1FFPB

Crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
b'MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidic termini play a significant role in TCR recognition
pubmed rcsb
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B, ALPHA CHAIN
source organism Mus musculus
molecule tags Immune system/signaling protein
total genus 14
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ffpB00
1CICD 4WFHE 1OT1A 3PV6B 4OSUL 3MV01 5D7IA 4DW2L 2LAAA 5BQ7B 1ZHNB 3GMNA 1NBYB 1G0DA 3ISWA 5AD0A 4X5WB 3DBXB 3S4SB 5I1HH 4AL8H 1HK6A 3AU1A 2OYPA 4LSUH 4POZD 5HGDA 2GQHA 5I16B 3P3YA 2R0WH 3JUYA 4KJWD 4RFEB 4ZPTB 3EOAB 1P5UA 1XF4A 3QCVL 4B7LA 3TBVB 5FA4B 7CGTA 3PWVB 5J1AA 5E00A 5EA0L 4DUVA 1R3HA 4YHML 4MA7L 5EOTB 4LVOB 4OI9A 2BY2A 5F7DB 3FO2B 3TA3C 1J8HA 4P9HC 2B2XL 1T04A 2PTTB 3ARDA 3WFZA 2Q6WB 3BSZL 5D72L 2EH8H 4ODHL 4M9OA 1QYGL 5C0IA 2EC9T 4U31A 2J1KA 4CW1A 2R1YA 4UMGA 3X13A 4X6EA 1SEBB 1CDHA 5CILL 1MCLA 1VEMA 1UB5A 1GXEA 4DOHB 4FZ8L 4Z7OE 3D1MC 1QPXA 3DV4B 4EI5A 1BJ1J 3HB3D 1OAKH 4AEIL 3R8BB 3WFEH 5TJWK 2VITA 1F4XH 3OR6A 2H6PA 2XZQL 2EICA 4F37K 2UY6A 3ARBC 4TTGA 1BOYA 2DJUA 4F9LC 1BFTA 4K9EL 1S7WB 2W60B 3O6KL 1XF3A 1ZLWK 5A2LH 1JMXA 1ZGLA 1H3UA 1ZEAL 2N4IA 4JM2A 1MWAH 1GOHA 3D3VA 3MLSL 3HI6H 3O2DH 3U7WL 2EDHA 4OIAA 5AG8A 1KJ3L 4B53A 3U82B 2CDFB 1BZ7A 1G7IA 5DJ6A 2ORBH 1NGPH 4L4VD 1JGLH 3LS5L 3TA3B 1E6JH 1CFNB 1CLCA 2WNGA 4DK6A 4LPXA 5FB8B 1BFSA 1BPVA 4MQXC 4YGVA 1SJXA 3GMLB 3JTTB 5E7BA 1KT2A 3MV8E 1MHCB 3ARTA 5GSVA 1NGZB 3DTXA 3QAZC 4EXKA 1XR9A 2HP4A 2EYSA 3SCMC 3NPZB 4MWFB 1W72H 5HYSB 4EBQH 2IG2H 3ARYA 5DHYA 1FNGB 5FYLL 1UCTA 4KQ4L 3T0WA 5FYJD 3AXLB 1D5ZA 3H9YA 1JFQL 2NNAA 4EDWH 3ARBB 5EBWB 4M48L 1OVZA 3DUUA 3O3BB 5IGXH 3EYSH 1BD2B 1ZLUH 3G6DL 4KJQC 1XH3B 3SOBL 2UV3A 1GGBH 1ZHBA 3MNZA 2M1KA 4NFDA 4LHQB 4G7YH 3ARGC 3QQ4B 5MEQB 3FO1A 4G9FA 3FQWB 3IVKB 4DZ8B 1S9WA 3RAJL 1DN2A 3NCMA 2FJHB 4I0KA 2P5WA 1QO3A 3BX7C 3QI9C 4UT7H 5F9WB 3UTPD 3QFDA 4ZFZB 4GKSB 2R39A 1ZVYA 5IQ7H 1TZGH 3FRUA 3Q6FB 4O5LH 5AYUH 2EDRA 2NY4D 5FO8A 1WZKA 4LCUA 4ZUTB 5M7QA 1JZ3A 4AIXA 3QAZB 2APTA 5F9JA 5DS8A 1MFEH 5T1MA 1MJ8H 4HGMA 3MR9B 4AMKH 1MWAA 2ILLA 4HGWB 3TO4A 3G5ZB 3CX2A 4JDVA 1QSFE 1N59A 5E95B 1FFNB 3QNZB 3O2DA 4TUOB 4ZUSB 4Q97A 3RWCA 3EOBA 3VWJC 1BQLH 1S7VA 5JZ7D 1FLRL 3C5ZD 5IBLD 3VXNA 1P4IL 2E9IA 2Z8RA 5C0CD 4PJ8D 4PGJA 1TJGH 4GMSL 4KMQA 2XQYG 5KVMC 1EXUB 3ARGB 1SJHA 3TT3L 5C0RH 1T89A 1ZHKA 3HNTL 1RUPL 4Y19A 2F19L 2I07A 4IMKA 5I15H 1OCWH 2XV6B 3L5IA 4HXBH 4J4PD 3S34L 1W72A 1AQKH 3QI9B 1DEEA 1ZS8A 3RRQA 4NKMA 4D0CB 4NHUB 1JN6A 1G9ML 5CSZA 4AT6A 5CFHA 3TIEB 3GBML 1CDJA 3S36L 3OKDA 1RUML 1XGTB 1OAZL 4AYFA 2GTWB 3S37H 4K8RD 1QLEH 1DBBH 2UZIH 3P0YL 4HBQA 3VXQA 3IDNA 5J06A 1KULA 2HT3D 1FN4A 4NUJA 1P84K 3VXMA 1YC8A 3OB0H 5C0JA 3LEXA 1GAFH 1KB9K 2F53D 4LBEB 1MCRA 3QIUA 3VI3F 2CRZA 2QHRL 2NY7H 1HINH 3VFGH 1YN7A 1LEIB 1DBKH 5D6CB 4RGMC 5TDPA 1YEJL 3NPSC 5FKAA 3VXRB 2FH8A 1CLOL 3WEXB 3O3EA 3WHXA 3U0WH 1UENA 3AM8A 5FKPB 1X44A 4QCIA 3QXDA 3ZDZF 4LLYA 3VXRE 1JZ7A 3TP4A 1QFWM 1SYSB 3PWNA 2F58H 1XGYL 2VZ1A 3TJEH 1I7RB 2BDNH 4NN6C 4P2QD 2FEEI 1IC1A 3PG2A 4LRIC 4P5KB 1CDBA 2Q1EA 2GFBB 3JWNC 5I18L 3SJVD 4RAHA 2V17H 1RZIB 3FB5B 4G7VL 5A2IH 3JVGC 4HCRH 1Q38A 1MELA 5DGQA 5IROC 4OV5A 2E7CA 5IKCA 1J1XH 2F5BL 3O3AA 3C5SB 1MCBA 2XRAH 1MI5B 1LEKA 2D31B 2C3VB 2XOTA 4ALAL 2VLJA 3C2AL 1MI5E 2B8OT 3RJQB 1U95B 2A74B 3IXAB 4Z9KB 2PYEB 4M43L 2ZCKH 2R0KL 3HMWH 4TVPE 5GIRA 5E8PB 3B8YA 1ZA3B 4MHHG 2PYEE 2QQNL 2OR9H 2CK0H 4JFFB 1CXEA 5A40E 2ZSWB 3RL1B 1EIBA 1Q94A 1Z9LA 1FRGH 4EQ2A 2GJZB 3FO0H 1FDLH 4QXWA 3BD5A 5T1KB 4XNMB 1YEIH 1TCMA 2GUOB 3NPSB 3RWEA 4Z78A 4L4TE 4X0KA 4NYLB 4OFIA 4XNQB 5LXGL 4HEPG 4MNQD 3H7BA 4UV4H 1K3IA 4LVNC 2NY2B 3MLRL 4M1DH 1C5BL 1HCVA 4JFXA 4YHIB 4YHZH 2OL3B 3IDIB 3JWDH 1TJIL 3H9HA 1JZ8A 3NCEB 3U6RA 1QKZL 5IB2B 4DVBA 3S4SG 4IS6B 3WNPA 3DARA 4RFOH 4Z76A 3QG6B 4G3YH 3PDDA 4OIIL 2ED9A 2YPLA 4DKEL 4U1GC 4TSCH 4NM8L 4BZ2H 4U6XB 3DO7A 1FBIH 3ILQC 5DD3L 3MLZL 4NC0B 4Z0BL 3VI3E 5C09A 4M5ZL 3QCTL 1T5XA 5TQ2H 1HHIB 4JPKH 4IDJL 3T3ME 4KK5D 4PTUA 4MQ7B 3IAQA 5T5NG 4QYOB 5DQJA 4N0YH 3GUTA 2EKJA 1HXYB 4ONGH 3WNMA 2DQHH 4S1SH 5IB1A 3IYLW 4NHCL 3RY6A 3ZDZE 2IGFL 1CN4A 4FFWC 2VDLL 4KRMB 2HRLA 5FYLD 5E5MB 2YN3A 4HCRA 1XGQA 4FMKA 4X6CF 5BRZA 5F7WC 4AZ8A 1ACZA 1ZSDB 5F3HA 2CUMA 1LDPL 3RDTA 3L3GA 4HFWB 5JMOC 5DUPL 4QLRA 3RTQD 3GI9L 4BFIB 3CFJA 3IFNH 1QFUL 4X6FB 3RNQB 4QRSB 2YHGA 3IJSB 1HQRA 2GK0A 3C08L 2OX5A 1H0DA 4WO4C 3TBSA 4XCYB 4ACPA 3UYRL 3ULUF 1ND0B 1B0RA 2NR6C 4UINH 4BSVB 2YUWA 1DR9A 3DXAD 2AEWA 3MRKA 2YA0A 1U8KB 4KJYB 5KW9L 3PP3H 3MREB 4PJIF 3A6CH 1W8OA 3O4LD 4QRQB 3DBXA 4X5WA 4Y2DD 3S4SA 1WEJL 2YKLH 4ODSH 2AK4D 4UT6H 1E4JA 1HHJB 2YBRB 1QHOA 5DZLA 3BEWA 4PUBL 4JZNA 4LGRB 5DRWA 4ZPTA 4RFEA 3RBGA 4P59H 3EOAA 4HC1A 6CGTA 3EJJX 4HUVA 3RJDA 3PWVA 4NCC1 5J11C 4Z7WB 1KB5H 4DN4L 4GAFB 1PQZB 1GGYA 5EOTA 3G6AB 2FB4L 2VSCA 5FAAA 1MCHA 2EECA 3FAXA 2DAVA 2Y07H 1J18A 2E5EA 5F7DA 5HYSG 2XWBB 5SWSB 3QUZD 1JNLL 1U93B 2Q6WA 1TJHH 3V6FA 4HZAA 2JJUA 4O4YL 5SWSE 2HH0H 5EORL 1WWAX 