1FEUA

Crystal structure of ribosomal protein tl5, one of the ctc family proteins, complexed with a fragment of 5s rrna.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
b'MEYRLKAYYREGEKPSALRRAGKLPGLMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 19 NT FRAGMENT OF 5S RRNA
publication title Structure of ribosomal protein TL5 complexed with RNA provides new insights into the CTC family of stress proteins.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosome
total genus 39
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01386 Ribosomal_L25p Ribosomal L25p family
A PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 1feuA01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 1feuA02
1GTRA 5JVHS 3DLLS 5GAHW 1EUQA 5DM7S 1EUYA 1QTQA 1QRTA 4IO9S 1DFUP 1QRSA 4H3SA 5IZNA 1B75A 5BNZA 4UY88 4JYZA 4JXZA 4WF9S 4IOCS 3PIPS 5GAGW 4U67S 4IOAS 5GADW 4WCES 1EXDA 2RE8A 1D6KA 3AIIA 2ZJRS 1O0CA 1FEUA 5GAEW 5JVGS 3CF5S 3PIOS 4WFBS 3J7ZV 1NYLA 4JXXA 1QRUA 4WFNS 2HZ7A 4P2BA 5HL7S 5DM6S 2RD2A 1ZJWA 1GTSA 1O0BA 4WFAS 2ZJPS 2ZJQS
chains in the Genus database with same CATH superfamily
4MEYA 4OINA 5JVHS 2Y0SD 5HQHA 3HOWC 3RZOC 5DM7S 1K83C 4A3LC 4A3DC 1QRTA 4XSXA 1UDXA 4LJZA 2JA5C 4Q4ZA 3S2DC 4G7HA 2E2HC 1WCMC 1TWCC 2B63C 2L5NA 4C3JC 3HOVC 2PMZD 4A3FC 2E2JC 1B75A 1I6VA 3S1NC 2A6EA 2Z0YA 1V6ZA 4LK1A 4WF9S 4QIWD 2A6HA 1R9TC 4IOCS 5C4XC 3GTLC 3PIPS 2O5IA 4KMUA 4LK0A 3HOZC 4BXXC 3S15C 3GTKC 4OIPA 1EXDA 2BE5A 2RE8A 3K7AC 4YFXA 5IP9C 5GAEW 4XLNA 2NWAA 2R93C 5FLMC 1SFOC 2R92C 4BY7C 1QRUA 1TWAC 2HZ7A 2L3UA 4P2BA 5HL7S 5DM6S 2RD2A 4A3EC 1GTSA 1O0BA 4GZYA 2ZJPS 2ZJQS 5IYCC 1GTRA 3I4NC 3DLLS 3S1MC 4Q5SA 2NVTC 3I4MC 4IO9S 4C2MC 1DFUP 2WAQD 4JK1A 4H4KA 3GTPC 1Z85A 4UY88 4JYZA 2KPUA 5TMCA 2NVQC 5D4DA 4KN7A 3S17C 3S14C 1IW7A 2NVYC 2CX8A 3CZBA 3W2VB 5GAGW 2AE0X 3FKIC 2EGVA 5GADW 2JA7C 3GTMC 4A3GC 4E8BA 1VHYA 2O5JA 1D6KA 3PO2C 4LLGA 3PO3C 5C44C 5JVGS 4A3MC 4Y7NC 2E2IC 1TWGC 2NVXC 2KXYA 4Y52C 3H0GC 4OIRA 3CF5S 3S1RC 1YNJA 5GAHW 1EUQA 1EUYA 2KQ1A 2A68A 3LYWA 4C3HC 4A3BC 4BY1C 2PJJA 1I3QC 4C3IC 1ZYRA 4H3SA 3GTOC 5IZNA 4OIOA 4QJVA 4JXZA 4YG2A 4BBRC 3HOXC 4BBSC 3M3YC 4A3IC 1TWHC 4OIQA 4KN4A 2PI8A 2WB1D 3S16C 4A3JC 1NXZA 3X1LB 2R7ZC 4YFKA 4X6AC 4L69A 5C3EC 1O0CA 4XSZA 3HOUC 3CQZC 4JXXA 1NYLA 4NOIA 