ A;  2X32 A;  4GU8 A;  2C1S A;  3DTQ A;  4CPH A;  4QAE A;  4DCB A;  1NQM A;  2QO5 A;  5L3Y A;  3VE1 A;  1STP A;  5FQ6 E;  4CDF A;  3HWD A;  2HZQ A;  4QQ1 A;  2KTS A;  3KZA A;  4MIR A;  1BEB A;  4GD9 A;  3WJF A;  3PH6 A;  2KTD A;  5D47 A;  1AVG I;  1HBQ A;  5IRA A;  1LIB A;  4U8U N;  2RA6 A;  3S26 A;  1SWF A;  4O9S A;  2GTF X;  2CBS A;  2RTQ B;  3HWE A;  4U8U O;  1LDQ A;  2FR3 A;  2G78 A;  5EEE A;  4Z6J A;  1KL5 A;  1EW3 A;  1T68 X;  4U9C A;  1SY1 A;  2RTH B;  3NX2 A;  3NAD A;  1U0X A;  5HBS A;  3ZW1 A;  1VWM B;  2Q4N A;  1SWP A;  3APU A;  5FFH A;  1LIE A;  3T6L A;  2FT9 A;  1A3Y A;  3KFG A;  1SLF B;  3ZQ3 A;  1B8E A;  1HXZ A;  4HPB A;  1MEP A;  1E2T A;  2BS5 A;  1IW2 A;  1MDC A;  3LV4 A;  4L3R A;  1EAL A;  4WFU A;  2OVE A;  4OS0 A;  1SWU A;  3F9D A;  3FDC A;  1CBR A;  2AMM X;  5LJD A;  1WUB A;  1QFT A;  2N93 A;  1JYJ A;  1KL4 A;  4ORU A;  3ZW2 A;  1LUQ A;  2OYB O;  3RDX A;  4ZGF A;  1L6M A;  2QO4 A;  5KIC A;  4TKJ A;  3TF6 A;  3ZUI A;  3U0D A;  2E4J A;  1SWC A;  2OVA A;  5D8J A;  5D45 A;  5AQ6 A;  3U03 A;  4Z27 A;  1TW4 A;  5BVQ A;  4ALB A;  5B29 A;  4O4S A;  5HCC C;  1GKA B;  1PEE A;  1SWK A;  1JJX A;  4TNN A;  4TKH A;  1B0O A;  2K62 A;  4QZT A;  2LBV A;  1HN2 A;  1AEL A;  1QY1 A;  2OF8 A;  1SMP I;  3PK2 A;  3AKN A;  2WEX A;  3NBX X;  2VFC A;  2POA A;  1A18 A;  1BJ7 A;  1VPR A;  1Z24 A;  4FBO A;  4HFO A;  4YFQ A;  3RKG A;  1Y53 X;  4AZR A;  5F6B A;  4BX5 B;  1SWJ A;  2UZ2 A;  1YP7 A;  2IZL B;  1VWO B;  3HK1 A;  4ZH9 A;  3WYQ A;  1CJ5 A;  4U8U M;  2OVD A;  1VWB B;  4LQZ A;  4NP1 A;  1VWH B;  1GT1 A;  2A3F X;  3N91 A;  3FLL A;  3GE2 A;  3O2Y A;  2RCT A;  1GX9 A;  3VGW A;  3WVM A;  1JJJ A;  1SY2 A;  1EPB A;  1SXX A;  2W2F A;  2WEW A;  3D4R A;  4Z2O A;  2ACP X;  2RTI B;  3EW2 A;  4XMH A;  4LZV A;  1LFO A;  2OL8 O;  5L8I A;  1Y9L A;  4MVE A;  1SXW A;  2Y32 A;  1H91 A;  1KL3 A;  3C78 X;  3OBL A;  5B5F A;  1STR B;  4GGR A;  4MVI A;  1ICM A;  3ELZ A;  4I3D A;  4QYN A;  3MM0 A;  3VE2 A;  1O1U A;  1QQS A;  4NLJ A;  2MJI A;  4ZHG A;  1EIO A;  5IXG A;  2KT4 B;  4XMC A;  1SWL A;  1PBO A;  1QY0 A;  1N4J A;  1E06 A;  2NNE A;  4NV8 A;  5EDB A;  4CPE A;  