3QO0B 5JA9A 1QFWI 4YX2H 4XP4H 4EN3A 1SEBA 5DJXB 2DQCH 3ILPB 4YHOL 2W0PA 2VXSH 3ARZA 3DV4A 3GGWA 2N56A 3KWWB 4JR9L 2QSCL 3HUJF 2D4DA 3K8KA 2AABH 5DK3A 3O2VH 1Y6NR 2Y6SD 3PWPB 5TH2B 2CRIA 4MAYB 5HVGB 4X6CB 2W60A 3BMVA 3F62A 4X6CE 2YA1A 5L7XL 3X3GH 3MRPB 4YFLI 3V4VL 2FX8L 5JQ6H 2VZUA 3I84A 2WV3A 4OQTL 4RAUB 1MEXL 5IBTH 3WFBH 4OLYH 2XKNB 1KEMH 2K3TA 4UTBH 1I1FA 1MCOH 3ZYZA 2VYRE 3IJHB 1N8ZA 3MV8A 1I9RH 4BK4A 4KDVA 5TGBB 4QRRD 2CUIA 2Q8BH 4RZCB 3ULUE 1EEYB 3JTTA 3ARPA 3W81A 1QBAA 3K7UA 1AGEB 1MHCA 3RU8H 1I7UA 5L0QC 3GIVB 4DVRL 4PJIB 3HFML 1R3JB 2NYYC 1VERA 1YYLL 4J12A 4MD4A 4ENED 2AKRA 3S36X 4XMKH 5HYJB 5HYSA 4HKJB 1FNGA 1ADQH 1N0LA 2AEPL 4GKNB 1EAJA 3DNKA 4X6BB 5HYJE 3DVNA 3TM6A 4HLZH 3NZ8B 4OM0L 3B43A 4OZ4B 4JZJB 4EDXB 5TF0A 4WWID 1EJOH 4NM4H 5EBWA 3NA9H 4LFHG 3B9KB 1DUYB 3O3BA 4LMQI 1IKNC 1HILB 4LKXB 2AEIT 4FABH 1XH3A 4WY7H 4XNZB 3UZQA 2VABA 3KPPB 4UUJA 1NBZB 3FQWA 4V2BA 4GW5A 3NIDF 2FJHA 3MRLB 4HIXH 2W1NA 1KNOB 2EEAA 2ICEB 4ZFZA 3TBYB 2DYPB 4KPHH 2NXYD 2X1QA 4RA3A 4EKXA 3F7VB 4FN0A 4EUPB 3HR5B 4RSVA 5KSVB 4WDIB 1KTDA 3AREA 5GGQH 1IGCL 3HUJB 1YEDB 1KCSH 1I1AA 3BIKA 4WFFE 5AWNL 4KI5F 5GRUH 3HUJE 2BVUA 4LLVA 1S5IH 1UWGL 5DHVB 4OI8A 4CADB 5I1IL 1QSFA 2DWEB 1UM4H 4I48B 2EKSA 3QPXH 5GGSY 3U4EA 5JOPE 1A02N 1YEEH 4RNRB 5F6HJ 5I71B 5TQ0L 3G5ZA 4D9LL 1P69B 2WUCH 1ZLSH 1PZUB 1OQOA 4ZUSA 4N0FB 1IGFH 1VA9A 4DEPC 3VGEA 4TVPH 1KF9B 3TYFB 2AGJL 1J12A 2OMBA 4MQTB 1T2QH 3QEGH 1MIEL 3RVUD 5B8CC 5MERB 3C09C 3FCTA 3SDYL 2GSGB 1I7ZB 2HWZL 3TZVD 3CU1A 5HGHB 2EC9U 4NQCD 2C1OA 5ILTH 3BHBA 4JQXC 4YNYB 1A5FL 2EE2A 2P8MA 4LSRH 2IAND 5I8CB 4LK4A 5EN2B 4GG8B 1DTUA 3AC0A 1ADQA 5I66B 4D0CA 3KPMB 4NHUA 2XNAB 5I1HL 4FNLH 4PJBE 4OTXH 1IEBA 2UUDK 5JW3H 2CPCA 3W5NA 2ICWI 1BFOB 3OKLB 2R0WL 1I3VA 1X4YA 1EBPA 1TETH 2OL3H 4WGWB 5E70A 3C60C 1LMKA 5FM8A 2PO6C 2QR0B 4DJMA 3T0EC 4GT7A 3BRFA 4LBEA 4FFYH 1H3GA 5INCB 3HLAA 4HWBH 5H2BB 5DMGC 3WO4C 3GI8H 3EYUH 4FTVD 3REWA 3B2UD 1AE6H 1UKQA 4AM0B 3MRQB 3O8XA 3MLWH 2BP3A 4QHMB 1NAMB 5C07D 5D6CA 4YXKL 4DEPB 3E8UL 3VXRA 4JJHA 5EO0A 3WEXA 5A16B 3NIDE 1QZ1A 3JBG7 2DM3A 3QJFB 2WIIA 5FKPA 5B8CB 4J1UB 1U8MB 5J4MA 1U8HB 5MHSD 4LAJH 3VWKD 3C09B 4PFEA 3WFHA 1QHPA 1FNLA 1OAKL 1I7RA 2CDGA 1T80A 5HBBA 4WI7A 3WFEL 5FYJU 2JF1A 2GTZB 2GFBA 1IGTA 4GG6F 5H94A 3OJDA 4RIRA 4HMDA 4MAUL 2XY2A 3FB5A 3LKNA 4KI5E 2XTJB 4JFQB 1VSCA 5J1TC 3QXUA 4PR5B 1MY5A 1NKRA 4IEFB 4U6YA 1MI5A 1MWAL 4MNHB 2C3VA 2OTUB 2BVYA 3HI6L 5FUCC 3D0LB 4P5TC 4LCIH 1EEZB 3C60B 5SWZE 3IXAA 2A74A 3KLHD 3GKWH 5DT1H 3V5DB 3T0EB 5GJTL 1XZ0B 1T21B 1K9TA 4YK4C 1NGPL 5E8PA 1ZA3A 2YWZA 5HXMA 5L8KB 4IRSC 1JGLL 1E6JL 1QNZH 3WO4B 2X1OA 5BO1H 2ZSWA 5T3XE 1V7MH 3RL1A 1KIPB 1AXSB 4NQTA 4PB0H 3EJYD 1C12A 1W0VA 2CMRH 4PJ9D 4L4TA 1F8TH 1VADA 2P1YA 4ZTOH 4XNMA 1FNSH 4GBXC 5HSFA 2BJMH 4M8QA 4P99A 4X7TB 2FYYA 3DMMC 1DEDA 1KG0B 1YYML 4XNQA 1REIA 4ONHA 5MEND 1U8NB 3MRDB 5LAXB 4EBQL 5IHBA 2DI8A 2DQFA 3W9DB 5EU7C 1I4FA 1QLFA 3UTTD 3M45A 2X1XR 2OL3A 5D2NB 2VXQH 4NNYB 4NGHH 1S78C 2RCSH 4K55A 1CD1B 1UEMA 5IJVB 1DE4B 4LEOB 4HEME 1XF2B 4JVWA 1MCEA 4EDWL 5D7JD 4KROC 5D2NE 5L2JB 4IS6A 1X9QA 5FHBH 3VE0B 3BIBX 4HWBA 2H45A 3HG1E 3ZSSA 2VLLB 5C71A 1I9JH 3EYSL 2B1HH 2A6KB 1QRNB 2IH1A 4M03A 5E94B 1Y18A 1JF5A 5L2KD 5EH1A 3FQTA 4G7YL 4FQXD 3FQRB 3GK8L 3PL6C 3QXTA 1QRNE 5EFIA 4P5TB 2NLJB 3SO5A 2YD3A 1PKQB 1C5CL 1P7HL 2V2WA 3FN9A 3VFPB 3QWOB 1M1SA 1HHIA 1Z6JT 2X89D 4IRZH 4MQ7A 4Y4HC 4ZXBC 4IRSB 1PKQE 2BOCA 5IQ7L 1TZGL 3S9DB 1YN6A 4F33B 1IZKA 1ES0A 5AYUL 5GRXG 1Y0LB 4ZS6D 3DRTA 1NEZG 1SMOA 4HX1A 4KDWA 3P4MA 4WEBH 4GG6B 4YAQB 3DMMB 5BZDA 3V52H 4LLWB 1LNUA 1ZSDA 1MFEL 3QHFH 4P46B 4GG6E 4AMKL 4HFWA 2EDLA 3WBDA 4G6KH 1FH5H 5EC2B 4X6FA 5ESVA 4P57B 5BXFB 3QDJD 3DX9B 1T1ZB 4OF3A 1BQLL 4LLQB 5DRZA 5JIIA 4MS8C 3JWOH 4XCYA 3UTOA 4HIJB 4KHXH 3ULUH 4LQ1A 3MV9B 4Y0GA 4K7PH 5DJCB 2IAMD 5F96H 3I6GB 5C0RL 3WJLA 5D7KD 3WFCH 3QCUH 2VISB 1KC5H 3MV9E 2DRUA 1N4XH 1RAMA 5I15L 5E5RB 5L88L 1GSMA 1OCWL 3UJJL 4QRQA 4OCWH 1JRHH 1AQKL 4Y4HB 3KPLA 5GS3A 3CPLB 4LCWB 2YBRA 3I3DA 2EDXA 3QUYA 4LCWE 4WGVB 1U8QB 5D1XC 1QRKA 2YD6A 2DD8H 3P0VH 4YH6A 3QWQB 3S37L 5FGBA 2YD1A 1QLEL 1DBBL 5CEZD 2UZIL 2V7NB 1CVRA 3EJZC 1WK0A 4KZDL 3G6AA 3GMPB 4X9HA 1MCNA 2ZSVB 1RVFH 2H9GB 3E1F1 5SWSA 2FJFB 3D3VD 5T5FH 1ACYH 1PLGL 3NFSH 1NUNB 4JHZA 3U48A 5J13C 4G6JH 1NEZA 2H8PA 2COQA 4DGIL 2NY7L 1HINL 3VFGL 5KANI 3T8XB 5EU4B 1DBKL 5F8RC 2E6PA 3QWRD 3L3DB 3ILPA 5DJ2B 3V4UH 3U0WL 2BMKB 1DUZA 2UVEA 2AJVL 2P45B 1MCCA 4PV9B 4HULB 2YPKB 3ROLA 2F58L 5DWUH 3GHEL 2BDNL 3BMWA 1MVFA 3G6JF 4JM4H 4XPFH 5TH2A 3HZYA 4JJ5A 3EUUA 4MAYA 5CEXB 4M6AA 4X6CA 2BNRA 2X9WA 1A7NL 2HKHH 2QLVB 2V17L 5BV7H 2A1WL 1IZJA 4W81A 4OT1H 2DIBA 5EU6B 1J1XL 4EUPG 2HG5A 2E8YA 1YEGH 2W9DH 3L5WB 5D1XB 1NMBH 4CAGA 5DK2B 1ZLVH 3B8SA 2VDNL 4RAUA 1JZ2A 3SDDB 1EHLH 1EZVX 2ZCKL 3IJHA 5TDNB 3VFTB 3HMWL 5TGBA 4TSAH 2ENSA 1IGYB 4RZCA 1T6VN 3ULSA 5J13B 1UYWH 1HOCB 1ZXQA 2V7HA 2OCFD 4ZSOE 5E6IC 5LCVH 3T1WA 1FRGL 1S7QB 2WZPD 1NC2B 3EO0A 1FDLL 3FO0L 3RVWD 2R4RH 5D1QC 3BP7A 1V8HA 4ODBD 1O7VA 3N50A 1SEQH 4DFHA 5HYJA 