1FEUA

Crystal structure of ribosomal protein tl5, one of the ctc family proteins, complexed with a fragment of 5s rrna.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
MEYRLKAYYREGEKPSALRRAGKLPGLMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ribosomal protein TL5 complexed with RNA provides new insights into the CTC family of stress proteins.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosome
molecule keywords 19 NT FRAGMENT OF 5S RRNA
total genus 39
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01386 Ribosomal_L25p Ribosomal L25p family
A PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 1feuA01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 1feuA02
4WFAS 3PIPS 1EXDA 3J7ZV 2ZJPS 1ZJWA 5DM6S 5JVHS 1QRSA 5GAGW 4JXXA 5GAHW 5HL7S 5JVGS 3DLLS 1GTRA 2HZ7A 1QTQA 5DM7S 2RE8A 4WFBS 1O0BA 3PIOS 1D6KA 1GTSA 1FEUA 1NYLA 4UY88 4WCES 1QRTA 5BNZA 5IZNA 4JXZA 4H3SA 4JYZA 4IOAS 4IOCS 4U67S 2ZJQS 1QRUA 4P2BA 1O0CA 1EUQA 4IO9S 1EUYA 3AIIA 4WF9S 1B75A 1DFUP 5GAEW 2RD2A 5GADW 4WFNS 3CF5S 2ZJRS
chains in the Genus database with same CATH superfamily
5IYBC 3J7ZV 2PI8A 3GTPC 3S1NC 2NVQC 5GAGW 5C4JC 2O5IA 4A3EC 2E2IC 4OIQA 1I3QC 3S14C 1GTRA 4A3IC 3W2WB 3S1MC 1HQMA 4A3MC 5DM7S 2JA8C 4Q4ZA 2CX8A 4WFBS 4G7ZA 2A68A 3I4NC 4BY7C 1TWCC 2A6EA 1Y1VC 1QRTA 2BE5A 2JA6C 4BY1C 2R93C 4QIWD 3I4MC 4E8BA 4A3JC 4JYZA 4A3DC 3CZBA 4OINA 1ZYRA 4XSXA 1V6ZA 2EGWA 1VHKA 2PPBA 1WCMC 5C4XC 1UDXA 5C3EC 4GZYA 4JK1A 3RZDC 1I6VA 3PIPS 4BBRC 2ZJPS 1IW7A 3GTJC 4L69A 5JVHS 2A6HA 3WODA 5IYDC 4OIRA 4NOIA 3S15C 1TWFC 1I6HC 4LK0A 3PO3C 3KW2A 2NVYC 3CQZC 2WB1D 3H0GC 3GTGC 3W2VB 3HOXC 1NXZA 2R7ZC 2VUMC 2NVXC 2KQ1A 3HOUC 4YFNA 1GTSA 3DXJA 4BXXC 4A3LC 4UY88 4KMUA 1R9TC 1TWHC 2YU9C 2G6GA 2KXYA 2Y0SD 4G7OA 4Y7NC 1VHYA 4IOAS 4MEYA 4U67S 2ZJQS 5TMCA 4C3IC 1K83C 5TMFA 3S16C 1TWAC 2R92C 3PO2C 1B75A 2PJJA 4C3HC 5IP7C 4A3FC 3EQLA 5GADW 2RE8A 1Y1WC 1EXDA 1SMYA 4QJVA 3K7AC 2B63C 4H4KA 5DM6S 4Q5SA 4LJZA 5GAHW 5HL7S 4X6AC 3S1RC 4ZH4A 2WAQD 2HZ7A 4A3KC 1SFOC 4J3CA 3S17C 3HKZD 1QTQA 2PMZD 3GTMC 2PNWA 5HQHA 4C2MC 3S2DC 2KPUA 2L3UA 1D6KA 1FEUA 4KN4A 3M4OC 4LK1A 1TWGC 5BNZA 5IZNA 4C3JC 4A3GC 4H3SA 4A93C 2GAEA 1QRUA 5IYCC 4P2BA 3H3VD 4OIPA 3LYWA 4YFKA 4IO9S 1EUYA 1Z85A 2A69A 5GAEW 2RD2A 2CW0A 2EGVA 5C44C 4MEXA 