1FFPB

Crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
b'MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B, ALPHA CHAIN
publication title Peptidic termini play a significant role in TCR recognition
pubmed rcsb
source organism Mus musculus
molecule tags Immune system/signaling protein
total genus 14
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ffpB00
4LCWB 2WP3O 2X4TB 3VWJB 1VFAA 1CE6A 4HWEL 2X1OA 3GJFB 1B4JH 5FO7B 2JTDA 5DJYB 4M43L 4B7IA 4Y2DD 2P5EB 5D1ZC 2Q86A 2ZPKL 2GJZB 5FYLH 4PJCB 5JUEH 1WEJH 1N4XL 2NCMA 4DFIA 3GKWL 3MYJA 4JFEA 3BHBA 5I8OH 3RIFF 1FCCA 3BP6B 4HQQL 2Q76A 4MNHB 5HGHB 4ODTL 4RWYL 4UUJA 3HMXL 3D3VD 5B8CB 3IB4A 1MFCL 5KW9L 3EW3B 1K8DA 3BW9A 4P2RD 1X4ZA 3ARDD 4KZDH 3VFWB 5GRJH 2FO1A 2MNUA 3D3VE 5JORB 2EDNA 3DX6B 2NY3D 4CVZA 2QQKL 4KK9D 5I1EL 1IQDB 5CSZA 4P2RE 5DDHA 2JIXB 3W39B 4PGCB 5JPMA 3T65B 3RVUD 5E6IB 1YEEH 2GW5A 4UIMA 1QLFA 3KAAA 1EHLH 1OAKH 5DD1H 1MHEB 1A5FH 3PABA 3VD3A 3QAZB 3RDTB 1MCSA 3S4SA 2AJ3A 3HZKB 1KJ2L 5FK9B 4DZ8A 1A9EA 1FV1A 4MD0A 4KUCF 3FT4B 3JWDH 1J1XH 2X40A 1A7OH 3VFGH 4LSSH 2W38A 4HWUA 3O6KH 1MJJA 5D1XB 4I48B 4CU8A 3GJFK 3T4YB 4F33A 2DLTA 2XZCH 3O8XB 5AZ2L 5C6TH 1JV5A 5FDYA 3O4OC 2M26A 4L9DA 4OF5A 4OT1L 5M95B 4PRDA 1H8NA 3T08A 1JFQH 3CFJB 4QKXB 1IAKA 4NO0B 5CZKA 4PRHD 2EIDA 2QBWA 3AMLA 1WTLA 1OM3H 4G43A 2EKSA 4JQXC 3QFDB 4KTEL 2D03L 5C0ND 3C87A 1OT1A 1W0VB 3KPNA 3TV3H 2G2RB 2YHGA 4PJIB 2NY2B 2IPUG 1CGVA 5GSVA 3EYOA 4MSWA 1CD1A 2CDEA 4EUPA 4Z95L 3SKUD 1J1PL 1TVDA 4ZXBC 4OQTH 2FO4B 3T0AA 4JFQB 3CDGA 3FL7A 1KCVH 3FO2A 4ZO6A 3G6DL 4JQIH 1A1NA 1FYTD 3RU8L 4NKDB 1KTLB 5E8PB 1DEEB 3QCVL 2CUIA 4MNGA 4JM4L 1R24A 4HLZG 5EA0L 3X12B 4M6MH 3CUPB 1U8KB 4F3FA 3BP4B 1FYTE 2E9BA 4JHBA 2VZ1A 1ROWA 4NO2A 4KY1L 2WW8A 1BGXL 1NL0H 3OX8B 5BS0A 4Z7QF 2YS4A 3BAEL 1U8NA 4XNZC 5D6CB 4L9LC 2XWBA 4JFPB 4XCNB 5GZNC 5I1JH 5J0BA 1KJ3L 5ABDE 1HINH 1RUPL 5DQJB 3K80A 4O2FB 4D8PA 1BEYL 3IJYA 3D69A 4Y19B 2FLBT 2VISB 3MTRA 2HT3C 4ZUSB 4QTIL 3J8F7 3T4AA 3VFVA 4BZ2H 5HXMA 1CDGA 3WBDA 2F19L 2ESVA 2R0KH 5CJOH 1JBJA 4X6EB 3W82A 3MV8D 4YDLC 3DRQA 2VLJB 5KSBE 5HYSA 4RA0C 5FHAL 3O4LB 4QGYA 4RAHA 4WY7L 3VGDA 4Y5XB 4HUXA 5EUOF 3L3DB 1EAJA 3EJJX 3DMMA 3MV7E 3PGFH 2O5YL 4BQ9A 3QIBB 3BH8A 4XNYL 3B9KA 4MVBD 3WIIL 4Z76A 4O2CA 5HJ3A 4E5XB 4TRPL 3NGBB 1JHLL 3ZKXB 3M8OH 3W5NA 1LO2L 2VAAA 5EUOA 5HHPA 4FQQA 3QIWB 4XTRD 1MNUH 4J8RA 4WEBH 4QNPF 4D2NA 2FR4A 5HHNB 5C7XH 3OHXA 1C7TA 3OAUH 4KAQH 3MLRL 2OJEB 2NY7H 3OF6D 4YC2C 1ERNA 2NYYD 3KDMB 1EDQA 5EO0B 5LXGH 2R9HD 3DECA 5FUOH 1J5OH 3JVGC 3X3FH 5MEPB 5AUMA 1F13A 2EDYA 4QRPA 3DIFA 1WITA 2WM0A 1P1ZB 3IF1A 3OGCB 5AYUH 4I13B 1JUFB 4Y16C 1A6ZA 5TH2B 2JCCF 2VDOL 4L8DA 3RVXD 2CDGA 3INUH 4LLDB 3L3KA 5EBLA 3GUTB 1D5IH 3CU7A 4P9ML 5CFHA 3VXUD 3UAJD 1NGZB 3OXRB 4GRWB 2DM4A 5GGQL 3DHJA 1DN0A 4K9EL 2C4FT 1HYRC 1LP9E 1YJDH 3QDMA 4NP4H 3CVIH 5LCVH 3VXUE 4M3JA 5GGSB 2AJYH 3SJVA 2MFNA 3BX7C 1XGQA 3WXWL 3M07A 1T0MA 1Q9OA 4H8WH 4Q6IC 3ZTJG 2J8UE 4JFXA 2HN7A 3CNKA 4Y5VC 5FGBC 3MNZA 1KV3A 2P1YA 2YD5A 4TNWF 1LO5A 4RFEB 3GGWA 5IK3A 5IHZB 1KCUL 3MFFB 3ES6B 4FZ8H 2B4CH 3RZCB 2VDQL 5EIVA 1YEJH 4EVNB 1HQRA 4IOFD 4HWZB 3SGJA 4YHKH 3MPCA 2PYFB 3E6HA 1D9KA 3CFBB 2P44B 4H20L 1OTSD 1U3YA 5F7DA 1WZKA 2HT2D 4XP1H 2C1PA 2VUOA 4KKNA 2Q3ZA 3WLBA 1CXKA 4UT9H 3KLSA 3C8DA 5JW4M 4KMQA 3S96A 3WUWG 3BGFC 5FHBH 2VNCA 5C9JA 2NTFA 1U8QB 4MS8D 2R0ZL 1U95B 2G75A 5EO1A 4HGMA 1TFHA 5C0BA 5DFWH 3SO3C 3O3DB 4D9QD 3HZMA 4XMPH 1HHIA 4HF5L 1JYXA 1M6OB 2VXUH 2YUVA 1DQML 1KLFA 4Y2DA 4EQ3A 2X5PA 4KJQD 4U0RB 4FG6D 4D9QE 3H8NA 1NJ9B 1BQHB 3DVIA 3MGTA 3VXRD 1GZPA 4XCYB 3CXHJ 2R0WL 5E56A 1UENA 1V3KA 4PJGB 3ZYJA 1LO3L 3OBAA 2CRIA 1H9VA 2CKBL 1PW3A 4RISH 3VXRE 1EFXB 4X7SH 3ILPB 2DAVA 2JK5B 5ESVA 3D3VA 2LU3A 2HVJB 1RMFH 4Z7WB 3FN3A 1CLYH 1MQKH 1NMBH 4XI5C 2SEBA 4NNYA 3TCXA 4X9IA 3QWOB 1U3HA 4X4XB 5IW1B 5B4MD 3DO7A 1MF2L 4P2RA 2OR9L 3ARDA 1OARH 4U1LB 3WKMH 3TPKA 4P46B 4K7PL 5L6YL 5GRYA 1T66C 5FGCB 4GAYB 4F7CB 1P7KB 1T89C 2PF6A 1W72L 4GRLD 1MRFL 3SDDC 4NNXA 4TUJB 4MYWB 3KXFE 1GGCL 4UIKL 5CJBA 3EYQC 1JNLL 1HWHB 1A6VL 2HTLD 3D0LB 4Z7UE 5DRXA 1IFHL 4H5SB 2VXTH 2ADGA 4YPGB 3EKCA 4QRSB 5GJTH 3DV6B 4Y4FD 2OTUB 4JDVB 4K8RD 5I74B 5A2JH 2YD3A 1DP0A 4JZJB 2YA2A 1A2YB 3QO1A 5F7YC 1C5CH 2GSIA 2DI9A 2J7LA 2X10A 4E42A 1OVZA 4IOIB 2APWA 2GJ6D 2YOCA 5H8DA 4EBQH 1I85A 2FHFA 5JDJA 4Q9BA 3SQOH 2FB4H 3MCG1 5ALCL 3IS1X 5D7JC 1TIUA 2A6JB 2XY2A 1S7UA 4OSUH 3TBWB 4LGRB 3TVMB 1FJ1B 1PLGH 1WT5C 3N9GL 1WIUA 4J4PC 1OP5K 2J5LC 4J3TA 2EDRA 1L0QA 4F7PA 3AVEA 3Q0HA 4OFDA 1DL7H 5DMIL 5KG9B 5GS1B 3CFKB 3K0WA 3BSZH 3EDDA 1FORH 2Y9RT 4LIQE 1QRNB 1CTOA 2BERA 4YHLL 2IBGA 3IU4H 4HXBL 2BVEA 4EKXA 1SJHA 4HH8A 1FFNB 2CIKA 3OKLB 3FQXB 1NDMB 2X4OB 4ZYKA 3UBXB 2R8SH 4WW2C 1EAPB 4TQEH 1T20A 4XP9H 1IM3A 3M1BB 1N3NB 4J7RA 3SDXF 4ODWB 1H3PL 4FP8L 4MAUH 4P59L 3NACH 1NCUA 3V0VA 1UYWL 4O00A 5BVJB 5D2LF 4HUNB 1I7TB 3MLTA 5E2JA 5J12C 4WNQA 4ZOAA 2HJLB 4P3CL 3CFIC 1NC2B 1R5IB 1SJEA 1X5JA 3RGHA 4ZUVB 1A1OB 2VRAA 1CR9H 1FYTA 1UM5H 4EI5D 3LHPH 4NZUL 3FKUS 3IJSA 5AWNH 3UPCA 4MJ5B 