1G7LB 1A7PH 1AD9B 4ODTH 5DEFB 5ISZE 4KKBC 5HPOA 4X6BA 4UV4L 4JZOB 3FQUB 4FG6D 4MJIB 1D5MB 4M1DL 2VDQH 3B5HA 4YDLB 1XEDA 4JZJA 4EDXA 2NW2B 1JTPA 3QDGB 4O2FB 3JWDL 2DBLH 5F7LB 2B0SH 1OP9A 4HC1L 3B9KA 1DUYA 3ULVL 3WJJA 5DMKB 3QDGE 1HILA 3TO4D 4K3EL 4S1QH 4QT5B 1MCWM 2G60L 4JO3H 3SQBA 1KPRB 1BZQK 2FLRT 2FSEA 4UU9B 1UH4A 1OSPH 3MGTA 1OM3L 2RR3A 3FFCB 4ZYKB 4NRXA 5IW6B 4I0PC 5EB9A 4TSCL 3RBSA 2XXMB 1FCGA 1NUGA 5LGHH 3D39B 4QF1B 1WISA 1A3LH 5I0ZA 3F7VA 3W11D 5DF0A 4G5ZH 3HR5A 4N0YL 3U4BL 2GCYB 3D39E 4OZHB 1F58H 1JNNH 4F7CA 1J86A 4Y8AA 5ITBL 3HUJA 1YEDA 4ONGL 4OKVB 1MJ7H 2DQHL 4MJ4A 5E1AB 5E6IB 4WHYH 3U0PB 3G6JB 4CMHC 2JB6B 5CMAB 3TBWB 3QQNA 4PJDF 4M3JA 5D1QB 4K3GA 3PNWB 1ZA6B 4J23A 4CADA 4S0SD 3GJFH 3G6JE 4I48A 5LGKA 4PTTB 3V5HB 2XXCB 3UBXI 4LU5L 3TYGH 4WHYG 3WNKA 4N0FA 2J8HA 4OCXL 3IFNL 2V5YA 5E9DE 3H8NA 5I19H 2E3VA 4WWKA 4FA8A 4P49A 4CN1A 3LHPL 2OXHA 4KK6D 2GJ6D 5T3ZD 3CFIC 3IU3B 3TWCH 2NZIA 2VDMH 3T0XA 1AKJB 3OF6A 3QIUD 5T3XH 5A2FA 4UINL 3PABA 1T5WA 1DQDH 5DUBA 4U6HA 1MRFH 4I0PB 4QHNB 2B7DT 3QIWD 4YNYA 3QDMB 4FXKB 1TVDA 4PJBA 5IG7B 4TUKL 5I8CA 3A6CL 5EN2A 1WICA 3OXSB 1JZ5A 1I8KA 2XNAA 2YKLL 4ODSL 3S35H 4UT6L 5SWQA 3BN9D 3OKLA 1DVFB 2N7BA 1XAUA 4WUUD 3OAZH 2D9CA 1ORQA 2P8PA 1Z5LB 3QULB 1A0QH 5ICXB 5K9OB 3PQYB 2V2XB 2G75B 1HHHB 4MXQD 3MUHL 4APQD 5IFJB 2XN9E 1YEKL 2YD2A 5H2BA 1FPTL 2NY0C 5GZOC 3WN5A 1NCCH 2C3HA 1TJHL 3BW9A 5CJOH 2XQBH 1TITA 1FYTB 2HH0L 3IJYB 4FZEH 1II4E 4PLJC 4YX2L 1MQ8A 5A16A 4XP4L 2AJYH 3VA6A 1FYTE 1U8MA 2DQCL 3BP6B 3L3IA 4K3DH 4KKAD 1H15B 1CGWA 3GIZL 1F4WH 4MVBC 1UQSA 3GSNB 4YQXH 3VGHA 3ZTNH 2FATL 2GTZA 2AABL 4WHTA 3GJFA 5D7LE 1SMAA 3OGCB 1I8MB 2HT2C 3LKOB 1CFQA 2Q86B 3D2UA 2JJSA 1CLZH 2YZ8A 4PJDE 2H32B 1ZGLP 5CLWA 4HH9B 4QOKA 3CLEH 1F3DH 2FHFA 4PR5A 1E28B 2D7QA 1RUAH 3CVHH 3X3GL 5SWZA 5KSAA 1J0YA 4UIKH 2JIXA 2OTUA 4L1HA 4PY7B 3IDYB 3D0LA 1EEZA 2VNCA 2V9TA 3D25A 43CAA 3V5DA 2PXYD 3WIFB 5BS0D 1ZHLB 3TV3H 3CJJA 5D93B 1XZ0A 5IBTL 3WFBL 2DL2A 4CJ0A 4OLYL 1ITCA 5K9JH 4UTBL 3MLTB 3IDUA 2YPLD 2NY0B 2UYLB 1I9RL 2H41A 1L0QA 4HFUH 2WLYA 1G1CA 3X12A 1KIPA 1X5IA 2PKDA 3K80A 4XC1H 1FIGH 1AD0B 4PRIB 3RU8L 1A2YB 1I3UA 1RMFH 2H2SC 4NPYB 1RZKH 1JCKA 4YIQB 1KG0A 4GJTB 2J6EH 4PRIE 4BQ6A 2XZCL 4O02H 2ENYA 4YFLF 2X44D 5HGGS 4XMKL 3QRGH 4XPHH 3MRDA 4YPGA 1ADQL 4HW6A 3S37X 4KDTA 2DQJL 1B2WH 1KLUB 5D2NA 4NNYA 2PYFB 1Q9WB 1ZWIA 4KKCC 4LEOA 3HG1A 5I8KL 1XF2A 1LWRA 3EHBD 4MSWA 1A6PA 5F21B 4KRPB 4U1IB 5L2JA 2O5YL 2VL4A 1BP3B 4NM4L 3SE4C 3KYNB 3RDTD 3BT2H 3NA9L 2VLLA 1P7QB 2WWMC 4FABL 1QRNA 2FZ3B 2A73B 4WY7L 1FL6A 3QO1B 1NKOA 4DCQB 1UJ3A 1T22B 5LGJB 3FQRA 1AP2B 4DGYH 3MACH 1EHAA 4R7NB 2LU7A 3W82A 1YUHA 1PKQA 4HIXL 3P4LA 3QWOA 4LPWA 4OZFB 2MNUA 3IRPX 4ZTPL 3HPLB 1Z3GH 4OD1L 1XGPB 3QBTB 4PS4H 3LQAC 3LPFA 4ETQA 3C6LB 2XA8H 4GG6A 4KUZH 3OZ9L 4LIQE 4Y1AB 1DSFH 5GRUL 5ESAB 4ZUWB 4N9GB 4HBCH 3BZ4B 2FHBA 1C5DB 3SE8H 1UM4L 1GCFA 1IBGH 4XT1C 3CVHA 1YEEL 2VH5H 3T2NH 5FO7B 1S7TA 3PWLB 4G6AC 3U4AA 5EC2A 3ULVD 5I2IA 2WUCL 1ZLSL 4KJPC 1T1ZA 1IGFL 2W9EH 4C4KT 1I3RB 2YOCA 4LSTH 3RY4A 2EDWA 2R1WA 1CICC 4LLQA 2OJEA 3TJHC 4TVPL 1FGNH 3MMEB 4JHWH 4NN7C 32C2B 3JV0A 4POZC 2UWEF 3MV9A 3UEZA 3KPSB 1XCQA 2BY3A 3I6GA 1MHEA 5E7FA 1HXMB 1OAXH 1YPZF 5ILTL 1NBQA 1WBZB 5KVGH 2OBGA 4LSRL 1UADC 3NACL 4LCWA 4XHJC 4OD2A 4HIIB 4LASL 4HJGB 5D5MF 4OTXL 1M71B 3DETD 5J9PB 1DBAH 5JW3L 2IADB 3NCFB 3WO3B 5E1HB 5I6XB 2AI0H 5D7SH 4NKOB 4I3GA 2EIEA 1TETL 3VXOB 2GSIB 2OL3L 1KN2H 3GMPA 3VXSE 1WFNA 4OJFH 4FFYL 3HAEB 5KSUA 2X4UA 3ARFA 5A3IC 4HWBL 5DGRA 4HDIB 4HGKC 3P9MB 4J3OC 3EYUL 2JK5A 1PD6A 4UTAL 4RAVA 5AZ2L 1AE6L 1FCCA 3MLWL 4IMLB 5EU4A 2V5SA 3TA3D 1EGJH 5EC1B 3L3DA 1Q9OB 4PV8B 3R06B 4FQLL 3BP4B 3SKNB 4NN7B 4Q0XH 1JI1A 4WFED 2BMKA 3CH1B 5FHAH 4GAYB 2Z0BA 4PV9A 5BW7A 2BVQB 1MREL 2YPKA 2Y4SA 3DLQR 2I27N 4QHLB 1ZLWH 2APVA 1P1ZA 3LQMA 2GHWB 3MZGB 3INUH 5CEXA 3WKML 5DVMA 4GLRI 5IVXF 2LQRA 1TLKA 1NLDH 4LMQE 1JPSH 2EDFA 4IRJB 4C83B 5DDHB 3EFFB 4IM8A 4HUXA 4X8XA 3DUSA 3H6JA 4N9OB 1JHLH 3ARBD 1DBJH 2GI7A 5IFAH 4CGTA 3PGDA 4I3RH 4YBLC 4LCIL 3T65A 4MD0B 1BD2D 1C7TA 2O5ZL 2R0ZH 5DT1L 3SDDA 3LVEA 3VFTA 4IOIB 4OGZA 3BGMB 5FXCH 1MVUB 4XAKE 5K59F 4ZSOA 4X4YB 1X5FA 1IGIH 4MGXA 3R8QA 5GS0H 1IGYA 2DN7A 2E6JA 1QNZL 2ICWJ 5BO1L 4W70A 1R24B 2X4RB 3TVMC 1KACB 3DJ9A 2UWEE 1NC2A 2YD5A 2CMRL 1VFMA 1A7OL 3GBNL 5ISZA 3RWFB 1FNSL 4YBHA 2BJML 1PJ9A 3MBEA 2VERN 1KELL 4MQXD 1JHTB 4CU8A 3DUHA 1YPZE 1AD9A 1TMCB 5DEFA 1M6OB 1F4YH 3MROB 5JR1H 4PJGF 5D5MB 4LCCC 3RHWF 4JZOA 4TSBH 1U8OA 3P30H 2QV2A 3U2SA 1D5MA 3KPNA 3EBAA 3T4AA 3U46B 3VGFA 4YWGH 5D5ME 1LGVA 2VAJA 1L9MA 5C0GB 2NW2A 3QDGA 4O2FA 3SCMD 2VXQL 4NGHL 2RCSL 2E27L 4LQFL 4MDIB 1ZMYA 2ZG1A 4G6FB 4LSQH 2NY5C 1NGWA 5CEYB 5FHBL 5KN5A 5DC9B 3LY6A 4UU9A 2DTMH 4OCYH 3IS0X 4Y4KC 2B1HL 1BJMA 4J3SA 3F7YB 4GW4B 4Z7NF 4ZYKA 4HMEA 2X9YA 1P4BH 1EGJA 3O6MH 3MRFB 3TN0C 5CAYB 4FS0A 3TH2T 3MGAA 3VFUB 4O9HL 4KJQD 5JTWA 2PUQT 3D39A 4L8CB 4QF1A 1YNKL 2ICWB 1G84A 3ARGD 4V1DB 1FSKC 1LO0H 1X5JA 1V7NH 3SGEI 3BZFB 3TVMB 3D85B 1BAFH 3GSNH 4K94C 1IM9A 4KGLA 3G6JA 3QI9D 4NOFA 