3GAQ A;  3CBS A;  3TGC A;  3MX7 A;  3PH5 A;  2CAM A;  4YCH A;  3CMP A;  1FDQ A;  2CZT A;  3C76 X;  2A2U A;  3P6E A;  1FE3 A;  2JMB A;  3PEC A;  3KVN A;  3MG5 A;  2L67 A;  1VWD B;  1OEE A;  2WPU A;  3FYF A;  1OPB A;  5AJC A;  3B2K A;  2KD2 A;  1QWD A;  3T1D A;  1ML7 A;  1Y55 X;  2OY5 O;  3VG2 A;  3T2X A;  4I95 A;  2NP1 A;  4NLI A;  1SRJ A;  4LKT A;  4KCA A;  4MVK A;  1S44 A;  4ON1 A;  4TJZ A;  3RDU A;  1JBH A;  1YWD A;  2OY8 A;  1BM5 A;  1GT3 A;  1K3B A;  1RST B;  1HY2 A;  1NC9 A;  2HYS A;  1QFV A;  3Q6L A;  5DPQ A;  5HA1 A;  4RUN A;  3T6F A;  3NX1 A;  4U46 A;  2GJ5 A;  5CSE A;  2AKQ A;  3MVF A;  1RLB E;  2WWP A;  4BBO A;  1VWC B;  1EUO A;  1ACD A;  1X8Q A;  2X55 A;  4ORY A;  3DSZ A;  4CPH B;  5L8N A;  2X56 A;  3WZO A;  4TLJ A;  2RTN B;  3ZW0 A;  2A13 A;  1JQP A;  2X4M A;  2A5B A;  5IO5 A;  3NQ3 A;  1A2D A;  1LEL A;  1FEM A;  1LCW A;  2X8T A;  3D96 A;  3ZI8 A;  2RTG B;  1W4T A;  1IKJ A;  1VWF B;  4IB8 A;  3AEH A;  4Z2V A;  1D3S A;  2RTD B;  4DQ3 A;  3D9W A;  4I9R A;  1GX8 A;  1OEJ A;  2F09 A;  5C0N A;  3UEU A;  2HLV A;  3BDR A;  4KH8 A;  4IMN A;  4YFR A;  5LJE A;  1JMZ A;  3C77 X;  3BY0 A;  1ZNE A;  1KT7 A;  2LB6 A;  3ZW1 B;  2GC9 A;  2ACO A;  3EYC A;  5KHP A;  2QCB A;  2AH7 X;  4A8Z A;  1URE A;  4KT5 A;  2AL0 X;  2MF6 A;  1HQQ A;  3E3C A;  4FBV A;  3JSQ A;  3F8A A;  4BX6 A;  4B55 A;  4YFP A;  4I6S A;  3SZI A;  2FS7 A;  5EZ2 A;  2GH7 A;  1KT4 A;  1ALB A;  1UYN X;  1UZ2 X;  2OVS A;  2RN4 A;  5EPQ A;  2FKG A;  5F58 A;  3K3L A;  4CPF A;  1X71 A;  5B5G A;  1SXY A;  1T8V A;  1N9M A;  2FWV A;  3KFI A;  1IJ8 A;  2OFA A;  2AVI A;  1KGL A;  2Q9S A;  1MM9 A;  1PTS A;  3CQR A;  3QKG A;  2F01 A;  2IFB A;  4N7D A;  3VG6 A;  4O3X B;  4IB7 A;  3B2H A;  3OD9 A;  4MEE A;  3VG3 A;  1P6P A;  4OMX A;  1SRH A;  2CM4 A;  2RTO B;  4XMG A;  3BRN A;  1I05 A;  2EU7 X;  4IRW A;  4WFV A;  1ZNG A;  2W2B A;  5HTD A;  3BU1 A;  1LDO A;  1FJ1 E;  3VU1 A;  2OL7 A;  1MX7 A;  1VWQ B;  2BC3 A;  1SWA A;  3SAO A;  4Z2P A;  2NNQ A;  1OBP A;  2RTE B;  4GNW A;  1TOW A;  2WR6 A;  4INN A;  2RCQ A;  4ZH6 A;  3BX7 A;  1ADL A;  1ERB A;  2RTC B;  3APV A;  4HPC A;  3BU9 A;  2HNX A;  1NDJ A;  3B2L A;  4GKC A;  1SY3 A;  3RY1 A;  1KT6 A;  4AZN A;  1G74 A;  1LKE A;  2PI3 O;  3WJD A;  4N7C A;  4ORX A;  3EM0 A;  2IZI A;  2RTL A;  4UU2 A;  5DG4 A;  1BWY A;  2RTR B;  3KFF A;  1VWN B;  1SA8 A;  2Q2P A;  3NPO A;  2WSJ A;  4FQB B;  5IO7 A;  2OL6 O;  3EW1 A;  4LKP A;  3B2I A;  4QRL A;  1A57 A;  1KQX A;  1SWG A;  1XKI A;  4NW4 A;  5K68 A;  4ZHD A;  1QY2 A;  1TOU A;  1DZP A;  4GK9 A;  3ZZV A;  2OZQ A;  3S60 A;  2Y3E A;  4XMD A;  2CZU A;  4YVB A;  5L8O A;  4OS8 A;  5LJC A;  4ZFX A;  2AT5 X;  4CPI A;  3HPE A;  4AZQ A;  3PQS A;  1IKE A;  3PED A;  1CRB A;  1PMP A;  1SWD A;  4BQU A;  3OJY C;  2R56 A;  1JZU A;  1E00 A;  2RTM A;  4MIS A;  3HWF A;  3O22 A;  1KT3 A;  1YWC A;  2WQA E;  1KFF A;  1R0U A;  1Y9T A;  3EC5 A;  5CYB A;  3UEV A;  1LID A;  2X45 A;  5H9A A;  2GTL N;  4L1N A;  3IFB A;  3UAQ A;  1FEL A;  2Z4H A;  4GJV A;  4HPD A;  4EQA C;  5BVT A;  4DNE A;  1MX8 A;  2JU7 A;  3P6D A;  4C5P A;  1AB0 A;  3B2J A;  1PBY A;  3FEN A;  4IB9 A;  2FKJ A;  1VYO A;  4IBA A;  2ANS A;  3EBK A;  3FA7 A;  1ZNK A;  4CDD A;  5LJB A;  3WZP A;  1AQB A;  1FTP A;  4JO6 A;  2JW1 A;  5BVS A;  2OY7 A;  3STK A;  5FEN A;  3TGA A;  1DFV A;  4I3C A;  4Y5D A;  3RDQ A;  5K06 A;  2AT8 X;  3FR2 A;  1VWP B;  5HZ8 A;  2M4L A;  1BSO A;  3P6G A;  4EKV A;  3SZH A;  3NQK A;  1ZND A;  4ZJ0 A;  2XST A;  3KFH A;  4OKA A;  3SLT A;  3WXQ A;  4CDC A;  4YCE A;  1X8U A;  3STM X;  1OBQ A;  2NND A;  5B27 A;  4PJ2 A;  4ZHH A;  3ZW0 B;  2JOZ A;  1MOY A;  3VHI A;  3RWX A;  2VDF A;  1BBP A;  4PSQ A;  2FTB A;  4ALO A;  1N43 A;  3FA6 A;  1HBP A;  1HQP A;  2BS6 A;  1B4M A;  3RE6 A;  2IZC B;  2ZAI A;  1PM1 X;  1DF8 A;  5KID A;  2F73 A;  2IZD B;  4BVM A;  3BSZ E;  2RQ0 A;  3P6C A;  3U9P C;  1LIF A;  3Q34 A;  1VWK B;  1RXH A;  4A1Y A;  2IZK A;  4XMF A;  3RBY A;  1NGL A;  2MWH A;  3STN A;  3RE5 A;  4GGT A;  4LZU A;  2HMB A;  3WBG A;  4JHQ A;  1BRP A;  1SWO A;  3WYP A;  1GXA A;  1IFC A;  1LNM A;  4EFG A;  3D95 A;  3HWG A;  2GTL M;  1BSY A;  4GDZ A;  1KZX A;  1Y0G A;  4CV7 A;  1ZNH A;  1RAV A;  1SLE B;  2Q2M A;  4ODD A;  1B56 A;  5AJB A;  4AZP A;  1SLD B;  4M7M A;  1N7Y A;  1X8P A;  4O4X A;  3FEP A;  