1FF4A

X-ray structure of muscarinic toxin 2 at 1.5 angstrom resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
LTCVTTKSIGGVTTEDCPAGQNVCFKRWHYVTPKNYDIIKGCAATCPKVDNNDPIRCCGTDKCND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUSCARINIC TOXIN/ACETYLCHOLINE RECEPTOR BINDING PROTEIN
publication title X-ray structure of muscarinic toxin 2 at 1.5 Angstrom resolution
rcsb
molecule tags Toxin
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ff4A00
4FAOE 1QKEA 1FSSB 1RL5A 2MFAA 4QTIU 1LJZA 2QJ9C 1TXBA 1KL8A 3KFDE 1CDSA 6EBXA 1REWC 1HC9A 1W6BA 2CCXA 1QM7A 1NXBA 2K3GA 1QKDA 3U74U 2CRSA 1FASA 1CRFA 2J8BA 1NYSA 1TXAA 2L5SA 3NH7A 1L4WA 3BT2U 1FF4A 1IDIA 4FAOC 1CDQA 1LXHA 2MJYA 4EY8B 1CVOA 2HLQA 1VB0A 2OFSA 1LX5B 3NDSA 1KBSA 1KC4A 3BT1U 1FRAA 4LFTA 2LA1A 2X8BB 3FEVA 1BTEA 2MJ4A 2PJYB 1KBTA 1NYUA 1CREA 2H7ZA 4RUDA 2CTXA 1HAJA 1S4YA 1TFSA 4XJJA 5IMTD 1BXPA 1ABTA 2UX2A 3KFDI 2I9BE 1ES7B 1FSCA 1IDLA 2UWRA 1CDTA 1UG4A 1KXIA 4DO8A 2FD6U 1CDRA 5DZ5A 2MUPA 1F94A 1KBAA 1IDHA 2NBTA 4P7UA 1KFHA 1HC9B 1RGJA 4ZQYA 2ERAA 1M9ZA 2BTXA 1IDGA 1KU6B 2H64C 1DRSA 1PLOA 2VLWA 1JE9A 2H62C 1MR6A 2H5FA 1F8UB 1I02A 1H0JA 1KS6A 1ONJA 1V6PA 2H64B 2L03A 2GOOC 2MJ0A 3QB4B 3LAQU 2CRTA 2CDXA 2H62D 1NORA 1CXNA 2MUOA 1CODA 5EBXA 1KTZB 1XT3A 2GOOB 2N99A 1NTNA 2MHYA 4BIKB 1FFJA 4HQPF 1CCQA 1MAHF 1COEA 4AEAA 2QJAC 3ERAA 4OM4A 1CHVS 1NTXA 2ABXA 2H7ZB 2BHIA 1G6MA 1ERAA 1HAAA 3NEQA 3EBXA 1IKCA 3U73U 1ZADA 1ERGA 2JVEA 1CXOA 3EVSC 1NEAA 5DO6A 2H8UA 2QC1A 2QJBC 1YWHA 1CTXA 1IJCA 1CB9A 3VTSA 1TGXA 3PLCA 1LSIA 5DU1A 1HOYA 3HH7A 1JBDA 2JQPA 1JGKA 4OM5A 1LXGA 2PJYC 1IQ9A 1B41B 2HLRA 5IMYC 4UY2C 4BDTB 4IYEA 1IK8A 2LCRA
chains in the Genus database with same CATH superfamily