4BKLB 1NCDL 3QIUB 1HK6A 2KDGA 1NBQA 1AI1L 4NRXA 4V1DD 5EOCJ 5TF1H 4LRIA 5EORH 3UTTD 2MQ0A 5KANG 4HFUH 1NAMB 3NCJH 1CBVH 3MXVH 4L29A 3GHBH 3HPLB 5KSBF 1K4DA 5FECB 5CSGA 3JTSA 3VWKA 4V1DE 3UTTE 4U7SA 2QHRL 1QVOB 1WFNA 3PIQB 3LB6D 2J88H 1VPOL 1AGEA 1GGIH 3LS5H 2Q7YA 1MWAH 4PJ9A 4S1QH 3MUJA 3G6JF 1ND0A 5T1KD 4Y5YA 3RKDC 3I6GA 3ET9F 4HKJA 5KSBA 1C08A 1FNEA 3VRJA 4K7PX 3CSYA 3BD5A 3TEUA 2IQAA 1NBZA 4YBLB 2I07B 2UY7A 4ZUWB 2BSTA 2Q7NA 3VH8B 3WJJA 3CZFA 3MV7A 2GAZB 1CFVH 4LL9A 5E0QA 3QUYA 3VDAA 2R2EB 2E8YA 2HLAB 1OLLA 2EDLA 2DQCL 1E4XI 1MH5A 3ULUL 2X4QA 5GRVK 2R0LL 3UO1H 4WUUB 4R0LC 3C6LC 4XPAL 4E0RA 2DD8H 3ARFC 4YH6A 5J6HB 1X5ZA 3O2VH 5JR1L 4S1SL 5E03A 3MLUH 1TVBB 2J6EA 3NFSL 3L6FB 3QUMB 3AS1A 4R26L 1CQKA 5SWQA 2D0HA 3BH9A 5KSAB 2HRPL 3OF6A 5EU3B 5CEZH 2VH5L 4X7TB 3RNQB 3UTOA 3RUGE 1F11B 4WO4C 3MREA 1IGMH 1S7SB 4EIGB 5I1AB 3HPJB 3JWDC 2FGWH 4XZUA 3U7WH 8CGTA 2YWZA 4OJFH 1M05B 3MCLL 1P4BH 1T1WA 4IMLB 4HJGB 4YDIL 4J3OC 3DROA 4D0CB 5AG8A 1S9XA 2AEQL 2OL3L 1OP3H 3MROA 1T04A 2AGJL 5FYKH 1KC5L 3QEUA 4KQ3L 1X5FA 3OAZH 1YEIL 3VGAB 2Y06H 4N0FA 1LP9A 5F97E 1CFNA 1YQ2A 2WK2A 3VXUA 1MFEL 1WBZA 4GXUM 1UXWA 2Z31C 2VDPL 1UZ8B 4PJCE 4QHMB 3FOMA 4PJBF 4G80A 1IC1A 2J8UA 3WS6A 3MRPA 5SX5K 3VJ6A 3WCYA 3L3JB 4YQXH 5BVPL 5J13C 4O02L 1ZGLA 2QR0A 1D6EB 4JEGB 4ZD3H 3KVQA 5D8JL 2R2HB 2OSLA 3HC0B 3V52H 3WDIA 3NZ8B 4M7KL 5IEKB 1AO7D 1A3RH 3MOQA 1KFAH 5DJCB 2AS5M 4POYA 3EUUA 2H8PB 1NCBL 1FYHB 2ATPA 1FSKC 1NAKH 4IRZL 1K5NA 3RWFA 1AO7E 2EICA 4I18A 2JIXD 4EN3A 2AQ1A 5FCSH 2VXSH 5DTFB 3QZWB 5DVKA 3CLEL 2BOBA 2BDNL 4LOUD 2DWEA 2M8XA 5E6ID 2XPGB 2YD6A 1YEGH 3MMEA 1R3JB 5DYOB 1QSEB 5CMAB 5CBEA 2X70A 1RZJH 4R7DA 4UV7L 2YN3A 3L5IA 1H5BB 2AXFA 3H9HA 3H0TA 2X4NA 5DUPL 3V7MA 4BZYA 2KPNA 3BD3A 4LLVA 1NFIA 3TGXA 2BZDA 6FABH 3L1OH 3S9DB 2Q6WA 3QULB 3FOLB 3SDAC 3O3EB 4ALAH 4XPBH 3O8XD 3FZUC 3FO9A 4X80L 2R4RH 5KJRH 3EDKA 4H26A 2ZSWB 4FQXA 5DFTA 2JELH 3VXRA 5JOEA 4XAWL 3PL6B 3PWUB 4HWEH 1U8HB 2VLMD 5F7MC 4OCRL 2VC2L 5BRZD 5SWSB 3KPQA 4JPVL 4L3EB 3V5HA 1AXTL 2Z91B 1K3ZA 4EDWL 2OK0L 3VFRA 1N4XH 1Q9KB 2VLME 4Z7UF 4PD4K 5DD3L 1LEKB 2NY2D 3O81A 3GKWH 1FNLA 3G08B 3DNKA 5FA4B 1UCBL 3S97C 3AMKA 1AE6L 1NC4B 2O5XL 4HQQH 3KXFA 1H3WM 4CMHC 4PJIE 4G8IA 5IIEA 4RGND 4N1CA 3K1KC 4ODTH 4RWYH 2I9TB 3HMXH 2NY1B 1DUYB 4Z7UA 4GRLA 4PJ7B 1MFCH 5KW9H 1ZT7B 3UMTA 4ZOCA 3BXNB 4U1GC 4CADA 3ZT7A 3RL1B 3TJHD 2QQKH 5ANME 5I1EH 4R96B 5IHBA 3V6FA 1YC8A 3ETBF 4A6YL 2E8ZA 2NNAB 2EEDA 4HIEA 3VXOA 3NAAL 1K4CB 4UV4L 4XP6L 4R9HA 3C2AL 3DUSA 2IMNA 4U6HB 4K3EL 2DB8A 4OB5L 2A6KB 2NY4B 3GSNA 1JGEB 1VB9A 4QXUH 4O2EA 5F7WC 3H6JA 2AEWA 1BVLB 3PHQA 4XP4L 4KRMB 3G04B 4LP4A 1YJDC 1KJ2H 4QRUA 3QQ3B 1EXUB 5I1DB 1A6TA 3TO4B 4ZFZB 2QLVB 1NGPH 2HFFB 5A2FA 1S7XA 4X7CC 3IDUA 4EXPX 5GSRA 1GRWA 2ID5A 4H8WC 4PJFB 2B20A 2OI9C 1KB9J 4U6YB 5AZ2H 3FJTA 2IAMD 2PXYD 3BUYB 3OKMA 3GM0A 1R5VA 4OT1H 3QB7C 1OTUD 5DI8A 3KJ6H 4YEEA 5BV7L 5J6GA 5FO8A 2OXGA 3P4OB 5DSCB 2B4CC 4XH2A 5I9QC 4TNVK 4RBPH 3B9EA 1ETZB 2BC4B 2NW3B 3PWPB 3U46A 1LGVA 4KTEH 1A14L 2D03H 3ARZA 3MACL 2WWKO 1I9RL 5EUKA 1DVFC 4HS6A 3CDYA 4EI5A 3QG6A 3B2UC 5I15L 3WDHA 3L3OB 4F80A 4PLJD 5GRUL 4V1DA 4R4BB 1I1AD 3UTTA 4Z95H 3EIFA 2HJKB 5ESAA 5K59F 2WQ8A 5C08B 2HT4C 4PLKD 4NHUB 3ZTNL 3G6DH 1VSCA 4LRNL 3RU8H 3NTCL 4F2MB 4L8SB 3QCVH 5JZ7C 1A3LL 5CIPH 4XX1E 1KENL 4JM4H 5EA0H 1M7XA 4HIJA 4F7EA 1MSPA 4OF0A 5C0JB 5T1KA 3MRQB 2IWGA 4NRYA 4KY1H 1BGXH 4CVXB 4AENA 4MAYB 5EU6D 1KBGH 1X4XA 3KLAA 1G7JA 2BVOA 4LPVA 4GRMA 1RUPH 3WSQL 5HPMA 4JFOA 1BEYH 2RJMA 1F3DH 1HXMB 4HWBL 1VACA 4ZOEA 5ALBL 4NN7B 5EU6E 4P23C 4WW1A 1VFBA 1AXIB 3IJHB 1Z9LA 3IKCB 1YY9D 4GRWE 3TBVB 3QUXA 1M71B 5E4EC 5J1AA 3CFEA 4N0YL 5F1IA 3QHZL 4D9LL 1RURL 2BSRB 4HV8B 4LBEB 4ZAKB 1XIWB 2H2SD 2XWJA 4W6XB 2MCPL 3CCHB 5CLTA 3OAYK 3FQNA 5DC9B 5F44A 4QLRA 1T1YB 5IB1B 4WY7H 1R3IL 3RUGA 4PTUA 3F7YB 1S5IL 2K1MA 5IBUB 2IPUK 3WHE1 2UZXB 2BNUA 4K7PY 2IMMA 4XNYH 1FQ9C 3I3BA 3MJ6A 4MXQC 3WIIH 3ILQC 2A9ML 4AQ1B 3EOYG 1NGQL 4DCQB 4MHHI 4O58L 1LO2H 2F58L 2HVKB 3Q6FA 2ZUWA 4HG4J 4MNQD 4ZSOE 1VENA 4YHZL 1ZHLB 5C8JB 5F89A 1RIVL 3GMOA 3GMNA 5T1LA 2ZUQC 4GBXB 2ICEB 2MOVA 3U4EB 2X4TA 3DUUA 1CD0A 2LV4A 1IAII 4KHXL 1LK3L 5DMGD 3SQBA 3IVKA 3GJFA 4LSTL 3R8BB 1BZ9A 1FO0L 3TIDB 2ADJB 5DJYA 1JI2A 5JIPA 2XWTB 2VLKD 4PJCA 3JUYA 1ZLWH 3UC0H 2N4IA 5EIIB 1MCLA 3OPZL 2VDOH 5DHXB 1KELL 2VLKE 4YK4C 4M4RA 1KXVC 4OFYA 3BP6A 2ARWA 4P9MH 4XNXH 3LSOB 5HGHA 4HIHB 4M7ZB 1NBYB 2HFEB 5B8CA 2V2XB 1CFBA 3SPVA 1JK8A 4E9LA 3FFDA 5GGQH 1XF2A 4HGKC 2GTWB 1L9NA 4KROB 1GPOL 1SJXA 1AO7A 1V7NL 2IAND 3BQUD 1YPZE 3GIVB 3CXHK 2HLFC 2DQHL 2ZG3A 5JORA 4RSVA 4M5ZL 4Z7WE 4K8RH 4Z78B 4PG2A 4ODHL 1G6VK 1IQDA 3SO5A 1ZGLM 1DANT 2EDEA 3V4VL 2JIXA 3W39A 3T2PA 1VEPA 3T65A 1MUJA 2EZ0C 3MLWL 2NY5L 4EDXB 5E6IA 4YFEA 3PHOB 3VFPB 4PJ8B 2YR3A 3KS0J 5FGCE 1FVEB 1MHEA 1IEBB 5IR1B 1W72B 1PZ5B 1KCUH 2X1XR 2H32B 2VDQH 3HZKA 3QA3B 4I1NB 5FK9A 1TQBB 4NJAL 1YQVL 2K3TA 4G9FD 3V6ZA 4H20H 3OG4B 5JW5A 4NIKB 1U6AL 5IVXB 1E27B 4KJYB 4G9FE 2FJFB 4I48A 4IBLT 5D1XA 1U8OB 3T4YA 3O8XA 4UU9B 5HI5C 1JYVA 1YMMB 2VXQL 3ZYOA 4EIZC 2R0ZH 1SEBA 1JRHI 2GSGB 5ID0A 4GJTB 5IW3A 3SGJC 4EOWL 1F3JB 3TZVB 1AKJD 5HHQB 4NO0A 1D9KC 3KWWB 1Z9SA 4LCUB 4HF5H 4DK6A 3RKPA 1DQMH 3BKML 1JTTA 3EJZC 1F6LL 5FYJD 3LKOA 1PEZA 4MB4A 4XVUC 3UXFA 4BM7A 1FCGA 2G2RA 2HP4A 1T1ZB 4OLZL 3WDJA 4PJIA 5IKCB 5FYJU 4FFWC 1RZGB 1QRNE 1SBSL 3FO0L 5JXEC 5D7IB 1QUNA 3JZ7A 4NN6C 1T5WB 2FL5B 2R0WH 5FYJE 2GUOA 5DZLA 4OZGB 1ED3A 5IF0A 3PGDA 4U6XB 2CKBH 5I18L 1FL5A 3EBAA 2V9QA 5DJAB 2W60A 2EO1A 1T6VN 3NN8B 1D5BB 2Z4QB 3N85L 5ANMA 4RMQA 4NKDA 3WFZA 1KTLA 1BIIB 1MF2H 4M1DL 5E8PA 1DEEA 3BIKB 4HBQA 1MHCB 2OR9H 3QIUD 2OS7A 4YO0B 3X12A 3CUPA 4YHIB 1U8KA 1HYSD 1U8IB 5E5MB 4K7PH 3KLHD 5L6YH 2PW2B 4OFKA 3OX8A 1W72H 4K94H 3I50L 1FN4B 5D6CA 3QEQB 4C83A 1MRFH 4M6OL 4XCNA 4LSQL 5C0DB 5CP7B 1GGCH 1LHZA 2EEAA 1S7RA 3CX5J 1F2XK 3MV01 1JNLH 4PB9H 1A6VH 1IFHH 4CNIB 4IEFB 3MRNB 2VISA 3UPRB 4ZUSA 1PQZA 1K6QL 2NY3C 6CGTA 4XT1C 1IAMA 1DBJL 4N9GB 4BSWB 1H3GA 2KQMA 4X6EA 4B53A 3BZEB 1U41A 5J4MA 1VKXB 1X5KA 3RVUC 5H94B 5ICXA 3D2UD 5ALCH 2ARJA 1J88A 1JN6A 3L7FB 3L3DA 3PJSA 3NA9L 2IAMA 3O2DL 3MUZ1 1G1YA 4FFZL 4AG4L 1ZTXL 5LAXA 5ACLA 2V7NB 4RAVB 4AL8L 1HHGB 5DMIH 2I60L 2W9EL 4XCFL 1J18A 2UV3A 3IDYB 1P69B 2CSPA 5IQ9B 4M00A 4YHLH 1BIHA 3QIWA 1TITA 1PY9A 2QADB 4NKMB 1M7IA 5HHNA 3ZDZE 3GI8L 2OJEA 4CVWA 1JPGB 1QA9A 1RZJC 4QRQB 5JQHC 1H3PH 4FP8H 4P59H 3KDMA 2A74B 1UYWH 3BPOB 4CRPA 5FV2A 3O2WL 5GGVY 2X44D 4P3CH 4MQ7A 4PR5B 1BZ7B 4G6JH 3V5KA 1BOYA 4WHYH 4HIXH 2C7UB 1K8IB 1KOAA 3AREB 1NFDB 4JY4B 2YD9A 3BOVA 2XZZA 3RWJB 5C0NC 5D4QA 4NZUH 1P1ZA 3OB0H 5B38B 2OYPA 5BW7A 1NCDH 4GRWF 3EFFB 4H1LB 5TH2A 1AI1H 4LFHD 3KPRD 3JV4B 5CD3A 2YA0A 2OTWA 5GRWA 4GG6F 3EOTL 1MQ8A 4PPTA 5EU6A 2F15A 5CJQL 4IOSD 2OL3B 4C56B 3OXRA 4N0UE 4MA8L 4KU1A 3UYPA 1VPOH 1MJ8L 1TNNA 2C3GA 3VFMB 1T21B 3GRWL 3BRDA 4PTTB 4LRIC 3MV9D 4WHCA 3PP4H 1G0YR 5F7HA 3G5YB 2YUWA 3STZB 2DYPB 5CBAB 3MV9E 4YE4L 4FXKB 1EA9C 3MLPA 3P4NA 1DQDH 3TA3B 4RFEA 1C1EL 1U8LB 2DQCH 5IHZA 3OR6B 4Y5YC 2IALB 3LKSB 3MFFA 3ES6A 3TFKD 4OUOA 2R0LH 1G9ML 4EVNA 5J9PA 3LRGA 4J3VA 3FCTB 4P49A 4HWZA 4OZ4A 2PYFA 4D0DB 1GGUA 4ZSOA 3CFBA 2EDBA 3L95B 5EOTB 3WJJC 1PKQE 4P5TB 1KG0B 3MXWL 5JR1H 2NY6B 4AJ0A 4S1SH 4NBZB 5E1AA 2AJVL 4I4WA 5C0CD 3NFSH 3WN5B 4G6FD 3HKFA 4WFED 3O11A 3SCMB 2HRPH 2WIMA 4Y4KD 1QYGL 1QSEE 2VH5H 1NEZA 1U8QA 5FOJA 1U95A 1U36A 5C0CE 2BSSB 2R1WA 4MVBC 3O3DA 4GSDH 4MWFA 3T1FB 3KYMB 4WFEE 2MQCA 1O7VA 4QXWA 4PJGF 3S6CA 3RGVB 4M1GL 1M6OA 3HR6A 1OGTB 3MCLH 4Z7OE 2DTML 2VLKA 5JO5B 4KQ4L 3I02A 1BFOB 2IEPA 5DO2C 2VYRE 2VZVA 4H25B 2AEQH 2R2BB 2OL3H 3QEHA 3FT2A 2AGJH 2NYYC 4L3AA 4MHHG 2YD2A 4PJGA 4R2GD 1WV7T 3STLB 3VXPB 3VXSB 1YEIH 1K9TA 3HAEG 5SWSD 2DBJA 4JZNB 2R9HC 1WC7B 1YPZA 1EJOH 2DRUA 2UVFA 2B8OT 5F9WB 3DPBA 1S9YB 3WNNA 3ZSTA 2HVJA 4Z7WA 3F5WB 1MFEH 3ULVD 2Q8BL 5DXWA 3T04D 3TPUB 4U1MB 5SWSE 4L4TB 4MJIB 3OL2A 1P5UA 4QT5B 5CLWA 1NC4D 4P46A 3RVXC 3ULVE 3G5VA 5IWLA 5C07B 3A0OA 3SE4A 3TWCL 5BVPH 4AEFA 4GAYA 4F7CA 1LDPL 3LN4B 5J8OA 3ARBB 5K9OB 5D8JH 1J0ZA 2AKRB 4TUJA 3UAJC 3K8MA 3QP3A 4NM8L 3WNMA 5C0GB 1WVZA 1JL8A 3D0LA 2LTQB 1NCBH 3BPCB 4H5SA 4HK0A 3EYVA 4YPGA 4JQVA 1F42A 2DKUA 4IRZH 2OTUA 2H26A 3MLSH 4CBPA 3WS6C 5FO9B 2YMXL 3CLEH 1MI5B 2BDNH 4G9FA 4HBCL 1U8PB 4FA8A 1MCIA 5HI4D 2G9HB 3UEZA 4G9DA 4OV5A 2NY4D 2R29L 4A6YB 2YBRB 5EO9B 2VB5A 2OR8A 4M93C 1ZHNB 4UV7H 1NCWL 3TBWA 4C58B 2YA1A 1FJ1A 5LGJB 2ED8A 2DBLL 1C16B 5DUPH 4ERSL 3OR7B 2UZIL 3ARVA 4IOFC 3F62A 4YFDB 3CFKA 5DURD 1QRNA 5SWZD 4S2SB 2HT2C 5IB2A 4FQHB 3MUGB 5BQ7B 1MAJA 4M8QB 5DD6A 4X80H 1FFNA 3Q5OA 4P9HL 3OKLA 3FQXA 1NDMA 3DVNA 1UZ6E 3UBXA 1B0RB 1EAPA 5SWZE 4L4VD 4QHNA 1GGYA 5KAQF 3QXUA 4ODUB 4XAWH 1N3NA 2UY6A 3C60B 4MS8C 4LARL 5CKGA 2R1XB 4OCRH 1IRAY 5BVJA 1I7TA 3V0WL 2EO9A 4YZFE 3VXQA 4F57L 4JPVH 2HJLA 3LIZL 3S36L 4EDWH 2OK0H 5BV7B 1A1OA 3BO8B 3O6FB 1BBJA 5DD3H 2RGSA 4KJQC 4FG6C 4OQ1A 3TM6A 4LSPL 5ICYA 1UCBH 4MJ5A 4BKLA 1D5XB 4GAGL 3VI4E 3QIUA 4NUJB 1EMTL 1AE6H 2EDXA 2O5XH 3HB3D 1P9MC 5EOQL 3ZDYE 4AIZB 2XN9D 1NAMA 1L7IH 4QF1B 5LG1A 3ZHDA 3HPLA 1BBDL 4X5WB 3BZ4B 4ZUTB 5LWYL 4AZ8A 3AM8C 3HE7D 4FN0A 1PKOA 5IFHL 1QVOA 1DR9A 4XBGB 2WANA 5B4MC 1J11A 4UQ3A 4WU7A 5C08E 2IQ9H 3TBSA 1UH4A 1KPUB 1ZVSA 2NQCA 3QNYB 2AI0L 4G6KL 3FQTB 1M7DA 3NAAH 4UV4H 4XP6H 1I8LA 4WWKD 3PQYB 4MAYD 3C2AH 2ERJC 2DF3A 4RRPA 4P3WA 4K3EH 4P2OD 3AB0B 4Y4HB 4ZUWA 2PYED 4FXLA 4OB5H 3VRLF 3N1MC 3I84A 1E4KC 5IB3B 1KCRL 4NCDA 4NFDA 3ZDZF 3D2UA 3EJYD 1Y0LB 2HTLC 3DYMA 4XP4H 1L0XA 4AEIL 2VLLA 4NM4L 2PYEE 1I8MB 1QSZA 2DTSA 4WI6A 3MLVL 1T3FB 2QSCL 3MBXL 1KN2L 4Y4FC 2L4OA 1J1OL 4IRSB 4K8RC 3WYRA 4MDIA 3GM8A 1BZQK 4ZAKD 5DR5L 3WL9A 3X11A 2AEIT 2MSPA 4HUUB 5F7UA 2YPLB 1M4KA 1IQWH 2X2YA 4Z7VB 4BQBA 3EDFA 4LVHB 4IMKA 4KTYA 4JRYD 4RAUB 5E00B 3L6FA 3GEWB 3QUMA 1RZ7L 5KSAA 4TUOB 5JHDB 5EU3A 5BV7H 5J89A 4X7TA 4XMKH 1S9VB 1T80A 5CINH 3IFPB 4BK5A 2E3VA 3RPIA 5EU5B 3SGDI 1S7SA 1L4IA 5I1AA 3HPJA 1A14H 4QHLB 5T1MB 5ECJE 3MACH 1M05A 3MRHB 1I9RH 4S0TD 2UZYB 4HJGA 4MLIA 2CO6B 2BMKA 1EHXA 4GBXD 4D0CA 5E5RB 1N2RB 2R56L 4F15B 2VOTA 5F1SA 4KJPC 4JZOB 4N0UA 3Q3GB 4TSCL 4WV1A 