4QGV A;  5FQ8 E;  4QZU A;  1EXS A;  2IZG B;  3JQO A;  2FHN X;  3P6F A;  3LTW A;  4IAW A;  5EED A;  4ES7 A;  1YIV A;  2RTJ A;  5HZQ A;  2OFR X;  1SWQ A;  4WBK A;  1HMR A;  1OPA A;  2KW1 A;  1I4U A;  2FLJ A;  2O62 A;  5B2A O;  3V8U A;  3VG7 A;  3FMZ A;  4AZO A;  3T2W A;  4COT A;  3RDS A;  3VHH A;  1DC9 A;  3NP1 A;  2JU3 A;  4Z28 A;  1CBQ A;  4GZV A;  5LKF A;  3FW4 A;  4ARH A;  1NQN A;  1VWE B;  4IMO A;  3H3I A;  4NNS A;  2Y3F A;  1YUP A;  4U3Q A;  5K67 A;  2C4I A;  3SOT A;  1IIU A;  1CBS A;  4CDE A;  2BHV A;  5HWZ A;  2IZE B;  1ZRY A;  4I3B A;  4BX6 B;  3HOL A; 
#chains in the Genus database with same CATH homology
 1IFB A;  3WOV A;  2W2A A;  3UEW A;  5HZ6 A;  3TGB A;  4QYP A;  4ID2 A;  1DF3 A;  2JU8 A;  1KT5 A;  5LJH A;  4CSB A;  2X8S A;  1HMS A;  4KII A;  3UEX A;  3G7X A;  3S5V A;  5FAZ A;  1TVQ A;  5HA0 A;  2X46 A;  2Q39 A;  1X8O A;  3FIQ A;  1HMT A;  1JV4 A;  1QG5 A;  3P02 A;  4OMW A;  5D48 A;  4EEJ A;  4GH7 A;  1KZW A;  3ZUO A;  4QGX A;  3FEK A;  5F6Z A;  3VPJ E;  2R73 A;  1EQD A;  2ZAG A;  3CBC A;  2CBR A;  3APW A;  3AKM A;  2PY1 A;  1VYF A;  1LIC A;  3FR5 A;  5EDC A;  4A1H A;  4ZGU A;  2ALL X;  2G79 A;  1YWA A;  2LKK A;  2MO5 A;  3FW5 A;  2RD7 C;  4R0B A;  5H9N A;  1FEN A;  1N0S A;  4IAB A;  2BT9 A;  4Y0Q A;  1EI5 A;  4OS3 A;  2XKL A;  3F6Z B;  5H8T A;  4JGL A;  4YGH A;  4YH0 A;  2QOS C;  3PP6 A;  1E5P A;  4ZCB A;  4ZHF A;  1KOI A;  3CWK A;  2LBA A;  3CQN A;  4HPA A;  1JIW I;  4A60 A;  3O19 A;  1X8N A;  4CK4 A;  2MHD A;  1GT5 A;  1U17 A;  4QGW A;  5H9K A;  4HWM A;  4M6S A;  2ASN X;  1XCA A;  2LA7 A;  5F7G A;  2L5P A;  5LJG A;  2A0A A;  3RSW A;  3MBT A;  2JN3 A;  1U18 A;  3S5X A;  4BOE A;  3BS2 A;  2L68 A;  4NNT A;  4YGZ A;  2X8F A;  3VG5 A;  1BSQ A;  1SXU A;  3WJB A;  2LFO A;  4NYR A;  4EDE A;  3BX8 A;  5JR8 A;  3CR6 A;  3P24 A;  2GTL O;  1E02 A;  3OE3 A;  1S7D A;  1TXL A;  4YKM A;  3HTY A;  5HCE C;  3IA8 A;  2CM9 A;  5HTE A;  4GE1 A;  1QAB E;  3KQ0 A;  1VYG A;  5D4A A;  1GM6 A;  3HOE A;  2Z4I A;  1EII A;  1SY0 A;  5F1E A;  1YP6 A;  5BYP A;  1KXO A;  3APX A;  1DZJ A;  2P8G A;  3JS1 A;  4NYQ A;  2YMS A;  1NP4 A;  5CE4 A;  4D6B A;  