4FAOE 1QKEA 1FSSB 1RL5A 2MFAA 4QTIU 1LJZA 2QJ9C 1TXBA 1KL8A 3KFDE 1CDSA 6EBXA 1REWC 1HC9A 1W6BA 2CCXA 1QM7A 1NXBA 2K3GA 1QKDA 3U74U 2CRSA 1FASA 1CRFA 2J8BA 1NYSA 1TXAA 2L5SA 3NH7A 1L4WA 3BT2U 1FF4A 1IDIA 4FAOC 1CDQA 4KSNA 1LXHA 2MJYA 4EY8B 1CVOA 2HLQA 1VB0A 2OFSA 1LX5B 3NDSA 1KBSA 1KC4A 3BT1U 1FRAA 4LFTA 2LA1A 2X8BB 3FEVA 1BTEA 2MJ4A 2PJYB 1KBTA 1NYUA 1CREA 2H7ZA 4RUDA 2CTXA 1HAJA 1S4YA 1TFSA 4XJJA 5IMTD 1BXPA 1ABTA 2UX2A 3KFDI 2I9BE 1ES7B 1FSCA 1IDLA 2UWRA 1CDTA 1UG4A 1KXIA 4DO8A 2FD6U 1CDRA 5DZ5A 2MUPA 1F94A 1KBAA 1IDHA 2NBTA 4P7UA 1KFHA 1HC9B 1RGJA 4ZQYA 2ERAA 1M9ZA 2BTXA 1IDGA 1KU6B 2H64C 1DRSA 1PLOA 2VLWA 1JE9A 2H62C 1MR6A 2H5FA 1F8UB 1I02A 1H0JA 1KS6A 1ONJA 1V6PA 2H64B 2L03A 2GOOC 2MJ0A 3QB4B 3LAQU 2CRTA 2CDXA 2H62D 1NORA 1CXNA 2MUOA 1CODA 5EBXA 1KTZB 1XT3A 2GOOB 2N99A 1NTNA 2MHYA 4BIKB 1FFJA 4HQPF 1CCQA 1MAHF 1COEA 4AEAA 2QJAC 3ERAA 4OM4A 1CHVS 1NTXA 2ABXA 2H7ZB 2BHIA 1G6MA 1ERAA 1HAAA 3NEQA 3EBXA 1IKCA 3U73U 1ZADA 1ERGA 2JVEA 1CXOA 3EVSC 1NEAA 5DO6A 2H8UA 2QC1A 2QJBC 1YWHA 1CTXA 1IJCA 1CB9A 3VTSA 1TGXA 3PLCA 1LSIA 5DU1A 1HOYA 3HH7A 1JBDA 2JQPA 1JGKA 4OM5A 1LXGA 2PJYC 1IQ9A 1B41B 2HLRA 5IMYC 4UY2C 4BDTB 4IYEA 1IK8A 2LCRA
chains in the Genus database with same CATH topology
4FAOE 1QKEA 1FSSB 1RL5A 2MFAA 4QTIU 1LJZA 2QJ9C 1TXBA 1KL8A 3KFDE 1CDSA 6EBXA 1REWC 1HC9A 1W6BA 2CCXA 1QM7A 1NXBA 2K3GA 1QKDA 3U74U 2CRSA 1FASA 1CRFA 2J8BA 1NYSA 1TXAA 2L5SA 3NH7A 1L4WA 3BT2U 1FF4A 1IDIA 4FAOC 1CDQA 4KSNA 1LXHA 2MJYA 4EY8B 1CVOA 2HLQA 1VB0A 2OFSA 1LX5B 3NDSA 1KBSA 1KC4A 3BT1U 1FRAA 4LFTA 2LA1A 2X8BB 3FEVA 1BTEA 2MJ4A 2PJYB 1KBTA 1NYUA 1CREA 2H7ZA 4RUDA 2CTXA 1HAJA 1S4YA 1TFSA 4XJJA 5IMTD 1BXPA 1ABTA 2UX2A 3KFDI 2I9BE 1ES7B 1FSCA 1IDLA 2UWRA 1CDTA 1UG4A 1KXIA 4DO8A 2FD6U 1CDRA 5DZ5A 2MUPA 1F94A 1KBAA 1IDHA 2NBTA 4P7UA 1KFHA 1HC9B 1RGJA 4ZQYA 2ERAA 1M9ZA 2BTXA 1IDGA 1KU6B 2H64C 1DRSA 1PLOA 2VLWA 1JE9A 2H62C 1MR6A 2H5FA 1F8UB 1I02A 1H0JA 1KS6A 1ONJA 1V6PA 2H64B 2L03A 2GOOC 2MJ0A 3QB4B 3LAQU 2CRTA 2CDXA 2H62D 1NORA 1CXNA 2MUOA 1CODA 5EBXA 1KTZB 1XT3A 2GOOB 2N99A 1NTNA 2MHYA 4BIKB 1FFJA 4HQPF 1CCQA 1MAHF 1COEA 4AEAA 2QJAC 3ERAA 4OM4A 1CHVS 1NTXA 2ABXA 2H7ZB 2BHIA 