5HGGS 3ZTNH 4HG4K 3KNBB 1NGXB 4ZNEE 4LRNH 1QBLL 3WV0A 3NTCH 3KPPA 2ZG1A 3W9DB 3QDJB 1OAYL 3WFBH 1A3LH 1RZKC 1N5AA 4HPOL 4RMWA 1PYWB 4EI5C 3JBG7 1FO0B 3MRBB 1UZ8A 1LMKA 1X3DA 3UTSB 4GS7C 1U3ZA 4QHMA 1GZQB 4QRRD 5EN2B 3MV9A 1I7ZA 1W2KT 4GKZA 1OTTD 3L3JA 2MTPA 4JRXD 1R3HB 4I0PD 3WSQH 2R2HA 3HC0A 5IEKA 4HWBH 4LGPB 3VI3F 3L5XL 4K3DL 5ALBH 2JJTC 4D0BB 3LB6C 4JRXE 3QPXH 2FX8L 1GAFL 4TSBL 43CAB 5I30H 4I0CC 1P7QB 3F7QA 1PKQA 1Q38A 4N0YH 1NANH 3QZWA 5T3ZL 1RURH 2KZWA 3GJEB 1LE9B 2MCPH 2VSDA 1IC4H 4Z7OF 4K94C 1QSEA 1R3IH 1S5IH 4F7MB 3HZVA 5FDWB 5C0CA 3LKNA 3N1FC 1G7MA 3SKJL 1LVEA 1H5BA 3S37L 3Q2CA 2RCSL 1SYVB 2CD0A 3ELAT 3FB7B 4G8EB 2A9MH 5DHYB 4GXVL 4R7NB 5B22A 5F7FA 5BXFA 3PGCA 3GBML 5TPWL 4PJXF 4QHKJ 2CLZB 1EHAA 1AHWB 4KGLA 1HZHH 1RIVH 5E6ZA 3T3PE 1A47A 4FS0A 1BJMA 2ZSWA 3WJLC 3MUY1 5IVXE 3B9DA 1MRCL 1C7SA 3I6LE 4AT6B 4KHXH 1LK3H 1A7NL 3PWUA 4JKPL 4PGBB 4LSTH 5J7CC 1AQDB 1FO0H 5SWSA 5AEAA 5KSVB 4JM2D 2ICWA 2Z91A 5D9SB 4TVSa 1A8JH 4PJ7F 3P4MA 1NMAH 1BVZA 3E1F1 4F37F 3OPZH 3T0ED 1KELH 1ZWIB 5B21A 4ZPTB 1Z3GL 1NC4A 3LN5B 4KK8D 1OPGL 3D48R 3OKNB 1U93B 1UVQB 3C5ZB 2VZOA 3BGAA 4KKBD 1INQB 1DUYA 2DJSA 2XA3A 4OZGE 3RAJL 3RI5F 4XWGL 1GPOH 3VD4A 4PY7B 4L8CB 5C6WH 4OM0L 4YAQB 5DJ0B 4M5ZH 3SE3A 2BNRB 1AD9B 3RL1A 2VTFA 1FP5A 1DQJB 4R96A 3CC5B 4S11A 1CLZL 3RWDB 4JO3L 3V4VH 2NNAA 1UCTA 4RZCA 1EVTC 3QQ9D 1K4CA 2BRRL 4NN5B 3FB5B 5FKPA 2VR5A 2NY5H 3MLWH 4JREB 5IROA 2A6KA 5SX5H 1JGEA 4CU6A 3ROOB 1UZ6F 3OTTA 4HS8L 1NGWA 2CRZA 4PG2C 4PJFF 5IG7B 5D96C 3HNVL 1A1MB 3G04A 5B39G 3V7AG 4O5LL 3QQ3A 4NJAH 1L6ZA 1QFOA 1VEOA 1EXUA 1YQVH 5I1DA 3TO4A 2NW2B 3LDBC 4LOUC 2BVPB 3CX5K 2CGRL 4CAGA 5SWZA 1MY5A 1ITBB 2EXWD 4ZTOL 1A02N 3BUYA 4P2QB 5D93C 1VGKB 3RWCB 2VXQH 4HD9A 1U2HA 3ZDYF 4I9WE 3VGBA 4EOWH 1QRKA 3P4OA 2LVCA 5DSCA 3LD8C 4MDJB 4ZUUB 3S37X 2A0LD 3PWJB 3CDFA 3S5LB 5DRNB 1YECL 2XV6B 4DUWA 3BKMH 1CIUA 5JMOC 1CYGA 5IMMA 4RQQA 4LLMB 4X99B 1DLFL 3MJ9A 1F02I 4OLZH 1SBSH 3BPLB 3FO0H 5BZWA 3EYFB 3L3OA 4KH2A 1FVDB 1OQXA 4OZFB 4R4BA 5I18H 3ALPA 2Z35B 4R8WL 3T2NL 3O9WD 1S3KL 3QXDB 1A0QL 4YNYA 5C08A 3WEXB 4NHUA 3ARED 4XXCA 1VERA 1C12B 3HE7A 4M1DH 3HUJB 4F2MA 4L8SA 1S7TB 5H37H 1LO0L 1LEIB 3RWHB 1NFDE 2VLRD 2W92A 2EE3A 4U1IB 1UA6H 5C0JA 5I6XC 3MRQA 1QBML 3NIGF 1RV6X 1FFOB 4CVXA 4RGNC 3I50H 5ACMA 4W4NA 4WWKA 4MAYA 3J7HA 1DUZB 1FZJB 4M6OH 4PBWD 2OMNA 1U2CA 4NC0B 3P2TA 5TDPA 2PYEA 4QY8B 4PJHB 5CP3H 2X7LB 4MA1B 1AGBB 2F8VA 2JLLA 4YDKL 4LDEB 3BFOA 1C5BL 3ECBB 1A22B 4XNMA 4CL7A 2DQIL 3P9LB 1SMOA 1KN4L 4PRNB 1HOCB 4YLQT 3TJHC 3IJHA 1FGNL 3IKCA 2ITDB 3TBVA 1QO3B 2CPCA 3AS3A 1Z5LB 3GSRB 3CPLB 1JYNA 4LLQB 5FM5O 5SX4H 2WIIB 4HV8A 4LBEA 4ZAKA 1XIWA 4KXZI 1S7WB 1T1YA 5IB1A 3U2SB 4EZMA 1W8NA 4WDIB 3TA3D 1TZHB 3NA9H 4FFZH 3O2DH 5A16B 4AG4H 1Q9LB 1ZTXH 2W0PA 2AJZA 4JB9H 4NSKA 2CUMA 3P73B 4AL8H 2I60H 1CFTA 4JO1L 2W9EH 4XCFH 4XCCL 1AGCA 4WHTA 4B41A 5D7LB 5MI0B 4DCQA 3OG6B 4POUB 2CXKA 2DQGL 2HVKA 2G5BB 3B8YA 4HT1L 4OZFH 2ENSA 3GSQA 1ZLUH 1I3RA 2HH0L 4LHUG 3N1QC 1ZHLA 2IAMC 5C8JA 3GI8H 3SCMD 2PXYC 2VZ3A 4G8GD 4IRJB 1XCQB 4X6BB 4GBXA 1OTUC 3V95A 4ZNEA 4DFHA 3U4EA 1BD2B 1QKZL 3UYRL 3O2WH 1ZT1B 1S8DB 5DVMA 3RGVD 4XNUL 4G8GE 1IE5A 4NT6B 2ADJA 1CXIA 2O26U 2NXZD 3ULVH 4PY8I 5CUSL 3NPZB 1CD9B 4NJ9L 1EEQA 2CQVA 2EYSA 5FA3A 3DX9B 4PJ5B 5DJ6B 1LWRA 4HDIA 2PTUA 3HN3A 5CZVL 5FB8B 3HE6B 1A7PH 4HEME 5CJXA 1E6JL 4PLJC 1I1AC 1ONQB 4NQED 5F6IC 4U2YA 3LSOA 1I8IB 4HIHA 3QDGD 1NBYA 4PLKC 4N1EA 4JRXA 5CJQH 1MCBA 3RY4A 3TT3L 32C2A 4MA8H 4TUKL 4KRPD 3VXSE 1D5MB 2GTWA 1MJ8H 4L4TD 3DTXA 2YSSA 5C0EB 3GIVA 3GRWH 4Y0GA 3T1WA 2FBOJ 4Z78A 4LPWA 3RIFK 1HILB 5ICZB 4U05A 2MCG1 2VL5B 4FQLL 1DJSA 4L4TE 3PV6A 3RIAK 5DQ9B 2EDWA 5DRWA 5I8KL 4QCIA 2NLJB 3P0GB 3CVHB 4EDXA 3MJ7B 3V79C 1S78D 3VFPA 3OXSB 1FVEA 1CICC 3T3PF 1C1EH 5FM8A 5EB9A 4YHYC 4JANA 1MELA 5IVXF 2EE6A 1A9BA 3ME0A 3QNZB 3QA3A 1YY9C 4PV8B 1G9MH 4NQCD 1T7WA 4M7LL 4BFEA 2YD1A 4J3XA 4NQXB 2ADFL 5TQ0L 1UEMA 1HI6B 2H2SC 3U6RB 3WUWA 1HWGB 1CZ8L 5IVXA 4IS6A 2AXJA 2AJVH 2FJFA 2XFXA 5E8NB 1U8OA 3IXTA 4UU9A 4DZBB 1BX2B 1QYGH 1VEMA 4KJWD 1TCRB 5D7IF 3DETD 2HYMA 2C4XA 3LS4L 2Q3AA 4PRIB 4HPYH 5HHQA 4CJ0A 5DUBB 1T5XB 3H3PL 1B9ZA 5I71C 1OGAD 4M48L 4M1GH 2GK0A 4OZGF 4DKFL 3LZFL 3MJ8A 1NCNA 2WMPA 3MA7B 4BFIA 5JQ6L 2DTMH 3KPSB 4KQ4H 4QWWD 4LEXL 1U92B 2W9DL 5HHMD 1PGRB 4NRZB 5IKCA 1OGAE 3HI5H 1WAAF 3HAEB 1MVUA 4ZDHB 2CDFA 2P7TB 1J0IA 4OLYL 4J2XA 1T5WA 3GKZA 2F54B 4OZGA 4JLRB 4OZIE 4Y1AB 4U6XA 5HHME 1VHPA 5DJ2B 5DMGC 3DV4A 3NN8A 1MHHA 2Z4QA 2Q8BH 3BIKA 4JKWA 1MHCA 1GCFA 5HDBE 4YHIA 4ODXB 3SDCB 4C4KO 4OCXL 4U1HA 2IC2A 1U8IA 3VFUB 2QL1A 3OKDB 1SHMA 4U1JB 1E28A 3TWCH 1LDPH 1B4JL 3FAXA 4JPIB 4Z7NF 2GHWB 1TTGA 1FN4A 3EYUL 1YUHB 2WBJB 5C0DA 3O45B 4NM8H 5CP7A 5FUZL 4DN3L 5DK3A 3V5DA 3K46A 3MRLB 3BQUC 3MRCA 3MRNA 5HVFB 4IIQC 1AJ7L 1X5IA 4H88L 3TYGL 5IWLC 1XT5A 1AD0A 3ARYA 2YMXH 4HKZA 4N9GA 5DK0A 3SE4C 5EZJB 4HBCH 4BSWA 1AQKH 4LPCA 3C8KB 2X6MA 3DBXB 4Y4HD 5TDOA 3BZEA 1XR8A 3FRPG 5D2NB 1A21A 1JWSA 5F9JB 4H0IA 4WHDA 1Z2KA 3ULUF 1XF5A 1NCWH 3QWRD 3ZKQD 1BM3L 2DBLH 1U42A 2C3VB 