1FFPB

Crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B, ALPHA CHAIN
publication title Peptidic termini play a significant role in TCR recognition
pubmed rcsb
source organism Mus musculus
molecule tags Immune system/signaling protein
total genus 14
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ffpB00
3U46A 4XCYB 1MRDL 3N50A 4P9HL 2CJUH 3E1F1 1WBZB 4S1SH 3QEUA 1HINL 1CL7H 2A73B 4I3GA 1T7ZA 2QHRH 4YHYC 1FFNA 5J9PA 2MHAA 3RVWD 3SGJC 3KLDA 2XWJA 5SWSD 2DM4A 2PYEE 2Q8AH 3OGCA 1RIVL 3TT3H 4Z95H 1QLFB 1OD9A 3TO2A 5C3LD 3IVKB 1A6AA 1P7KB 2Z93B 1T3FB 1HQRB 4H1LA 4LL9A 4GW5A 2V17L 4XP5L 2P5WB 4RA0C 4QNPE 5KN5B 3ULVH 1FZOA 3O9WC 5ICZA 3EZJB 4L4TE 1QOKA 1SEBA 3P4OA 4IOFC 1N7ML 3DUUB 1V7NL 3B9KB 3CXHJ 1Q9LB 2VKXA 1FG9C 3PWJA 2EH8L 4GRWE 4QY8A 3QHZL 2Z91B 4OB5H 5B3JE 4WNQB 2UYLB 1F4AA 4LNVA 5I6XC 3GKZA 1A14H 4M7ZB 1MEXL 4ETYA 5KVEL 4NZRL 5DK0B 3RZCC 3ZKNC 2XOTA 3F5WB 5GZND 3SDAC 2WWMC 5CSZA 3G5ZB 1S78C 3BD5A 3RWGA 2J8UB 2R8SH 1E27B 4UUJB 4WO4D 4Y5VB 1HE7A 5GSVB 3FKUS 3MOBH 4NPYB 1XAUA 1B0RB 1JE6A 3L1OH 4XP9L 4C56E 3EOYG 4XVTL 1XF4B 1MFDL 4KUZL 2ICES 4OV5B 1LEKA 1T2QL 3ARQA 1GAFL 3ES6B 3IDYC 1Z6JT 2ATKB 4LKCA 5GGTA 1X5AA 2IBBA 1LVEA 2EKSA 5IBLD 3KR3H 3H0TA 1JZ6A 2VDLL 2R2EB 4MD0B 1J1OL 1HHIA 1OAYL 5DQJB 1FJ1A 4PTUB 1DBKL 5EIIB 4PV8A 2CKBL 5HGBB 4C55A 3MV8A 5F1IA 1D5IH 1H0DA 4P48A 5ALBL 3H8NA 3OKLA 1UM5H 3ARGD 3I2CH 4O2CB 3VI4F 2BDNL 2J5LB 1BVZA 1ES0A 2XWBA 1ZHBB 2ZUVA 2ITDB 5T1DH 2ICEB 3T0DA 5DJ8B 2XA8H 3P0YL 3QCTH 4JKPH 1QFHA 3D0LA 2H26A 1LDSA 1UVQB 3CIQA 3EYUL 2NXYC 3BZFB 4TPRH 2YD1A 1R3IH 2FH8A 3ARBD 3T0VA 1C16B 4EBQL 2VLKD 1U8KA 3QUYA 1NBQA 1OAKH 3EGSB 1MFBL 2W60A 2FGZA 5ID1A 3BKJL 4HZLB 5IGXH 3DMMA 3HG1D 3FFDA 1WBXB 4KMLB 5BOPA 4UZGA 1CFNB 4H20H 4N5EC 5KG9B 1ZWIB 3BEWA 5AZEL 2DOCA 2XQYK 2V9RA 4LHUB 2FX7L 5T3ZL 3ULUH 4MMZC 3E3QE 1K85A 4PJEB 3L3GA 1HHJA 4JPKL 4U3CA 1XIWB 1LK3L 3QNYB 1ZT7A 4GRLA 3C87A 3H7LA 3QAZC 4L1DA 3MUGA 3RZWA 5DJ2B 4BZ2H 5T1LD 1VCAA 4YXLH 4Z7VB 3QDME 4P3CH 5JOPE 1ULVA 3S3SA 4BK4A 1I8KA 4LVHC 5DMGD 4CMHB 3H6JA 4QOKA 1JV5B 4XRCA 1MIEH 3O6FB 4PJ5B 1WJ3A 3R0MA 4QT5A 3V5HB 5IB1B 1S7VB 2WAHA 4CL7A 3RVTD 3UJJH 3L5XH 3ULUC 2ED7A 3PL6D 4PG2A 2VERN 1TJIH 3MA9H 1BQHG 1BIHA 5BW7A 4FNLH 3OX8B 1BIIA 4Q9BA 5HVHB 3I9GH 5D93B 3HRPA 3CMOH 4XAWL 1IGCL 2DQTH 5F1NB 3RGVA 5C92A 1PY9A 1ZVSB 3KJ4C 4QNPF 2L4OA 1YEJH 2OR8A 4NHCL 4JPIB 3UX9B 1A7OH 2DBJA 1ADQL 4BZ1H 2E6QA 4XPAL 1I8IB 2VXQL 4D9QE 3S35X 2R4SH 4GRWF 5I8KH 5B3JF 5DWUL 1MCBA 1YUHA 3AUVA 5F6IC 1IGTA 4RGNB 4GQPH 2CIIB 2PCPB 4NQUA 2FD6L 4OZIE 5HJ3A 1OSPH 2EIBA 3BGAA 3LD8C 4DJMA 3T8XB 4HK3N 4K3EH 1UXSA 4PGZA 3FQNA 1F6AB 1IEHA 1E6JH 3PABA 2PO6A 5L9DL 2QQKH 1OQXA 1G7MB 3DIFA 4OLXH 4Q58C 2BHZA 4YHPB 3TBWB 4XNMA 1YMMA 5E56A 5ESVA 5LWYL 3AY4A 5D1XB 3WO4B 1JHLL 3NABL 4PJFA 2BNRD 2GTWA 4ODUB 3B9DA 4GRLC 1OAUH 4K3DH 3THML 3NZ8A 5E8NB 3C5SA 3I6GA 3QNZA 3WS3A 4JRWA 2GAZB 1GGIL 1LO4H 1MCIA 4EI6B 1I8LC 1VEMA 5I1AB 4XGZA 3CSPA 3BSZH 4UBDC 4PRIE 4MNGB 1W2KT 3PQYE 2HH0H 3DWTA 4LNRA 1BGXH 4JM4L 2YPVH 3B2VH 3AAZA 2D31A 4JVWA 4EUPH 1W72L 5IVXA 1NSNH 1QP1A 1MH5A 3ZDZF 1G7QA 1U93A 4J3TA 5F6HI 2YWYA 5ERWA 2FCBA 4TULL 3U0PB 4BSWA 4NQCD 2AXFB 4Y2DD 3Q5OA 4EN3B 2C3XA 2BY0A 3MXWL 4OLWL 3VRIB 1KXTB 2FEDC 4YUEH 5LVEA 1D5BA 2DWEA 5GS2H 1EEZB 3ZTJG 2NY7H 4WVRA 3B43A 3K8MA 1Q1JL 4LSPL 5F8RC 5EBLB 2CK2A 2B4CL 4UILL 1A5FH 4BJLA 3O4LE 4O58L 4IHOB 4M8QA 3QIBA 3IJYA 3QJHB 3MACH 4MZ3A 3ARVA 3G9AB 1A6VL 3WDJA 3OGOE 1NAMB 3ZKXC 3EOTH 2XQYG 2WWKO 4XMKL 5EOTB 3S37L 2VDOH 4OCSH 3VXPB 5H2BB 3K4AA 2ZUTA 2VITB 1NFKA 2DYPA 3PWVB 2HJKB 1AQDB 1F13A 5GGSA 4QXGL 3MRMB 1E6OH 1AD9A 3GSNH 3WFEL 2PO6C 1B88A 4JPVL 4Z77A 4QHNB 3KPSA 1AGCA 4HXAL 3CDFA 4RFEA 4RMVA 4YHKH 4E0RB 1GPOL 1HKLH 4U49A 3WFDL 1MCFA 4OQTH 3O45A 3PWUB 3U0WL 1JWSA 4QRRD 4MJIA 3IDUA 3TBSB 4GBXB 4JR9H 3MV7D 4OCLC 5F9OL 1DDHA 3DLQR 3I3BA 3VFUB 1N4XH 4YHNA 1B2WL 1KYOJ 3NOIA 5I8OL 1CXLA 2XTJB 4LLVA 2VN7A 3CK0L 1N0LA 1MI5D 2F5AL 3U83A 4FFWC 4G6KL 5DUPH 5DZNA 3DVNB 5JHDA 1P6FA 4PRDB 5EORH 4GG6E 4KZDH 5TFSL 2W38A 5K93A 3QEQA 4PJCF 3QHFL 4QRPD 1TQBB 3EJYD 1MJJB 1KUMA 5KSAD 1FCCA 3SEPA 3QBTB 1M6OA 3NIGE 1TZIA 1QLRB 2R1XB 5ACZA 1A6UH 4C54A 2JJTC 5DJDA 2YRPA 5FGCB 1I9RL 2WBJD 4RDQG 2A74A 4XCNB 1CZ8L 1YQVH 4JY4A 1U92B 3GHBL 3JV5A 3MX0A 4GSDH 1S9VA 1VERA 3GSOA 4AM0A 1AHWB 5C9JA 1LE9B 1AGFB 4H0HB 2EYSB 3PG2A 4DKEL 3UPRB 3VW3H 4WEBL 5BQ7B 2FHBA 3WJLA 3MYZA 5TQ0H 4QHUA 2NQCA 1N5YL 2OMNA 1J0IA 1Z9SA 2BNQE 3VXRB 1BPVA 3C60B 1MHCA 1DBAH 1P6AB 3ILQC 1WIOA 3RJQB 2W07A 4RMUA 4AIZA 1Q94B 1D5ZA 4ZS7H 4OZIF 1HHKB 4NC2B 1FE8H 1N59B 3DROB 5IJVA 4OCWL 1DBMH 5EZJB 4IOSD 3WN5C 1NGXA 2Y07H 3ARWA 5F9JA 2DLHA 4JPWH 1AO7B 3HI6H 5BCAA 4KJQC 5IP4A 1HQ4B 1F3JA 2ICWJ 4Y1AD 3QIUC 1RAMA 2K1MA 35C8L 4M6OH 1OAXH 3O0RH 4P59H 3PF2A 2NY1B 1FAKT 2XWTB 3ZE0E 2NR6C 1MRFL 4MXQD 3TFKC 4F9PA 1IKFL 2ZUQB 3ZT5A 3MRRB 3DRTB 1T0PB 4G8GD 4J4PC 1YEIL 4N5UA 4X4XB 4N0UB 1FZMA 4LPCA 5CD3A 1NEUA 3BMWA 1G6RB 3QH3B 2DIJA 4UQ2A 4WW2F 4X8XA 1N0XH 5I8CA 3CD4A 4JFDD 4RWYL 4KROD 3NTCL 3VRLE 1N5AA 