1G6MA 1ERAA 1HAAA 3NEQA 3EBXA 1IKCA 3U73U 1ZADA 1ERGA 2JVEA 1CXOA 3EVSC 1NEAA 5DO6A 2H8UA 2QC1A 2QJBC 1YWHA 1CTXA 1IJCA 1CB9A 3VTSA 1TGXA 3PLCA 1LSIA 5DU1A 1HOYA 3HH7A 1JBDA 2JQPA 1JGKA 4OM5A 1LXGA 2PJYC 1IQ9A 1B41B 2HLRA 5IMYC 4UY2C 4BDTB 4IYEA 1IK8A 2LCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAO E;  1QKE A;  1FSS B;  1RL5 A;  2MFA A;  4QTI U;  1LJZ A;  2QJ9 C;  1TXB A;  1KL8 A;  3KFD E;  1CDS A;  6EBX A;  1REW C;  1HC9 A;  1W6B A;  2CCX A;  1QM7 A;  1NXB A;  2K3G A;  1QKD A;  3U74 U;  2CRS A;  1FAS A;  1CRF A;  2J8B A;  1NYS A;  1TXA A;  2L5S A;  3NH7 A;  1L4W A;  3BT2 U;  1FF4 A;  1IDI A;  4FAO C;  1CDQ A;  1LXH A;  2MJY A;  4EY8 B;  1CVO A;  2HLQ A;  1VB0 A;  2OFS A;  1LX5 B;  3NDS A;  1KBS A;  1KC4 A;  3BT1 U;  1FRA A;  4LFT A;  2LA1 A;  2X8B B;  3FEV A;  1BTE A;  2MJ4 A;  2PJY B;  1KBT A;  1NYU A;  1CRE A;  2H7Z A;  4RUD A;  2CTX A;  1HAJ A;  1S4Y A;  1TFS A;  4XJJ A;  5IMT D;  1BXP A;  1ABT A;  2UX2 A;  3KFD I;  2I9B E;  1ES7 B;  1FSC A;  1IDL A;  2UWR A;  1CDT A;  1UG4 A;  1KXI A;  4DO8 A;  2FD6 U;  1CDR A;  5DZ5 A;  2MUP A;  1F94 A;  1KBA A;  1IDH A;  2NBT A;  4P7U A;  1KFH A;  1HC9 B;  1RGJ A;  4ZQY A;  2ERA A;  1M9Z A;  2BTX A;  1IDG A;  1KU6 B;  2H64 C;  1DRS A;  1PLO A;  2VLW A;  1JE9 A;  2H62 C;  1MR6 A;  2H5F A;  1F8U B;  1I02 A;  1H0J A;  1KS6 A;  1ONJ A;  1V6P A;  2H64 B;  2L03 A;  2GOO C;  2MJ0 A;  3QB4 B;  3LAQ U;  2CRT A;  2CDX A;  2H62 D;  1NOR A;  1CXN A;  2MUO A;  1COD A;  5EBX A;  1KTZ B;  1XT3 A;  2GOO B;  2N99 A;  1NTN A;  2MHY A;  4BIK B;  1FFJ A;  4HQP F;  1CCQ A;  1MAH F;  1COE A;  4AEA A;  2QJA C;  3ERA A;  4OM4 A;  1CHV S;  1NTX A;  2ABX A;  2H7Z B;  2BHI A;  1G6M A;  1ERA A;  1HAA A;  3NEQ A;  3EBX A;  1IKC A;  3U73 U;  1ZAD A;  1ERG A;  2JVE A;  1CXO A;  3EVS C;  1NEA A;  5DO6 A;  2H8U A;  2QC1 A;  2QJB C;  1YWH A;  1CTX A;  1IJC A;  1CB9 A;  3VTS A;  1TGX A;  3PLC A;  1LSI A;  5DU1 A;  1HOY A;  3HH7 A;  1JBD A;  2JQP A;  1JGK A;  4OM5 A;  1LXG A;  2PJY C;  1IQ9 A;  1B41 B;  2HLR A;  5IMY C;  4UY2 C;  4BDT B;  4IYE A;  1IK8 A;  2LCR A; 