4Y0R A;  1GKA A;  5HZ5 A;  1YWB A;  3EBW A;  2HZR A;  5AEO A;  1OBU A;  4FBR A;  4GET A;  2R74 A;  5HZ9 A;  4O3Z A;  1BRQ A;  4ML7 B;  2OFM X;  3FA8 A;  4O49 A;  4D6A A;  1X89 A;  1DZM A;  4O3W A;  3FR4 A;  2AT6 X;  3I0A A;  3NR3 A;  5FQ7 E;  2AT3 X;  4Y0P A;  4TKB A;  4EXZ A;  2FRS A;  1NP1 A;  5HCD C;  1GGL A;  4KC8 A;  1RBP A;  4O3Y A;  4QNI A;  1JYD A;  5LJK A;  3WJG A;  5HAE A;  3WJE A;  4K19 A;  3LHN A;  1CBI A;  1I06 A;  1ICN A;  4YGG A;  4FGI B;  2L9C A;  2K23 A;  1GT4 A;  2DM5 A;  4MVL A;  4ORR A;  4ZHC A;  1G7N A;  1BLR A;  4I9S A;  4O4O A;  1MUP A;  4YMY A;  4WHI A;  1ZNL A;  1S2P A;  2MM3 A;  3VG4 A;  1O8V A;  4DQ4 A;  4XME A;  2FR2 A;  4YDB A;  4IAX A;  2G7B A;  4TQ2 A;  1G85 A;  3PQU A;  3RZY A;  3P6H A;  3NQ9 A;  2WUT A;  4GRJ A;  2QO6 A;  4IB6 A;  4KC7 A;  3L4R A;  3ZWE A;  4O4U A;  1ERX A;  3FA9 A;  5IO6 A;  4RUU A;  4Y0S A;  2FS6 A;  3EMM A;  1MVG A;  3FEL A;  3ELX A;  4AW8 A;  1DV9 A;  4YBU A;  3BLG A;  1D2U A;  1EPA A;  1T0V A;  2YG2 A;  2WQ9 A;  4AZM A;  4AYH A;  2A2G A;  2AT0 X;  4GNY A;  3D97 A;  1O1V A;  4ORW A;  3TZS A;  4YBP A;  1DZK A;  3WJC A;  4ORS A;  1OEK A;  2QMI A;  4YKO A;  1G5W A;  5LKE A;  1KQW A;  4YDA A;  2BLG A;  3I17 A;  4ZR2 A;  3PPT A;  2QM9 A;  4UU3 A;  1LF7 A;  1I04 A;  5H9L A;  1LPJ A;  4GU8 A;  3DTQ A;  4QAE A;  2QO5 A;  3VE1 A;  5FQ6 E;  3HWD A;  2HZQ A;  4QQ1 A;  2KTS A;  3KZA A;  4MIR A;  1BEB A;  3WJF A;  3PH6 A;  2KTD A;  5D47 A;  1HBQ A;  1AVG I;  3S26 A;  1LIB A;  4U8U N;  2RA6 A;  4O9S A;  2GTF X;  2CBS A;  3HWE A;  4U8U O;  5EEE A;  2FR3 A;  2G78 A;  1EW3 A;  1T68 X;  4U9C A;  1SY1 A;  3NX2 A;  3ZW1 A;  3NAD A;  1U0X A;  5HBS A;  2Q4N A;  5FFH A;  3APU A;  1LIE A;  2FT9 A;  1A3Y A;  3KFG A;  3ZQ3 A;  1B8E A;  4HPB A;  2BS5 A;  1IW2 A;  1MDC A;  3LV4 A;  4L3R A;  1EAL A;  4WFU A;  2OVE A;  4OS0 A;  3F9D A;  1CBR A;  2AMM X;  5LJD A;  1QFT A;  2N93 A;  1JYJ A;  4ORU A;  3ZW2 A;  4ZGF A;  1L6M A;  2QO4 A;  5KIC A;  4TKJ A;  3TF6 A;  3ZUI A;  3U0D A;  2E4J A;  2OVA A;  5D8J A;  5D45 A;  5AQ6 A;  3U03 A;  1TW4 A;  5BVQ A;  4ALB A;  5B29 A;  4O4S A;  5HCC C;  1GKA B;  1PEE A;  1JJX A;  4TNN