1FEUA

Crystal structure of ribosomal protein tl5, one of the ctc family proteins, complexed with a fragment of 5s rrna.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
MEYRLKAYYREGEKPSALRRAGKLPGLMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 19 NT FRAGMENT OF 5S RRNA
publication title Structure of ribosomal protein TL5 complexed with RNA provides new insights into the CTC family of stress proteins.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosome
total genus 39
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01386 Ribosomal_L25p Ribosomal L25p family
A PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 1feuA01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 1feuA02
5DM7S 5DM6S 1ZJWA 4WCES 3PIPS 4U67S 4UY88 3AIIA 4IOCS 1EUQA 2ZJRS 1B75A 2ZJPS 5GAGW 5JVGS 5GADW 1EXDA 2ZJQS 5BNZA 4IO9S 1NYLA 4P2BA 4WFAS 4WF9S 1DFUP 5GAHW 4H3SA 4JYZA 1O0BA 1GTRA 1QRTA 4JXZA 3CF5S 1O0CA 2HZ7A 1D6KA 3J7ZV 1EUYA 5JVHS 4WFNS 1QTQA 2RD2A 4WFBS 3DLLS 4IOAS 2RE8A 5GAEW 1QRUA 1FEUA 3PIOS 4JXXA 1QRSA 5HL7S 5IZNA 1GTSA
chains in the Genus database with same CATH superfamily
3EQLA 1TWCC 2EGWA 5IYBC 5DM7S 5DM6S 4OINA 4BY1C 4LK0A 4OIRA 1UDXA 2B63C 4A3CC 3PIPS 4U67S 2A6HA 3GTPC 3S2DC 4C3IC 5FLMC 3AIIA 1EUQA 1IW7A 1TWGC 2PI8A 1ZYRA 2L5NA 4YFNA 5C3EC 1I6VA 4A3DC 3WODA 3H0GC 4P2BA 4WFAS 5TMCA 4Y7NC 4A3KC 2PPBA 3RZDC 4JYZA 1O0BA 4BBSC 2PNWA 3CF5S 5IYDC 1O0CA 4JK1A 3CZBA 1D6KA 2NWAA 5D4DA 4A93C 4BY7C 3M4OC 5JVHS 1R9TC 4QIWD 2R7ZC 4J3CA 3GTLC 4WFNS 4E8BA 1QTQA 5IP9C 3HOWC 2RD2A 2E2JC 3I4NC 2VUMC 4IOAS 3S1NC 4A3GC 4YFKA 3HOVC 1FEUA 3S14C 3X1LB 2WB1D 1VHYA 5IZNA 2HZ7A 1GTSA 4XLPA 4A3EC 2L3UA 1I50C 3DXJA 5HQHA 3M3YC 2KXYA 1YNNA 4YG2A 3PO3C 4G7HA 2CX8A 1BDFA 4Y52C 1HQMA 2PMZD 3HOXC 2R92C 5GAGW 3S1MC 5GADW 2A6EA 2WAQD 2GAEA 4IO9S 1NYLA 3FKIC 4KMUA 2JA6C 4QJVA 4C3JC 2EGVA 3I4MC 3J7ZV 3CQZC 1EUYA 4LJZA 3S15C 2JA5C 4XLNA 3HKZD 2E2IC 3S16C 4A3LC 2PA8D 3GTQC 2KPUA 4GZYA 3DLLS 3RZOC 1SFOC 1I6HC 5GAEW 4KN4A 4OIQA 1DFUP 2BE5A 3S17C 2A69A 4NOIA 1VHKA 2CW0A 1TWFC 4ZH4A 4BXXC 2PICA 3W2WB 5IYCC 4WCES 4UY88 3S1RC 1V6ZA 4LK1A 2NVTC 3GTOC 1I3QC 5JVGS 2KQ1A 5C4JC 1WCMC 2PJJA 4MEYA 3H3VD 4OIOA 4Q5SA 2NVQC 5C4XC 5GAHW 1K83C 4H3SA 4MQ9A 4G7OA 4L69A 3PO2C 2R93C 5C44C 2G5DA 3GTGC 4C2MC 1SMYA 2O5JA 