4EOWH 3PNWA 3C5ZC 4WEBL 5IBLC 5IVXB 2VLRE 5GS2H 4WVRA 2X5PA 3RWJB 3V52L 3V5HA 1HN1A 4X7FC 3VH8B 4XNUH 4H8WC 3QHFL 3LPWA 1IGJB 4LCCB 5IVXE 5ID1A 5E9DA 5EOCH 1BBJB 2EDNA 4XP1H 1FH5L 2W59A 4P3WA 3GHBH 3FOMB 3GNML 4Q9QH 1FVDB 3BOVA 2Z93A 2IFFH 4CVUA 2CO6B 4RQQA 1AGBB 1GL4B 3REVB 1J10A 1P9MA 5H35B 1MCWW 3O4OC 4JRXB 4Y4KB 4KHXL 2E7LC 1F97A 3ULUL 5GGSB 4Z0XB 5K59E 4K7PL 3V2AR 2BSSB 5F96L 3TN0B 3WFCL 4FXKA 3QCUL 4MD5A 1KC5L 4I4WB 3IGAB 5DJ8B 1N4XL 1MJUH 4KY1L 3OXSA 2AXHA 4OCWL 4LKCA 1G9NC 1H5BB 2FIRT 1LP9F 4LL9A 5E2UH 4L8SA 3SGJC 5HYEA 3BDYH 1KJMB 1ZAGA 1FZKB 1FFQA 1FZMB 1KIQB 3PDOB 4PJGE 3S8WA 4M7LL 3ZSTA 3MXWL 4UQ3B 3V6OE 3P0VL 4UQ2B 4PRAB 5K9OA 2XN9A 2FWOA 3MRGB 3SBWC 3U1SH 4A6YB 5D9SB 5HHPA 4NWUH 3B9AA 3NCBB 3QFJB 5HGAB 5IFJA 1F2XK 1MI5D 4CVZB 1RVFL 1L7TL 4JKLA 4TNVK 5T5FL 3NFSL 2B39A 3QFJE 4LDOB 1PFCA 4LSDA 4H0HB 1K8IB 1OAUH 1FYTA 2IALB 2PYED 2XICA 2ZUUA 1FG2A 1CFTA 3F5WB 4Z7NE 5C08B 3PWUB 1J1PH 5IHUH 2LE9A 5ITFA 4WW2F 5AAMA 2DJSA 3LEVH 3W0WE 4JFFD 4EQ3A 1H15A 2C9AA 5DYOB 2XPGB 1MIMH 3V4UL 2Y5TB 4AENA 3GSNA 8CGTA 5DD5H 5D7LA 5T1KD 4YHPA 4HS8H 3HPJA 1MRDH 2LVEA 4OFYA 5DWUL 4LIQH 5EPMB 4PJDA 1YDPA 4XPFL 3OGCA 1I8MA 4OZFG 5IWLC 1I1YA 2NW3B 4JO1L 3S96B 2HKHL 1IAIM 2NY2D 5GJSH 1LO3H 1KJ2H 1RJZB 4NT6B 4G43A 4OT1L 1E28A 4QWWC 5JO5B 1YEGL 4Q9RL 2W9DL 5BJTB 5C0AE 1NMBL 1QFWH 2VDPH 4OBSA 2WK2A 1EMTH 3WIFA 1ZHLA 3C87A 5CUSL 5JIPA 4NO3A 4D9QE 4N5UA 2QKIA 5ALCH 1MUJB 1EHLL 4ZOCA 3VGDA 3MLTA 2C1PB 2V2TA 3NIFF 4HMCA 4GRLC 2UYLA 5IIEB 5FOJA 1FVEB 1XT5A 3PDGA 3P11H 1UYWL 3FZUD 4Z7VF 1AD0A 3RWDA 2J88H 3OHXB 4PRIA 5LCVL 4KXZI 4U3CA 2I9TB 1HDMB 2MCPH 4YIQA 1U91B 2APBA 3B9VA 1J0JA 1OW0A 25C8L 4JCMA 1CQYA 1J1OH 1SEQL 1A7PL 2I60H 4JKKA 4ODTL 5D6DA 5DRXB 3B3IB 1A1MB 4JDZB 3ZLQC 4F7EB 1LP9E 3VFNB 5HDOA 2PYFA 1NFIB 2HJLA 4OZIF 1Q9WA 2NX5E 4TPRH 1B4RA 2DBLL 4JFEE 5ELIA 5JPMB 2B0SL 1KJVB 5DLMH 5DURB 5EZLB 3CK0H 3QISA 5I1DA 2VDOH 1QOKA 2FZ3A 1GZQB 2A73A 4JO3L 5GRJL 4X7EC 3OJMB 5IM7A 2Q76B 4WFGD 3HAEH 1OSPL 1T22A 1T0PB 1XF1A 4RISL 3CGTA 4B0MM 4IBLT 1OWWA 2GT9A 4WW2B 2DWDB 3HPLA 4I5BB 4XPTH 5LGHL 4GRLB 3CDGA 3HAEG 2ZOKA 3ALPA 1BQUA 4RWYH 4G5ZL 2X9XA 3VJ6A 3ILQD 4HS3A 1F58L 1JNNL 1MF2H 3LMJL 3N85H 4BZ1H 1MJ7L 4XAWH 3HE6C 4M6MH 2BNQE 5ESAA 4ZUWA 4N9GA 1WAAF 4Y5VB 1FIEA 3BZ4A 4J6RH 1QFHA 4PJ7F 1A1OA 1KJ2A 1C5DA 1M05B 5IUSA 3EDJA 2A2QT 4X99B 4JQVA 1PBYA 3RKDD 1WT5A 4CMMA 1JE6A 5FO7A 3PWLA 4FFWD 3VGBA 1OAYH 4HJ0C 3TYGL 1EBAA 2BCKA 1I3RA 1CFVH 2YRPA 2R2HB 5I19L 3ZHKA 1RZGB 2YD4A 3HE7A 2BFVL 3MMEA 1CLYH 1R3LB 2VDML 32C2A 3EDKA 1T66D 3OKKB 4PLOB 5T3XL 2XI9A 4DWHA 5DD6A 1T0MB 3NIFE 4WW1B 1GIGH 4HUNB 4WO4D 1HXMA 4JDTH 3LKPB 1FFRA 3LKQA 1WBZA 1KLFA 4Z7VE 2NR6D 3MCLH 1RZJC 5E8EA 5FA3A 3G04B 1RU9H 3QUZC 3S35L 1M71A 5J9PA 1OF2A 4ZAKA 3PWPD 3FFDA 5ID0B 2IBZX 4OZIB 5KVFH 3CIQA 4MAYD 3VXSA 4LLUA 3BQUA 3HE6B 1UXWB 2ZUSA 1NCUA 3RA7L 2GSIA 1EHXA 2IFGA 4UNUA 2DLHA 4OZIE 2CO7B 5EIIB 1RHHA 3KR3H 3HHRB 3FT4A 4DKFH 3HAEA 1OB1A 2QBWA 4ELKA 1XGUB 2HTLD 4DAGH 4HDIA 4JY4B 1NCCL 2I5YL 4NP4L 3FMGH 5ALBH 1G9MC 5CJOL 4ZG1A 1DLFH 2XQBL 2C7UB 4IMLA 4ESKA 2EXWC 5EC1A 4FZEL 4JFHD 1AIFA 2XACC 1MCFA 4LEXH 4PV8A 3TCXA 2DJ4A 5CD5C 1JF1B 3SKNA 2AJYL 5DTFA 1X7QA 3TBTB 3CH1A 4GAYA 2P7TB 2C4XA 1E27A 1F4WL 4JANB 4YQXL 4UDTB 3ZTNL 1HKFA 3EYVB 2GAZB 3OAYK 1SBSL 4HIEB 1GC1H 3PGFL 5HYJD 3OAUH 4PJ7B 4I3SH 3NIGF 4ERSH 4X8JB 4IRJA 1D3CA 1CLZL 2IEPA 3UAJC 3EFFA 4D9RE 1WAAE 4PJ7E 3OXRB 4MA1C 1AJ7H 4U4BA 2BVPB 1RUAL 1X5YA 3CVHL 4UIKL 3B9KD 1WBXB 3SDCC 1AGFB 1SJEA 4XVUD 3TV3L 1NH6A 4F15C 3BGMA 3VH8G 4PB9H 4WNQB 4X4YA 1INQB 5K9JL 2UWEA 2OSLB 4WI6A 4Y7MA 4J8RB 4HFUL 2X4RA 2ADJB 2IPUK 5F3BA 3RVTC 5SV4A 1FIGL 1YPZA 3TGXA 5DUMH 2DYPD 1NEUA 3PXHA 2E9WA 3D69B 3FB7B 3UBXB 2CKBH 1CD8A 2BXYA 3JV4B 3MROA 1MY7A 3GJEB 4R7DB 5D5MA 1V3JA 4PJFB 2VXVH 3QRGL 4XPHL 2R69H 3SDAC 3O9WC 1BVKB 1FZJA 3BKMH 4GO6B 4RGNC 2NYYD 5JOPD 5C0GA 5FECA 1KN4H 1MAKA 3B6SB 4MA8L 5IF0B 5DFWH 1FL5B 2I24N 3FONB 4NQDE 4QRPB 3T1FA 4G8GA 1ZT7B 3MCKA 5T1DH 4ZPVA 4HT1H 1ZT1B 2A6DB 4JGUA 4RMSA 1JPGB 5MP6H 2OS7A 4MA1B 4X98A 2D2OA 5J12C 5I1CH 4GW4A 3WLBB 5FM4A 5B3JF 1EX0A 1G1YA 1KBGH 3MRFA 3MACL 5L8LB 3SDCB 5I74C 2HVJB 2NZ9C 3BPNB 1CBVL 4L8CA 4LNRB 1JMZA 3LPGA 4F15B 2ICWA 4NKQB 5AEAA 1EDQA 1Z3GL 4XCCL 3IXTB 1CT8A 3IDJA 2PETA 3VFRA 1HI6B 1LK3L 2YUXA 2V9RA 1QEWA 2F15A 2OI9B 3WYRA 3KLAB 3UYOD 2VLRA 1XCTB 5C3TA 3N1GC 4PS4L 4QRTB 2LU4A 4FQQA 2XA8L 1EVTC 4U1JB 4X4XB 1CD9B 4FQJH 5IVXA 2WUBH 1O0VA 3ALWA 1DSFL 4Q6IC 3RWJA 5C0BB 4HBCL 3VH8A 2DKSA 3RVUC 1JGEA 5DVKA 3RI5F 1UJTA 4M9PA 3SE8L 1IBGL 1JWSB 2CLZB 3F12B 1BBJA 2J5LB 2VH5L 3NIGE 2BERA 3O9WB 3SDAB 3T2NL 3WXWL 5JW5A 2WBJC 4RGNB 3QDAA 4NFCA 3TZVC 3ROOB 3G5XA 2C3WA 3MUGB 2OJZH 1LE9B 5A2JH 5FYKH 3KVQA 5GRZA 2W9EL 4LSTL 5EBLB 4PJXF 1AGBA 3Q1SH 4RMUA 2AAVA 4OLUL 4YR6A 5HHVH 4R2GC 3FQNA 2VLKB 3RFZC 4PBXA 2N7AA 2JTDA 4UIMB 1FGNL 5DSCB 1A8JH 4JHWL 5J12B 4R0LA 3ZDXF 1CDIA 5GGSA 2VLKE 4KRLB 1L6XA 4WI3A 3CFDB 2BSSA 5DK0B 2UUDH 4J7RA 4NQSA 4PJEB 5T1LB 2CKBA 3IGAA 4I4WA 3STLB 1JYXA 3HI1B 3NZHH 4F58H 4JPIB 4X7CC 3U9UB 