1FFVA

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
155
Chain Sequence
KKIITVNVNGKAQEKAVEPRTLLIHFLREELNLTGAHIGCETSHCGACTVDIDGRSVKSCTHLAVQCDGSEVLTVEGLANKGVLHAVQEGFYKEHGLQCGFCTPGMLMRAYRFLQENPNPTEAEIRMGMTGNLCRCTGYQNIVKAVQYAARKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
total genus 45
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1ffvA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ffvA01
1FXAA 5EE1A 2H89B 1KF6B 5MPOA 4YXDB 3AE4B 3AEGB 1CJEA 1NVID 1TKEA 1J7BA 1WGKA 3P1MA 2K5PA 3EUB2 5AUIA 1L0VB 4JWSC 1AWDA 1E7PB 5AUKA 4YTMB 1FMAD 1VDVA 3AN1A 1PUTA 1TJEA 3AE9B 4C7ZA 2H88B 4P6VF 1QF6A 2BS3B 3AEBB 1DOXA 1L5PA 1A70A 1NEKB 1DOIA 2BS2B 2WLBA 2CJNA 1CZPA 5EE0A 3HRDD 3AECB 1NENB 2L52A 2M19A 4YSZB 1V97A 3L4PA 1WXQA 1SIJA 3SFEB 1N61A 3NS1A 2K9XA 3P4SB 3AE2B 1B9RA 1RWSA 4US8A 1JWAD 2AX5A 3AH7A 4USAA 3CIRB 1ZOYB 3P4PB 3P63A 1N5WA 2BT6A 1N63A 1L6UA 2W3SA 1SF0A 2KMMA 1ZUD2 3AE5B 1EWYC 1VLBA 1L6VA 1ZXIA 3BIID 3VR8B 3VR9B 3W9CB 2DWQA 2BS4B 1QLBB 1OQQA 1XLNA 2MH7A 3P4QB 4JX1C 3WCQA 4YTNB 3VRAB 2FBWB 2WP9B 1WYGA 3NRZA 1QOFA 1DOYA 3PO0A 2B76B 1N62A 1JALA 1OFFA 3AE7B 3SR6A 1JROA 3LB8C 1TYGB 2DBYA 1YJIA 3HVZA 2CU3A 1J7AA 3AEFB 2MJDA 2W54A 2E3TA 1SB3C 3NVYA 3AEEB 4ITKA 4C80A 2G1EA 2WU2B 2WDVB 2L83A 4JWUC 1J7CA 3AE8B 1T3QA 4C7YA 1FRDA 3B2FA 1FFUA 2WS3B 4N6EB 2W55A 1QOAA 2Q5WD 3B9JA 3P4RB 1TKGA 3NVZA 1JW9D 1PDXA 2W3RA 1PFDA 2OHFA 2KAJA 4US9A 3AE3B 4YT0B 5C3JB 2N0SB 1YJJA 1KFYB 1JWBD 1UWMA 1ZP0B 2WDQB 1NI3A 2WU5B 3FC4A 2CJOA 1KRHA 1FIQA 1N5XA 1FXIA 3KWLA 4N58A 1XLPA 3AEDB 1NYRA 3NVVA 1XLOA 4ZHPA 1IUEA 2EKIA 1R7SA 2M56B 2PVGC 1FM0D 3ETRA 5H8YE 2Y5CA 3LXFA 1RYJA 1I7HA 2PKOA 3W5VB 1FFVA 5G5HA 4HROA 1FO4A 4N59A 3ZYYX 2PIAA 2QIEB 1RM6C 2K22A 5C2TB 2HTME 1QT9A 2WDRB 3CWIA 5GXGB 4LTUA 1JQ4A 1YQ4B 1JRPA 1E0ZA 1GPXA 2ACZB 1E6EB 4WWMA 4IDIA 1NYQA 1XO3A 3AM9A 1V8CA 4FXCA 3DWMA 1OQRA 1DGJA 1GAQB 2MJEA 3AEAB 1F0ZA 5EE3A 3AE6B 1RFKA 5EE9A 1N60A 1VJKA 3HUIA 1WWTA 4YSYB 3W5UB 3DWGC 1QOGA 3AE1B 3B2GA 1WRIA 4YTPB 1AYFA 4A9AA 1FRRA 4ZOHC 3SFDB 1QOBA 1XLQA 3AB5A 2LEKA 4KX6B 3ABVB 3AV8A 4ZHOA 2WQYB 2MJ3A 4HRSA 4YSXB 1E9MA 5H92C 1E10A 1TKYA 2QJLA 3FAHA 3VRBB 3AMZA 3NVWA 2PVOD 5G5GA 4WQMA 3RPFC 2JQRB 2JX5A 1YQ3B 1ROEA