5I1JH 2IH1A 4JHAH 4ZTOH 1G84A 2R0WL 2AQ3A 3JWOL 1OM3L 3L7EA 3LKQA 5HHOD 2OR7A 3FOLA 2ADFL 5I1GH 1MCDA 3QXDB 1CTNA 1F6LL 4L3EE 4DOHB 3QEGH 4PP2A 3DX6A 1UZ6F 1BFVH 5T5NG 1T5WA 3DYOA 4JDTL 4N1EA 5ICYB 1IGFH 3P4MA 4OCYH 4ZPVA 2YZ1A 2XN9A 2J3SA 2PTTB 4RMRA 5I1CH 3KS0J 4PJ8D 1BM3L 3MRFB 3VXQB 1FG2A 1WWAX 3P4NB 1U8JA 2CGRL 1OARL 1KB9J 1K8DA 3QUMB 5CBAB 3LN9A 2OTPA 4AIXA 2DQFA 3Q3GB 3JTTB 1C7TA 3C5ZD 4PRHA 1EUTA 1G7LB 1NLDH 3GSRB 1H5BA 1CN4A 4R8WH 4NFDA 3GK8H 1CBVH 5DRXA 5E4IA 4F7TA 3QFJE 5GS1B 3MV01 2BX5A 2Q8BL 3HPJB 3EKCA 4L9DA 4FXGB 3G5XA 1VGEL 4LVEA 4PJ7E 5D7LA 5B39B 2FATL 3Q5TA 3CGTA 5BS0E 1F8TH 3V4VH 5IBUB 3TO4C 4Y19E 1U2CA 4JRYA 4ZTPH 1ERNA 3C2AL 1J8HD 3WHXA 1AI1H 2NXZC 2VDNH 5JR1L 4CVWA 4HCRH 2BVQA 3SDYH 3DHJA 4WV1B 4QHMA 6FABL 4X9GA 3BI9X 3MLXL 4JQVA 4GG6F 2RB8A 3FN0H 3STZA 3WLWC 3QG6B 5ENWA 4Y7MA 2OL3L 3QDGD 1INDH 1T21A 5IESL 3RX8A 1U91B 1I3RA 1WWWX 5I16B 2AEIT 3LPWA 3TJHD 3NIGF 4LCCA 5L7XL 5C09A 3QO0A 3LVEA 2HG5B 1ED3B 4I5BB 4JE4B 3UAJC 3UC0L 1NMBH 2UV3A 5GGVH 1HNFA 3QR2A 2FYYA 1NFIA 5INDB 3H9HA 3QUZC 1DEDA 3V8CA 3DETD 2DD8H 2FZ3A 4ZOEA 1JZ5A 2FGWL 1HEZA 2LTQC 1EHNA 1OB1A 1C5BH 3H9YA 3MNZA 3FO0L 5MEOB 3Q6FA 2NW3B 3HG1B 2DLGA 3MRQA 4PBXA 4KQ3L 3GMLB 3P11L 4E41E 1E4WL 5J12B 2HKHH 2EKJA 4F37F 3QRGL 1TITA 1PW3A 3QI9D 5MI0C 3VXSE 4Z7WB 1NCWL 1UKQA 5DC4B 1H5BC 4HIJB 5C08B 3UYOD 4KK6D 1T20A 4MB5A 4JFEE 3ULVE 2YEZA 4HD9A 4X9BA 1DUYA 1I4FA 1YEKL 3PGDA 4KK8C 5FO9B 2LFGA 2I25N 3KPTA 1MHEB 4OD3L 1UYWH 4NBXB 4PLOB 1KPUA 3BUYB 3C6LA 3VWKB 5A16B 3ZYZA 2GJZB 3L3HB 3VMNA 5CHNB 2R2HA 4X7SL 4NQDD 3G5YB 4R2GD 3OKDA 4JQVC 5JXEA 3HMXH 4RZCA 3I6LE 3PGCB 4GKZB 2EYRA 3GBNH 4I0PA 5J57B 5DMKB 4UIMA 1ZHKA 4WTWA 5JUEH 1J87A 3VRLF 1FDLH 2P8LA 1F90H 4LCCC 4LHQB 4M62H 1QRNB 1XR8B 5I17B 3SJVE 1L7TL 1DN0B 4X99A 4YR6A 5IROA 5D5ME 1DQMH 1CDIA 4JHWH 3I6KA 4FQIL 3KPPA 2CMRH 1QR1B 1FRGL 4RAUB 5EU6D 2OK0H 2Z4QB 2H32H 5HYJB 4X5WA 4KY1L 4X8JB 1QFOA 4XVSL 1F4WL 2BSRB 4PYGA 4GKSB 5ETUA 3QDHA 2HFFA 3V6ZA 3GJFA 3FB5A 4P2YA 3EYQC 2ZOLB 1Z5LB 3O3BA 1J0JA 4YDVA 4PGEB 5BXFA 3EOAA 3GZKA 1JNHA 4CVUA 1IQDA 2Z31D 1LK2A 1CDHA 1D6VH 1FO0H 2ATPB 3MJGX 4ZS6C 4NM8L 2CDFB 4NO0D 4YFDB 4ZFOB 2FBJL 4PB0H 2D0HA 2AKRA 1NGPH 4M43H 1OGAA 4OGXH 1SJEB 3VFSA 2QKIB 5IF0B 1JVKA 2BNRB 3KDMB 5DO2D 4ALAH 1DSFL 1UJ3A 3HE6B 4DKFH 4HDIB 4CVZB 3TN0A 1FYHB 1WZ1H 4LRNH 1Z0NA 4WENB 1A6ZB 3C8DA 1KF9B 4PJ7F 4I77H 1J12A 4S1QH 4V1DA 2HT2C 3C6LC 4IRJD 4NFCA 3UTQB 5EUOA 3KPQB 2VZSA 4GKNB 4Y4HD 3NN8A 1P4IH 5GRYA 4BM7A 2DI9A 2FEEL 3VD4A 1DBJL 3QUKA 5JXEC 4TSAL 4UB0L 4J23A 3GM8A 2D7TL 3N1MC 5JW5A 1RZKL 2IFGA 5DEFB 3GMRA 3HPLA 4P9HH 4NQCB 2DQIL 5SWZA 3JV6B 3MOAH 2E6PA 1MJUH 2C1PA 2WUBL 3ULUE 2C3HA 5GHWL 3T04D 1JGLL 4NCC2 3VXMB 3VRJB 4YXKH 4ONOA 1J7VR 5HI5D 4KGJA 1B0GB 3M8OH 3RU8L 3QPQD 5IBTL 5IROC 3HN3A 4EVNA 5HI3C 3RDTA 1EO8L 1IT9L 4QCIA 4HKBA 1EZVY 3UPCA 2F53E 1KEML 4JRXD 1G9EA 4Q6IB 4BK5A 3LIZL 4G80B 4YZFE 4MJ5B 3U1SL 2VDQL 3MRBA 3BQUB 4XZUB 3AXLB 2OLDA 3N1GC 2Y6SD 3GSVA 3V95A 1KELH 4KJYA 4G3YL 2H2SC 4K8RL 3TCLA 4ZSOA 4POYA 1M4KA 4HH9A 4K07A 3L7FA 5C1MB 3ZLQC 2I26N 5J6GA 4ZAKA 4U1MA 4KHTH 4P9HC 3ARTA 4NN5C 3FT3B 5L0QC 1KJVB 4Y89A 3VFNA 3WLBB 1MEXH 4YGVA 4NO2B 1R3KB 4LLMB 4JREC 2Q86A 5B4MD 4LOUC 2E7HA 1UJ3C 5F3HB 3TLRA 4Q9QL 4DEPB 3TN0C 2IF7A 4M48L 4LPYA 3E6HA 3TZVA 3WIIH 3EJZD 4QRRB 2NLJA 4OBRA 4F7EB 1XGQA 1CFSB 4IMLB 3P40A 5F3BA 4XVTH 5CJXA 4CAGA 3U4EB 1EEUA 1RUKH 3ZKMC 5D7SH 1S7TA 3GI9H 1H8NA 1T2QH 1GAFH 3W2DL 1CXHA 2CO7B 4PYHA 1UA6L 4D0DA 4WUUA 1MQ8A 5FYKD 1KJ2L 4OFYA 3V5DB 2ERJB 5KANG 1KGCE 3FZUC 4P49A 3QWQB 1J1OH 1RJLB 4NCDA 5E94A 5FV2A 1Y0LA 4QRSB 1JF1A 1OAYH 1CD9B 3LHPL 5EN2A 5ANME 5BV7B 2CKBH 1OAQH 4FP8L 4WTZG 1BQHA 2FRGP 2VLRA 4FTVB 5ALBH 3RDTC 3QWRA 3ROLA 1VEOA 2WBJB 1UKTA 5D5MF 2A6JB 1KULA 5DHXB 2PYED 3TV3L 2GCYB 1NUGA 3IGAA 1FLTX 3HS0B 3TC9A 4G9FB 3LKOB 1XGUA 3VFGH 2FHCA 3O2WL 3BH9A 4PR5A 4PY8J 4RQQA 5CAYB 5C0BB 1GSMA 3N1PC 2CUHA 4M3KB 3EYUH 5CBEB 1MWAL 4KKLD 1CICA 1LP9E 4MA7L 4L4TD 4ZAKC 1F4XH 2OMBA 1KJ3H 4YBQD 3LKSA 3WCYA 5I9QB 3HR5B 5GGQH 3MJ7B 3OWEA 3DBXB 2D4FA 2YPKB 2NTFB 3MO1A 1NC4D 3BKJH 5DUMH 2HRPL 4U6HB 3KPRA 2IADB 5E2WH 3QUXA 2ZZUT 5AZEH 5C0JA 3KLHC 3PWPA 3TZVC 1DE4B 5T3ZH 5GS0H 1AQKL 12E8L 1RY7B 4I3SH 1IGJA 3CH1A 2NY6D 4HLZH 1YEGL 5I73B 5CJXC 4X80L 4DK3A 4X4YB 4P4RB 1BOGB 2IEPA 3WD5L 3NCMA 1M7DB 1MCRA 3HMWH 1FYTE 4C56D 1ADQA 4XNXL 1FPTH 2E27H 2G60L 4XMLH 3WSQH 4PRPE 5IB4B 5MP6H 3V7AE 5DK2B 3ORJA 2M26A 3X3GH 3PXJA 3LS4L 3PHQB 3EYOA 5HDQH 5JZ7C 15C8L 3CC5B 1BMGA 4JFDB 3UO1H 3FL7A 4WCYH 3N06B 5I1EL 4P2OB 3WFHB 1FZJA 3GDBA 3ULUF 2O5ZL 2VDPL 1NGQL 1ZLWH 4NSKB 1S9WB 3IDGB 1FCGA 5F7MC 4Y16B 4HT1H 1QA9A 2UVEA 4YHZH 4ZXBC 2EE2A 3WUZA 4K3JL 2AEPL 1Q9KB 1IGCH 3V79C 3O6FC 1FORL 1U8QB 5GGUB 4HUXB 5MENE 2J4WH 5ESQB 5CJOH 1CICC 3NIDF 4KJPC 1PZUB 2QQNH 1K4DA 4PRNB 4KDTA 3OR6A 3VE0A 4YIQA 1T7VA 3UTZB 2EDDA 2P8PB 1KCLA 4XWGH 3WIFB 3VFOB 1W72A 4ZDHA 1VFMA 2OBGA 5SWQB 4DW2H 1PSKH 4MDIB 4HPOH 5J1TC 3C8KA 3KPSE 3SHSA 1F2QA 4MCYB 4LSSH 2YPLE 3K3QA 1YNLH 4KDWA 1YNTA 3F7QA 1DCLA 