5LG1A 2MMXA 4DN3L 1X5HA 4O2EB 1H5BA 4PJGA 3IETB 1IC4H 2E7HA 3WL9A 4I77H 3C9NB 3V6OA 1KJMA 3WCYA 1FZKA 3B2UC 1KIQA 1DBAL 3QSKB 2J2ZA 2AI0L 4OV6F 1D5BB 4UQ2A 4PRAA 5DJDB 3X11B 2XTJD 4Q6IB 3MRGA 1KN2L 3CAFA 3QFJA 3T4YB 3Q5OA 4OJFL 4CVZA 1R3KA 1D5IH 1PY4A 5GS1C 2WBJB 5HHXL 1PKOA 3C60D 4AIZA 3I9GH 1K8IA 2BK8A 4TUJA 1F4HA 2IALA 4ZFGH 3W0WA 2F8OA 3PHQB 4HWUA 3AROA 1AO7B 3PIQB 3T0ED 3PWUA 3GMOA 4NRZB 4CKVX 5T3XD 5B3JE 3BWUC 5J6HB 4UV7H 1EGJL 2L7UA 4R2GB 5DMGD 1AO7E 1A3RH 4LLMA 5DYOA 4XNXH 4YE4H 2XPGA 4BH8B 2Y5TA 4BUGA 1BVLB 3QH3B 1EUTA 4YJZL 5FHAL 3J8F7 4PP1D 3DVGB 3GSVA 4D3CH 3Q5YA 2ZOLB 1QA9B 4HIHB 2ARJQ 3INUL 3MXVH 3F6LA 5DXWA 2NW3A 3ES6B 1NLDL 4KC3B 2P44B 1JPSL 4L3EE 1RJZA 1I7TB 3KNBB 4NT6A 5C0AA 4PLNC 3SGKA 5BJTA 1JNHB 5DJYA 3EJYC 2F9BT 1JHLL 3G9AB 3OR7A 5E2TH 1DBJL 4P2OA 5CD3B 1DQLH 4PJXB 4I3RL 2YC1B 3LRSB 3Q3GB 1QRND 1RUQH 4PYHA 1IM3B 2C1PA 5EUOB 4JO4H 4PJXE 3O45A 5IBUB 2BHZA 5IIEA 2W38A 5GS1B 4IIQA 2ESVB 1IGIL 4P5TD 4O00A 5GS0L 3MUZ1 4PP2B 3MA9H 2FEEL 5KANG 3OHXA 1ZVHA 4JG0L 1BIHA 5D7IF 2D0HA 1YNLH 2ESVE 1HDMA 4RDQF 1U91A 1WFTA 4IRSD 5D7JC 4GAJL 4MA3B 1KGCD 3S35X 4X7DC 4L8BB 3SPVA 1LP9A 2A77H 4PJ5B 4BKLB 1F4YL 5JR1L 1A1MA 2NX5A 4JDZA 3R4DA 1UA6H 3U30C 2QTEA 4JFEA 4HG4J 1NFIA 3DMMD 1JWMB 5E8DH 4YWGL 1MAMH 4Z18A 3MYJB 1MFAH 4R4FL 2RFXB 4P46D 3WV0A 3M8OH 2Z31A 4LSQL 1GGIH 2Q7NA 4S2SB 1GZQA 3VXUB 4NQXB 5C8JB 5KSBF 2DTML 1TQBC 2Q76A 5LWYH 5CBAB 4OLXH 3ZE0F 2GW5A 5FO9B 3MLYH 4JHBA 5B38B 1PSKH 1P4BL 3O6ML 1A7QH 3EGSB 4WW2A 5I0DA 2B4CL 3ZKNC 5DJ0B 4NQEB 3MV9D 4HAGA 3PL6D 3DIFB 1PVHA 3BE1L 1V7NL 2BNQA 2WMPA 3RWIB 1JK8B 3GSNL 2X70A 4JN2B 1Q0XH 1QSEE 4CVWA 3BH8A 4AH2B 5DZNA 4Y4HD 5HDQH 4LCWD 4Y5VA 1HKLH 3V0WH 1M05A 3QEQB 4J3XA 12E8H 3ARDC 4JM2F 2EE9A 5JDJA 3QUXB 4MYWB 3B4NA 4M7ZC 2Y1VA 1CFSA 1J87A 3DWTA 3KPOB 3C5JA 2ZKHL 3DX7B 3BPOC 1N3NB 2IFFL 3MBXH 4EI5C 2CXGA 1WCBB 1R3LA 2EDYA 2QJDA 2X41A 1LK2B 3HMXH 1XIWB 2HA1A 2GY5A 3CXDH 3OKOB 1OARH 4I0CC 2QADC 5M94B 4KHTH 2MFNA 2A6JB 4Z7VA 1QBMH 3NTCH 3KJ4C 3LN9A 5D7IB 3PJSA 4MS8D 2QSTA 2J8UE 3GMNB 5AD0B 5EOQH 1CD0A 4ZMAT 5LJYH 3AU1B 5HGDB 2L0DA 4H20H 1F45A 1UACL 4R26L 4JM2C 2XKUA 2X4TB 4LGSB 3G04A 3BWAB 1BBDH 2BC4A 4G8IA 3VI4F 3CDYA 4L29A 3BDYL 4H26A 5J1AB 2IPKA 4OZIA 4HPOH 3SKJL 4XWOC 1S7XB 2WM0A 3ESVF 3UBXG 5EIIA 1J8HB 3S88H 4P2YA 4QKXB 3NFPA 4R90H 3ARDB 5EU6D 3K4AA 3U1SL 5D1XD 5KSBB 1XGUA 2PN5A 1I9IH 1OSZA 3F6IA 4M6NH 3DHMA 3DROA 4U0RC 2R29H 4JY4A 4NN5B 5JDSA 1WVZA 4M7ZB 1MAJA 3BP5A 5DD0H 3EJZD 5KSBE 1URLA 2X4QA 3ZE2F 4NO2A 4CW1B 2R1YB 2EEBA 4D0BA 1OAUL 3X13B 3SDDD 3WS6A 3BPOB 2OP4H 1YY8A 4M1CC 3ZE0E 5FFLA 1J1PL 1FNEB 2ICES 4EI5B 5TF1L 3RP1A 3LEVL 3NGBC 1P4LA 4YDKH 4OLZH 1INDH 1MIML 4P4RB 1NC2D 2QADB 4JANA 2IH3B 3KLSA 1WWWX 3KJ4B 4UDTA 1HH9B 1HSBA 2GAZA 4HS8L 1FZOA 2QEJA 4LIQL 3RGVA 3QQ9D 2ZG2A 1WAAA 1MFCH 1XF3B 4PJ7A 1L4IA 1ZGLB 1OD9A 4X8JA 3HZVA 1JTTA 3GSRB 4JM2B 2AK1H 2A6IB 4MJID 5GJSL 3OXRA 1LO3L 3M1BA 1KJ2L 1D9KB 2BVPA 3QDGD 3CMOH 2BSED 2CIKA 5IESH 3MRRA 3EYFA 1BZ7B 1G7IB 3FOLB 1KCVH 1QFWL 2VDPL 4TOYH 2N1KA 1QP1A 2Z8VC 3GFUA 4ZUVA 1BFVL 8FABA 4F7TA 1VGKB 3HMXA 2MHAA 5ALCL 1UM6L 3FFCD 3G08A 3IKCA 3ZL4H 1KT2B 2VXTH 3QXAA 1QSVA 4Z5RA 3DTXB 4WI9A 1XR9B 2D7MA 3P11L 4LPYA 3VRJA 2EYSB 3FJTA 2J88L 1JL8A 2ADIA 3EKCA 3FB7A 2X2YA 4LP5A 3UBXA 1A21A 1NLBL 3KYOB 4JKPH 2MCPL 4C56E 3TO4C 3GJEA 4R7DA 3MV7E 3NGBB 5GRVK 3EO9H 3NAAH 5E6ID 3UTSE 3EFDH 2R4SL 1D5ZB 2BSRB 3FN0H 4NQDA 2NNAB 5D1QD 3E3QC 3B6SA 1PZ5A 2FL5A 3VI4E 4R4ND 4TPRL 4KKBD 3SE9H 3MNZB 4NBXB 2ZCLH 4PJCF 2R8SH 5DVNA 5DLML 5DFVC 5AZEH 1X5ZA 1JPGA 3CK0L 3H2WA 1T89C 2VDOL 5HYFA 3FO1B 4G9FB 3WLBA 3KPRB 4IMKC 3L9RB 2NCMA 3WS3B 5J8OA 2P5WB 4MX7A 3FT2B 3K8MA 3KPRE 2HVJA 4WJ5A 4OB5L 1MFNA 3CFCH 1AKJD 4LNRA 1L6ZA 4QEGA 3UDWA 1MFBL 4XPTL 3IXTA 5FO8B 3V5KB 4I0PD 1HI6A 1IKFL 5DZOA 1F3RB 4RWYL 3QDMD 5B4MC 1XCTA 1DFBL 4QRTA 1MF2L 3N85L 4U1JA 4BZ1L 5DS8B 1CU4H 1JRHI 4PG2A 1MWAB 1V3MA 4M6ML 2Z4QA 1RV6X 1HSAB 4J6RL 4JDVB 2P43B 4OGXH 4W68A 1DVFD 1S9YB 5ACMA 3QIUC 2XFXB 1IE5A 3EOBB 1PEZA 3GM8A 3CUPB 1K85A 1S7VB 3RVXC 1OAYL 3CXHK 4FMFA 3VXNB 3PQYD 1LE9A 2J4WH 3THMH 1A7RH 5C6WH 3MA7B 1GGCL 3AM8C 4Q2ZB 3WHE1 4EIZC 4HUKB 2VLKA 3DYMA 4UIMA 5DSCA 3DVIA 4H88L 1GOGA 2XG4A 4N0UB 1KSRA 4Y19B 2G2RA 3P77B 2I07B 2XZAL 1KYOJ 4G42B 3I2CH 4N0UE 2AERT 4OCRL 4HF5H 5CSBA 1W72B 1DEEB 1ZS8B 3STLA 3RY5A 4NKMB 4WEMB 3FHAA 2Y25A 4JDTL 1JYVA 1JYNA 5CSZB 4AT6B 3U9UA 3MCLL 2YUVA 2KQMA 4MXQC 2AJ3B 3IETA 2J7LA 2GITA 5LBSH 3C9NA 1RU9L 3H3BC 1U3YA 3HZMA 3WIHL 2ITCB 3IDNB 3MJ9H 1FN4B 4NUJB 1D5BA 3VXMB 5KVFL 1A14L 1AXIB 5E6ZA 4U33A 3IF1A 4RX4D 4DKFL 4MDJB 3VGAC 4PJCE 3H7LA 2YD9A 2HFFA 4DAGL 4ONFH 1U8LA 4KTDL 5FKAB 1AO7A 3FMGL 5ALBL 1I8IA 3O3EB 4NRZA 3UZEA 3WHXB 1DLFL 4QCIB 3SKOA 5J6HA 5TE6H 1A6AB 1BQHG 3MQIA 4XVSH 2NY0D 4LLYB 4M7JL 5GZOD 5IV2B 4B5EA 1P2CA 1DBMH 1BVLA 3D87B 3QH3A 2AEQH 4MCYA 3EO1B 4PRID 3PUCA 3S97C 4XVTH 1Z9SA 4XBGB 1S9XB 4HIHA 1D6EB 4L3EA 3WIIL 1GC1L 5IHLB 3OAUL 4MVBD 4UI2A 3ES6A 3MYZA 1R3IH 3O3AB 4WUKL 4I3SL 3A6BH 1I7TA 1LEKB 3RWGA 3V7AE 3KGRA 1S9KC 1QR1A 