3RZOC 4WFNS 3CF5S 2L5NA 4WFAS 4BBSC 1ZJWA 3GTOC 4A3CC 4V194 2PA8D 3FKIC 1QRSA 4G7HA 4JXXA 4YG2A 5JVGS 3HOZC 3DLLS 3X1LB 4XLNA 4OIOA 2O5JA 5IP9C 2NWAA 1O0BA 3PIOS 1YNNA 4XSZA 1NYLA 4KN7A 2Z0YA 3M3YC 4MQ9A 4WCES 1BDFA 4LLGA 3GTKC 4JXZA 3GTLC 3HOVC 5D4DA 4YFXA 4IOCS 3S2HC 1I50C 3S1QC 4AYBD 4XLPA 1O0CA 1EUQA 3GTQC 2E2HC 3HOWC 2PICA 3AIIA 2ZJRS 2AE0X 5FLMC 2JA5C 1DFUP 4Y52C 2JA7C 3HOYC 4A3BC 2NVTC 2G5DA 1YNJA 2E2JC 4WF9S
chains in the Genus database with same CATH topology
4WFAS 3PIPS 1EXDA 3J7ZV 2ZJPS 1ZJWA 4H4KA 5DM6S 4V194 5JVHS 1QRSA 5GAGW 4JXXA 5GAHW 5HL7S 5JVGS 3DLLS 1GTRA 2HZ7A 3W2WB 3X1LB 1QTQA 3W2VB 5DM7S 2RE8A 4WFBS 1O0BA 3PIOS 1D6KA 1GTSA 1FEUA 1NYLA 4UY88 4WCES 1QRTA 5BNZA 5IZNA 4JXZA 4H3SA 4JYZA 4IOAS 4IOCS 4U67S 2ZJQS 1QRUA 4P2BA 1O0CA 1EUQA 4IO9S 1EUYA 3AIIA 4WF9S 1B75A 1UDXA 1DFUP 5GAEW 2RD2A 5GADW 4WFNS 3CF5S 2ZJRS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFA S;  3PIP S;  1EXD A;  3J7Z V;  2ZJP S;  1ZJW A;  5DM6 S;  5JVH S;  1QRS A;  5GAG W;  4JXX A;  5GAH W;  5HL7 S;  5JVG S;  3DLL S;  1GTR A;  2HZ7 A;  1QTQ A;  5DM7 S;  2RE8 A;  4WFB S;  1O0B A;  3PIO S;  1D6K A;  1GTS A;  1FEU A;  1NYL A;  4UY8 8;  4WCE S;  1QRT A;  5BNZ A;  5IZN A;  4JXZ A;  4H3S A;  4JYZ A;  4IOA S;  4IOC S;  4U67 S;  2ZJQ S;  1QRU A;  4P2B A;  1O0C A;  1EUQ A;  4IO9 S;  1EUY A;  3AII A;  4WF9 S;  1B75 A;  1DFU P;  5GAE W;  2RD2 A;  5GAD W;  4WFN S;  3CF5 S;  2ZJR S; 
#chains in the Genus database with same CATH topology
 5IYB C;  3J7Z V;  2PI8 A;  3GTP C;  3S1N C;  2NVQ C;  5GAG W;  5C4J C;  2O5I A;  4A3E C;  2E2I C;  4OIQ A;  1I3Q C;  3S14 C;  1GTR A;  4A3I C;  3W2W B;  3S1M C;  1HQM A;  4A3M C;  5DM7 S;  2JA8 C;  4Q4Z A;  2CX8 A;  4WFB S;  4G7Z A;  2A68 A;  3I4N C;  4BY7 C;  1TWC C;  2A6E A;  1Y1V C;  1QRT A;  2BE5 A;  2JA6 C;  4BY1 C;  2R93 C;  4QIW D;  3I4M C;  4E8B A;  4A3J C;  4JYZ A;  4A3D C;  3CZB A;  4OIN A;  1ZYR A;  4XSX A;  1V6Z A;  2EGW A;  1VHK A;  2PPB A;  1WCM C;  5C4X C;  1UDX A;  5C3E C;  4GZY A;  4JK1 A;  3RZD C;  1I6V A;  3PIP S;  4BBR C;  2ZJP S;  1IW7 A;  3GTJ C;  4L69 A;  5JVH S;  2A6H A;  3WOD A;  5IYD C;  4OIR A;  4NOI A;  3S15 C;  1TWF C;  1I6H C;  4LK0 A;  3PO3 C;  3KW2 A;  2NVY C;  3CQZ C;  2WB1 D;  3H0G C;  3GTG C;  3W2V B;  3HOX C;  1NXZ A;  