4MJ2A 1RURL 5FYLH 3TPKA 1DVFA 1BECA 3VWJD 1ZSDB 4P2RB 1VADA 3CFDA 1VPOL 3QDJA 4P2QE 4U1HA 4XBPB 4N9GB 3C8HA 4NO5B 2VAAB 3HZMB 4XI5D 5JHLL 3M17A 3B2UD 5BJTA 3L3OB 1BEYL 4F7PA 4LDLB 1QNZL 3DHMA 5ACMA 2XYCA 3SE9L 5C0IA 4Q9CA 4KKBD 5H37H 4R96A 3QDMD 4U1IB 2H1PH 5JOPD 4X9IA 2FO4B 3QDGB 2CKNA 4TVSa 1KG0B 1LO2H 2Y5TA 3VJ6B 1UM6H 2PXYA 1GOHA 3MR9B 1JGUL 2FR4A 2X1XR 4C57C 3QO1A 1CE6A 3MXWH 4OLWH 4ZFFB 3QFDB 4FZEL 5KTEH 3D0VA 5ICXB 4IRSB 3HFMH 3REWB 3ARED 3DO3A 3GJEA 4QRQA 3G6AB 3KPOB 4OF6A 1RUML 1ZGLA 4OT1H 2GT9B 2YD9A 5C3TA 4LEOB 3PJSA 4XPTL 1EJOH 5BRZA 1CXFA 2O5YL 1JPGB 3BP4B 3OXSA 3EYVA 2LAGB 1EMTL 4ODVH 1CK0L 1LP9F 4K3GA 2W91A 3EUUA 1A6VH 4YFLF 4D9QD 5KSUB 4G6JL 3T4YB 5TPWL 5B38G 3HZVB 1BX2B 3QI9B 5HYEA 4WHYH 3ROOA 2UUDK 1JPFB 1DUZB 1DVFC 1OLZA 5JLZB 1J5OH 2JCCA 4OD2B 3O6ML 3DX8A 4EI5B 5IIEA 4IJ3B 3MA7A 1GPOH 3QQ9D 4DGYL 1KENH 4GAJH 4BKLA 1ZS8B 3IU4L 2XZCH 3L5IA 1A7RL 2AV7A 2E7CA 2APBA 3RI5F 4DCQA 5D96B 3A6CL 1IZJA 3N9GL 3H9SE 2NZ9D 3MLTB 4G6AD 4R7DA 1FLRH 4LCWE 4JEGB 4B53A 5I8OH 5IVXF 1LEIB 1MJ7L 2B7DT 3RWJB 2QADD 4PJAE 4R4BB 3MZGB 2HAZA 1QSEA 3RVXD 2CLVB 5EOCL 4PRID 4LP4A 4YXHL 3PQYD 5A2KH 4YO0B 3SQOL 3F6IA 4MLSA 4OUUB 4RISL 2D4DA 2BNUA 2AJZB 1LD9B 1INEH 3HRZA 3FQXA 3W39B 2BY2A 2IMNA 2BRQA 2WQRA 3HUJE 4S1DC 1U6AL 5TE7H 2DWDB 4JDVA 2FB4H 3P9MA 4JKLA 4JFFA 4WW1B 3FONA 4M7LT 5C0AA 3KYMB 2I60H 1JNNH 2HKFH 4MNHA 4TTDD 1I9RH 4AJ0A 3K2MC 4ZUVB 1GHFL 4HPYH 3NGBB 1L9NA 3G6JA 1RJYA 4UT7H 1GZQA 2W9LA 2H41A 4DKEH 3X11A 3JWNC 4OZ4A 5A3ID 1S5HB 2VAJA 1WCQA 4WEBH 3SCMA 1MCOH 2W0FB 3L5WB 3O4LD 2ESVE 1WF5A 2Z35B 4TTGA 3ESUF 4JVUA 5FA4B 3V6OA 3VFTA 3TBTA 1U3JA 1NDMA 1VKXB 2X4TA 3IRZA 3KNBB 3SOBL 5HVFB 1S7QB 3BN3B 4LK4A 5ID0B 3PP4H 5BVPL 2FJGA 1RIHH 4JAMA 1DL7H 4P46A 4B0MM 1MLCB 1RUAL 1N6UA 2HTKD 2NY0C 3MREB 3STLB 3WO3B 5EU4A 2YC1B 1NCBL 4Z7UE 3LH2L 4Z76B 2BHYA 4P5TD 1GGBH 5HD8D 3MGTB 4OAWA 5E8OB 4ZO8A 3EHBC 2FSEA 3MV9E 1PBYA 3W81A 35C8H 1XZ0B 2JE8A 1CF8L 3EAKA 1SMAA 2LV4A 4M1CC 3LEVH 3SKOA 3MLYL 4M6ML 3VI3E 2LU3A 4UV4L 1KSRA 1BAFH 5DUBA 1YEIH 3NZHL 5F88B 3MCKB 3GMNA 5HGGS 3FCTA 3NPZB 3O2DH 5B8CA 1U95B 4OM1H 4HGWB 4HKZB 2BFVL 4HX1A 5IMOA 3HI1B 3LZFH 4NWUL 3MYJB 5JOFA 4H5SA 1FVDB 3RKDD 4RWYH 5CFHA 4NT6A 2FL5B 4HJGB 2AW2A 4QWWC 3IXTB 4K2UH 4NZJA 2FBOJ 5C6TL 5F7DB 1KC5L 2VIRB 3OXRA 3CX5K 5EU5B 4KTDH 1XGRA 1ZKAA 2R0WH 3OJDB 2YD4A 1TQCC 3JWOH 1IBGL 1OM3H 4M6NL 5EC1A 3PDGA 1NL0L 3PWNB 2VABA 1UQSA 4YAQA 2IC2A 1PLGL 5I66B 3T65B 3ARDA 3SCMC 4GUPB 5CD5C 2BSTA 1A9EB 1D5XB 5D9SA 5DRWA 3V6OC 1KCSL 1OCWL 5GISL 2GJ6A 3HNVL 2DAVA 4K7FA 3UBXG 3GGWB 3JBG7 3MBXL 4P46C 2IANA 2BNQD 1D6EB 5CUSL 2OL3A 1FSKC 1S9XA 4LSQH 5C0CA 3WIHL 1BD2E 4ZOCA 3MRJA 3F7PC 2SEBB 4EZMA 3KXFA 1C5DB 4XNQB 3JWOC 2V7HA 2R2CA 3TVMB 1I1FB 4M4PA 1DLFL 1T5XB 5E5MB 1I7RB 1MJ8L 4PS4L 5D1QA 4KMQA 1IARB 4PLJD 4GKOA 4PJHB 1A64A 4EJ1C 3O2VH 5DRZA 4NRZA 3UYRL 4PJAF 5B8CC 1N26A 1F6FB 2KH2B 2J1KA 2DQCL 1RULL 3DOSA 3QQ3B 1U8OA 4HFUH 2GTZB 3BHBB 4NNYA 3JSSA 1S9YB 2H6PA 2LQRA 5E6IB 1G7PA 5IVZB 3V0VB 4K7PX 2EIDA 4XTRD 3RWEB 5HVWA 3CFBA 4ZYKB 3HUJF 5A43C 2CDGA 3OKNA 1A4JB 4HWZA 1U3HA 1MQKL 2J88H 5L7XH 2D3VA 1KN4H 1LE5B 3WMSA 4PP1D 2HMID 4XPBL 1X5JA 4DAGL 1JFQL 3HE7D 4WWKA 5C0RH 3LEXA 4EDWH 1X9QA 3EFFB 3ARDC 5DMIH 4XX1E 2OQJB 2ZSVB 3RWFB 1JK8B 4B7IA 4DUWA 1NAML 4L3ED 4OZFH 4A6YL 3BRFA 5EO0B 2Q6WA 5EDXA 3DUHA 2ARWA 4ZD3L 5MEPA 1FQ9C 4PJ9A 3GI8H 4NQSB 1QO3A 3FO0H 5DK3A 2P5WE 4OLVL 4Y2OA 3BAEH 4FS0A 4WU7B 1E4WH 1XF3A 4XNUL 2R9HD 3N1FC 3T3PE 4DGVH 3WFCH 1E28A 3RNKB 4W81A 3T0EB 2EDFA 1EHXA 4Z7UF 4X9HA 2WIIA 4U1GC 3UTPE 5D1QC 2IH3B 1A1MA 3CMGA 4K23H 3GIZL 3QFJD 4N8VB 4XBEL 5E8PA 1MCEA 5T1KA 5FO7A 4IOIB 4M5YL 4EDXB 5E8DL 3PNWB 4NHUB 4NQXB 1KV3A 4RFNB 3B83A 1QYGL 3U9PL 1IM9B 5BS0D 2F19H 4ZNEA 1CI5A 4Y19D 1NANI 2R0LL 5D2LB 3ARFD 1CXKA 1PKQB 1R5IB 5J11B 1BZ7B 3HTLX 4DN4L 2EZ0D 4OGYL 5MEQA 3D18A 3DI2B 1SM3L 4XMPL 1BLNA 3IKCB 3B3IA 5DD1H 1U3HC 1D9KA 1IGIH 4J8RB 3ZYIA 1NBVL 2EXWC 1JL8A 4NC0B 3BH8A 3G08B 2BSED 1CGYA 1HXMB 4OM0H 4TUJA 2LVEA 2R15A 4WWKC 2VZVA 2X6MA 4DGIH 1R24B 4GXUN 5E9DB 2AJYL 2BC4B 4KQ4L 3QXAB 2APTA 3U0TA 5E2VL 2F54A 2VR4A 4JZNB 3O9WD 1GRWA 2VSCA 4KY1H 4XHJC 4P23B 5DS8A 4IOFD 1QUNA 1CD1B 4O5LL 3LN4B 4TVPL 3GB7A 3OJ2C 5DURB 5I76B 1HH6B 5GRVK 1T66C 1BBJA 3OJVC 2FX8L 4RAVB 3MGOB 1RFDL 3KGRA 4X6BB 4XP4L 5C0FB 5FKPB 4ORZC 3RZCD 4UTBL 3MOQA 4E41D 2WWMD 3FRUB 1EERB 1OQOA 1LWRA 5EBWA 1KB5B 4L4VA 3VXSD 4AEEA 5IOPB 5CJ8A 4H88L 3S36L 1T0MA 4WI8A 3R0NA 2YBRB 2ICWA 3FB8A 1NCCH 5HHXH 4JFED 3ULVD 4WUUE 5K9JL 4YBHA 3GSQA 4XBGB 5L6YL 4X5XB 5FUZL 4PJEE 2Q76B 4KGLA 3TIEA 4N0CD 4AH2B 2JJSA 3P0VH 4L8BB 1O7SA 2OJEA 4P4KD 3BT2L 4C83B 2EDNA 5TQ2L 4I2XB 4WTZA 3D2UD 4ODXB 1RMFH 4IRZL 4PPTA 3I6LD 1D9KC 5T3ZE 1FZKB 1WBYA 3VDCA 4Z7VE 4JZJB 4PJCB 3LS5L 1ZVHA 3MLWL 5JDSB 2A6DB 1QFWL 1JGEB 1AKJB 5IBTH 5C9KA 4NUGL 1D5MA 1DQDL 5J1SC 4TUOA 4JKWA 2LU4A 5EIVA 4RFOH 3SJVD 1JGVL 4XCEB 1KEMH 4PJGB 5T1MB 3D69B 4JFXB 1PZ5A 4AL8H 3H9ZA 3NCCB 4R7NB 5FYJU 3NH7L 2BZDA 2VDQH 2JTDA 4R0LA 5EFIA 3MRKA 1U8NA 2DQEH 4JFQB 4NQEB 4M5ZH 