1YNJA 2JA7C 4A3MC 3LYWA 4WFBS 1Y1VC 5IP7C 4YFXA 4KN7A 2RE8A 4G7ZA 1QRUA 4A3BC 3PIOS 4JXXA 1QRSA 2A68A 4A3JC 4LLGA 3W2VB 2Y0SD 4OIPA 2YU9C 1ZJWA 2Z0YA 4MEXA 4IOCS 2AE0X 2ZJRS 2ZJPS 4V194 1B75A 4A3IC 4X6AC 1EXDA 2NVYC 2ZJQS 5BNZA 4A3FC 3GTKC 4WF9S 3GTMC 2O5IA 2G6GA 4BBRC 1GTRA 4JXZA 3KW2A 2E2HC 4Q4ZA 3HOYC 1NXZA 4AYBD 3K7AC 3GTJC 1TWAC 4XSXA 3HOUC 4H4KA 3S2HC 1Z85A 2NVXC 1TWHC 1Y1WC 3HOZC 3S1QC 4XSZA 2JA8C 5TMFA 5HL7S 1QRTA 4C3HC
chains in the Genus database with same CATH topology
3W2VB 5DM7S 5DM6S 1ZJWA 3W2WB 4WCES 1UDXA 3PIPS 4U67S 4UY88 3AIIA 4IOCS 1EUQA 2ZJRS 4V194 2ZJPS 5GAGW 5JVGS 1B75A 5GADW 1EXDA 2ZJQS 5BNZA 4IO9S 1NYLA 4P2BA 4WFAS 4WF9S 1DFUP 5GAHW 4H3SA 4JYZA 1O0BA 1GTRA 1QRTA 4JXZA 3CF5S 1O0CA 2HZ7A 1D6KA 3J7ZV 1EUYA 5JVHS 4WFNS 1QTQA 4H4KA 2RD2A 4WFBS 3DLLS 4IOAS 2RE8A 5GAEW 1QRUA 3X1LB 3PIOS 4JXXA 1QRSA 5HL7S 5IZNA 1FEUA 1GTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 S;  5DM6 S;  1ZJW A;  4WCE S;  3PIP S;  4U67 S;  4UY8 8;  3AII A;  4IOC S;  1EUQ A;  2ZJR S;  1B75 A;  2ZJP S;  5GAG W;  5JVG S;  5GAD W;  1EXD A;  2ZJQ S;  5BNZ A;  4IO9 S;  1NYL A;  4P2B A;  4WFA S;  4WF9 S;  1DFU P;  5GAH W;  4H3S A;  4JYZ A;  1O0B A;  1GTR A;  1QRT A;  4JXZ A;  3CF5 S;  1O0C A;  2HZ7 A;  1D6K A;  3J7Z V;  1EUY A;  5JVH S;  4WFN S;  1QTQ A;  2RD2 A;  4WFB S;  3DLL S;  4IOA S;  2RE8 A;  5GAE W;  1QRU A;  1FEU A;  3PIO S;  4JXX A;  1QRS A;  5HL7 S;  5IZN A;  1GTS A; 
#chains in the Genus database with same CATH topology
 3EQL A;  1TWC C;  2EGW A;  5IYB C;  5DM7 S;  5DM6 S;  4OIN A;  4BY1 C;  4LK0 A;  4OIR A;  1UDX A;  2B63 C;  4A3C C;  3PIP S;  4U67 S;  2A6H A;  3GTP C;  3S2D C;  4C3I C;  5FLM C;  3AII A;  1EUQ A;  1IW7 A;  1TWG C;  2PI8 A;  1ZYR A;  2L5N A;  4YFN A;  5C3E C;  1I6V A;  4A3D C;  3WOD A;  3H0G C;  4P2B A;  4WFA S;  5TMC A;  4Y7N C;  4A3K C;  2PPB A;  3RZD C;  4JYZ A;  1O0B A;  4BBS C;  2PNW A;  3CF5 S;  5IYD C;  1O0C A;  4JK1 A;  3CZB A;  1D6K A;  2NWA A;  5D4D A;  4A93 C;  4BY7 C;  3M4O C;  5JVH S;  1R9T C;  4QIW D;  2R7Z C;  4J3C A;  3GTL C;  4WFN S;  4E8B A;  1QTQ A;  5IP9 C;  3HOW C;  2RD2 A;  2E2J C;  3I4N C;  2VUM C;  4IOA S;  3S1N C;  4A3G C;  4YFK A;  3HOV C;  1FEU A;  3S14 C;  3X1L B;  2WB1 D;  1VHY A;  5IZN A;  2HZ7 A;  1GTS A;  4XLP A;  4A3E