4JY5L 1K85A 1U8MB 3MGAA 4ERSH 1OOAA 3TESA 4QOKD 1A3QA 1XGRA 1QFWI 1YEDA 5IQ9A 5F3BB 1YYML 1YEEL 2QJDA 1HDMB 5DD1L 2GY5A 4NKMA 4P9HH 4R3SA 1NFDF 3DGGB 2VKXA 4Z7VE 5D6DA 3VXMB 4JVUA 4FMFA 1SY6L 4QRQA 3MR9B 1HSAA 2A74A 3W0WD 4X4YB 3JWDL 4ELMB 3V0WH 1J1XL 3IDMB 4PR5A 3LIZH 1BZ7A 5JHDE 4IHOB 4U1NA 3WKNA 3AREA 1NFDA 3RWJA 4GMSH 2HJFB 1J7VR 4BH7B 2EDQA 5HBBA 2PW1B 5IV2B 1ORSA 4GAGH 4CU7A 5IB4B 1KXTB 3HNTL 1FVCB 5EOQH 1BFSA 5HGAB 3WE6B 3SKMA 4C55A 3IETB 1FC2D 3PP3H 5IFHH 3OKOB 3JTTB 3PHSA 5D1ZB 4WTZG 1XF4B 3HCVB 5DF0A 3VFMA 4N8CL 1I8KB 5AD0B 4YHPA 1IKNA 1WF5A 4N0CD 4ACPA 2AI0H 1HYSC 1X9QA 4G6KH 4KI5F 3IAQA 3KLHC 3R1GL 4OQTL 3G5YA 5F7LB 3BI9X 3UTSE 3STZA 2DYPA 5CEYB 1FNSL 3QUZD 5CBAA 4FXKA 4PGDB 4DEPC 1KCRH 2FECI 3TA3A 4AEIH 1U8LA 4M6ML 4NM4H 4X6DB 3OR6A 3RX7A 3MLVH 2QSCH 3MBXH 1KN2H 4NO5B 1J1OH 4JFDD 5F3HB 3MRJB 4BUGA 1DTUA 4XBPB 1I8LC 3FCTA 1TENA 4XPTL 5DR5H 2UYLA 2HAZA 5I1JL 1HINL 1JNJA 5T5NF 5I76B 4P5TA 4OCWL 5EBMB 4NBYB 1KG0A 3WHE0 2NY5C 2AV1B 4JPWH 3QRGL 4TNWK 1IAOB 1AGFB 3WN5A 1KTDA 1RZ7H 3SCMA 1MCDA 3GSOB 1CXHA 2HG5B 4G8GA 4TULL 3MOAL 5CJOL 5ACZA 5HYFA 2L7UA 3T1FA 1JNNL 3RGVA 5E95B 2DMBA 2KZ1B 4JVWA 1DN2A 3K7UA 4ODVH 3CLFH 5CHNB 3RJQB 1BFOA 4XGZB 1MCWW 2D7PA 3IKKA 1T4KB 1N64L 4NHCH 2R56H 2R2BA 1KT2B 3O4OB 4LQ1A 1JWMB 3FFCD 3ZYZA 5F1NB 2F53B 4TSCH 3VXPA 4ORGB 5I17A 5EC2B 3VXSA 4NZDA 5C70A 4JZNA 3M8OL 3NCYP 1WC7A 5E8OB 1CFQA 1QBLH 2J4WL 1KPVB 2OLDA 2WBKA 3S4SG 3F5WA 3OKKA 3VE0B 1OAYH 3L7EA 4JG0L 4HPOH 2RHEA 3TPUA 4L4TA 2NY7L 2FX9L 1MCEA 4U0QB 5HYJB 4HCRA 3NCMA 3NFPA 5FKAB 1N8ZB 1RFDL 1QP1A 4HS3B 4WV1C 2UWEB 4CJ1A 1FG9C 3FQWB 4APQD 4Q2ZB 5K9OA 4ZXBB 2AKRA 1KCKA 3HI1A 4HXAL 5GGRA 3ZKSD 5CWSA 3L5XH 5C0GA 2FX8H 1GAFH 5D2LB 4PV9B 4TSBH 3BPCA 4YXHL 1H3TA 4LCCA 3RWGB 3PWLB 3INUL 4RFNC 2YKLH 2P8PA 4TTDD 2DLFL 5FO9A 3BESR 3VD7A 2FSEB 1X5XA 5E5UB 4WUKH 1U8PA 3G5XB 1EEYA 3QXVA 5F72S 2G9HA 4XNZB 4ZPVA 1S7QB 2Z8VC 4L9LB 1I7RA 2YBRA 5EO9A 5BO1L 4KRLB 4NQDD 1YJDL 1ZHNA 1NGYB 3STBA 3CVIL 5JPNA 2X4PB 3S37H 4P4KD 3TFKC 5LGJA 2RCSH 2X9XA 3EOBA 1C16A 3IU3A 4NQDE 5GGRY 4GXVH 4P57B 4M5YH 3EOAA 2W0FB 1NCTA 5CKAA 3QUKB 3GBMH 4YDVB 5TPWH 1OGAA 3D0VA 2HWZL 4CUCA 5I0ZA 4YDLB 4OF3A 1KYOJ 3MUGA 1BOGA 2EC8A 4JPKL 1VGEL 4M8QA 4CN4A 4OZIA 1G7HB 1FL3A 2B4CL 2DLIA 1Z0NA 5GHWH 5DS8B 4ODUA 2V9RA 4Y4KC 5DZOA 3QRFM 1KIRB 2D9CA 1A7NH 4JKPH 2R1XA 1JCKA 3SKNB 3QH3B 4H0GA 4P2QE 2XOTA 4TVPL 5GIRA 4C54A 1N59B 4Z77B 3BO8A 1T22B 2XNAB 3L9RB 3OKEA 1ZHKB 4OLVL 1FL6B 1P4LA 5FFLA 4OFIA 5L9DL 2Y25A 4PREB 5FHBL 4HC1A 1IL1B 2Q20A 4NUJA 2BVUA 4P3DB 1OPGH 4R2GC 4YC2B 3HG1B 3HLAA 4AIZA 1UM4L 3BWUC 1MCPL 1MAKA 2ICES 1QLRA 4X5WA 1FZKB 3BZ4A 3VGGA 4ZUTA 4XCEB 4PP1D 4YR6A 3EGSB 3RAJH 5I1CL 3IDGA 4XWGH 3ULVC 2UVEA 4EQ2A 4XBGA 3BP7B 4OM0H 4LKXB 1EEUA 5E9DB 3UROR 4M6NL 3BEWB 1CLZH 3QNYA 4MB3A 4Y16B 4LVEA 4X6FA 4KDVA 3JXAA 1NLDH 4YIQB 1BQHG 2QSQA 2BRRH 5JIIA 2PR4H 1FDLL 4RISL 4LCIH 5KS9B 2DLHA 4XVSL 3T0VA 4Y4HA 1CLYL 1NMBL 1FG2B 1PD6A 5IUSA 1XF1A 1RI8A 3IDJB 4Z7VF 5IB3A 4HS8H 3G6AA 4NZTL 1ZA6B 1LEGB 3HNVH 1FNGA 1I8MA 3GMPB 4LF3B 3BZFB 1T3FA 4O5LH 5ITFA 3S34L 3QBTB 3AXLA 5H35B 1IGTB 2WINB 4PY8J 2CGRH 5HI4C 4Z7VA 5IROC 4YHNA 5BZDA 1RHHB 4Q6IB 4ZTOH 5HDQL 4RAUA 1VFMA 2ZOKA 4Y5VB 5E00A 1CGXA 3GNML 4WVRA 5E2UL 5GJTL 3GK8L 4TUOA 3QO0B 5DEGA 4AH2B 5JHDA 3L5HA 4BH8B 3VMOA 2YK1L 2J8OA 5D7LD 4LLUB 2XI9A 5EBWA 5EU5A 1YECH 2H9GA 3WIHA 4Z8FH 1P2CA 3B4NA 4QHLA 2VE6A 5EZLB 5M94B 3SQOL 3U9UA 2YN5A 4HMDA 5IOPA 4AIXA 1DLFH 4X9FA 3MRHA 5D7LE 4IDLA 4XHJD 1B90A 1E4WL 2W9LA 1S9WB 5MENB 1N2RA 3BGFB 1XR9B 3FAWA 2IPKB 4R8WH 2ADIB 1WQVT 3T2NH 1S3KH 1A0QH 1AC0A 2XTJD 4X5LA 3NPSC 3SO3B 3KNBA 3JUZA 5F88B 1BD2E 4Q7DA 5I1GL 3W9DA 5E2TL 4PJ5D 1PYWA 2XTJE 4KUCD 3HE6D 3GSXA 4RFOL 3UTSA 1GZQA 4Z6AT 5EN2A 3HB3C 3CD4A 3TN0D 2ZG2A 3VW3L 4PJ5E 1QR1A 1MRDH 1I1YA 3RTQD 4W4OC 4QRTB 4MD4B 1AGDB 1QSFD 4XXCC 4L8BB 2O61B 2J8HA 2ZUVA 3HE7C 3DX7B 1ZANL 1CGWA 4XVJL 3H9ZA 4YDKH 1C5BH 2FBJL 4D0BA 3ARUA 4JHAH 2DQIH 3P30L 1QSFE 3U7AA 2W0KA 4LNRA 4Z0XB 4HFUL 3KLDA 3GHBL 1OWWA 4WWKC 2FZ3A 4JKLA 4P2OC 4UDUA 5L88L 1UXSA 3SDDB 2J88L 2V2WB 5IMKB 1DZBA 3P11L 4F7MA 2Y7QB 3EJYC 5FDWA 4LPTA 3DXAB 5A3ID 4NUGL 1RSFA 5BS0D 4JO1H 4XCCH 1SYVA 3RY5A 2AV7A 1CL7L 3H3KA 5DHYA 5C9KA 4R7NA 4LHUB 3RBSA 1Q72L 2DQGH 3TNNB 2EIZA 4GH7B 5D1QD 2HH0H 1AHWA 2E27L 3MRGB 1N7MH 3T0BA 3VH8G 5EZIL 5D7JB 2X9YA 3UYRH 1QKZH 4AT6A 4WFGD 4S1DD 2IGFH 2J5LB 4PGBA 4XNUH 1AQDA 3O2VL 5DJXB 5KSVA 5CUSH 1LE5B 5D9SA 3VG9C 4PRIE 4NJ9H 4WFGE 3VD9A 2Y4SA 3U9PH 4WI2A 5GRZA 4YBQD 5CZVH 1JHTB 4LVNC 2ILLA 3AAZB 3T8XB 1E6JH 3B9KD 1ZWIA 2B5IC 4WW2B 2EYRB 1IEAB 5TFSH 3RPKA 2WLYA 3OKNA 1UVQA 4ZFFA 1JNHA 1INQA 4N8VG 4APQA 2F54E 5J12B 3TT3H 3KPLA 1P4BL 1FNFA 4TUKH 4Y1AE 4NQVB 5H2BA 4ETQB 4DGVL 5JW3L 1WWAX 2XACC 4MX7B 2XRAL 4GW4B 2YEZB 4YHML 3GMMB 3MRFB 2D2OA 4FQLH 3CC5A 1XEDA 3RWDA 2B7DT 5IVZA 4PFEA 5I8KH 3KPOA 1RD6A 4KKAD 3FB5A 5AZEL 4I0PC 4QRPD 1BPVA 4QNPE 2HRLA 3RHWF 2W65B 4XC3L 3TJEL 2PETA 4LP5A 3ROOA 4JDZA 3X14A 4NQDA 2NXYD 4GW1A 4MA7L 4WJ5A 1TDQA 3VXNB 1YY8B 2OQJA 2H6PB 1BHGA 