3RIFF 1QBBA 5DXWA 3FOMB 4WUKL 4E5XA 2IPTH 3MNVB 4Y5XA 4KWUA 2X7LA 4KPHL 5HPMB 1KJ2A 1RZKC 5MERB 2VZUA 2KQMA 4P3DA 3UZEA 4FG6D 1CGSL 2D7NA 4PUBL 1PY4A 3SDDD 5IHZA 5DR5L 5D1ZA 3V4PL 4QXWA 4X98A 3MLRL 4OZIB 2OP4H 5DA0B 2VDML 4N5ED 5ECJE 3T3PF 5JMRA 2Z9TA 3CUPB 1W0VB 4D2NA 3KPLB 3U36B 3O8XA 3BIKA 3MRHA 5CINL 4N8CH 5GRVL 5K9OB 4APQA 4RGNE 1MVFA 3NAAH 1L6XA 3PHOB 5C7XH 3Q2CA 5KSBB 4PG9B 1XCQA 2IG2L 4XXDA 5I74C 4Z9KB 8FABB 5IJKC 2P47B 1R5WA 5BV7H 4K8RC 3W2DH 1WFOA 2JJSC 2HVKA 3QIWA 3OTTA 3RTQB 3RWDA 4HS6B 4PRIB 2DLTA 5GGVY 4PJBA 4BFGA 4RMQA 1RHHB 2W9DH 1YEFH 3ELAT 4DEPC 3EOBA 3KS0H 1T7XA 2ZNXA 4HKJB 4H26A 3CCHA 4PJIB 4HWNA 2C26A 3EDJA 3B5HA 4JY5L 5CGTA 5DD5L 3LHPH 2A6KA 4M00A 3CH8A 4KJWC 4DZBA 4FP8H 5FB8B 4RGMC 4YHMH 5FYLE 1JZ3A 1QBLH 4MNGE 5TF0A 5DT1H 4F2MB 3VFPA 4XP1H 1AY1L 3ULUD 3LN5A 2HLAB 4YDIL 4YDJB 4NZTL 3C08H 4ODWA 32C2B 3X3FH 5DD0L 2QLVB 5JPNA 2NY4D 2YD3A 3HAEG 3PGFL 1R3HB 3SKMA 2H9GB 5IHBA 4R0LC 3AS0A 3D85D 4LPUA 2F53D 3O2WH 5C0DB 1MUJB 2XXMB 1HH9B 3S35H 1WZKA 4W4NA 1MWAH 4QXTB 4Z0BH 1INQB 3HZYB 1AH1A 4FQCL 5EZLA 1QZ1A 3DSFH 2X4OA 4PRAA 3MRIA 1EFXB 3W9EA 1VB9A 4HUKB 4OZHE 5T33L 3T4AA 2HRPH 1JUFB 1ZT1B 1I9IL 1I1AA 1T1XB 5HYQA 4NP4L 3QT2A 4D8PA 5I8EB 1J0YA 2IQAA 4OKVA 2DQDL 3O8XC 4P5TB 3RIAK 4ELMB 12E8H 4UOW0 4OQ1A 1TTFA 1I3GH 1AJ7L 2J8HA 3TNNB 1HILB 3DV4B 4GRLD 3TYGL 3TT1H 5C07A 1XT5A 2JELL 5F72S 3I75A 2IALB 4GT7A 4BSVB 3QIWC 3V6FB 2GJJA 2RR3A 5LXGL 3SKJH 3C6SB 1OD7A 5HY9B 4PJEF 4UBDD 3OMZA 4NDMB 3FO2A 4NO3B 3U2SB 1T04A 5BO1H 2ADIA 3S96A 2AEWA 2QBWA 4P2CG 2ITCB 3T2NH 2X4RB 15C8H 4NM4L 4GG8A 2ADGA 1KGCD 3BWAA 4F33A 1N2RB 2FX9L 2YA2A 3BD4A 4NUJB 3VGHA 1BZQK 1U8LA 2X89A 2XTJE 5D7JA 5BZDA 4Z7VF 4P57A 3CXDL 4I3RL 1NEZB 3QWOA 4P5KB 2FEDD 1OY3B 2IBGA 4O4YL 3K2UL 4R26H 5HHVH 1WGOA 1XEDA 1AGBB 2MCPL 4KI1A 4F7CA 3L3IB 1RJZA 1QFPA 5DZLA 3IDJA 3S8WA 4L8SB 1I9EA 1GZPB 3O3AB 4J1UB 1K4CB 1YPZB 5D2NB 1TETL 4YFLI 5DQ9A 4G7VH 1RUPL 1H3GA 4FFVC 4YDKL 5FGCE 4RBPH 3C9NA 3E8UL 5DDHB 3LPGA 5B38A 2ZJSH 2Z8SA 4JY6B 3CSYB 2BNQB 3TWCL 5EZOL 1JTTA 5AD0A 1HZHL 3HI5L 5I15L 1V3LA 4JFHE 2V5TA 2NYYD 4PGCB 2NY2C 4F57L 2VLJB 1OP3K 2R1YB 4LAQL 2PO6D 4X6EB 1WTLA 5GS2D 1F3DH 1ORQB 2BMKB 4G7YL 1KN2H 4WI3A 1AXSB 1UH2A 4KRPB 2CDEA 4FQHB 4ZG1A 5FGRA 3NCYP 1VPOH 5KVDH 5CP7A 4HIIA 3IF1A 1IJ9A 3B9KA 5I75B 1TJHH 5DJCB 3LRSB 4KRMB 4NNPL 1FFPB 4PBWD 2Z91A 5J13B 3LQZB 4KKCC 2WWKT 4HAGA 2NCMA 2P46B 4G8FA 2QSCL 1FYTD 2E3VA 1YMHB 3U6RA 4NJ9H 1JYNA 4ZUUA 2BRRH 3VD7A 2BERA 1YA5A 4PRPD 3U4BH 2D2OA 3G5ZA 3UTTA 3WFZA 4NJAH 3TBVA 2J8UA 4QTHB 4L9LB 3ECBA 43CAA 2V5RA 4N0UE 3SE3A 4B5EA 4R90H 5L2KE 4HV8A 1IMHC 3RUGA 1KPRA 1IAOB 1K5NA 1TVHA 2RAMA 1IFHL 3HE7B 5JW4R 1C1EH 5GPRA 1HYSC 3BPCA 5E7BA 2XZZA 4XPTH 1BQLH 1FAIH 1G6VK 4L3EB 4LCUA 5GSRB 3MLUH 4HKXA 4X7TB 3OKMA 2VXSH 4N1CA 3WHE1 2HT4C 3BW9B 1C5CH 4D9RE 5KVGH 5IQ9B 1EDQA 4IRSC 5CWSB 5MEND 1CK0H 3CZFB 3O6LL 4X6CB 2G2RA 5JA8B 3VGBA 1MHHB 4H25B 5CEXB 4PTUA 4OCXL 4DOHE 1QSFE 4OZHF 3ILQD 4FXLA 3NA9H 1R3JA 1YECL 5DQDH 3O3DB 5DF0A 5FUOH 3A67H 3KPSD 4O2CA 5IEHB 4TQEL 1LO5B 2F58L 4PREB 1UWGL 3L3JA 3U7AA 1EHLL 1P7QD 2YPLD 2VXVL 1N64L 1ZHBA 3H42L 3LEYH 4K55A 3WXWL 2BVTA 3CVIH 4Y5YB 3MBED 1ZOXA 3IU4H 4LHJB 3QIUD 1UWEL 1UVQA 2ZKHH 4OCRH 1XH3B 3ALXA 3VXUA 2P8MA 2PKDA 3I85A 3N9GH 4LQ1A 4P2QD 3TA3A 3O11B 4LSUL 3QCUL 1ACZA 3EGSA 4J4PD 3U7WH 3C5JB 1GCFA 4GAFB 2BSSB 5SV3A 2AJVL 5GXBB 3CFJA 1UWXH 4C59B 5F70A 4EI5C 1Q8MA 1A3QA 4YXHH 2VWEC 5H35B 5KG9A 5FOJA 5HI4D 2YWZA 4RISH 4R4ND 2JJVA 3EO0B 2Y7QA 2XFXB 4YHYB 1CLZL 5FM5O 3SE3C 2COQA 4M03A 4HUWA 1XF2B 4JO3H 1LO0L 4OLZH 3GMOB 1DQLL 3WXVH 3GNMH 1XIWA 3HC4L 1X4XA 2ZOKB 3CVHL 4JM2B 3BEVA 3SDCC 4S2SA 5DJ2A 2BP3A 4MSWA 4ZOBA 2YD6A 3O9WB 2NY3D 2VDRL 5IMMA 4X6DA 3BXNB 1VGKB 2FJFB 4QF1A 1ONQB 4MCZA 2BOCA 2HFEA 2UY6A 5A40E 3UBXA 4LLAA 4OIIL 1XFPA 1I85A 2B0SH 3RWIA 4PJ5A 3MXVL 1U8HA 1NJ9B 3V5HA 5I6XB 5I1DB 3D39B 3OAYK 3RQ3A 4OBSA 2DJSA 3RZCB 4GQ9H 3W9DB 3BKML 3KXFE 3SDAB 3E6FA 4E41B 5F89A 2A6IA 3VXNB 4NZDA 4HG4K 3VXSB 2BVOA 3FFCA 3JTSA 4ZFGL 5FA3B 2C3VB 1P5VA 1A7QL 2R0ZL 4X6FB 3OHXB 3D3VB 2GK0B 5C0NC 2QSQA 1T03H 2DRUA 2ARJB 4JFEB 2R29H 4HUUA 2AJUL 2O61A 3DGCR 1T83A 4MB4A 1B4RA 1VFBB 3BN9D 4Z7WE 5E2UL 3TA3C 1GGUA 2UUDH 1QVOB 3IDYB 5C08E 3TO4D 2DLIA 1X5ZA 2OX5A 4M6MH 4JG1L 2APWA 1CDGA 3H9SD 4WFFE 3CSBA 2QL1A 3MRCA 5DJ0A 4LCWD 2CIIA 4LASH 3FB7A 3QEUB 1JNLL 4D9LL 1XCTA 5HYSG 2Q7NA 4G6MH 1FFNB 4N0YL 5J9PB 2GSIA 2MHAB 4OKDA 1NC2D 1ROWA 2XWJB 4Y4KA 3TBWA 3WIHA 5HXMA 2A77L 3OGCB 3HKFA 1YJDL 4CADB 5FF6A 3HZKA 3TO2B 1JHKH 2JJWA 1R0AH 4OF7A 4H1LB 4E42A 3PHSA 4GW5B 3W0WE 2CK0L 1FZOB 2D0FA 4LDEB 1T0NA 1NL0H 4TYUA 3WNPA 1GIGH 3QUZD 3P4OB 4U7MA 1PLGH 5IG7A 2B1HL 5ADOL 2NXYB 5KS9A 2ZUSA 1QRNE 1U8MA 3RVVD 3PWJB 2DL9A 1I85C 4MGXA 5JOEA 4QY8B 3LB6C 2P7TA 1GH7A 4WU5B 3HNVH 1KTDA 5IWLC 5BMFH 2ESVD 4JO2H 4N8PA 4NGHL 4EN3A 2YA1A 4OSUH 4WHCA 1JI1A 5HYJE 4LLQA 4QRUA 2DQHL 1EEZA 1AGEB 3WIHH 2VISA 3TP4A 4OD1L 5GGTL 1MCCA 4G8IA 4GAGL 2NX5A 3S3PA 4W4OA 4TOYH 4PGJA 1T83C 1DLFH 4MD5A 5J3HD 1E4XI 4HS8L 4WIQA 3QAZB 