1RJLA 4L4VE 2VLJB 1PGRB 4N8CH 2HT2D 4KRPD 4UT9H 3O0RL 1R5IA 4G80A 2OLDA 2YC1A 1P7QD 5GIRB 3E2HB 3Q3GA 4WV1A 4ZODA 1RY7B 4GKOA 3N1QC 2WQRA 3EZJB 3V7MA 2VZTA 2UZXB 1MFDL 3QDHA 2AJXH 1PDKA 1RJYB 1Q94B 4IOSD 4PB9L 3VGAB 2ESVA 1CL7H 3RY6C 2BRRL 1IC7H 5E08H 3CSGA 1W8NA 3RWEB 4GLRH 3B9DA 4D8PB 2IWGA 3D9AH 5FYJE 3H7BB 4MA3A 2VO5A 2CKBL 4L8BA 3RDTC 5KVDH 4M93C 2Z8WC 5GQBA 4BKLA 1N2RA 3ZYJA 3OPZH 3C6LD 3MJ9A 4HPYH 3WFDH 3G9VA 3JV6A 4EI6A 4F7PB 2H2SD 3T2PA 3BKML 1VENA 4KI1A 4Y1AD 3RIAF 1FC1A 4DVBB 1X5XA 1KN4L 5KVEL 2RFXA 5IJKC 4RDQG 4Z76B 1BQHA 2XQYK 4S2SA 4HT1L 5HYIA 5C8JA 2YRZA 4ZO9A 4A6YL 3HCVA 2Q3AA 4H8WL 5F9AC 3DO7B 2AW2A 4ZDHA 3UTPE 5I1CL 3GM0A 2OZ4A 5FO9A 5C09B 3UJIH 1T5XB 3OKNB 1KBGL 3EGSA 4PTUB 2WWMD 3RKPA 5DJ0A 3GUTB 4MMZC 3KPSD 5CKGA 2DS4A 3AS0A 3JWDC 1UVQB 1QSEA 4FQ2L 15C8H 4KK8C 3RWIA 4KUCF 1XGQB 2QSVA 4AH2A 1HNGA 2H2PC 2YEZA 5BRZB 6FABH 1AQDB 1U42A 2VC2H 3X3FH 5F3HB 1OLLA 2EYTA 3L3GB 3VXTA 2Y36H 5F71A 5CHNA 1RUKH 4C57C 2BVOB 4PJ8B 5JW4N 1CZ8H 4XB7A 3QUXA 1V05A 2GK0B 5C0CE 3KPOA 1H0DB 3TBSB 3DX7A 4EN3C 5EIQA 1BMGA 3O6FB 4ZD3L 2YWYA 5L9DH 2D3VA 4QTHB 3BUYA 4X4ME 2OK0H 4G6AD 3UC0H 5HHVL 4AEFA 4FFZH 4JEGB 3SGEH 1T2XA 1XIWA 3MRKB 2J8UA 1GVIA 3OKOA 3DETC 2DM2A 1U3HB 1S7RA 2A6JA 4R3SA 5EBMA 3TJHD 1U6AL 4TNWF 5BOPA 3GMRA 1GZPB 3CFBA 4JO2L 5IMOB 3I6LD 2JJVA 1B9ZA 5C0EB 4F58L 3BEWB 1AGCA 4JZNB 3O3DA 2DF3A 2X4TA 5DRWB 3HRZA 3BWAA 1FV1B 1E4XI 3LQZB 2YN5A 4HUVB 4I77L 2R1XB 4A2MA 2WBWB 1H8NA 5JLZB 2F53E 2RGSA 4MZ2A 4P9MH 4XXCA 1FGVL 5FCSH 1S7XA 2RIKA 1QLRA 4WEUD 5HHMB 3CC5A 4XHJD 1X3DA 1WF5A 4L8DA 3O3UN 5HHME 4EIGB 4WCYL 4K23H 3QIBB 3V6FB 5KSBA 4O2CA 1SHMA 1KTLB 3H9SD 3N1PC 3ZYOA 2EH7L 1D5IL 3RX7A 4XAKD 3V9FA 4EN3B 3K1DA 4J3VA 1FNEA 2DLGA 4FXGB 4P2QE 3GGWB 5JOFA 2BSTA 5A3ID 1ORSA 3LV3A 2DLIA 3RIFF 3MLPA 1DQMH 4XNXL 3SJVE 1JPTH 3BGFB 4P4RA 5DI8A 4J2XA 1INEH 2IH3A 2A0LD 1NGYA 1H8SA 1TZIA 1HH9A 1YZZA 3VRIB 3BH9A 3AS3A 4D3CL 5F9DC 3NCYS 1A4JB 2PW2B 4GRWF 3GSRA 2A6IA 1EEQA 1D9KA 4GMTH 3GSXB 4GKZA 5DD1L 4PREB 1OD7A 5EZIH 3FOLA 3H3PH 5F9WC 1I1FB 1DQLL 1RSFA 1N8ZB 2G5RA 3MV8B 4RCAA 4W6WB 5F88B 1VGKA 4X80H 1T83A 1T2JA 1ONQB 3AREC 4JO4L 3EDDA 4DKDC 1KEGH 1JPFB 1I1AC 1I7UB 3MNVA 1HYSC 3QR2A 4MNQE 4GQ9H 4XNYH 5C0FA 3MA9L 4MD4B 4C56A 5HHNA 4MMXC 4Y4FA 2AKRB 1YNLL 3MV7A 4JLRB 5KAQF 3KYOA 2NTFA 4V1DD 3UTSA 5JXEA 1E0OB 3DYPA 5I76B 1ZT4A 4HQQH 3DVNB 3TVMD 3LN5A 3D85D 1P5VA 2BSRA 1KB5B 2I9LB 1UA6L 3UROR 5IK3A 2YMXH 3Q48A 5EWIL 4NO0B 2WBKA 4PGDA 1A6UH 5E2JA 1MAML 4CVXA 4CU7A 4Z7UF 4NCDA 1MFAL 4WENB 4UB0H 4MQSB 2VABB 3M8OL 2C3XA 4FP8L 5I1JH 4TRPL 1DANT 4UUJB 4XCEB 5HI3C 3TCLA 3KPRA 1B4JH 1NDGB 3L9RA 5E03A 4GW5B 1RULH 5IQ9A 1GHFH 3WS3A 5LWYL 3TH4T 4OLXL 3NCCB 4KXZH 3FT2A 4FFVC 3MPCA 3T0VA 5CGMA 5FGSA 3TO2A 1CDUA 1H3XA 1PSKL 3V6ZB 1A7QL 3GDBA 4JRXD 4Y4KD 5EZOH 3DV6B 5MEPB 3VD9A 1KTDB 4RMWA 3AREB 3PP3K 5FYLE 5IMLA 3V5KA 1I1AB 3BIKB 3TN0D 5FDWA 2FX9H 4U2YA 4PLKC 2KZWA 4LLVB 1G7PA 1QSFB 4HKZA 4KGJA 2EKSB 3U4EB 5GISH 1K3ZA 2EXYC 3K46A 1N5AB 5HDQL 3V0WL 1HSAA 1HKLL 2VDRH 1I85A 4M7KH 1RZJL 1S9YA 4GUPA 12E8L 3HNSH 2XFXA 4NOBA 4X7SH 3D0VA 4GRWE 1NANH 3CUPA 2Q8AH 1FFPB 2X4SA 2KPNA 4F3FA 5DEZA 1HE7A 2FO4B 4C58B 3MA7A 3QFJD 4Q2ZA 1ZV5A 1L7IL 3ME0A 5ETUA 3V7AG 4Y2DB 3FCTB 4N0UA 3IDXL 1QQDA 3P77A 3CVIH 4Y5YA 3QHZL 4G42A 3O4LE 3HMXL 2C1OB 2D7OA 5IHZB 3BHBB 1OARL 2AK4E 5C08D 2P8MB 4KHTL 4YDVA 1QBML 5FYJH 5F1IB 1VFAB 2E7MA 4JFPB 4E5XA 2GYSA 2EDQA 4OUUB 1IEBB 5CJBA 3KYKH 2AJ3A 4H20L 4ZS7L 4IHOA 1HEZA 1N6VA 1BBDL 3L7FA 1MCDA 2CR3A 2GEEA 2ITCA 3R0NA 4TQEH 2WP3O 1QUNA 3LDBB 3VCLA 1BZ9A 4Z7UB 2PCPA 3MRCA 3VW3H 3HLAB 4PJCA 3S88L 1G6RH 5F7NC 4Z7UE 1AC0A 5FF6B 3REWB 4MDJA 2NY5H 1NJ9B 3RPIB 3ZHLA 3N9GH 4M6NL 3O8XB 3T3MF 2HYMA 5DD0L 2FRGP 5EO0B 5HPMA 1CGTA 2QSQA 1JGVH 3U7YH 2WP3T 2WIIB 4TTDC 2YD8A 1A6AA 2FIKB 5D1ZB 2EIBA 4JCLA 5IV2A 3SE3A 3SKMA 3WFHB 5J6GB 4P3DB 2NY2C 2BX5A 1LO2H 2CDGB 2X10A 4AIOA 1YQVL 5HHOD 4YDKL 5T33H 3EO1A 1IGTB 5H94B 1N6QH 3OJDB 4RIRB 4XBGA 1S9XA 5H37H 3L1OL 3LKNB 1D6EA 4JN1L 2ADFH 3QRFM 1DZBA 1MFCL 3OKEA 1OAQL 4FQCH 4L4VA 1JBJA 4U6YB 1VGEL 2AK1L 1D6VH 5LKNA 2CJUH 4YPJA 2RJMA 1ZOXA 4U1SA 3D18A 5H37G 3FZUC 3BIAX 4XP5H 5DURD 5E24E 2CLRA 4NUGL 4BQBA 4QRRE 1MRCH 2GK2A 3I75A 5F70A 1Q72H 2HTKC 4MNGE 3GEWB 4QWWD 3QT2A 4Z7QF 1RJYA 3QA3A 1FORL 4QXUH 5FV1L 1C12B 1W0VB 3ZL4L 1EEUA 4L4TB 1ITBB 1VADB 3K8LA 1IAIH 4M6OH 2VB5A 4M8QB 1JWUB 1C16B 5E8NB 2FYYB 4F7MB 4KQ3H 1FE8H 1K4CA 2F8VA 4D8PA 1UEYA 4ONHB 5CKAA 4K8RH 4GRLD 3OJVC 3QEHA 4QTIH 1EO7A 4JKPL 3WNOA 1A9EB 2DQFB 1I4FB 3SQOH 2ED8A 1QLFB 4U6TA 1AXTL 5IMMB 4D94A 1CYGA 2LVCA 1HHKA 4F7PA 2VKXA 3FN0L 3VFOA 3BPCB 2DQUH 3K74B 4F8TA 5E99L 4E41D 3QUKA 2FLBT 3KG5A 4YDJA 3MLXH 3NVQA 2VAAA 2IH1B 3SE9L 4N90D 1Y18B 2ZCLL 4CBPA 4WU7A 2R8SL 2NXYB 3FQTB 2AV7B 3DX8A 3FTGA 2GJJA 5EFIB 3WJLC 2HJKB 4X9IA 3NH7H 4F9PA 1AY1H 2V2WB 1FFOA 1IAOB 3OKNA 1I8LA 4PJHF 2YXFA 4S1DC 2I25N 2BOCB 2YSSA 4IJ3B 1YN6B 2AJZA 4QHKI 1ES0B 1UVQA 4KKLD 3RKDC 1U8PA 3QCVH 4AEHH 1U36A 3DRTB 3VFMB 4OFDA 3EYQC 4HX1B 1EUUA 5FGBC 3P4MB 5BZDB 4YHMH 1AQDA 