4M7LH 4UQ2B 1IILE 1WUNT 2YRPA 5HD8C 1NQBA 3TH3T 2ADFH 3NABL 4JVPA 2NW2A 4ZFOB 5HYIA 1RJCA 3F12A 2BVPA 5FF6B 1TXKA 5JW4Q 1A3RL 1CZ8H 5K93A 1MCFA 4JFYA 4GW5B 3VRIB 4PRPB 2VN7A 5DQDL 1X5AA 4U31A 5IEHB 2BJMH 4P2QA 1VGKA 4OCMC 2JCCE 4DKEL 1A6AA 2VXSL 2QSTA 3VFNA 4GOSA 3LS4H 4ZUUA 1DE4B 2GFBB 3H3PH 3CX2A 3G9AB 3THML 4R0LB 3C6LB 5A2IH 3ARFB 4S1RL 5IESL 3T0DA 1JMXA 3D87B 3SGEH 4LLMA 3O3AA 4LEXH 2W9DH 4X99A 1MY7A 3VXMD 3EFDL 5GGTA 2BNQB 5A2KH 3HUJF 4OLYH 3EYFA 5B3JE 4KK6D 4RWHA 2UUDK 1H3XA 3MV11 2VUYA 1DDHB 2Z35A 3V8OA 3VXME 2FLRT 5C0IB 1KB5A 3QXDA 3DVGB 4WO4B 4JM2C 2PO6D 2D31B 1C12A 4ELME 2AJXL 1NMCC 4HKXB 5KJRL 3NCCB 4G8FA 1SM3L 2AW2A 4PJHF 2F8OA 3RWHA 3TLRA 2JELL 3T0EC 2COQA 5C0BD 4OCXH 1KJMA 4U1IA 4KK8C 2VQ1A 4MZ3A 5ELIA 4HUWB 1RK0A 3EYUH 2BHYA 4QEGA 5C0BE 5CZXD 4DW2L 5FUZH 1PG7W 3OZ9L 1HHJB 4QY8A 1MLBA 3ZZ1A 4DN3H 5I66B 5KVFL 1AGBA 2BVQB 5T3XD 4CN1A 1FBIH 1AJ7H 3P9LA 4I77L 4H88H 4PRNA 3TYGH 4BQCA 1HOCA 2Z31B 3H9SB 2NX5B 5ENWB 3RIAF 2ITDA 1Z5LA 1WFUA 3GSRA 2FX7L 1WZ1H 3CPLA 3HMWH 4AQOA 5FV1L 3MRRB 5T3XE 3QQ9C 3NIFF 1EH9A 4HW6A 3UJIL 1IKFL 2LFGA 1U3HD 3F6LA 4LCYB 1U58B 4MA3B 4OLEA 3VFSB 1S7WA 3F7VA 3U2SA 4WDIA 5MEQB 1DLHB 3V4PH 5A16A 1XFPA 2DL2A 1BM3H 1FZOB 4JY5H 1F8TL 1FSKB 1YNTA 3U36B 2B2XL 1RY7B 2HFGL 5TF0A 5JOFB 4X6DE 5D7LA 5L8KB 2IFFL 1YYMH 2XKNB 4Z5RB 5FGSA 4QXUL 1G7LB 2G5BA 4WFFD 4NFBA 2EXWC 5HHOB 4ESKA 1GGBL 5KSUB 2I26N 1SY6H 2VITB 4X6BA 1KJVB 1J8HB 5L2KD 1D5ZB 3D39D 5T5FL 1G7QB 1BD2A 1HKFA 4WFFE 1HXYB 4CW1B 2A0LC 1NGPL 1ZT1A 1OF2A 4NCC2 4NT6A 2J6EL 5L2KE 3D39E 4ETYA 3U0PA 3D6GA 1KTRL 4PBXA 3DX9A 5FAAA 1MCHA 3SDAB 4PJ5A 5DJ6A 1IGYB 3IDNB 3OSKA 5FB8A 3HE6A 2Z8SA 5TDNB 3KJ6L 3HNTH 4HJ0D 1JGDB 2R23B 3OJDA 5F7EL 1I4FB 5DJDB 2VXVL 5KANI 2NY0D 3TN0A 1F4XL 1RZ8B 1PG7X 3O9WC 3RTQA 5J1SC 1FPTL 1K2DB 1NFKA 5I8CB 1QSFA 4GQPH 5J57B 4Z9KB 5C0EA 4TOYL 3V6BR 4N8CH 3E6FB 2FYYB 4AK1A 1UQSB 1ZA3B 1HILA 1I7UB 3SE8L 5ICZA 3R1GH 2VL5A 4GG8B 5GZOD 3DURB 5DQ9A 1VFAB 1CE6B 4CMHB 4P5MB 5LBSL 1FNSH 2EYTB 3CVHA 1H8OA 3MJ7A 1FAIL 2AQ2A 3T09A 1XGPB 2UWEE 5E7BA 1MLCA 2VDNL 1IKNC 3HNSL 3PXHA 1T03L 3MYJB 4U1GB 4ENED 3SDXE 3BHBB 5MERB 5D2LE 1S5HB 4XPTH 4NC2B 3VWKD 1KBGL 5DMKA 2Q76B 4LK4A 4NQXA 1HI6A 4OCWH 4UUJB 3U6RA 1OB1A 4PJ9D 4CDGC 5I73C 3QRGH 3WIFB 4NPYB 5D1QA 4POZD 3B43A 4DZBA 1BX2A 4F9PC 4Z0BL 4L3CA 4TULH 3MOAH 4CVZB 5C92A 4NWTL 4PRIA 4PRAA 3MV7D 1OAQL 5DDHB 5ISZD 1JNNH 1T5XA 5DUBA 3UJTL 2ZKHL 4AM0A 3QUYD 2RB8A 4UIMB 4RNRA 4Q74A 2R69L 1U92A 5DGQA 5ISZE 4KI1A 4NRZA 2OI9B 4ZDHA 3HAEA 1JPTL 4KMTH 3PABB 3G6JE 1N64H 4X6CF 1ZSDB 2DJUA 3S4SB 2F54A 2AJ3B 5DK2A 5IBUG 1KB5H 1C5DB 1AXSA 4FZEH 2AK4D 4JLRA 4DZ8B 1YN6A 1YYLL 4Y1AA 4MD0B 3FHAA 3K4AA 2Y07L 2J4WH 2P8LB 5I9QB 2NXZC 4X8XA 4WU5A 3U30C 4JG0H 2AK4E 3ARRA 4I3SH 1T7XA 4HZAA 5I0DA 1MJJB 2OP4L 1EBPA 2FX9H 3VDBA 3KGRA 4F33B 3VGHA 4I8DA 1RFDH 1DVFB 4I5BB 1N5YL 3SDCA 4ODXA 3MCKA 3F58L 5JLZA 1NCAL 3OKDA 4KDTA 4U1JA 4JPIA 3FB8B 1VDGA 1IAKB 2WBJA 4NGHL 3W9EA 3DSNA 4BFBD 4HXAH 3I6KA 4LSDA 4N5UA 5KOMC 3O45A 3TC9A 1E0OB 1F3DJ 3QCTL 4G43B 2EKSB 2V7HB 4KRPC 3LV3B 3UC0L 2PNDA 1DBMH 3KPNB 1MIML 4YXHH 3U7YL 15C8L 1YDPB 2A83A 2JJSA 1JTOA 2DLFH 3NFNA 3EYOB 1YA5A 4XNXL 1KUMA 5CJ5A 1HN1A 4DOHB 3WHXA 2CDEB 9CGTA 4UOW1 5TE6L 3DBXA 1U9KA 1R3LA 1CDBA 3CDGB 2JCCA 1S78C 3FO2B 5BO1H 1BVKB 2F74B 5F9JA 1A1NB 3LKQB 5KZCB 4JGMA 5KS9E 4GG6B 5B3JF 4LCCC 4K8RL 3LH2L 3CH1A 3V7AE 3R0MA 4P23B 4LHJB 4F3FB 3BPNC 2ZCHL 3GSNL 4NO2B 5E4EB 3MBED 2IH1A 1YN7A 3OJVC 2HWZH 1U8NB 4ELMF 1HH9A 2XWBB 1HDMA 1MCWM 3SGKC 4JGJA 4JPKH 1P53A 1VGEH 4ONGH 4FABL 4LIQL 1A7RH 1RJLB 4D8PB 3IJYB 3DGGA 3BISA 3VXMA 4EN3D 1PSKL 3A6BL 3B83A 5I1KL 1RHFA 4B0MM 4PJBE 4KJWC 1CDIA 3T4AB 3DETC 4X4YA 3MGOB 4ELMA 2RFXB 3MNVA 4TVPH 1N0XH 2ZP0T 4AEEA 2Y5EA 3QXWA 4IHOA 4M6AA 1XGTB 4MJ4A 4I3GA 3DRQB 1ITCA 2PO6A 4X9GA 2FIKB 2HJFA 4OLVH 4CMMB 5HYQA 5L9DH 4QWWC 1JGVL 2DIAA 1ORQB 3V4UL 5ADPH 5IV2A 3WFHA 4U6VH 4JN2A 1LD9A 5IB4A 1WCBB 2ZUQB 5JIHA 3OMZA 5HGAA 3WE6A 1UM4H 4GUPA 1MCPH 3CMGA 4PRBB 1UGNA 4O51B 4Z76B 3QJFA 5HJ3B 5HGDB 1RZKL 4DAGL 5GS0L 5I1CH 2E5EA 5DEFA 2BRQA 4FQQB 4FQXD 5IP4A 1EIBA 5F8QC 3QI9D 1GSMA 1XF4A 2PTTA 4EUPH 2FR4B 1I8KA 1RPQA 5AD0A 3G5ZA 4M6NH 3U0WL 1UG9A 3GMLA 2KUTA 4X6DF 4F58H 1A7BA 1FDLH 4YK4B 2DM2A 1IM9B 5DHVA 4XVSH 4XRCB 1I3VA 4LMQE 1XCTA 5AUMB 5LJYH 1MCRA 2CIIA 2DQDL 4NZTH 3DIFB 3KXFD 4X6DA 5CEXA 3RVTD 1A6ZB 3S34H 5F3HA 3GSWA 3MRJA 1ES0A 2CDGB 4WHYG 4K94L 4N8PA 4NQSB 3HTLX 5EBMA 3M45A 2E9JA 3WFEL 4PB9L 5HDQH 1ULVA 2IJ0C 1GC1C 2AV1A 2BP3A 3DXAD 3GNMH 3HI6L 5E2UH 1AGFA 3GK8H 2HG5A 1R3KB 2YK1H 1YMHA 5L2KA 1TCMA 3D39A 1NANI 1MWAB 3DXAE 4LHUD 3RNKA 3HZYB 5F21B 2EDKA 4HFWA 2KKQA 3TNMA 1S7VB 1T0MB 3V6OE 3LPFA 1TQCC 35C8L 4JFXB 2HN7B 2V6HA 1E4WH 5CHNA 2DM3A 2V5YA 2H45A 2A6DB 1LO5B 2DQJH 3GGWB 5F6HJ 5IK3B 3K1DA 1KT2A 2Y36L 4PYGA 4FTVD 2F53A 5EC2A 1HQRB 1KIPB 1P84K 1EEZA 1XH3B 5I1GH 1D9KB 3U4AA 2UWEF 2FGZA 1NDGA 2XQBL 5E2VL 4MZ2A 1Y6KR 2WUCL 3VE0A 4GO6B 4FTVE 5E2TH 2C1PB 2MHAB 3UZQA 4JQXA 1RZFL 1BWMA 4HGWB 4HZLA 3WLBB 2H3NB 4RFOH 5I8EA 3S96B 5J1TC 4ZS7L 