#chains in the Genus database with same CATH topology
 4FAO E;  1QKE A;  1FSS B;  1RL5 A;  2MFA A;  4QTI U;  1LJZ A;  2QJ9 C;  1TXB A;  1KL8 A;  3KFD E;  1CDS A;  6EBX A;  1REW C;  1HC9 A;  1W6B A;  2CCX A;  1QM7 A;  1NXB A;  2K3G A;  1QKD A;  3U74 U;  2CRS A;  1FAS A;  1CRF A;  2J8B A;  1NYS A;  1TXA A;  2L5S A;  3NH7 A;  1L4W A;  3BT2 U;  1FF4 A;  1IDI A;  4FAO C;  1CDQ A;  4KSN A;  1LXH A;  2MJY A;  4EY8 B;  1CVO A;  2HLQ A;  1VB0 A;  2OFS A;  1LX5 B;  3NDS A;  1KBS A;  1KC4 A;  3BT1 U;  1FRA A;  4LFT A;  2LA1 A;  2X8B B;  3FEV A;  1BTE A;  2MJ4 A;  2PJY B;  1KBT A;  1NYU A;  1CRE A;  2H7Z A;  4RUD A;  2CTX A;  1HAJ A;  1S4Y A;  1TFS A;  4XJJ A;  5IMT D;  1BXP A;  1ABT A;  2UX2 A;  3KFD I;  2I9B E;  1ES7 B;  1FSC A;  1IDL A;  2UWR A;  1CDT A;  1UG4 A;  1KXI A;  4DO8 A;  2FD6 U;  1CDR A;  5DZ5 A;  2MUP A;  1F94 A;  1KBA A;  1IDH A;  2NBT A;  4P7U A;  1KFH A;  1HC9 B;  1RGJ A;  4ZQY A;  2ERA A;  1M9Z A;  2BTX A;  1IDG A;  1KU6 B;  2H64 C;  1DRS A;  1PLO A;  2VLW A;  1JE9 A;  2H62 C;  1MR6 A;  2H5F A;  1F8U B;  1I02 A;  1H0J A;  1KS6 A;  1ONJ A;  1V6P A;  2H64 B;  2L03 A;  2GOO C;  2MJ0 A;  3QB4 B;  3LAQ U;  2CRT A;  2CDX A;  2H62 D;  1NOR A;  1CXN A;  2MUO A;  1COD A;  5EBX A;  1KTZ B;  1XT3 A;  2GOO B;  2N99 A;  1NTN A;  2MHY A;  4BIK B;  1FFJ A;  4HQP F;  1CCQ A;  1MAH F;  1COE A;  4AEA A;  2QJA C;  3ERA A;  4OM4 A;  1CHV S;  1NTX A;  2ABX A;  2H7Z B;  2BHI A;  1G6M A;  1ERA A;  1HAA A;  3NEQ A;  3EBX A;  1IKC A;  3U73 U;  1ZAD A;  1ERG A;  2JVE A;  1CXO A;  3EVS C;  1NEA A;  5DO6 A;  2H8U A;  2QC1 A;  2QJB C;  1YWH A;  1CTX A;  1IJC A;  1CB9 A;  3VTS A;  1TGX A;  3PLC A;  1LSI A;  5DU1 A;  1HOY A;  3HH7 A;  1JBD A;  2JQP A;  1JGK A;  4OM5 A;  1LXG A;  2PJY C;  1IQ9 A;  1B41 B;  2HLR A;  5IMY C;  4UY2 C;  4BDT B;  4IYE A;  1IK8 A;  2LCR A; 