1V5JA 1UKSA 1A22B 3MV9D 5TDPA 1U8IA 4LKCB 3B5TA 1NAMA 4A6YA 1ZGLM 2EKSB 3H0TB 1BP3B 3DECA 3UYRH 1FBIH 3VXPA 4U2YA 4MX7A 4U6VL 5KVFL 2VE6B 1SY6A 1HHIB 1IC5L 4EXPX 4YWGH 1AQDA 3IDXL 1FJ1B 2QQLL 4PV8B 5F7EH 3W11D 4LKXB 1TXKA 3ZTNL 2J8OA 1KACB 3MV8B 5D8JH 5F1IB 2ZP0T 1TFHA 4QHNA 4Y4KC 1GC1L 1F2XK 4F3FA 1WLHA 4HEPG 2PF6A 2GIYA 4OIAA 1MQKH 2XY2A 3DXAA 3SE8L 2AK4A 3UJTL 1OSZA 3P30L 1ES0B 3QEHA 4XNZC 3P0GB 2XWBB 3EIFA 4GBXA 4DAGH 1UGNA 4LCYA 4OZGA 3PXHA 3KJ4B 4HK3J 4MA3A 3D85B 3DGGB 4PRBA 3T1WA 1Q9OA 3D0LB 2X09A 2H26B 4XNYL 1FNAA 3VXME 2EC9T 3DO7B 2PR4L 1RV6X 1UACH 1DFBL 2MQ3A 1WC7A 3HLAA 1JGDA 4F8TA 1QPXA 2W9EH 4MNQA 2W60B 3CFEB 4OFIA 5D72H 5ID1B 4WFGE 3U9UA 5JXAL 3IJSA 4LRIA 5F9DC 3P73A 4UV7H 5F6IB 1N8ZA 3FFDB 1NGZB 4NC1C 4S1RL 5IHUL 3CFCL 4FQ1H 4KTYA 4OLVH 5GRUL 5IT2L 5BOZG 3LD8B 3GKWH 4M7JL 1T2XA 4QHLA 1FGVH 4ODTL 4D3CH 4ZS6D 2R1XA 1VFAA 3KYOA 1TZGL 5HDLA 1HHJB 4TUKH 1BD2D 1WZLA 3ALWA 4ELKA 1AGFA 1X5LA 1ZT7B 2DL2A 4PLKD 4GRLB 4RX4A 3OR7A 1T2JA 3MUGB 5FHBH 4XBEH 5LJYH 4LU5L 2KZWA 4Z7WF 4JFOA 3OKKA 2VUOA 1MREH 2HT2D 4JZOB 1I8KB 2DM7A 3RRQA 4POZC 3U9PH 4FQXD 4QOKB 2LU7A 1NMAL 1SQ2N 4XRCB 2ENSA 2VH5L 4UDUA 4DN4H 4QT5B 3KPNB 1TCRB 2R69L 4WI9A 1SM3H 2HYMA 4ACPA 6CGTA 3GO1H 1LDPH 4XMPH 1X6NA 3RY6A 1AO7A 1KEGH 1NGWB 4JKMA 1NBVH 1BIIB 7FABL 1CGWA 2AK1H 5KSVB 3QG7L 3L3DB 5J11C 3ABZA 2WMPA 3MRRA 4Y4FA 3PIQA 4FTVE 4LIQL 4HAFA 1Q0XL 1G6RA 3QH3A 4UT9L 4Z18A 3QPXH 3FQRA 2CUMA 5AYUL 5IM7A 2H2SD 1SYSA 3GRWH 3QCVL 3ZKXB 4DKAA 1T1WA 1YUHB 5FM8A 1IGTB 3B8SA 2AERT 2RIKA 3BGFC 1KB5H 5HJ3B 5AZ2L 3LQAH 4G9FE 4XP4H 1MNUL 1QKZL 5SWSA 1P2CB 4OTXH 5AWNL 4NBZB 1ZANH 5C0BE 1UXSB 2K9UA 4K94L 3FQNB 4ZUTA 2P5WD 3PABB 2PO6B 2P43B 3DIFB 4XNMB 1YMMB 5ESVB 3ZYJA 1DEEA 1NCAL 4PJFB 4WGVB 5EOQL 4LOUD 3NZ8B 3C5SB 3I6GB 3QNZB 4KVCH 1G0YR 1J10A 3UTPD 5EBMB 4Q74A 5FOBA 3IDNA 3B4NA 3D9AL 5D7IA 3DRQA 3NACH 4LNRB 4OGZA 5L6YH 4H8WH 4PTTA 3AAZB 5FUZH 1PAMA 1S7SA 4J3OC 4UINH 3X14A 4HF5L 5IVXB 1MH5B 3IDMA 1NFDA 1G7QB 1U93B 3DX9A 3I50L 5ERWB 2HT3C 2UZIL 1KBGL 5D4QA 5CJQH 4BSWB 4FABL 5DJAA 4L5FL 4U1SA 3GSNB 4WO4A 5LAXA 1X3DA 1ZA6A 3RY6C 5HSFA 1D5BB 5GS1A 2DWEB 2LVCA 2V9TA 3QA3B 4I13B 3MQIA 3P4LA 4I4WA 4JB9H 4O02H 3HAEA 3FQUA 2VZ3A 4WI6A 1JIBA 1DQDH 5F21B 4ODHH 5AG8A 1MPAL 2ORBL 2RCSH 2FIKA 2DKUA 4Y4FC 2V7NA 3F8UB 2WBWB 4OI7A 2VMFA 3IJYB 2CRIA 5KW9H 2GYSA 2I5YL 4N68A 4WDIB 3QYCA 3NH7H 4NRYA 4H8WC 3T2QA 5C2BL 2B5IB 3QULA 4HWBL 5GJTH 5ALCH 4XPFL 1J11A 1C12A 2XKSA 5GRJL 4KPHH 4MA8H 3RVWC 1SBSL 2DYPB 4BA8A 5GGSB 5DRNA 1CGSH 1AD9B 3VFMA 5DFWH 4HC1L 3PDOA 2I9TA 1OPGL 4Z77B 1CFTA 5DHVA 3ARGA 1Q9WA 3V4PH 2Y36L 3MLRH 3KPSB 1AGCB 2DKMA 3WN5B 3CJJA 1ED3A 4RFEB 1IAKA 1P7QB 1X5FA 2YPLB 1RIUL 4HGMA 2ZCHL 4C4KO 5INDA 3O45B 1JWSB 3RAJH 3WE6A 1YZZA 4FMKA 1YYLL 5C07E 3QIUB 4YK4B 1QEWA 4G6FB 5FUCC 1DDHB 3S37X 3ARBA 5FYKL 4P2QB 4YHNB 2IG2H 3MUY1 3D5OF 1ZLUH 4LLVB 2FNBA 3WNKA 2VLKA 2KL6A 3QRFM 2J6EL 1G9MH 4U6YA 1IAIL 4WUUD 4DUVA 3HG1A 3BIBX 3LRGA 5EZIL 5JHDB 4P2RE 4LHUD 5EO9A 1A7PL 3FAWA 4ZQKA 4JG0L 3HNSL 4WO4C 4DUXA 4ZUWA 3QEQB 1AXIB 4EIGB 3RX7A 4KTEL 4YQXH 3HNTL 9CGTA 5FYJH 1M6OB 1I1YA 4AENA 1XGPA 2GK2A 4Q7DA 3T77A 3ZYOA 4J6RL 1DR9A 3RNQA 1YNKL 1AY1H 5T3ZD 5GRZA 5GS0D 2A74B 3GBLA 4YDIH 4K9EL 5FO9A 4JY4B 4NZTH 1Z3GH 1S9VB 4AM0B 4YE4L 5C9JB 3KJ6L 1HYRC 5T1LA 5IFAH 3NFNA 4ZXBD 1Q72H 2XICA 5EB9A 3ULSA 2QR0B 3O6FD 3IDIA 1P4BL 2C4FU 5CHNA 4QHUB 2DMBA 2N4IA 5HGHB 2G75B 4OLEA 3X17A 3G5YA 1P53A 1FNEA 1BVLA 1MHCB 4KJPD 5FK9A 2YRLA 1LO3H 4GKZA 5EA0H 1KFAH 4AIZB 4GAYA 2OZ4L 3KLAA 5DMKA 2Q20A 5IJVB 3PL6A 3ARGC 5GJSL 5EU7E 4OF5A 5IEKA 2AV1A 1NGXB 1SVZA 4JN1L 3H3PL 4UTAH 5F9JB 1DN0A 4XCFL 2HTLD 4XPGL 1JTPA 3K4ZA 4W68A 5JORA 1JRHL 2MTPA 4DK6A 3F7VA 1XGYL 2Z4QA 3ARBC 3MJ8A 1CTOA 5CZVL 4RA3A 1CGTA 4RGND 3TYGH 4UNTA 4FFYL 1FZMB 5CD3B 2ZOLA 1Z5LA 2NXZB 5C70A 4UQ2B 4OI9A 1DLHB 3ZDYE 1GOGA 1YEEH 1IL1A 1EBPA 2ED9A 4PGDB 5LG1A 4PJAB 2L0DA 5I8CB 3IFNH 2X4NA 1M05A 5DJXA 3S34L 4L1HA 1XMWA 5D1XD 4DFHA 2VLME 5AAMA 1EA9C 1N5AB 4ZFOA 1VFOA 4LSTL 1UADC 2QKIA 2X10A 5IF0A 1RVFH 3ZKQD 2BNRA 3CXDH 5JQ6H 2QJDA 3HUJB 3L7EB 3FOLB 5FYLD 5I2IA 4HIEA 3PP3K 1KPVA 4PP2B 3DX6B 3M1BA 4N8VG 3BKCL 4I8DA 2BOBA 2H8PA 1A6PA 5DMGC 1T5WB 2YKLL 1TETH 4FQLL 1CDJA 3P4MB 4UIKH 43C9B 3N85L 2XN9B 1V3JA 2LTQB 1P9MA 3G04B 3FHAA 1Z9MA 1FG2B 2ESVB 1U8JB 3LSOA 4NQCA 4Y2DA 5T3XH 3CZJA 1OT2A 1K8DB 1ZHNA 3PL6C 5C71A 1AFVH 3DNKA 3VRJA 2DQFB 3OBAA 4DFIA 3WKMH 1ACYL 1BVKB 2CLZB 5MI0B 2G5BA 4PRHB 1RUQH 4YJZL 5I18H 1J0HA 4F57H 1H5BB 3CLEL 5DRXB 4F7TB 5IHLB 4NRXB 2Q7YA 1QLEH 3EO1B 4G7YH 1TPXC 3IFPB 5DVLA 5D7LB 1B9ZA 5I1KL 1KCVL 4JRYB 3WHXB 5TE4L 4O00A 1X44A 2BVQB 2PW1A 4ONFH 4MXWL 1G0XA 1NPUA 4QHMB 1TVDA 2X9YA 3VGAC 2ZCLH 1KJVA 3WLBA 1J05A 5H8DA 1FC1A 1B4JH 3STZB 3OZ9H 1E4KA 5ENWB 2VXUL 1VEPA 4AMKL 4NKIH 1T21B 3OB0K 1MRCL 1I3RB 4ONGL 1J86A 4LCCB 4Y8AA 2HJLB 5C09B 5CZXD 4X7EC 4TSCH 4ONHB 2DLFH 4QRRA 2DJUA 2XTJD 1FVEA 1CFSA 2FYYB 1NFIB 3MV7A 1IFHH 2B2XH 4RNRA 3H9HB 1OAZH 3U4EA 2AQ1A 3Q5YA 3KYKL 1MI5A 2FZ3B 4NQVA 3MLVH 2IAMC 1HEZB 3BESR 3E2HB 