1Y1VC 3WODA 5C4JC 3GTQC 1ZJWA 4G7ZA 2VUMC 4V194 4ZH4A 3M4OC 3KW2A 2JA8C 4G7OA 1QTQA 5IYBC 1QRSA 1I50C 2G6GA 3S2HC 1TWFC 5TMFA 2GAEA 2PNWA 5BNZA 3DXJA 2CW0A 5IYDC 1VHKA 4A93C 4YFNA 3W2WB 2PICA 4AYBD 4MQ9A 3EQLA 1SMYA 5IP7C 3S1QC 2YU9C 2A69A 4U67S 4IOAS 1Y1WC 3HKZD 4WCES 2EGWA 1BDFA 3GTJC 2PPBA 2JA6C 3AIIA 4J3CA 2ZJRS 1FEUA 3H3VD 4MEXA 1YNNA 2G5DA 3PIOS 4WFBS 3J7ZV 4XLPA 1HQMA 3GTGC 4WFNS 3RZDC 3HOYC 4A3KC 1I6HC 4A3CC 4WFAS 2PA8D
chains in the Genus database with same CATH topology
1GTRA 5JVHS 3DLLS 5GAHW 1EUQA 5DM7S 1EUYA 1QTQA 1QRTA 1UDXA 4IO9S 1DFUP 1QRSA 4H3SA 4H4KA 5IZNA 1B75A 5BNZA 4UY88 4JYZA 4JXZA 3W2WB 4WF9S 4IOCS 3W2VB 5GAGW 3PIPS 4U67S 4IOAS 5GADW 4WCES 3X1LB 1EXDA 2RE8A 1D6KA 3AIIA 2ZJRS 1O0CA 1FEUA 5GAEW 5JVGS 3CF5S 3PIOS 4WFBS 3J7ZV 1NYLA 4JXXA 1QRUA 4WFNS 2HZ7A 4P2BA 5HL7S 5DM6S 2RD2A 1ZJWA 1GTSA 1O0BA 4V194 4WFAS 2ZJPS 2ZJQS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTR A;  5JVH S;  3DLL S;  5GAH W;  1EUQ A;  5DM7 S;  1EUY A;  1QTQ A;  1QRT A;  4IO9 S;  1DFU P;  1QRS A;  4H3S A;  5IZN A;  1B75 A;  5BNZ A;  4UY8 8;  4JYZ A;  4JXZ A;  4WF9 S;  4IOC S;  3PIP S;  5GAG W;  4U67 S;  4IOA S;  5GAD W;  4WCE S;  1EXD A;  2RE8 A;  1D6K A;  3AII A;  2ZJR S;  1O0C A;  1FEU A;  5GAE W;  5JVG S;  3CF5 S;  3PIO S;  4WFB S;  3J7Z V;  1NYL A;  4JXX A;  1QRU A;  4WFN S;  2HZ7 A;  4P2B A;  5HL7 S;  5DM6 S;  2RD2 A;  1ZJW A;  1GTS A;  1O0B A;  4WFA S;  2ZJP S;  2ZJQ S; 
#chains in the Genus database with same CATH topology
 4MEY A;  4OIN A;  5JVH S;  2Y0S D;  5HQH A;  3HOW C;  3RZO C;  5DM7 S;  1K83 C;  4A3L C;  4A3D C;  1QRT A;  4XSX A;  1UDX A;  4LJZ A;  2JA5 C;  4Q4Z A;  3S2D C;  4G7H A;  2E2H C;  1WCM C;  1TWC C;  2B63 C;  2L5N A;  4C3J C;  3HOV C;  2PMZ D;  4A3F C;  2E2J C;  1B75 A;  1I6V A;  3S1N C;  2A6E A;  2Z0Y A;  1V6Z A;  4LK1 A;  4WF9 S;  4QIW D;  2A6H A;  1R9T C;  4IOC S;  5C4X C;  3GTL C;  3PIP S;  2O5I A;  4KMU A;  4LK0 A;  3HOZ C;  4BXX C;  3S15 C;  3GTK C;  4OIP A;  1EXD A;  2BE5 A;  2RE8 A;  3K7A C;  4YFX A;  5IP9 C;  5GAE W;  4XLN A;  2NWA A;  2R93 C;  5FLM C;  1SFO C;  2R92 C;  4BY7 C;  1QRU A;  1TWA C;  2HZ7 A;  2L3U A;  4P2B A;  5HL7 S;  5DM6 S;  2RD2 A;  4A3E C;  1GTS A;  1O0B A;  4GZY A;  2ZJP S;  2ZJQ S;  5IYC C;  1GTR A;  3I4N C;  3DLL S;  3S1M