chains in the Genus database with same CATH superfamily
2QLTA 4IRCA 8ICYA 2HVIA 4DDID 5ALIA 4O3SA 1L0VB 3WAOA 4B9LA 4II3B 3D2NA 4KGSA 4MM3B 2ICIA 4MGIE 5BOMA 1U48A 4E71A 1DOIA 1YD8U 5EE0A 2ZIWB 8ICEA 4B95A 1KM7A 3P4SB 1WR6E 5ALXA 2K9XA 2KN7A 1MSWD 1B9RA 5C0YA 3AH7A 2J0JA 1Z4NA 3MFGA 3P63A 2D11A 2M0XA 3MC0B 4A20A 1L3UA 2IHNA 1UHUA 4OCZA 1S76D 2MA9B 4PGXA 2MH7A 4DSFA 3PHWB 1EUVB 1SE9A 2W9NA 3IN5A 2HSZA 3UXOA 2M9NA 5DQIA 1BPZA 3C2KA 4NNJB 3ZUNA 5C5JA 2KDFB 2IZVB 1QZEA 4K4GA 4OZCA 4XX5A 2OJWA 2KFKA 2GLEA 5J2JA 2L83A 2IBKA 3B2FA 2W43A 3RRGA 4CF4A 8ICBA 1TS5A 2LWPA 4IQTA 2YB1A 3KW5B 4QZBA 3H7SA 2JWZA 5J17A 3K75D 4F4KA 2A4ZA 3RH4A 3ML8A 2CKHB 1OEYA 1L7YA 3UXNA 2WXNA 3VHTC 4I2GA 2XEWA 3MC8A 1FIQA 5KL1B 4MEXA 1QSYA 1SV0C 1MN8A 3M9OB 2YY6A 4TSSA 3RNFC 1Z00A 2LVOA 2PFOA 2IGDA 3R3MA 4PT5A 4PGQA 4KLDA 4XDCA 4UB8U 3WIMA 4MFCA 1F77A 2L05A 4KLSA 1WXAA 2AQ1B 3PMNA 4F50A 1TS3A 2KVRA 4ZRPA 4IR9A 2HHUA 2R8IA 2D10A 2WXKA 3JYUA 2XK5B 2ZCBA 5AKHA 1TIFA 1HZ5A 5DB8A 3PMLA 5BMGA 3F2DA 3DVGY 2W03A 2RD0A 5EE3A 4MF2A 1F0ZA 1QQRA 1QCKA 3VCBA 3KZIU 3C2MA 3KLSX 2KV2A 1FRRA 1EM7A 2ZTDA 2JHDA 1WR1A 4KX3A 3SFDB 4C8MA 4KX6B 5ALUA 3C28A 1DK3A 5IP4D 1E9MA 3KWVA 5GTHU 3TCAA 2LKYA 1L7NA 3TEYA 1LKYA 3C29A 2ALZA 4GIVA 4G9BA 5J2EA 3VH3B 1C1YB 3ECIA 4RGTA 4S0RA 3QK0A 4F5NA 4B9KA 3B0YA 4J9RA 4RNMA 2K5PA 1JN3A 5TZVA 3ZTDA 2XN9C 4Y2RA 3PO5A 3H9DA 1T0RC 1T6BX 2LJ5A 3ZI4A 4JV0A 4LJOB 1DOXA 2JZBB 1SV4A 5AI5A 3HILA 2WLBA 1SV0A 4C4SA 3RR8A 3AECB 4B0MA 1I4GA 3L4PA 3KHGA 5EOZA 1ZQAA 3ETLA 2MBHA 2GO7A 2D3CA 4HPLB 4M9GA 4EZ6A 4HK2A 3H0LB 2WXFA 1RQLA 1K53A 3DEEA 3MGIA 4KLJA 1OQQA 1XLNA 1EU3A 1F1HA 1V81A 2CN1A 4F4WA 3I63C 3RRHA 