1P9MC 1OB1B 3V5DA 1RI8A 2D0GA 2MPAH 4JO4L 3WNLA 3MNZB 1SEQL 3MJ9H 3QXWA 3Q6FB 2BHUA 4Y2DC 5I71C 1PG7L 3MRGB 1WAAE 4FQJL 3MRQB 4OLYH 1IM3B 1A7BA 4QRPA 2IFFL 4OCXH 1HIMH 5IB3A 1FIGL 5IMLB 5KSAA 4N0RA 1R3LA 3FT4B 1LNUB 3B9AA 2AJSH 2IQ9L 3OAZK 1CGVA 4JQXC 2BXYA 4JFHD 3AB0C 1T20B 4U31A 3PWLB 5GZOD 1X4ZA 2NY0D 5DJYB 1UWGH 3GIVA 3HB3D 1A6WL 1EHLH 1DUYB 1I4FB 3PGDB 1RZ8A 1VA9A 1MHPH 3WXWH 3CVHA 3SO3C 3C60D 5DYOA 3G9VA 1GGTA 3EHBD 4WY7L 4J2XA 1WUNT 3C6LB 1A7NL 2E7BA 4XCCL 4M1CD 2R2HB 4LQFL 5CEZH 3LOWA 3OKDB 3ZDYF 2NTSP 5HYSA 4M61A 1II4E 2EYRB 4AEHL 4I0PB 1GGYA 1K3IA 5F7UA 4JFZH 4UIMB 1ZHKB 3BOVA 1JPSL 4Y5YC 4AEIH 3WS6A 5DTFB 3FMGH 2Y23A 4PJHE 3RUGF 2EIZA 5DHYA 3FQTB 2NY1D 1U42A 1AE6L 2AEQL 4QWWD 4Y1AA 4X7FC 5FKAA 4MDJA 4YR6B 2C4FT 2E9BA 3HC4H 3TEUA 5L2KD 1HCFX 3I6KB 2AGJH 2CLRA 3R8QA 5KOMC 5JDJA 4F37K 4G8GA 4X5WB 2P5EA 2RFXB 3LPFA 1MFNA 4FZ8L 2HFFB 4U3HA 4W6XB 4GXUM 3V6ZB 3FB5B 5CP3H 3O3BB 4IS6A 5BXFB 3EOAB 4MYWB 4JFDA 3VG9C 1IQDB 3JUZA 4OIBA 3QQ4A 3EJYC 1LK2B 1RQ5A 5HHPA 4D9RD 3MXVH 4NN5B 5E08L 5KSAC 4JM2C 2A9NL 5KZCB 5L0QB 3GSWA 1EGJL 2AXGA 2P45B 4R9HA 3AC0A 1VENA 3BKMH 2AKRB 4JREB 1CR9L 1QSVA 3K4DA 1OGAB 1I7ZB 1QSFD 5HHOA 2UWEA 4HW6A 3VFSB 3VFVA 4LFHD 1QG3A 1UJ3B 3TN0B 5EU3A 5EWIH 2FECL 3HC3L 3H7BA 4PJXA 3PV7A 4V1DB 5GGUA 4CDHA 3EBAA 5EUOB 2MWCA 3SY0B 4LSRH 3FN9A 4PJ8A 1TVBA 4DVRL 5E8EA 3QUKB 3T0EE 2P8PA 4ODSL 4XP6L 3WIFA 5JW5B 4JG1H 1JPTL 1OHQA 3GMRB 1BFTA 3HPLB 1EAPA 4EOWH 2AP2A 5SWZB 3WS6C 3C5ZA 1JNLH 1NDGA 4H1LH 2C1PB 2ILLA 1RU9L 4KUCF 4K7PH 5AUMA 5DD3L 1RK1A 3KVQA 2C1OA 2PN5A 4EVNB 2Z92A 3IU3A 1KJMA 3RDTB 1G9NL 4QGYA 1CU4H 4EXKA 2XNAB 5EH1A 5D2LE 4MXQC 1DQQA 1PKQE 4QCIB 4HKBB 4G5ZH 1HHGA 1DBBL 4X6DF 1EJ6A 3ZDZE 1CLOH 4OFVA 2CK0H 1J8HA 3MRBB 3ZHKA 5BZWB 3GSVB 3MTRA 2B1AH 4EQ2A 3ARDD 1A6TB 4IIQA 4KJYB 1V7ML 3TCLB 4ZSOB 1L7IL 5DFVC 5ADOH 2OR9L 2ENYA 3L7FB 5J6HA 5DEGA 1S5IH 4M7KH 1I9JL 5J6GB 4ZAKB 3JWDL 4KROC 5IK3A 1WAAF 2AABH 3VFNB 5E9DE 1QHOA 5ILTH 1X5GA 4YGVB 2Q3ZA 3K7UA 2CKBB 3DYPA 4Z5RA 4U1KA 1RZGA 4M1GL 2Q86B 1J1PL 4ISVA 3TYFA 1YJDC 2DLEA 3KXFD 3TZVB 1P7HL 5GGTH 5CJBA 2NLJB 1G7HA 4CRPA 2WIMA 1XGQB 4F58L 5TF1L 5F3BB 1HKFA 4TNVF 2VJXA 7CGTA 2EDEA 1S7TB 3AM8A 5JPMA 3EYSL 2JB6A 3GM0A 5CKGA 2ZPKL 4D0DB 1SYVA 4WUUB 1KLGB 3ALPA 2OXHA 3U4AA 3T4YA 2GY7B 1FGNL 5C08D 5SX5K 4HSQA 1WCBA 4U6VH 5E94B 1Y0LB 5KVFH 2VZ1A 1JF1B 1YN7A 5T5FL 5IKCA 1Y18A 3IDXH 4WFFD 5FGBA 3Q1SL 3ZTNH 3IFOA 4PJHF 1BQHB 3WFBH 2VLRB 5F7NC 3V0WH 2XQBL 4N0FA 2MKLC 1FL6A 4D0CB 5LQBH 3ROLB 4I48A 3VXTB 2R2BB 1NLBL 3VWKD 5I1HH 2OTWA 2VXTL 1CFVL 2EXWD 3EDFA 4DVBA 3SE8H 4ZXBB 3UJTH 1CE1L 4I2XE 2G5RA 2NY5L 3IGAB 1RZ7L 4TSBH 1KLUA 1XGUB 1CYGA 3MLTA 4IM8A 4PR5B 4O2FA 4RQQB 1HDMA 2XKNA 3W0WD 1S7RA 4NQDA 4PJCE 4O9HH 2PR4H 1T22B 3JXAA 1CICB 5IFHL 4R4FL 4XHJD 3LKSB 3BE1H 4LGPB 4BFIA 4PV9A 1QRND 2ZCKL 5E99H 1KTRL 3TJHC 1M7XA 3S9DB 4PJGE 3TM6A 4U7SA 2YK1H 3KPRB 3FQWB 3CFCH 4X83A 2VZTA 3QUXB 1GC1C 4JO1L 3AROA 3NCJH 4NQEE 4Q2ZA 4WW1A 3PWPB 4ODTH 1A1NA 1E4JA 2IPUK 5HYJD 3SE4A 1IGJB 3CH1B 4WJ5B 3DETC 5EU6A 4M1DH 3QUYC 3BPOC 5F1SA 1NAKL 4XWOC 3DMMC 3F58L 5F7YC 3AM8C 1S5HA 2FWOA 4U6XA 3L3KA 1IGMH 4LU5H 2Z35A 4MJ6A 1MIML 2R23A 2OXGA 4OLUL 2Z31A 5CCKL 4PB9L 2C9AA 3EYOB 3SN6N 1H3UA 2RGSA 5KSBE 1WWCA 4NO0A 4KK6C 1FZJB 3DVGA 3HE6D 3OPZH 3JV0A 3LMJL 1JF5A 5ISZE 5JO5A 3BO8A 2R69H 3VG0H 1OOAA 1MF2H 1MCQA 4DN3H 5F96L 4LP5A 1QA9B 2OM5A 4OF3A 2YOCA 4LMQI 2EH7L 5D2LF 4G43A 5DEZA 5LGHL 7FABH 4PJIE 2VC2L 5DLMH 5TDNA 4IRJA 2AJXL 1UCTA 3X12A 2FJHB 2FEEI 2BJMH 2V2TA 1AP2A 2X4QA 4Y4HA 1MCPL 1LEGA 4R2GC 4WHTA 1G1YA 1UENA 5IW3A 1M7IA 2JLLA 2CJUL 3G5VA 4PG2C 1K4DB 3C09C 4S1SL 3OR6B 1U95A 1A3LH 2P42B 4GXVL 3VE0B 1Y6MR 3VXMD 3SDXE 1CL7L 5BW7C 3QCVH 1W72B 2QHRL 4ZDHB 3L6FA 2GUOA 3RGVC 1FVDA 1U0QA 5FYJE 1U8PA 2X42A 4G8EA 4HJJH 4WFGD 1QKZH 4F7MA 3TT3L 4OZHB 3NMEA 1UZ6E 4Z95L 5EU5A 1YNTB 1J88A 1HSBA 2DTMH 3BQUD 1DVFB 3ULVL 4JRXA 3CDCA 3V2AR 3JV4A 1VADB 3CFDB 3QNXA 4U1HB 2QV2A 3V52L 2MJWA 4YPGA 1GGCL 3D25A 4KK9C 1I7TA 5FO8B 1KCUH 1FP5A 1WEJH 1KXVC 3M17B 3QZWG 5BJTB 2Z31C 4F7PB 2OYPA 3D9AH 4ELME 3AY4C 4HWBA 5C0IB 3V5KA 1MFCH 4R96B 1DQJA 1ND0A 1CIDA 5FIEA 1D6EA 3INUH 2Y5TB 2UZIH 2R8SL 5K9KA 3WDIA 2FR4B 2R1WA 4OGAD 3QO1B 1CE6B 2F8OA 2UY7A 4HC1A 5EBGA 4K94C 1E0OB 3D0VB 3RPIA 1QFUH 3GJEB 4KJWD 3L1OL 4QRQB 3H3BC 3NCBB 4KI5E 1T5XA 1ZGLB 4QTIH 4IRJC 1I7RA 5FECA 3PJSB 2RHEA 4Y4HC 3DV6A 3MPCA 3UTOA 2HFGL 1FL3A 3EYVB 2HWZL 3RFZC 5J1AA 3ARPA 3O3UN 5I1IH 4R3SB 5JIIA 3ETBF 1G7JA 1ZLSL 2J6EA 1SJHA 4FTVD 3MLZH 5IVOA 1OTSD 3AS3A 1D5IL 5GRJH 2XKUA 4YX2H 5HI5C 2IPUG 3CPLB 4PJGF 3S5LG 3OG4B 3ROOB 4MD4B 1YEDA 3QPQC 3CU7A 1YPZE 5D2NE 1UM5L 4HC1H 3I2CL 3QIBC 4ZMAT 4L8CA 2XA3A 1A4JA 4MQSB 4G9FD 2Y36H 1EVTC 2JCCB 1F3RB 1FNHA 1LE5A 2NY0B 2PYEA 2B5IC 1J0ZA 3DX8B 5C0BD 5IIEB 2V2XA 2XA8L 5C0GB 3BYTA 1I1RA 1Y6NR 4JKPL 5CILH 2AV7B 3L5JA 4P9MH 3VFRA 1RZIA 4TPRL 4O51A 3IYLW 4DCQB 2EEAA 3RWFA 4AYFA 5D7IF 2A9MH 1MFEH 4R7DB 2VLJE 4L4TA 2FDBP 5DC0A 3F7YB 3TNMA 1OAKL 3GSUA 2R56H 3L5HA 1QR4A 1AXTL 1QSEB 5T3XE 1MAMH 5IGXL 1NC4A 