A;  4TKH A;  1B0O A;  2K62 A;  4QZT A;  2LBV A;  1HN2 A;  1AEL A;  1QY1 A;  1SMP I;  3AKN A;  2WEX A;  3NBX X;  2POA A;  1A18 A;  1BJ7 A;  1VPR A;  1Z24 A;  4FBO A;  4HFO A;  4YFQ A;  3RKG A;  4AZR A;  5F6B A;  1YP7 A;  4ZH9 A;  3HK1 A;  1CJ5 A;  4U8U M;  2OVD A;  4NP1 A;  4LQZ A;  1GT1 A;  2A3F X;  3N91 A;  3FLL A;  3GE2 A;  3O2Y A;  2RCT A;  1GX9 A;  3WVM A;  1JJJ A;  1SY2 A;  1EPB A;  1SXX A;  2W2F A;  2WEW A;  3D4R A;  2ACP X;  4XMH A;  4LZV A;  1LFO A;  5L8I A;  1Y9L A;  4MVE A;  1SXW A;  1H91 A;  3C78 X;  3OBL A;  4MVI A;  1ICM A;  3ELZ A;  4I3D A;  4QYN A;  3VE2 A;  1O1U A;  1QQS A;  4NLJ A;  2MJI A;  4ZHG A;  1EIO A;  2KT4 B;  4XMC A;  1PBO A;  1QY0 A;  3TGC A;  1E06 A;  2NNE A;  5EDB A;  3GAQ A;  3CBS A;  3MX7 A;  3PH5 A;  4YCH A;  3CMP A;  1FDQ A;  2CZT A;  3C76 X;  2A2U A;  3P6E A;  1FE3 A;  2JMB A;  3PEC A;  2L67 A;  1OEE A;  3FYF A;  1OPB A;  5AJC A;  3B2K A;  2KD2 A;  1QWD A;  3T1D A;  1ML7 A;  3VG2 A;  4I95 A;  2NP1 A;  4NLI A;  4LKT A;  4KCA A;  4MVK A;  1S44 A;  4ON1 A;  4TJZ A;  1JBH A;  1YWD A;  1BM5 A;  1GT3 A;  2HYS A;  5DPQ A;  1QFV A;  3Q6L A;  5HA1 A;  4RUN A;  3NX1 A;  2GJ5 A;  2AKQ A;  3MVF A;  1RLB E;  2WWP A;  1EUO A;  1ACD A;  1X8Q A;  4ORY A;  5L8N A;  3DSZ A;  4TLJ A;  3ZW0 A;  2A13 A;  5IO5 A;  3NQ3 A;  1A2D A;  3ZI8 A;  1FEM A;  2X8T A;  3D96 A;  1IKJ A;  4IB8 A;  1D3S A;  4DQ3 A;  4I9R A;  1GX8 A;  1OEJ A;  2F09 A;  5C0N A;  3UEU A;  2HLV A;  3BDR A;  4KH8 A;  4IMN A;  4YFR A;  5LJE A;  3C77 X;  3BY0 A;  1ZNE A;  1KT7 A;  2LB6 A;  3ZW1 B;  2GC9 A;  2ACO A;  3EYC A;  5KHP A;  2AH7 X;  4A8Z A;  1URE A;  4KT5 A;  2AL0 X;  3E3C A;  4FBV A;  3JSQ A;  3F8A A;  4YFP A;  4I6S A;  2FS7 A;  5EZ2 A;  1KT4 A;  1ALB A;  1UZ2 X;  2RN4 A;  2OVS A;  5EPQ A;  5F58 A;  3K3L A;  1X71 A;  1SXY A;  1T8V A;  2FWV A;  3KFI A;  1KGL A;  2Q9S A;  3QKG A;  3CQR A;  4N7D A;  2IFB A;  3VG6 A;  4O3X B;  4IB7 A;  3B2H A;  3OD9 A;  3VG3 A;  1P6P A;  4OMX A;  2CM4 A;  4XMG A;  3BRN A;  1I05 A;  2EU7 X;  4WFV A;  1ZNG A;  2W2B A;  5HTD A;  3BU1 A;  3VU1 A;  1MX7 A;  3SAO A;  2NNQ A;  1OBP A;  4GNW A;  4INN A;  1TOW A;  2WR6 A;  2RCQ A;  