#chains in the Genus database with same CATH homology
 4FAO E;  1QKE A;  1FSS B;  1RL5 A;  2MFA A;  4QTI U;  1LJZ A;  2QJ9 C;  1TXB A;  1KL8 A;  3KFD E;  1CDS A;  6EBX A;  1REW C;  1HC9 A;  1W6B A;  2CCX A;  1QM7 A;  1NXB A;  2K3G A;  1QKD A;  3U74 U;  2CRS A;  1FAS A;  1CRF A;  2J8B A;  1NYS A;  1TXA A;  2L5S A;  3NH7 A;  1L4W A;  3BT2 U;  1FF4 A;  1IDI A;  4FAO C;  1CDQ A;  4KSN A;  1LXH A;  2MJY A;  4EY8 B;  1CVO A;  2HLQ A;  1VB0 A;  2OFS A;  1LX5 B;  3NDS A;  1KBS A;  1KC4 A;  3BT1 U;  1FRA A;  4LFT A;  2LA1 A;  2X8B B;  3FEV A;  1BTE A;  2MJ4 A;  2PJY B;  1KBT A;  1NYU A;  1CRE A;  2H7Z A;  4RUD A;  2CTX A;  1HAJ A;  1S4Y A;  1TFS A;  4XJJ A;  5IMT D;  1BXP A;  1ABT A;  2UX2 A;  3KFD I;  2I9B E;  1ES7 B;  1FSC A;  1IDL A;  2UWR A;  1CDT A;  1UG4 A;  1KXI A;  4DO8 A;  2FD6 U;  1CDR A;  5DZ5 A;  2MUP A;  1F94 A;  1KBA A;  1IDH A;  2NBT A;  4P7U A;  1KFH A;  1HC9 B;  1RGJ A;  4ZQY A;  2ERA A;  1M9Z A;  2BTX A;  1IDG A;  1KU6 B;  2H64 C;  1DRS A;  1PLO A;  2VLW A;  1JE9 A;  2H62 C;  1MR6 A;  2H5F A;  1F8U B;  1I02 A;  1H0J A;  1KS6 A;  1ONJ A;  1V6P A;  2H64 B;  2L03 A;  2GOO C;  2MJ0 A;  3QB4 B;  3LAQ U;  2CRT A;  2CDX A;  2H62 D;  1NOR A;  1CXN A;  2MUO A;  1COD A;  5EBX A;  1KTZ B;  1XT3 A;  2GOO B;  2N99 A;  1NTN A;  2MHY A;  4BIK B;  1FFJ A;  4HQP F;  1CCQ A;  1MAH F;  1COE A;  4AEA A;  2QJA C;  3ERA A;  4OM4 A;  1CHV S;  1NTX A;  2ABX A;  2H7Z B;  2BHI A;  1G6M A;  1ERA A;  1HAA A;  3NEQ A;  3EBX A;  1IKC A;  3U73 U;  1ZAD A;  1ERG A;  2JVE A;  1CXO A;  3EVS C;  1NEA A;  5DO6 A;  2H8U A;  2QC1 A;  2QJB C;  1YWH A;  1CTX A;  1IJC A;  1CB9 A;  3VTS A;  1TGX A;  3PLC A;  1LSI A;  5DU1 A;  1HOY A;  3HH7 A;  1JBD A;  2JQP A;  1JGK A;  4OM5 A;  1LXG A;  2PJY C;  1IQ9 A;  1B41 B;  2HLR A;  5IMY C;  4UY2 C;  4BDT B;  4IYE A;  1IK8 A;  2LCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...