4QO1A 1BZ9A 5LCVH 4HK0A 1ZEAL 4YBLC 3ZSTA 5KSBF 5B4MC 2OZ4A 1BWMA 2BNUB 4YK4C 3ULUL 5H94A 1OP5H 4G9DA 3FQXB 3EJZC 4KTEH 5TGBA 4JDVB 3P9MB 4JFFB 3FONB 5C0AB 3FB6A 2MNUA 3RL1A 4MJ4A 5L2KB 2N56A 2IH3A 3NA4A 3WL9A 4N8VA 1HSAA 1TQCB 2KDGA 4PJIF 5E5UB 4BZ2L 1RJYB 4UI2A 4YE4H 4C56A 3VU2A 1GZQB 2R4RH 4OZ4B 1AIFA 3SCMB 5KVMC 4Z78B 4P2OD 3FTGB 1P4BH 3VFTB 4RMSA 2Z8RA 3TBTB 1NDMB 3SDXF 3UZVB 2X4TB 5E4EC 1XF5A 2HVJB 1KCRH 4Y16D 3UJJL 3L5XL 2FJGB 1WFTA 1WSST 4JAMB 4S11A 3RI5K 4P46B 1FN4A 3S88L 1QPPA 3MRNA 3IKCA 4U1NA 1TJIL 3MA9L 4EQ3A 1URLA 1FSKB 1QSFB 2X4UA 4FNLL 5GGRA 4DZ8B 3WJLC 4YHOH 3I9GL 1OGTB 1SHMA 1HXMA 4NOBA 3CMOL 5EU4B 4XCFH 4X6CE 4HBCH 1YEJL 5GGRY 1A7OL 4XPGH 4ERSH 4OAWB 1JRHH 4BZ1L 1NBYA 3MRPA 4HXBH 2FSEB 4KKLC 4V2BA 1BOYA 1KIPA 5IV2A 2R4SL 2BY3A 4YBQC 5C07D 1OWWA 3K8KA 3G6DH 5I8KL 4HWEH 3SKOB 2YD8A 3TCXA 2C5DC 2JB5H 4BQ9A 25C8H 3GMNB 2OI9C 4JN2B 5I76A 3FCTB 4ETQB 3ZT7A 4ELMF 5B8CB 4GRMA 1OSPL 5F9WC 4MB3A 4KKCD 4RAVA 4HX1B 3NFPA 3I02B 5IMOB 4NKDA 5JOFB 2AAVA 4K3EL 5FKPA 3DTXA 4H5SB 5FHAH 3S34H 4NT6B 2GY5A 4P2RD 4HUMB 4OLXL 4F9PC 1MY7A 5KAQF 2NY6C 5JW3H 2X9WA 3VWJA 1Z9LA 1ZMYA 3OXRB 1OAUL 2M1KA 4K3DL 4KI5F 4OV6F 2GFBA 1LO4L 5EC1B 4ZFZB 3BSZL 3T0XA 1F4YL 2XRAH 4YAQB 3T09A 3BMVA 3ARDB 1S3KH 5DSCA 1BGXL 2BSTB 2YPVL 3B2VL 3SBWA 4PJDE 5D9SB 5CEZE 4YLQT 2YKLH 5DRWB 1PYWA 4NKQB 4FQLH 1QFWM 1ZE3C 5HHQA 3QDMA 5D6CA 3SGKA 4AQOA 3JVGA 4IRSD 4D0BB 1KIQA 2IANB 4YUEL 2YZ8A 2OL3B 3BFOA 1YPZF 1S9XB 3AREA 5C0CB 1MCSA 1EPFA 2NY7L 4OF8A 3MRJB 1KTLB 4QKXB 3KXFB 4X4ME 4MS8D 1SJXA 2V7HB 5M7QA 1J8KA 3VH8G 2D7PA 4U1GB 1E4XH 3D69A 4WI7A 5D1QB 1AR1D 1NGYA 3D39E 4Z8FL 4R7NA 5I1KH 3RY5A 2H3NA 4YHLL 4RWHA 3MACL 3CDGA 1S9KC 4ZO6A 4OZFB 3EOTL 5DRZB 2D03H 4NRZB 4NZUH 4P0DA 5DGQA 2VDOL 3D3VE 1U8OB 1VSCA 1G0DA 4NNYB 4EUPG 1E6OL 2UVFA 2H6PB 3SPVB 3RWHA 3R8BB 1G7PB 4EI5D 4OZIA 1KIRA 3S4SG 4AMKH 3CFBB 2P44B 3QJFB 2NW2A 3VWJC 4AQ1B 4F15C 3CUPA 4ONGH 2CDGB 1NCDL 3OL2A 4OQTL 1EXUA 3OKNB 5CJ5A 2VLMD 4HWZB 1H3TA 1U3HB 2IBZX 3GSXA 4LARL 1BBDH 4JR9L 2R0KH 4JLRB 2DDQH 3EO9H 4WWKB 2X4PA 3LEXB 1N4XL 2P5EE 3B2UC 5HYIA 1FIEA 4CW1A 2D9CA 1F58H 1UZ8A 4HIHA 1P4LA 3W0WB 5IFJB 3SDCD 3SBWC 2KUTA 1Z2KA 2Q6WB 1IEAA 1IGYA 3GBML 2YD7A 2A1WH 4HS6A 4PRIA 5MEPB 5L8JB 2DQUL 3PQYA 5EORL 2V5MA 3KYAA 3SGKC 4DWHA 3JVGC 1QO3B 4WW2A 1AC6A 1PG7H 3V7AG 1FV1A 2LAAA 3PUCA 4UNVA 5J06A 3FAXA 5I30H 3AREC 5C0EA 4M02A 2IPKA 1FIGH 1A6UL 2XZQL 1A4KB 3MODH 1P5UA 4H0IA 1E28B 1YQVL 3BYYA 3E2HC 4X6CF 1K2DB 32C2A 2WIIB 2ZSWA 4OFKA 1R3HA 2A83A 1CQYA 4FQQA 3MUJA 5E8PB 5T1KB 5FO7B 3O4LA 4HS3B 5C0DA 2VR5A 4WY7H 1HH9A 3BDYH 4QXTA 1DBAL 1A7NH 1C08A 3MMEA 4RSVA 5J7CC 1BF8A 4LF3A 1UXWA 1FE8L 2YUZA 1DBML 3OAUH 5MEQB 3D18B 2X41A 2BY1A 1MAJA 5CIPA 4AEHH 1ZTXH 2Y07L 1JPSH 4JPWL 1BLNB 1EGJA 3B3IB 3HI6L 3WUWG 4GMSL 1X5IA 2CXGA 3VFWA 1D9KB 3TH2T 4P5TA 2WM0A 3BH8B 4KUCD 4BSJA 4M6OL 4X5LA 3EYFA 3O0RL 4TUJB 4P59L 4XVUD 2Z8VC 3GJFH 4PY8I 1MVUB 3UBXI 4C58B 4HUVA 3U0TB 1MRDH 4I0PC 2F54B 3MV8E 2QADC 2KQNA 1CDCA 3EDEA 4LPXA 1HINH 5C8JA 4PJDF 3VGFA 5HY9A 5DS8B 4NO3A 4J3XA 5J56B 1HK6A 5K9QG 1CXEA 3GB7B 4WW2C 3I3EA 3LB6D 4JM2F 5TDOB 2X1WL 2W59A 1RIVH 1NBZB 4GG6A 2EDLA 4U0RC 3Q48A 2V17H 4XP5H 4KRNA 2HJFA 4BQ8A 2AJ3A 5I1GL 2E6JA 3NCEB 5EBWB 4X0KB 3UTSA 1A2YA 4L4VB 1N7MH 1V7NH 2PW2A 3NIDE 3QEGL 5F93C 1T0MB 2EH8H 1CT8A 1GZPA 3O3AA 1BFVL 4J1UA 3QHZH 5EOCJ 2ICWB 3FB8B 1T89A 4N1HB 1IGFL 4OCYL 2GSGA 2ICCA 3GSQB 2X40A 5I74B 5I1CL 5KVEH 4PY7A 4NZRH 4ZPTA 3TIEB 3T08A 3LKPA 1WIPA 2FHFA 2BNQA 2OJEB 4LLYB 1JPTH 2HTKC 1NLDL 3TVMD 3O81A 4R8WL 4KV5E 4XP9H 3GK8L 3BPNC 3S36X 4YFEA 1CBVL 1MFDH 4KUZH 5HD8C 3CU1A 4U1LA 4RGMB 4HFWA 5BVJA 4QOKE 1VFUA 4NNXA 4FQHA 1W0WA 4TUOB 1NMCC 3V4VL 5IB5B 1DBBH 2VDLH 4ZTPL 1PZ5B 1AI1L 2CQVA 5E1HB 1JWMA 4HCRL 2WZPD 4R0LB 1ITCA 4L3CA 5EFIB 3SDYL 3MRKB 1DBKH 5E6ID 2XG4A 3ESVF 1VACA 3BP5A 1L7IH 4KXZH 3FN0L 2WW8A 2X7LB 4YHIB 1KJ2B 3RKDC 1INDL 3NCYS 5JW4Q 2MCG1 4CMMA 5IHZB 1T80A 2BDNH 4L9LA 2UWEF 4X98B 3ARXA 5FM4A 4U33A 4QYOA 1NMBL 5GGVL 2YUVA 1YN6A 1BJMA 3LKNB 3P0YH 4WFEE 1J1PH 3HE7A 4GW4A 3O8XB 3BIKB 3MRHB 1B6DA 4EBQH 1T89C 1DZBA 2DD8L 5F7LB 2DBLL 4L3EA 1XCQB 4XXDB 1MFBH 4X7TA 2EE9A 1C5BL 2F74B 3BW9A 1R5WB 3U79A 5JIHA 1UEYA 5GIRA 5CWSA 3RWDB 2HVKB 3DUSA 3CZFA 1YMME 3QIWB 4MAYA 1MWAB 5L2JA 4UT6L 4PJFE 3VGGA 1GXEA 3JWDC 3O3EA 2HKHL 2FX7H 3CCHB 2YUXA 4CUCA 3T0ED 5MHSE 5T5FH 4JPKH 3L95A 2I9LA 3KWWB 4DZBB 1LK3H 5EUKB 3RIFK 2X70B 2HFTA 3VFPB 2F8XC 3LN5B 2XIDA 4JGMA 5IVXE 2H2PC 4ODWB 3QFJA 1IM9D 4FXKB 5JPNB 2WBKA 1CE1H 3OF6D 5DI8B 4PJ7A 1T1YB 4UOW1 5BS0A 1CGUA 1CFQB 3O11A 3DX7A 4Y19A 5JA9A 3HMXL 3ARFA 1OTTD 2BSSA 2LE9A 3MCG1 4M3JA 3GBNL 5TH2A 2ZWLT 5EZLB 2HRLA 4XTRC 5JUEL 2X4OB 4PRAB 1I7UA 3MRIB 3MRDA 1R5VB 1GOFA 2ZCKH 3W9EB 2C7UA 4M62L 3T4AB 1I1AB 5HYQB 2APVA 4KAQL 4XAWH 4D8PB 3RL2A 1XF2A 2E7LA 5E9DD 2HMIC 4NHCH 2IQAB 2NY2B 3GMOA 1DQML 1I3UA 5DD6A 1ADQH 4XPAH 3CFKB 4JHWL 2CMRL 2VXQH 1T6WA 3IAPA 5GQBA 3P9WB 4P23D 2OK0L 5FCSH 5JNYA 2VUYA 4DKDC 3O9WA 5DWUH 3QZWA 5DURD 5C07B 1S8DA 3UPAA 4UMGA 3I75B 2JIXD 