4ZH6 A;  3BX7 A;  1ADL A;  1ERB A;  3APV A;  4HPC A;  3BU9 A;  2HNX A;  3B2L A;  4GKC A;  1SY3 A;  1KT6 A;  4AZN A;  1G74 A;  1LKE A;  3WJD A;  4N7C A;  4ORX A;  3EM0 A;  4UU2 A;  5DG4 A;  1BWY A;  3KFF A;  3NPO A;  2Q2P A;  1SA8 A;  5IO7 A;  2WSJ A;  4FQB B;  4LKP A;  3B2I A;  4QRL A;  1A57 A;  1KQX A;  1XKI A;  4NW4 A;  4ZHD A;  1QY2 A;  1TOU A;  1DZP A;  4GK9 A;  3ZZV A;  2OZQ A;  3S60 A;  4XMD A;  2CZU A;  5L8O A;  4OS8 A;  5LJC A;  4ZFX A;  2AT5 X;  4AZQ A;  3PQS A;  1IKE A;  3PED A;  1CRB A;  1PMP A;  4BQU A;  3OJY C;  2R56 A;  1JZU A;  1E00 A;  4MIS A;  3HWF A;  3O22 A;  1KT3 A;  1YWC A;  2WQA E;  1R0U A;  1Y9T A;  5CYB A;  3UEV A;  1LID A;  2X45 A;  5H9A A;  2GTL N;  4L1N A;  3IFB A;  3UAQ A;  1FEL A;  2Z4H A;  4HPD A;  4EQA C;  5BVT A;  1MX8 A;  2JU7 A;  3P6D A;  1AB0 A;  3B2J A;  3FEN A;  4IB9 A;  4IBA A;  2ANS A;  3EBK A;  3FA7 A;  1ZNK A;  5LJB A;  1AQB A;  1FTP A;  2JW1 A;  5BVS A;  3STK A;  5FEN A;  3TGA A;  1DFV A;  4I3C A;  5K06 A;  2AT8 X;  3FR2 A;  5HZ8 A;  2M4L A;  1BSO A;  3P6G A;  3NQK A;  1ZND A;  4ZJ0 A;  2XST A;  3KFH A;  3WXQ A;  4YCE A;  1X8U A;  3STM X;  1OBQ A;  2NND A;  5B27 A;  4PJ2 A;  3ZW0 B;  2JOZ A;  3RWX A;  1BBP A;  4PSQ A;  2FTB A;  4ALO A;  1B4M A;  3FA6 A;  1HBP A;  1HQP A;  2BS6 A;  2ZAI A;  1PM1 X;  2F73 A;  4BVM A;  3BSZ E;  2RQ0 A;  3P6C A;  3U9P C;  1LIF A;  4A1Y A;  4XMF A;  3RBY A;  1NGL A;  2MWH A;  3STN A;  3WBG A;  4LZU A;  2HMB A;  4EFG A;  4ZHH A;  1BRP A;  1GXA A;  1IFC A;  1LNM A;  1KZX A;  3D95 A;  3HWG A;  2GTL M;  1BSY A;  4GDZ A;  4CV7 A;  1ZNH A;  4ODD A;  2Q2M A;  4AZP A;  1B56 A;  5AJB A;  5KID A;  4M7M A;  1X8P A;  4O4X A;  4QGV A;  3FEP A;  5FQ8 E;  4QZU A;  1EXS A;  4IAW A;  3JQO A;  3P6F A;  5EED A;  4ES7 A;  1YIV A;  5HZQ A;  2OFR X;  4WBK A;  1HMR A;  1OPA A;  2KW1 A;  1I4U A;  2FLJ A;  2O62 A;  3V8U A;  3VG7 A;  4AZO A;  3FMZ A;  4COT A;  1DC9 A;  3NP1 A;  2JU3 A;  1CBQ A;  4GZV A;  5LKF A;  3FW4 A;  4ARH A;  4NNS A;  4IMO A;  3H3I A;  1YUP A;  4U3Q A;  3SOT A;  1IIU A;  1CBS A;  5HWZ A;  2BHV A;  1ZRY A;  4I3B A;  3HOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...