1LNUB 2MSPA 4I9WE 3P0GB 1CU4L 1EAPB 1R5WB 2B2XH 5JUEL 4CDHA 1IFHL 2BVOA 4L3AA 4PJ8A 5C0CA 3S5LG 1C1EH 1T66C 2FX7H 5ESVB 3BSZH 5F1NA 5D72H 4ODHH 3HE6D 5C9KA 1TVBA 1YECH 3VG9B 1P7KA 5DRZB 2FR4A 4X4MA 1KENH 1DN0A 1VB9A 3O6FA 2J4WL 5CILH 1A22B 1A7RL 4J4PA 3THML 4X6DF 4QTHA 5SX4H 2IANB 4GXUM 4X5XA 4NQCE 1UWXK 4LPCA 3WNLA 1IEAA 3CD4A 4HJ0D 4Y2OA 2P47B 2IANE 1U3HA 5FUZH 4G9DA 4Z7QE 2RHEA 1ETZB 4MAYC 2YR3A 1EO5A 4G6ML 2P24B 4DK3A 3H0TB 4K9EH 1LO5B 1GZPA 3KPLB 3KS0H 5IMOA 5I8OL 3OMZA 5C0EA 2BHUA 3QUYB 4GRMB 1BWMA 1LD9A 1Q0YL 2F53A 3MLSH 1AFVL 1FO0B 1FV1A 3LQZA 1CI5A 2R1XA 2HTLC 3UPCA 5LBSL 5JLZA 2H3NB 3JWOC 4N8PA 4BH7B 4X83A 2AQ3A 4D9RD 4N0CC 3ULUC 1E4KA 1BLNA 5DJZA 4PBVC 5C07E 5C1MB 3QIBA 4UBDD 3K4DA 1KTLA 2F5AL 1NEZB 2H8PB 4PD4J 1IL1B 5L6YH 4P4KB 4P2QA 5MHSE 4PJHB 5GXBB 4U7KA 2OZ4L 1A1NB 4FXGA 3SJVA 1DUZB 4JAMA 5TE6L 1AHWA 4PJHE 2ITDA 1NCDH 5FYLH 4XVSL 1KPVA 3S5LA 5CBEA 5EBGA 3ROLB 3T77A 1DBML 4XH2A 4P3CH 5FM5M 2Q20A 4JZJC 1JFQH 3HZYB 4JJ5B 2EXWD 2XWTA 3VRIA 4MJ2A 2BNRB 5CD5D 2FBJH 2HN7B 3B9KC 1T6WA 3WJJC 3SY0A 1A4JA 3SOBH 2PW2A 4XNZC 4XVUC 2BNRE 2SEBB 2NY6C 4P5MA 4NNXA 2HG5B 1R3IL 2WANA 4GRWH 5KOVC 1BIIA 2DQDL 3A6BL 3BRGC 3GSXA 4NWTL 5CINL 3TPKA 2DMCA 4PREA 3F65A 4QRPD 2YXMA 1UKTA 1SVCP 5F88A 3UAJD 2PW1B 4JFYB 1A6ZB 4NZJA 1A4KB 1NCWH 1FAKT 3I02B 2ERJB 3ULSB 1ONQA 4MNQA 4X6DE 2AJXL 2V7HB 1JPFA 1NCAH 1N5YL 3EO0B 3K2UL 2P4AB 5DFTA 2VXUL 3SDCD 5MENE 1OP3H 4PJBF 2ATKA 1IC7L 5E4IA 5BV7C 3BP7B 4E0RA 4BSJA 4XXDB 4JLRA 1PG7W 4R4BB 5I71C 3D9AL 5CSGA 2HAZA 3MJ8A 3CX5J 5I76A 4Q9BA 2DI7A 5KVDL 4L5FH 3BD3A 4RFNC 3RVTD 1KB5A 4QXTB 2WINA 3OPZL 2I9LA 4HPYL 2DLEA 3GSUB 4XI5C 3WFDL 1AR1C 2P48B 2XZZA 1GOFA 4Z8FL 4NO0A 4WWKC 4FQXB 5DEGA 3W2DL 5C0BD 5KAQG 2KQNA 4BZYA 2FSEB 4GMSH 4KTEL 2NY6B 4HLZG 3SDAD 1QBBA 3MGTB 3O9WD 4JB9H 1CF8H 2EIDA 4KTYA 3K3QA 4RGND 3MOAH 4NRXB 4XCEA 1NDGA 2AXJA 1JGDA 1UZ6F 5HI4D 4XZUA 3UJIL 1A9BA 2VLKD 3V6ZA 1G9MH 1BF8A 4YFEA 4XVJL 3DX6A 3BJLA 3DV6A 3IAPA 5MEPA 2ZCHH 4F7CB 2CXKA 1OAZH 1NAKL 1RIVH 1RFDL 3MX0A 3RTQA 5T1LD 15C8L 2NZ9D 1HZHL 3VRLF 5BV7B 4OLEA 3H3KA 4K07A 1CXHA 3MFFB 4YDIL 6FABL 1N5AA 3KPQB 4JKMA 3DGGA 4OF5A 3QDJE 5TE4L 5HY9A 3WN5C 4RFNB 2Y36L 5CIPB 1RUKL 3C2SA 2NXZC 5C2BL 1BX2A 4Z77A 1FFPA 3IFPA 1CZ8L 4I18A 1DP0A 5GSRA 1H3TA 1T20A 2IAMB 1SY6H 4WWKB 2FO4A 1YEJH 2RB8A 1GJIA 1KPUB 4FQHA 4M02A 3H42H 7FABH 1LQSR 5D7KE 3O4LA 4Y2DA 3W9EB 1LHZA 2AK4A 2WBJD 4HK0A 3HZKA 3PABB 1T5WB 2A38A 4HWNA 3UC0L 4Y88A 5DUBB 4FFZL 4U6HB 2X4PB 5I1EL 5IHZA 4KI5C 4K2UH 2X7LA 4PJBB 3NCJL 5I18H 5F1IA 1VFAA 5TDOB 4R2GD 4KMLB 3V0AC 1I8KB 4G7VH 4JFPA 2JJSC 2W9LA 2JJTA 3OKYA 4AL8L 2XTJC 3ARSA 4OUUA 5SWQB 2F5BH 2YRLA 2VUOA 4XWGH 1OTTD 4LSUL 3UP1A 2CLVA 4I2XB 3IFOA 5CEZE 2IMNA 5KSAC 1QR4A 4I2XE 4U1LA 1ORQB 2P8PB 3LKRA 1J5OH 3C2AH 2HVKA 4M43H 4P9ML 5DC4B 5KOMC 2APWA 4FQ1H 4Z95H 1CXFA 4Z7UA 3EW3B 1BREA 3BESR 3MOBH 2VE6A 1VDGA 5FF6A 3WN5B 4HXAH 3G5YA 5F7KC 3ZTJH 1XFPA 1FC2D 2NXZB 2PR4H 4K23L 3BW9B 1NJ9A 4JFOB 3RPIA 2EH8L 4PP1C 1WTLA 1Q9KA 3ARWA 2J12B 3UTZB 1UZ6E 1HH6A 1WSST 1NL0H 3L3IB 2FIKA 5D1ZA 3E6FA 4LF3A 3ZTJG 1E6OH 5J6GA 4Y16B 1UQSB 4P3DA 2ESVD 4Q58C 4H0GA 4KDTC 1C5BH 5D2NC 1F4XL 1JPTL 1TJIH 4PJAF 4WHTB 3GJFB 1QKZH 4EZMA 4X5LA 1CFQB 1UH3A 3D2UB 4JG1H 1YJDH 4MCZA 3VRLE 3DRQA 4QOKB 4PJ5D 5I1LB 3EIFA 2AP2A 3BKCH 1FJ1B 5SWZB 5KSAB 1UJ3C 4QOKE 2JIXB 3F7QA 4NM8H 4WU5B 1NCBH 2UVFA 1SY6A 1CR9H 4GMTL 4QRRA 3O2DL 3D25B 4H25A 43CAB 3BUTA 3QCTH 5F9OH 4MNGA 2ORBL 3H3PL 1DQQA 5E5UB 1TQCC 4QRUA 3VXUD 5JHDB 1J88A 1Z0NA 1DANU 3OWEA 3X12B 3B2VH 2R9HC 5JHDE 4LHUB 1KEGL 4P48A 2IPTH 3SO3C 3AGVA 4WI8A 1JWUA 1C16A 5E8NA 1LEGA 4F7MA 1KCUH 4GQ9L 4XNYL 4U1MA 4NQED 2JKXA 1NCTA 4JFDD 4P46C 2GIYA 1W72L 1KLGB 4HH8A 1LDPH 4YPGB 2IG2L 3K2MC 1A9EA 3QZWG 5DUPH 1F3DJ 3GI9H 2BNUA 4NO5A 5IMMA 2BOBB 1UCBH 1G7MA 1QFUH 1FO0H 1ZWIB 3GJFK 3HG1B 3BPCA 4MSWB 5JNYB 1SYVA 3C08H 4M61A 1X5LA 2YMXL 5DR5H 3RZCB 3QEQD 5IW1A 1IAKA 1KCLA 5IGXL 5JW4M 1EFQA 4UB0L 1GGBL 1FL6B 2AV7A 3QUXD 1N0XH 1UJ3B 3IDMB 5ANMB 3K0WA 2HJKA 1RZKC 1YUHB 1RULL 1GHFL 3ZKXC 1IAOA 2ZWLT 5ANME 4OCNC 5KG9A 1WEJH 4UT7L 1TQCB 1KUMA 1UZ8B 2ATPA 3FO9B 2VL5A 1XIWD 5EZOL 4O5LL 4MB3A 1A6TA 1OLZA 1EHNA 4ETQB 3VFMA 3SO3B 4UOW1 4GFTB 1KTRL 4DN4H 1G7QA 2FX9L 3ZKND 4YEFA 5DA4A 1NC4B 4PJAE 1MJ8L 1GYAA 3ECBA 1EAPA 1R5WA 3G5VB 4PG9A 3CVHB 1CTNA 1S7TB 3ARFC 3K81A 4M7KL 4O4YH 5I2IB 2EEDA 5EORH 4YXLH 5T3ZE 4JPVH 2GJ6E 2VJXA 2Q8AL 2R1WB 2XKSA 2OJEB 1J8HD 4NQCA 5EO9A 4XMLH 3ARDD 4JGJA 2E9BA 1K2DA 4YHOH 3NN8A 3UPAA 2B1AH 2IANA 3QZWA 4BJLA 1TJGL 4JR9H 2R15A 5KZCB 5BW7C 1XCQB 5HVFB 1F2QA 2I26N 1MHEB 1VHPA 2ZZUT 4UAOB 2MWCA 2P46B 3U9PH 1ETZA 3ZKXB 4HXBL 2P24A 4WUUB 5FCUH 1FP5A 3H0TA 4EI5D 1LO5A 5FYJL 4OD2B 4OCLC 4NZUH 1K5NB 4WUUE 4GRMA 2QADD 1FO0A 4BQ9A 4LNVA 1C08B 1K8DA 4NQVA 2H3NA 4G8EB 1GRWA 4LLAA 2R2EA 4BH7A 1BM3H 3AY4A 5HJ3B 5C07A 3SDDC 1RJCA 1NFKA 4JM2D 1GAFL 4U1NA 5JW4Q 3VW3L 5KSUB 1J9CT 4L9LA 5I8EB 1D9KD 2X4UB 3ARFB 4NC1E 4P23B 4LGPB 2JK5B 1KXVC 1LILA 2VWEE 4XWOD 3VWKA 4RAVB 1JV5A 2JE8A 1IL1A 3N9GL 1A64A 1J05A 2FNBA 4P4KA 4F37F 