2FD6H 3QUXC 4QRTB 1ZA3A 4MAYC 3ZTJH 4GLRI 3TPUA 4MAUL 1T04B 1X6LA 2EDWA 2ADIB 1D6VL 3S96B 1FO0L 3GMMA 4HGKC 4PB9H 4XH2A 3LCYA 5L9DH 2R9HC 4MJIE 1HHHA 3U30C 2ZUXA 5LWYH 4GG8B 2ADGB 1JHLH 3NABH 4JJHA 4CN6A 3BWAB 3R4DA 4PB0L 4F33B 4E41A 4M43L 4OGXL 4KV5F 3LV3A 3K80A 4QHKJ 1U8LB 3THMH 5BZDB 3VXSA 4P57B 4ALAL 4DKFL 1GGIH 1WZ1L 3DURA 3IETA 5F96H 1T4KA 5HGDA 4CJ0A 4S1QL 4JHZA 5JHDE 3CX5J 4F7CB 4JFEA 1T1ZA 1RJZB 1RZFL 4JM4H 3IDJB 5LGHH 4BH8A 5E6ZA 3QEQE 1W72H 1LMKA 3VD9A 2VSDA 2VLLA 3CSGA 1MCPH 3ARFC 4TULH 3VA6A 2EZ0C 4P4KA 3V0AC 3C9NB 1U36A 3T0AA 3D2UA 5B38B 4GXVH 3S5LA 3MOAL 1MJUL 1VHPA 3K74B 3FJTA 5AD0B 4JDZA 2VQ1A 1AKJD 1WQVT 4YXKL 1Q1JH 1QFWI 3KAAA 2E7LC 3BVNA 4LSPH 2GI7A 3M8OL 2B4CH 4UILH 2VZOA 4O58H 4CADA 1A0QL 2DN7A 4JHBA 1X7QA 3SJVA 4KDTC 1XGTA 2CDEB 4NQED 2E7MA 5D5MA 4MXVE 4HLJA 3REVA 1KELL 3V52H 1A1OA 2WUCL 4XMKH 5CP7B 4HIIB 3IF1B 1AGDA 1GGCH 4EEEA 3S37H 4K7PY 1X4YA 1S7WA 4LLWA 4QXGH 4XX1G 4KHTL 4WU5A 4R97C 3WFEH 4G8FB 1JJUA 4PJFF 4ENED 4JPVH 3U6RB 1U58A 4ZUUB 3ZSSA 3SDDA 3DI3B 4HXAH 2PYFA 3BKYL 5KBNC 3UTTB 3WFDH 1QQDB 2B4CC 3TBVB 3U0WH 3MROA 1OP9A 1RK0A 1H8OA 4MHHG 4UQ3B 1AGEA 3ECBB 43CAB 2EYTB 1JYVA 4A2LA 3ZT6A 3WIIL 4HV8B 4KZEL 5F9OH 4C4KT 3RUGB 1KPRB 1T7WA 4L29A 4GW1A 1B2WH 1K5NB 1TVHB 1H9VA 1DTUA 1MSPA 3CAFA 3ULVC 5ISZD 4HZAA 3CK0H 2YD2A 1RUKL 3BPCB 4JFPA 3RTQD 5D7SL 1HN1A 2F5AH 3GI9L 3NCFB 4G6KH 1ZLWK 3SDCB 4LCUB 3F12A 2PXYC 4N0CC 2HFGH 4HKXB 5TFSH 2HLFD 3FO1A 3OKMB 3GUTA 2HWZH 4P4KC 4BUGA 2EDQA 3V9FA 3QHFH 4GS7C 1MOEA 2G2RB 2P48B 5IW6A 2VE6A 2C4XA 3BGMB 3BISA 4HJ0D 4Q0XL 2VKWA 1A02N 1ZLSH 1OAQL 2Z0BA 4LKXA 1O0VA 2A0LD 1CZ8H 3GHBH 1R3JB 1N6VA 3R06A 3RHWF 2XN9E 5FYJD 3OKOA 3L3JB 2N7BA 1I3VA 1EX0A 2CH8A 1MCHA 2OJZL 4XPHL 4XT1C 3VFGL 2K3TA 1N5YH 3NBNA 3D85A 1PEZA 3DGGA 2F53A 2WSKA 1QRKA 3DO7A 3VXUB 2P8MB 1F11A 4PRHE 1F4XL 1KJ3L 3BP7A 4YNYB 1EFXD 3TA3B 5E95B 1L0QA 5GGQL 4FG6C 4OCWH 1IZKA 3IFLL 2CXKA 1IEBA 1AXTH 1HXYB 3CFEA 5KOVC 3SDDC 5DUML 1OTUC 3CFJB 4JANA 5E6YA 2HN7A 1NGZA 4BQ6A 5IQ7L 5D7LE 1B0WA 5E2WL 4LGRB 1ZEAH 4CU6A 5EIQA 4DQOL 2Y7QB 4B50A 4JRYE 1KT2B 5GS0L 2X1QA 4I3SL 3PV6B 1H3WM 4HUWB 3HC0A 1CCZA 3ZHLA 1BQSA 4QXUL 1MRFH 1IKFH 1U9KA 1SVCP 3PDDA 3BEVB 4S2SB 2VB5A 3HMWL 4MSWB 1ZGLP 1FPTL 1I8LA 2E27L 4KI5D 4XMLL 3WSQL 4X6DB 5IMMB 5MP6L 4L8DB 3X3GL 4QF1B 4RMTA 4JZOA 4MCZB 2BOCB 1WISA 5HDQL 2HFEB 5C09E 3NTCH 3UBXB 3OSKA 4U3XA 3HCVA 3UO1L 3L9RB 2I07A 2OS7A 2P24B 4WCYL 3RWIB 4LHUG 1U8HB 4LVOC 4WI5A 3CLFL 3KPNA 2XV6B 3IXAB 1TCRA 3AMLA 2VDKL 2ADFH 5HHNA 3S88H 5ANMA 1FFRA 3E6FB 1V8HA 3ZO0A 2EO9A 5F89B 4HT1L 5E1AB 2ZG2A 3SKNA 1ZT4A 2A6IB 2BVOB 3FFCB 1NGWA 3JTSB 4YHZL 3VH8A 4BUHA 2QSVA 4M93C 1WTGT 2NY4C 4JDTH 5KSVA 5LGJA 3MRLB 2J2ZA 3L3DA 4HLZG 2DIAA 2J4WL 4MXVF 2AS5M 2DICA 4UAOC 4HUUB 2O61B 3HA0A 5CJOL 1BM3H 1FNGA 2VL5A 2G9HA 4LLDA 2CGRH 1REIA 2QQNL 1OARH 1T7YA 5DJ6A 1SBBA 1KNOA 4XWGL 4EUPA 1LP9A 4DW2L 2VLJD 3MRCB 1PSKL 5DJ0B 4HPOL 4L3AA 3FB7B 1XCTB 3S4SA 5T3XD 1A9BA 1P2CA 4LSSL 2Q8BH 1YNLL 3CXHK 4KRPD 4LSDA 2GSIB 2LABA 2Q1EA 5FYLL 1VGEH 4Y4KB 5CMAA 1S7UA 2FATH 2EICA 5IMKA 5IB2A 5EPMA 1J1XL 5CGYC 5FF6B 2BVPB 3HZKB 3C2AH 1EIBA 1MCKA 1MLBA 2YSSA 5JR1H 4E42B 4BH7A 3AU1A 4XNZB 5CEYA 1T0NB 4LEXL 4YGAB 2QEJA 5EBMA 6FABH 1F4YH 3MLXH 5IG7B 4NN6C 3KPMA 5KS9B 1U8MB 2OL3H 4XC3L 1FYTA 4MVBD 3WEXB 2CIKA 3GMPB 1FL5A 2P7TB 2H1PL 5IESH 4LBEA 1UCBL 2IAMD 4PRPA 1KTDB 1ZK9A 1LO2L 1UM6L 3S7GA 1EHAA 4Y88A 3UC0H 3GSNA 4YPJA 5KTEL 1QSZA 3ARSA 2I27N 3HFML 4LLQB 4CNIA 2VNCA 4QRUB 1JMXA 4NKOB 2VISB 1H15B 3QA3A 1CIUA 1WK0A 4OT1L 2JJTA 4G8IB 1HOCB 4OQTA 4IDJL 1EJOL 3RPKA 2NX5B 2FGWH 1ZHLA 1SY6L 4MD5B 4LPWA 5CLWA 2EDXA 2WP3O 4ODVL 4Z8FH 4WDIA 2ADJA 4YHLH 4KQ3H 3P11H 5TDPB 5MENA 1U8IB 1OGAE 1P1ZA 4A6YB 3QRGH 4KDVA 1NCWH 4S10A 5HPOA 1V05A 4MX7B 2NYYC 1UB5A 1ETZA 4NYLA 5H37G 4V1DE 3WUWA 5I0ZA 1N6QL 3RX5A 2DM2A 5EUOE 3B6SA 5GGSY 1J5OL 1YEKH 3WN5A 4F3FB 2XZAL 3GMQA 1IAIM 2DM3A 3R1GL 3K1KC 1P7QA 2YPLA 4Z7NE 4OD3H 1KENL 1NCDH 4GAJL 1UH3A 2XZCL 1I8MA 3DXAB 3MBEA 2AK4B 1OSZB 3QEHB 3QIUA 4LARH 4X7SH 5SWZE 4LCYB 4OZGB 1FLRL 4PD4J 4MA3B 4P2QA 1QBAA 4PRBB 1Q9OB 4IDLA 4RIRB 4CVXB 4Z7OE 1UB6A 2AXJA 2APXA 4J4PA 1WC7B 5HDOA 2V2WA 3MNWA 3HLAB 3OV6A 5DJZA 1JGDB 3GBMH 3EZ8A 2DQUH 4X7DC 4MNQB 1VESA 5CEZD 3U9UB 3IJSB 3P73B 1INEL 1N8ZB 3BGFB 1L7TH 4QEGA 2XPGA 5TE7L 3KHQA 4WHYG 2FB4L 3DYMA 3RWCA 4I18A 4JM2D 4QHLB 3UTSE 4LLUA 4FQIH 2I60L 1FRGH 1JNNL 4ZSOE 2HKFL 3NIFE 1VFAB 2XZQH 2ZNWA 4UU9A 3KYOB 4OJFL 4WHDA 3NPSC 4HPYL 4XVSH 1F4WH 1PQZA 5ESAB 4PJ9C 4UT7L 4ELKB 2VRAA 3OR7B 2QR0A 1MCOL 1H3XA 2BCKA 2JIXB 1EEYA 4AG4L 4JFOB 3OKKB 5HGHA 2G75A 5F6HJ 3D39D 3UROR 4NM8H 3ZKND 4NKMA 3SDAD 3PP4L 4XC1L 2FBJH 1S78D 1RIHL 1DL7L 4UDUB 1WFUA 2E9IA 1JTOA 3BZDA 1AD0A 3D3VD 1DSFH 4MZ2A 1HI6A 3V7MA 5HHMB 2O93L 4GMSH 1GGBL 1G6RL 4JFYB 4U1JA 3MBEC 1YY8B 4YH6A 3HR6A 5F7KC 4NWTL 1DBJH 1FFOB 3LEVL 4TSAH 4LDOB 4UB0H 2X05A 2D7TH 2NZIA 3ILPA 1RZKH 3TO4A 3QP3A 2W0LA 1BAFL 4Y4FB 3PIQB 4OFDA 2VLRE 4JQIL 2CRZA 5EC2A 2P5ED 3RKPA 2DQIH 3H9SA 3O2DL 3FQRB 4OM1L 3BP6A 5IM7B 4LCWA 2WUBH