C;  2L3U A;  1I50 C;  3DXJ A;  5HQH A;  3M3Y C;  2KXY A;  1YNN A;  4YG2 A;  3PO3 C;  4G7H A;  2CX8 A;  1BDF A;  4Y52 C;  1HQM A;  2PMZ D;  3HOX C;  2R92 C;  5GAG W;  3S1M C;  5GAD W;  2A6E A;  2WAQ D;  2GAE A;  4IO9 S;  1NYL A;  3FKI C;  4KMU A;  2JA6 C;  4QJV A;  4C3J C;  2EGV A;  3I4M C;  3J7Z V;  3CQZ C;  1EUY A;  4LJZ A;  3S15 C;  2JA5 C;  4XLN A;  3HKZ D;  2E2I C;  3S16 C;  4A3L C;  2PA8 D;  3GTQ C;  2KPU A;  4GZY A;  3DLL S;  3RZO C;  1SFO C;  1I6H C;  5GAE W;  4KN4 A;  4OIQ A;  1DFU P;  2BE5 A;  3S17 C;  2A69 A;  4NOI A;  1VHK A;  2CW0 A;  1TWF C;  4ZH4 A;  4BXX C;  2PIC A;  3W2W B;  5IYC C;  4WCE S;  4UY8 8;  3S1R C;  1V6Z A;  4LK1 A;  2NVT C;  3GTO C;  1I3Q C;  5JVG S;  2KQ1 A;  5C4J C;  1WCM C;  2PJJ A;  4MEY A;  3H3V D;  4OIO A;  4Q5S A;  2NVQ C;  5C4X C;  5GAH W;  1K83 C;  4H3S A;  4MQ9 A;  4G7O A;  4L69 A;  3PO2 C;  2R93 C;  5C44 C;  2G5D A;  3GTG C;  4C2M C;  1SMY A;  2O5J A;  1YNJ A;  2JA7 C;  4A3M C;  3LYW A;  4WFB S;  1Y1V C;  5IP7 C;  4YFX A;  4KN7 A;  2RE8 A;  4G7Z A;  1QRU A;  4A3B C;  3PIO S;  4JXX A;  1QRS A;  2A68 A;  4A3J C;  4LLG A;  3W2V B;  2Y0S D;  4OIP A;  2YU9 C;  1ZJW A;  2Z0Y A;  4MEX A;  4IOC S;  2AE0 X;  2ZJR S;  2ZJP S;  4V19 4;  1B75 A;  4A3I C;  4X6A C;  1EXD A;  2NVY C;  2ZJQ S;  5BNZ A;  4A3F C;  3GTK C;  4WF9 S;  3GTM C;  2O5I A;  2G6G A;  4BBR C;  1GTR A;  4JXZ A;  3KW2 A;  2E2H C;  4Q4Z A;  3HOY C;  1NXZ A;  4AYB D;  3K7A C;  3GTJ C;  1TWA C;  4XSX A;  3HOU C;  4H4K A;  3S2H C;  1Z85 A;  2NVX C;  1TWH C;  1Y1W C;  3HOZ C;  3S1Q C;  4XSZ A;  2JA8 C;  5TMF A;  5HL7 S;  1QRT A;  4C3H C; 
#chains in the Genus database with same CATH homology
 3W2V B;  5DM7 S;  5DM6 S;  1ZJW A;  3W2W B;  4WCE S;  1UDX A;  3PIP S;  4U67 S;  4UY8 8;  3AII A;  4IOC S;  1EUQ A;  2ZJR S;  4V19 4;  2ZJP S;  5GAG W;  5JVG S;  1B75 A;  5GAD W;  1EXD A;  2ZJQ S;  5BNZ A;  4IO9 S;  1NYL A;  4P2B A;  4WFA S;  4WF9 S;  1DFU P;  5GAH W;  4H3S A;  4JYZ A;  1O0B A;  1GTR A;  1QRT A;  4JXZ A;  3CF5 S;  1O0C A;  2HZ7 A;  1D6K A;  3J7Z V;  1EUY A;  5JVH S;  4WFN S;  1QTQ A;  4H4K A;  2RD2 A;  4WFB S;  3DLL S;  4IOA S;  2RE8 A;  5GAE W;  1QRU A;  3X1L B;  3PIO S;  4JXX A;  1QRS A;  5HL7 S;  5IZN A;  1FEU A;  1GTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...