4NN6B 3VW3H 1VA9A 4RMUA 2DJ4A 3KPTA 3DVFA 1D3CA 2UWEA 4BSVA 2G75B 4G6JL 5JXAL 1L6XA 4HIXL 4LAQH 3FQWA 4Q2ZA 2DI8A 3B6SB 4ZXBA 1HHIB 5E4IA 5GS0D 4PUBH 1ZANH 4XVJH 3SDXA 2FBJH 5IQ7H 3P30H 3LQAH 5D2LA 4O9HH 3RWGA 3PWLA 3MGTB 3TF7C 1GZPB 4U49A 5B38G 1IJ9A 1EBAA 4H1LG 4KTDH 5LKNA 1DBKH 3QUZC 4U2ZA 5L88H 1S7QA 4L9LA 4I3RL 5ESVB 5KVDL 3P11H 5MEOA 4NNYB 3BMWA 5FYLD 1NGYA 2I5YL 4NUGH 4P2RB 1UWXH 2QKIB 3PP4L 1V7ML 2X4PA 3RKDD 4R97C 5DJ8B 1CL7H 2NY3B 3LOWA 5K59E 4P57A 5FYLE 1A7QL 2W0FA 3DRTA 1HEZA 3BVNA 5ISZA 1Q72H 4HHAA 4M62L 3G6JA 1DQDL 3VXTB 3RA7L 1RZIA 2E27H 2C3XA 5I19H 2JJVA 5EZIH 2CK2A 4FFYH 3QUXD 5DRXB 1UB5A 1MFDL 2BHUA 2ADGB 1KEGL 4FFVD 2F8XC 3NCFB 3TYFA 4R4FL 3QH3A 2AK4A 3QO1B 2A73A 2WZPD 2GSIB 3WO3B 3FT3B 4E42B 1OAZL 5E1HB 5EH1A 4OM1L 4Z77A 1T22A 3HR5A 5HTSA 1ZHKA 3I2CL 4MQXD 4NFCA 4LLYB 5KN5B 2A1WL 4PREA 2VDRL 4ZTPL 1IL1A 2ICCA 2OTPA 3QFJD 1RIHL 4N8VB 2JJUA 3T3MF 2PKDA 5ID1A 4P3DA 1CF8H 3GBLA 4GSDL 2H1PL 1I9IL 2BNQE 3FONB 1IAIM 3B3IB 3ZKMD 3NA4A 3WXVL 5INDB 3QFJE 5T5NG 4XCEA 4PRHB 2P5WD 5KS9F 4DGVH 2J1KA 5JW3H 2BSED 5T1LD 1R5WB 3BP7A 4LCWD 4LKXA 2XRAH 3WNKA 1DBBL 1NBVL 4YHMH 3VWJD 3BEWA 4LLWA 5EULV 1IM3B 2P5WE 1A4KA 4YIQA 4LCWE 2VIRB 4PJEF 3T77A 3V0VB 1EJOL 2P5ED 1Q9WB 1IC7L 3E0GA 5KS9A 4F8TA 5AZEH 4APQC 4ODSL 4WNQB 2ZJSL 1LNUA 1A6UL 5B39A 4OZHF 4XC3H 3TJEH 3IDJA 2A2QT 2P5EE 1FYTB 2GITA 4NDMA 4MA7H 1ZA6A 2C3HA 3IJSB 4OFYD 4LF3A 3N0PB 1ADQA 4TTDC 4NRXB 1J05B 3UTZB 2BVYA 2IH3B 3BYYA 3NABH 5H35A 3QSKB 1CLCA 1IGTA 3QPQD 4G6ML 4L29B 2WINA 3MBEA 2X4RB 3W2DH 3MRMA 1BJ8A 4JRWA 1EO5A 3JTSB 1RHHA 3QISA 4PJBA 2BCKB 4OFPA 5DQDH 4Y5VA 5FGBA 4DKEH 1DSFL 3MLSL 3Q5YA 2Q7YB 1I3GL 2JF1A 4P4KC 4Y5YB 5IVNA 4HKJB 2OXHA 4LLUA 5IM7B 5GGVL 3CSYB 2HFTA 3THMH 1NBZB 1CDCA 5EZLA 1B3JA 4S1RH 5IESH 2BSTB 3ARGC 3MV8B 4U1SA 3QDAA 3RDTD 2D7OA 5BJTA 3T2QA 2V5TA 5CILH 5I16A 2VAJA 3EFDH 1B2WL 4AEHL 2CLRA 4JFZL 4U3HA 1JGUL 5HY9A 3QG7L 5LGKA 1WLHA 2OCFD 1XR9A 2BXZA 1VADA 2ADIA 2X4QB 1F45A 3RL2A 1KJ2B 3JV0A 5FM4A 1J8HE 5D1XD 5F88A 1NUNB 3ULSB 2AJXH 2X41A 2BOCB 4OCSL 3AC0A 1XZ0B 4OI8A 1SM3H 3KJ4C 1WBYB 3GB7A 3QI9A 5IMOA 1XAUA 4NO0D 5SWQB 5IHLB 4PJXB 1CK0L 4MQSB 4P2CG 4M61A 1MCNA 4UOJA 4MD4A 4OCLC 3MREB 1AGDA 4DW2H 3OZ9H 4PP1C 4ODBD 1TETL 5KVFH 1NEZG 3ARPA 3DX7A 5E6YA 1F97A 4I77H 2DI7A 2FJGA 2Z92B 3KR3L 3DROB 2OZ4A 3TT1L 3F8UB 4OLWL 1S9XB 5F9OL 1PAMA 1L7IL 2FX7H 1T6WA 5HDLA 5FOBB 3UJIH 3P77A 1IKFH 4W6YB 4X4ME 1T89A 3ARQA 1EUUA 1LP9B 2IQ9L 5IMKA 3VXUB 3L3HA 2R1YA 1EGJA 2VQTA 5IJVA 1GOGA 1WBZB 1PEWA 1UXWB 3DXAA 4MCZB 5MHSE 2BXYA 3LAFA 4FQ2L 3AU1A 4KMLB 1XGUB 4FQJH 1F8TH 3V6OA 3FOMB 5CIPB 2B2XH 2HFGH 4G80B 3QHFH 3DSFL 2J8UB 2IFFH 1J12A 3MRPB 4LHUA 4KV5F 3RWIB 2H2PC 4RIRA 5ITBL 2QR0B 2G60H 4Y19D 4KWUA 3IDIB 1DQQB 3MZGB 1GGBH 3MRGA 3EO9L 1TZGL 4M93B 4DGIL 4JR9L 4Y19E 5T5FH 2ATPB 3MLYL 4U4BA 1WWWX 3ISWA 1K5NB 3RWFB 4KPHH 2RBLA 4J4PA 4XPGL 3NCBB 5EU4A 4FTVA 5GJSL 2VLJD 3GMRA 3QJHA 4OTXH 1IQWL 4WW2F 4YGAB 2J6EH 3O4LD 3C6SB 2DWEB 2APVA 2B0SH 1MJUL 4ISVA 1WBXA 3MMEB 2VLJE 4XHJC 3WS3B 1G6RA 1KLUA 3QIBD 1JHTA 2X70B 3O4LE 3O6MH 4XNQA 3T8XA 4XMKL 5CINL 4YDJA 2XYCA 4RBPK 4WW2A 5F7EH 2EYRA 3AUVA 4U7KA 1IEAA 2VXVH 3VA6A 1F4XH 3H9HB 3H0TB 2Z93B 3QIWD 1UJ3A 1F00I 2X4NB 2XTJC 3BT2L 1FPTH 2EXYC 3S35X 1NFIB 2QQLL 1WWBX 2P49B 3GDBA 1JJUA 4UT7L 4NQVA 1P5VA 4TOYH 2O5ZL 5JIKA 3WFCL 4MX7A 4F37K 4GW4A 2YEZA 3T0WA 2C9AA 3GMMA 3MRFA 2FD6L 3SE8H 3ALWA 2YRZA 3ZE2E 3VXRB 3SY0A 3TN0C 1AR2A 3WFDL 1FE8L 5LBSH 3RTQC 1T83A 2CK0L 1F3RB 3GSUB 1BLNB 1FAIH 3WFBL 3RI5K 1R0AH 3AROA 2VDNH 3P9MB 3HNSH 1HE7A 4XAKE 1MFAL 1A6PA 1ADQH 1HHKB 1T03H 1YY8A 2W1NA 1MCOL 5KTEL 4UQ2A 1JYWA 5E8EA 4UILL 4G8IB 4ZFOA 5IIEB 3MLZL 4MJ2A 2E6QA 2ERJB 2FWOB 3WD5L 1RJZB 4N5ED 3VRIA 1MREL 4DOHE 3QPXL 3CXDL 5F7KC 3DI3B 3LQZB 1CGUA 1HHHA 1WIPA 5I30L 5A3IC 5D5MB 4Z0BH 3HFML 4KVNL 5JA8B 3R06B 3ABZA 4NWTH 4CDHA 2FATL 2BVTA 4GG6E 1DE4A 1OAQH 4Y4FB 1HH6A 5ETUB 3L5WB 3UJTH 4MCYB 1IC4L 2ZKHH 1CQYA 4QXTA 3SE9H 3QYCA 3DUSB 3N06B 3JV6B 4R0LA 3JWNC 3ARFA 2GJ6B 1H3UA 4QHUA 5D1QC 2R69H 2AP2A 1A6WH 4O2EB 5DGRA 3RZCD 1JPTH 2IBBA 4YGVB 1T7YA 3M17A 2BNQA 5CD5D 4RRPG 3QFJA 2V5MA 3MX0A 1IBGL 4QRUB 1DDHA 1YYLH 2CXGA 2Y07H 5FYJL 1A6TB 2EDHA 5GRVL 1A64A 4WO4A 3U48A 1URLA 5EU7C 2GI7A 5EC1A 2D31A 1KF9B 3DMMC 4PP2B 4JDTL 1HZHL 2P5WA 2OP4H 3RQ3A 2NR6D 1GH7A 4LCWA 4YBQC 4DGYL 3FRUB 1N5YH 4U3CA 3B9KC 3VWJA 3F58H 1R5VB 1II4E 1NCAH 1D6VL 1CVRA 5DI8B 5FUCC 4HUWA 5FO7A 5FO8B 4YFLF 5CJ8A 3HRPA 3A67L 4XH2B 1REIA 2P5EA 4NGHH 2GJZA 4K71C 5LGHL 2YPVL 3QCTH 3LVEA 1NMAL 2VJXA 1ZAGA 1MIMH 3CAFA 3U7YH 1V3MA 15C8H 1Y6MR 3FTGB 5D70L 1NAML 5EUKB 4EI5B 3QG6B 3FRPA 4PG9B 4Y8AA 4MNHA 4KDTC 4JJHA 2P46B 1EFXD 2N1KA 4Y2OA 4GS7B 4RCAA 5A43C 5HVHC 4V1DB 3UTTB 1V05A 5TE6H 4PJGE 4LQFL 4KKAC 1U58A 4JO2L 2VDKH 2CKBB 1LILA 5C09B 3VFWA 1U91B 4JAMB 1ZK9A 2L0DA 2FEEL 3DX6A 2YPKB 1DLHA 4P46D 2NXYC 3LH2H 2DL9A 3LQAC 1OY3B 1CE1L 4PGCA 5T1KB 2VZUA 3U36A 4J3UA 1PY4A 4A2LA 2ZCHH 3GSNH 4NRYB 2X1QA 4MXVF 2V5RA 3ZL4L 4Z5RA 3F65A 3PDOB 4YUEL 1G7LA 3KLAB 3C09C 2BVOB 4WWID 2E9WA 