2R7Z C;  2VUM C;  2NVX C;  2KQ1 A;  3HOU C;  4YFN A;  1GTS A;  3DXJ A;  4BXX C;  4A3L C;  4UY8 8;  4KMU A;  1R9T C;  1TWH C;  2YU9 C;  2G6G A;  2KXY A;  2Y0S D;  4G7O A;  4Y7N C;  1VHY A;  4IOA S;  4MEY A;  4U67 S;  2ZJQ S;  5TMC A;  4C3I C;  1K83 C;  5TMF A;  3S16 C;  1TWA C;  2R92 C;  3PO2 C;  1B75 A;  2PJJ A;  4C3H C;  5IP7 C;  4A3F C;  3EQL A;  5GAD W;  2RE8 A;  1Y1W C;  1EXD A;  1SMY A;  4QJV A;  3K7A C;  2B63 C;  4H4K A;  5DM6 S;  4Q5S A;  4LJZ A;  5GAH W;  5HL7 S;  4X6A C;  3S1R C;  4ZH4 A;  2WAQ D;  2HZ7 A;  4A3K C;  1SFO C;  4J3C A;  3S17 C;  3HKZ D;  1QTQ A;  2PMZ D;  3GTM C;  2PNW A;  5HQH A;  4C2M C;  3S2D C;  2KPU A;  2L3U A;  1D6K A;  1FEU A;  4KN4 A;  3M4O C;  4LK1 A;  1TWG C;  5BNZ A;  5IZN A;  4C3J C;  4A3G C;  4H3S A;  4A93 C;  2GAE A;  1QRU A;  5IYC C;  4P2B A;  3H3V D;  4OIP A;  3LYW A;  4YFK A;  4IO9 S;  1EUY A;  1Z85 A;  2A69 A;  5GAE W;  2RD2 A;  2CW0 A;  2EGV A;  5C44 C;  4MEX A;  3RZO C;  4WFN S;  3CF5 S;  2L5N A;  4WFA S;  4BBS C;  1ZJW A;  3GTO C;  4A3C C;  4V19 4;  2PA8 D;  3FKI C;  1QRS A;  4G7H A;  4JXX A;  4YG2 A;  5JVG S;  3HOZ C;  3DLL S;  3X1L B;  4XLN A;  4OIO A;  2O5J A;  5IP9 C;  2NWA A;  1O0B A;  3PIO S;  1YNN A;  4XSZ A;  1NYL A;  4KN7 A;  2Z0Y A;  3M3Y C;  4MQ9 A;  4WCE S;  1BDF A;  4LLG A;  3GTK C;  4JXZ A;  3GTL C;  3HOV C;  5D4D A;  4YFX A;  4IOC S;  3S2H C;  1I50 C;  3S1Q C;  4AYB D;  4XLP A;  1O0C A;  1EUQ A;  3GTQ C;  2E2H C;  3HOW C;  2PIC A;  3AII A;  2ZJR S;  2AE0 X;  5FLM C;  2JA5 C;  1DFU P;  4Y52 C;  2JA7 C;  3HOY C;  4A3B C;  2NVT C;  2G5D A;  1YNJ A;  2E2J C;  4WF9 S; 
#chains in the Genus database with same CATH homology
 4WFA S;  3PIP S;  1EXD A;  3J7Z V;  2ZJP S;  1ZJW A;  4H4K A;  5DM6 S;  4V19 4;  5JVH S;  1QRS A;  5GAG W;  4JXX A;  5GAH W;  5HL7 S;  5JVG S;  3DLL S;  1GTR A;  2HZ7 A;  3W2W B;  3X1L B;  1QTQ A;  3W2V B;  5DM7 S;  2RE8 A;  4WFB S;  1O0B A;  3PIO S;  1D6K A;  1GTS A;  1FEU A;  1NYL A;  4UY8 8;  4WCE S;  1QRT A;  5BNZ A;  5IZN A;  4JXZ A;  4H3S A;  4JYZ A;  4IOA S;  4IOC S;  4U67 S;  2ZJQ S;  1QRU A;  4P2B A;  1O0C A;  1EUQ A;  4IO9 S;  1EUY A;  3AII A;  4WF9 S;  1B75 A;  1UDX A;  1DFU P;  5GAE W;  2RD2 A;  5GAD W;  4WFN S;  3CF5 S;  2ZJR S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...