C;  4Q5S A;  2NVT C;  3I4M C;  4IO9 S;  4C2M C;  1DFU P;  2WAQ D;  4JK1 A;  4H4K A;  3GTP C;  1Z85 A;  4UY8 8;  4JYZ A;  2KPU A;  5TMC A;  2NVQ C;  5D4D A;  4KN7 A;  3S17 C;  3S14 C;  1IW7 A;  2NVY C;  2CX8 A;  3CZB A;  3W2V B;  5GAG W;  2AE0 X;  3FKI C;  2EGV A;  5GAD W;  2JA7 C;  3GTM C;  4A3G C;  4E8B A;  1VHY A;  2O5J A;  1D6K A;  3PO2 C;  4LLG A;  3PO3 C;  5C44 C;  5JVG S;  4A3M C;  4Y7N C;  2E2I C;  1TWG C;  2NVX C;  2KXY A;  4Y52 C;  3H0G C;  4OIR A;  3CF5 S;  3S1R C;  1YNJ A;  5GAH W;  1EUQ A;  1EUY A;  2KQ1 A;  2A68 A;  3LYW A;  4C3H C;  4A3B C;  4BY1 C;  2PJJ A;  1I3Q C;  4C3I C;  1ZYR A;  4H3S A;  3GTO C;  5IZN A;  4OIO A;  4QJV A;  4JXZ A;  4YG2 A;  4BBR C;  3HOX C;  4BBS C;  3M3Y C;  4A3I C;  1TWH C;  4OIQ A;  4KN4 A;  2PI8 A;  2WB1 D;  3S16 C;  4A3J C;  1NXZ A;  3X1L B;  2R7Z C;  4YFK A;  4X6A C;  4L69 A;  5C3E C;  1O0C A;  4XSZ A;  3HOU C;  3CQZ C;  4JXX A;  1NYL A;  4NOI A;  1Y1V C;  3WOD A;  5C4J C;  3GTQ C;  1ZJW A;  4G7Z A;  2VUM C;  4V19 4;  4ZH4 A;  3M4O C;  3KW2 A;  2JA8 C;  4G7O A;  1QTQ A;  5IYB C;  1QRS A;  1I50 C;  2G6G A;  3S2H C;  1TWF C;  5TMF A;  2GAE A;  2PNW A;  5BNZ A;  3DXJ A;  2CW0 A;  5IYD C;  1VHK A;  4A93 C;  4YFN A;  3W2W B;  2PIC A;  4AYB D;  4MQ9 A;  3EQL A;  1SMY A;  5IP7 C;  3S1Q C;  2YU9 C;  2A69 A;  4U67 S;  4IOA S;  1Y1W C;  3HKZ D;  4WCE S;  2EGW A;  1BDF A;  3GTJ C;  2PPB A;  2JA6 C;  3AII A;  4J3C A;  2ZJR S;  1FEU A;  3H3V D;  4MEX A;  1YNN A;  2G5D A;  3PIO S;  4WFB S;  3J7Z V;  4XLP A;  1HQM A;  3GTG C;  4WFN S;  3RZD C;  3HOY C;  4A3K C;  1I6H C;  4A3C C;  4WFA S;  2PA8 D; 
#chains in the Genus database with same CATH homology
 1GTR A;  5JVH S;  3DLL S;  5GAH W;  1EUQ A;  5DM7 S;  1EUY A;  1QTQ A;  1QRT A;  1UDX A;  4IO9 S;  1DFU P;  1QRS A;  4H3S A;  4H4K A;  5IZN A;  1B75 A;  5BNZ A;  4UY8 8;  4JYZ A;  4JXZ A;  3W2W B;  4WF9 S;  4IOC S;  3W2V B;  5GAG W;  3PIP S;  4U67 S;  4IOA S;  5GAD W;  4WCE S;  3X1L B;  1EXD A;  2RE8 A;  1D6K A;  3AII A;  2ZJR S;  1O0C A;  1FEU A;  5GAE W;  5JVG S;  3CF5 S;  3PIO S;  4WFB S;  3J7Z V;  1NYL A;  4JXX A;  1QRU A;  4WFN S;  2HZ7 A;  4P2B A;  5HL7 S;  5DM6 S;  2RD2 A;  1ZJW A;  1GTS A;  1O0B A;  4V19 4;  4WFA S;  2ZJP S;  2ZJQ S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...