5H37G 4LASH 1QFHA 4LIQH 4FABH 5IMLB 3RDTA 4X98B 3LMJL 4PIRF 3D1MC 5KSUA 2VERN 1PSKH 3A6BH 1VACB 5I1KH 4G42B 2QHLA 1PJ9A 2VITA 1KJVA 2VABB 1J8HA 4K55A 3E2HC 3O3BB 2EH7L 3C5JB 1EUTA 3FT4A 1HXYA 4GAFB 5F9AC 3QXAB 1SQ2N 4PLNC 3SGDH 5F96L 1CGSL 2XWJB 3LRHA 3QEGL 2DIBA 2GT9B 3QUML 1TVHB 2X9WA 4P2YA 5DZNA 1JGVH 3TVMD 2C3WA 3ZYIA 3V4UH 3RUGB 4PTUB 1IGYA 2DM7A 2MPAH 3DI2B 5HI5D 5TDNA 4KK6C 4W6WB 2VWEE 1DQTA 3CFJA 2R23A 2Y1VA 1IEHA 5DJDA 1QRND 4HEPG 4WTZA 1AR1D 4Z18A 1RZKH 2P42B 4DAGH 3QFDA 3WNOA 5GS0H 4OKVB 1MEXH 1WK0A 2L7JA 1W0VA 2PO6C 4ZS6D 4Q9QH 3EJZD 3S5LG 4D3CL 1ZGLP 3SBWA 3E6FA 1QFUL 3U0WH 5F89B 1ZA3A 1ZLVK 4X4MA 4GG8A 2CUHA 2AK1L 2FO4A 1JF1B 1HIML 3DUUB 1NC2D 4JFQA 3IRZA 3DURA 5CEZD 2AEPL 4P5MA 4Y2DC 3BDYL 3IVKB 4OZFG 2EYTA 4N68A 4QHKI 5CZXC 1BZ9B 1XGPA 4O4YL 1MCKA 3BDXA 4P0DA 2DQDH 5CEZE 2Q1EA 3BP4A 4CVUA 4KRNA 2JB6B 1UA6L 1CLOL 1AFVL 5MERA 1S5HA 5C3TA 2ARJQ 3MNWB 4JFPA 3DYOA 5DQJA 1U3HC 4O2FA 5FYKD 4HULB 3WFEH 3ARDC 4Y19A 3X13B 3SPVB 1T2QL 1JK8B 1X4YA 3FFDB 4NPYA 5FYKU 3HI6H 3WIFA 4CGTA 5FEBA 1XF2B 1AO7B 3GBNL 5EBGA 4KK9C 2QSVA 5FYKE 3BKJL 4J6RL 5D96B 3AS2A 2BY3A 2VLJA 3ZE0F 1RUQL 1HKLH 2YWYA 3LDBB 1MUJB 3O4LA 2D7MA 4Y5XA 35C8H 2AXGB 5AG9A 3JSSA 2ITCB 3QIBA 1UKSA 4JB9L 1O5DT 3ZE2F 5D93B 1ZSDA 2Y36H 4WUUD 4X7FC 4Q58C 3D85B 1C5DA 4E5XA 5HVGB 5I75C 1CU4L 1I85C 3NIDF 3V6ZB 4F8QA 5IFAL 5J13B 3LD8B 1GYAA 2P8LA 1GIGL 5E2VH 2XQBH 3VRLE 1KPRB 5JW5B 1CVSC 4WUUE 1YEFL 2WUCH 3P4LA 4R6UA 4TSAL 1KCLA 5DJZB 5EZOL 1RZFH 5IHUL 5KSAD 4YXLH 4FRWA 3VFOB 1JMZA 2V17H 3GJFH 1DVFA 4I5BA 3K8KA 4DQOL 4ZS7H 3GMQB 4HJ0C 5EO0A 2CLVB 4PD4J 4U1KB 1UT9A 2NY0C 1SEBB 5ID0B 5JXAH 3FB8A 3LN9A 3BYTA 3AFLA 3ULVL 5JDSB 5MEPA 1Q1JL 2AJSL 1W0YT 5IBLD 8FABB 5BRZB 3OB0K 3OGCA 4UI2A 2V7HA 2LQRA 3WO4C 3LV3A 1WFTA 3LKOB 1JUFA 3NMEA 5EWIL 1A7PL 4GMTL 1YDPA 4PRHE 4OCYL 5GXBB 4BZ1H 4LLDA 4XPFL 3GUTA 5K9QI 2X1PA 2GUOB 5I6XB 1J10A 5GZOC 1ED3B 1JPFB 5IF0B 3PGDB 2JB5L 1FL5B 5D7SL 5L0QC 1NGZA 4RGNB 1NH6A 4ELKB 4I3RH 1TJIL 4AY0A 5KVDH 2W60B 1BVKA 1HQ4B 2F74A 3LKQA 5GISL 1G7PB 3DGCR 5ANMB 2BY1A 2I5YH 4GG6A 5GGSA 2EDOA 1V7MH 5JA9A 5JHLL 3I3DA 2QQNL 2DDQL 4P23A 4ENEC 1YEHH 1V3LA 3BJLA 1A7QH 4RA3A 4WI8A 3VWKC 5TE7H 4M62H 2LU4A 1UB6B 3I85A 4C83B 3RA7H 3C08L 1OSPH 4PJ9C 4XC1L 1RJLA 1S7RB 5BOPA 1H3VA 3RZCA 4POZC 4RDQF 4X7DC 1MFDH 25C8L 1KEGH 5IB5B 2V2TB 4G7YL 1PQZB 2G5RA 4R4FH 5JNYB 1FRGL 3MGOA 2ICWJ 2RFXA 3N50A 1LQSR 2FJHB 1QSED 3BN9D 5C2BL 1OAZH 5DD5H 5GGSY 3PV7A 3QUYC 1XGTA 2Y6SD 4OM1H 3VI3E 3GIZL 3I2CH 2HKFL 2FIKA 4CMMA 5ICXB 2GTZB 2A1WH 1QNZH 2VDRH 1ORQA 4FQ1L 3TIEB 4ZTPH 2ARJB 1JN6B 1RIHH 3PJSB 3MV8E 4LSRL 4PYHA 2IAMB 2PXYB 1WCBA 2H1PH 5ILTL 4HPYL 1GVIA 1I9IH 4K23L 5LAXB 1XF3B 1INEL 4PRBA 1JPST 4O51A 3WXVH 3MJ9L 4XTRC 4YHOL 5HGDA 4YWGH 5IGXL 3IAPA 1NJ9A 3HI5L 1BQHA 4BYHA 2ZZUT 12E8L 1DBBH 1NBVH 2E7BA 2WQRA 1WGOA 4MD5B 1M7IB 4XCYA 3PL6D 5DO2D 2FH6A 1JIBA 1QA9B 2MJWA 4UBDD 2OJZL 4L3ED 1EFXA 1IC7H 3ILPA 1P6AB 5ERWB 1IM9A 2JK5A 1I1AB 4XRCA 2V5SA 5F6IB 3B5TA 4ODSH 2ZJSH 1A6UH 4PJXE 4MQ7B 3QWOA 5HDOA 4X4XA 3V5KB 5IW1A 1HSBB 4L3EE 4U1LA 1Y6NR 4JJ5B 4DUVA 2DQTL 1MIEH 1P7KA 4K2UL 2NY1D 1CXFA 4FMKA 1RIUL 5CD3B 4NQSA 2OTWB 4G6MH 4LVOC 4UAOC 4KXZH 1UH3A 2VZTA 5EU6B 2X4SB 1W0WB 4PJ7E 2V9TA 4NKOB 4QRSA 3RY6A 1CICB 3DV6A 1DSFH 4JDVA 2PCPB 1I3GH 4OD3L 5ESQB 5INCB 4YHYB 5CAYB 1R3KA 5I1LB 4JZJA 1A2YA 3CK0H 2A77L 4GQ9L 1AQKL 2HMID 2OBGA 1MWAA 4IOIA 2EKJA 5GGVH 2D7TH 3HZYA 3MBEC 1S7VA 1YC7A 1J0HA 1TPXC 2A6JA 7FABL 1B2WH 3P4NB 4AEHH 3TVMA 4XMLL 4JFZH 1JGUH 4XBEL 3QG7H 4I18C 4EN3C 2A6DA 2WNGA 3R8QA 3TO4D 4FQIL 1ZS8B 3E3QE 1AY1L 1JF5A 7CGTA 5GS1A 5KG9A 2XIDA 4GLRH 4EJ1C 3S35H 5J9PB 1OTSC 1UACL 1KIPA 4OZ4B 3FN0L 1XH3A 4ZSOB 5I71B 5E94B 1I1RA 1V8HA 4YX2H 4OCSH 4AYFA 3UCRA 2MHAA 2X4OA 5E1AB 3Q1SL 1T0NB 4HGWA 1Q8MA 3ESUF 1CXEA 2H3NA 2OM5A 3M1BA 4I4WB 4MNQB 4PJFE 4DVBB 3AY4A 4ODWA 3U0TB 3O11B 1KCSL 1CK0H 5JXEA 1CDUA 1NEZB 3PWPD 1KB9K 4K07A 1NC2A 1R5IA 2R1WB 4TPRL 4ZUVA 5LQBL 4MWFB 3RVWD 3B6SA 1TETH 3O6LL 4GMSL 3P0YL 1FZMB 4LMQI 1AH1A 4FQXC 3PWPE 4W81A 2VLKB 3QI9C 4X83A 2DQFB 2FEDD 4FXGB 3I02B 3KR3H 3JWOC 1BJ1H 4K7FB 4NOBA 2R15A 3TT1H 4OLWH 5F9OH 5C08D 3QEHB 1NSNL 3FT2B 4NOFA 4GRWH 2AABL 5GPRA 5FECA 1YNKH 1OCWL 5E08L 1TJHL 1YPZB 2X42A 4I0KA 3MRKB 3PIQA 4EXKA 2RIKA 3ROLB 5JMRA 1X5GA 4YBHA 5CGYD 4JFFB 3LKPB 4FQ2H 2IFGA 2IANB 2QKIA 3BQUB 3MO1B 4KKCD 3RVTC 4IIQB 5DJ8A 2I07A 3DSFH 3G5VB 4GRLC 2DOCA 3VH8A 1IMHC 1X7QB 5ITBH 2GAZA 1IVLA 1ZHBB 1P7HL 2XKUA 4HMCA 3VXTA 2R2EA 2HLAA 1ZEAL 4TTGA 3EO9H 1TZGH 4DGIH 4JR9H 4DVRL 5CSBA 4DTGL 1CDHA 3MLYH 3EYVB 4HK0B 5KVMC 3NIGE 3V6OC 5EOCL 3V9FA 3WLWD 1XIWD 4XPGH 4WUUA 1B0WA 3BKYL 2H26B 5GJSH 3EYSL 5D5ME 5J6HA 4G9FB 3FT3A 4GAJL 3ZLQC 1MJUH 2HKHL 5F71A 4IJ3C 5J3HD 1TVBA 4FQCL 4JPWL 4G9DB 4OV5B 4LLYA 5DA4A 1NEUA 5KN5A 4BJLA 3KYOB 3RNQA 5K33A 3LKRB 2AERT 1RU9L 2GJ6E 4N8VA 1DQLL 1F11A 3VFTB 5IFJB 2E6JA 1OP5H 5L7XL 1ZLSL 3FONA 3B3IA 3BT2H 1ACYL 3P0VH 5K9JL 5INDA 1AKJB 2QQLH 5CCKL 4PRHA 4R90L 3QQ4B 4UT7H 4IMLA 4ODVL 3CLFL 5IB2B 3SGEI 5L8JB 2O5ZH 1R5WA 3WFCH 5BMFH