1YYLH 5I1AA 1B3JA 4PJHA 3MBEC 2W07A 1A1NA 1JGVL 3QQ9C 1HWGB 1RIUH 5ICZA 4GW1A 2RQ8A 1CDGA 5C0DA 4LSPH 1DCLA 3TJEL 1RHFA 3C8KB 2X4NA 1P1ZB 1OY3B 4XHQA 4YDLC 3WSQH 5T33L 3X14B 4JY6B 4M1CD 3ULVF 2D03H 1HHGA 1N6QL 2HN7A 3AMKA 2AS5M 1H9VA 3KXFB 4HCRL 4ZOAA 2SEBA 5BS0B 4HUXB 2HLFC 3KXFE 5ICYA 3RL2B 2WW8A 3DUSB 5F6IC 1IC5H 2XRAL 1FLTX 5BS0E 2BHYA 1D6VL 5CIPH 3PGDB 1NDMB 3T65B 4PJ9A 4TULH 4XP5L 1T1YA 3MRMA 5ACZA 4OAWA 4X6DA 2PW1A 4JFYA 1A6ZA 1FNHA 5CWSA 4ZSOB 1A4KA 2OR9L 2OTWA 3I02A 2CK0L 1ZVSA 4G9FD 5MENA 3KPRD 1B0GA 4XPGH 2P5WD 3VA2C 4QXUL 3UPRA 5AWNH 4R97B 5J56B 4I8DA 5ISZB 4G8FA 4M6OL 3ZKSD 1RK0B 1UWGH 1YEIL 3CCHB 3MBEB 4R4NC 4OFVA 3NCYP 2W0LA 4XXDA 1DQJA 2EC8A 4KQ3L 4W6XB 1FE8L 3V6BR 3BGAA 4R4BA 4GS7C 1OT2A 4WI2A 4K8RL 4D9LH 5CEZH 3B83A 1U8OB 5IEHA 3I6KB 4LPVA 3U2SB 3KPNB 4U3XA 4URTB 3SQOL 5FUOH 3T4AB 3EDFA 4QXTA 3LSOB 1RK1A 4YHZL 4ETYA 3GSUA 4QO1A 4R6UA 5IB5B 5KBNC 2IJ0C 3BPLC 4FQXA 1GH7A 1F11A 1RZ8B 2DQUL 3OB8A 1UGNA 1MIEH 1NGWB 5KN5B 4RFOL 1P9MC 3WD5H 5GS0C 4G3YL 3L3HB 2X89A 1B0WA 5D96C 5F6IB 3OTTA 4ISVB 3MZTA 1X5GA 2E9JA 2HFTA 5F72S 4U05A 1N64H 4BZ2L 4Y5XA 1FBIL 1A5FH 3RX5A 3NH7L 3MRHB 4ONOA 1AY1L 5TQ2L 2Y72A 4JPKL 5DFVD 3OBAA 4PGBA 5F7YC 1QACA 3GSOA 4Y19D 4L8SC 3PGCA 5CCKH 2NMSA 4NCC2 5F1KC 1DVFC 3CSYB 2G5BB 4S1SL 1IM9B 1JTOA 4AEHL 2WLZA 4LHJB 3MFFA 3QDJA 5E2WH 5I17A 3VU2A 4GS7B 3KPQA 3ULVE 5ID1B 3NMEA 2W65B 5E9DB 3A67H 1ZANH 5B4MD 4XCFH 5INDA 4XMPH 5CIPA 5CJXA 1TENA 2B4CC 1C1EL 2FX7L 3AMLA 3VXMD 2IQAA 3ZO0A 4YXKH 3BPLB 2IAMA 2Z93B 3M07A 3E8UH 2OQJA 4RQQB 1KPUA 1YECL 4UOJA 5CJQH 1KENL 1QFOA 3QB7C 4O58H 3GB7A 4OFKA 3W9EA 5D96B 4LPUA 2R23B 1T3FA 3RVXD 2X4PA 1HWHB 2BVEA 4WI4A 4DOHE 4JKWA 4JHAH 3VD4A 4MD5B 4JRWA 4JRYB 5FUZL 2DM4A 4MAUH 3V79C 5TDOA 4LKCB 4JRYE 4XGZB 4L8SB 4I2XA 5IFHH 4WTXA 5EOCJ 4P59L 3BAEH 3RVVD 1XGRA 2CRYA 3IDYC 4LHUG 4YHNB 5KS9F 2XN9B 1KB5L 2FWOB 5F7MC 1TTFA 5D93C 5GJTH 3WDIA 1F42A 5HHPB 5IB4A 2Y07L 3LB6C 1KCKA 4UILH 3IDGA 3QWRA 4QHKJ 1F02I 4D2NA 2VLJD 4JFOA 5HVHC 43C9A 3CNKA 4U1HA 1FG2B 1CFTB 4M8VA 4JY5H 4WFEE 5ITFB 5L6YL 3UTZA 3U36A 1OW0C 1YYMH 2DDQH 2VXSL 3ORJA 2O26U 4Y16A 5D6DC 4AENB 1P84J 1E4XH 1NCDL 5D7LB 1KB9J 4YHPB 1CXIA 3HPJB 1WWCA 3KDMA 5EULV 3O2VL 4PJDB 3B5GA 4P3CL 1YDPB 2VKWA 4KRPC 4PGZA 5DQ9A 1I1YB 2FBJL 4H1LH 5CP7A 5I1LA 2H1PH 4S10A 2XG5A 4G43B 3WHE0 4HKBA 1FJ1A 1T7XA 5T3ZH 1BD2E 3GK8H 4WU5A 5JQ6L 4XX1E 5J0BA 1C5CH 4M3KB 4H1LG 4NIKB 4XB8A 4NO3B 2QKIB 1KEML 5SX5H 1JUFA 4LLDB 2V2TB 1MCOL 5JHDA 4Q74A 4R96A 5IVZA 3QNXB 2F54B 1NCWL 5HVHB 2Q8BL 3C6LC 2DB8A 5C09D 4LHUA 3RWDB 2F54E 4UDUB 3TLRA 1NCAL 4OIBA 3K1KC 2YK1H 5BCAA 3SCMB 1R6VA 2P49B 5GRWA 1KLGA 1S9VA 4HHAB 1VFBB 4BM7A 4JQVC 1WT5C 3MLVH 4F8QA 1G9EA 3L5JA 1X6LA 4LARH 3GMQB 2BOBA 4L5FL 2HJLB 1U58A 5J7CC 4P2RB 4QY8A 5BRZD 1Y6KR 5JNYA 5KS9B 5BZWA 1EJOL 4P2RE 1W2KT 3RZCA 3HE7C 2WSKA 5I1DB 5KS9E 4DUXA 1OPGH 1KFAH 5IM7B 4JB9L 3P40A 1T7YA 1CF8L 3IDMA 3F7RA 2DIAA 3MOAL 5ANMA 3S7GA 1UM5H 3ZKQD 4HV8B 5L88H 3O6FD 3UJJH 5K93A 2GT9B 1XMWA 2GKIA 1UZ8A 4KPHL 2K1MA 3FO9A 3CDGB 4WFHD 2OM5A 2ZOKB 2ZPKH 2LTQC 4C4KO 1U3HD 2ZCHL 3MO1A 4HS3B 3VJ6B 5F8QC 4ZAKC 4LP4A 5GGQL 5I6XC 1OTSD 4XBPB 5EU5B 1KCSL 3LKSA 4PJAA 1RIVL 3EYOB 1T4KA 4KVCH 3BQUC 1TVHB 3T2OA 4H1LA 2A9NH 4KZDH 1S5IL 1F6FB 1Q8MA 1NC4A 1A1OB 4ZUUB 1CE1H 1KJ2B 4RBPK 4QNPF 4PY8I 3G5VA 3QPXL 5JORA 3Q0HA 3TFKC 5D8JH 4KH2A 4CMMB 2GJ6A 1PLGH 4KK8D 4EVNA 4PRPB 2PTUA 2H2PD 1NSNH 1KCRH 2BCKB 3VWJB 3UTQB 4DGIH 4PRPE 3NOIA 5HHMD 1M7IB 1KV3A 1WUNT 2Z92A 3OG6B 1SY6L 2XIDA 1FL3B 3HE7B 3QIWA 3GRWH 1T2QL 3QEGL 1NMAH 3QIBD 3H42L 1FVCA 2AJVH 7FABL 3D6GA 1K6QH 5DD6B 3GHEH 3CDFA 2H26A 4EN3D 2J6EA 3BI9X 4QGYA 3V4PH 3LKQB 2DM7A 4K2UL 3AUVA 1P53A 4WUUA 3L7EB 5E8EB 1A7NH 5DRNB 3CFKB 5FA3B 2A1WH 3DHJA 5E2VH 2BY0A 4IRJC 4UZGA 1YQ2A 4FNLL 4H5SA 1K5NA 4PRNA 3OX8B 2FCBA 2OR7A 2LTQB 4APQA 4XBEH 4XWGL 4JE4B 1OF2B 4ZAKB 3HI5H 5EG6C 3VMOA 1C08A 3FFDB 4KUCD 3UYPA 3UO1H 3VXSB 5JA8B 4N1EA 4LLUB 3BQUB 4G8EA 3BO8A 2VDNH 1J5OL 3I3EA 4YEEA 5HJ3A 1BOGA 1EJ6A 1RHHB 3FT4B 3ETBF 4FQ1L 4Z95L 2YD7A 3STZB 2XA3A 3MRIB 1OB1B 5I8EA 4ELKB 4KK9C 1GGUA 3MOBL 4LOUC 4P23A 4XPBH 3GI8L 4HXAL 2PR4L 2A0LC 1SJVA 4JFFE 1AIFB 4RGMB 3MV8D 4RWHA 4K7FB 2LFGA 2FECI 5DTFB 1X7QB 1BF2A 1XF5A 1NL0L 2VR5A 4HK3J 1E27B 1E6OL 1CL7I 3C8KA 4NN6B 5E0QA 4N1CA 3X14A 4JY6A 4HC1H 3VMPA 4Z7WF 3ULVH 3TNNA 1WQVT 3QUMB 1H8OA 3KXFA 4JG1L 4K3EH 1C8PA 1YJDL 2G60H 4LVEA 1M4KA 2PF6A 2PXYA 5BS0A 3QQ3A 1F6AB 1PG7H 4QNPE 1OM3H 3RL2A 1NGQH 3BKCL 4JPWH 3OJ2C 4NO0D 3VDAA 1NCBL 1CR9L 1NDMA 2Z35B 3GRWA 1SJEB 3GKWL 3BKYH 4XP6H 4YBQD 1TZHB 5F9OL 1X4XA 2UWEB 1OQXA 5ENWA 3U4BH 5ITBH 1H3PH 1V7ML 4PB0L 5F3BB 3B2VL 1D5XA 3O6LH 1GC1C 4ZO6A 3LD8C 1F8TL 4ZTOL 1YPZB 5GGRY 3T04D 5EO1B 2IPTL 1RK0A 3DSFH 3CSPA 3CCHA 5J3HD 1KCUL 4MJ5A 4EEEA 3ARED 2Q7YB 1I1AD 2APXA 4LVNB 3I6KA 4ZQKB 1HYSD 3T08A 1S7SB 4LU5H 1A6VH 2R0LH 5E4EC 3FQXB 1FZJB 3T09A 4CUCA 1CXLA 5CZKA 3QEUB 4OCXH 3LSOA 3ZMRA 1UCBL 5FECB 3CSBA 3BEVB 3KJ6H 1FO0L 1QSFD 2DQTH 5IB5A 3L95A 5E56A 5KTEH 3T1FB 4G8GB 4O51B 1RZ8A 3KPTA 3MCKB 3LHPH 3WLWC