1YMHE 2NCNA 5L9XA 4YWGG 5J2BA 2JY6A 2RHFA 1SL2A 1NJYA 4LJXA 3MFIA 4M8MA 3DVNV 5FK9C 1K1SA 1ZQXA 3MGHA 3RB3A 1S10A 4KLIA 4EX7A 4UBBA 2J6SA 1OEYJ 2GBMA 2E8OA 3DPDA 4ECRA 5AIAA 4QZGA 3AE8B 2HCFA 3W1SA 1FRDA 2FCQA 4BVUC 3WK7A 3KYDD 2KEYA 4A3OA 3V6CB 5AI9A 1IBXA 2N9XA 2G4SA 4JMUA 3K1RB 4ED2A 5KT5A 2C7NB 4C8KA 1ZQQA 5J2DA 4KMUA 1KFYB 2WX0A 3ZDAA 4WAAA 2L5YA 1I4RA 2N9PC 4M8NA 2JZBA 3LWLA 1XCTL 4JE3B 2LBOA 2KTQA 1KJTA 5DG7A 3AEDB 4PGYA 1HXYD 5J29A 5JUMA 1WRDB 2CU1A 1X40A 3GIKA 2DZJA 2H3VA 2R18A 2F44A 1R7SA 1LFDA 2M56B 1UCVA 2ZTEA 4I6PA 2DUYA 4GMVA 4DBGA 2PKOA 4BUGA 2G9HD 4FBJB 3A9KA 3BS5B 4HEA1 1WWVA 4DFKA 2HBLA 5ALLA 3BYTB 4ELTA 1QT9A 3ZJUA 1TS2A 4ZRIA 3KVFB 2LXCA 1CUKA 3GE3C 3RBDA 4DF8A 3WAMA 3ZDTA 4IQWA 4A6QA 5KG3A 2LHDA 3GV7B 4HDQA 1TZOA 4FS2A 3H40A 1KSPA 4AOFA 5AK4A 2N1WA 3R7RA 3EPGA 2MJEA 2KMAA 4DQIA 5CTRC 2LM1A 1WWTA 3QX1A 3Q6BA 1ZDVA 1ZJNA 2KN5A 5ALKA 4C0ZA 3N30A 5D94A 4TURA 1C4CA 2NBVB 1OTRB 3M6KA 5J0SA 4NJ6A 2ON8A 3A0BU 3MDAA 9ICSA 2Y5PA 5HMLA 3KQ4A 4R63A 1YQ3B 4EZLA 1KFSA 4ECZA 3EW9A 5HHDG 3KBBA 1WCLA 3P1MA 2BQUA 4IM0A 3EUB2 3ZO5B 2VH1A 4F91B 4AWJA 5KT2A 4WJ3B 4DEZA 4XYCA 4FADA 3AN1A 2ZIUB 2E8PA 4MEYA 4P6VF 2K4EA 2IOHA 3DHGC 3RAQA 4NY0A 4ANWA 3JPQA 3RFAA 4IUMB 1Y56A 3HRDD 4O1NA 2L52A 4RGMA 4MT5A 2WFAA 3E2EA 4Q43A 2XO7A 1U4AA 3TAQA 2NS5A 3QIJA 4IG7B 4JB3A 1O08A 4FZNA 1NJZA 2RQ5A 2W8KA 1X1MA 2HW3A 1FNVA 1V1OA 4OVZA 3PZ7A 5CHVC 2KTRB 1IIPA 1VLBA 2BZFA 3CYMA 3APFA 5I4DA 4QWDA 3CNHA 2GI9A 1UWXA 3K1ZA 3WCQA 5KFZA 4ED8A 4IL6U 9ICRA 1NZPA 3KD3A 4F93B 2NTTA 3L10B 5DPSA 9ICVA 2KLGA 1ZD5A 2WXOA 2INPE 3LB8C 4GXKA 2CU3A 4K7SA 3SEIA 2ZNVB 1S97A 1IYFA 2KQSA 2WU2B 3R7QA 1MFWA 4CRXA 2KHWB 3GU3A 5ALTA 4KLEA 4NL9A 4GIBA 4MSQB 4BKTA 4U6PA 4J9NA 5IILA 3WALA 1LKYB 4C4VA 2FLNA 1JW9D 2KE7A 3RTVA 1IG6A 1FPYA 2N0SB 9ICGA 1JXEA 2K8HA 4WWOA 4II2B 2PFPA 2QDFA 3APDA 4JL9A 3B1LX 4NWIA 2Z59B 2WNMA 4LLGM 1GB4A 2MA1A 1WX9A 5G55A 3NZUA 4P1BC 3WKAA 3QWZB 5AKYA 3KHHA 1NYRA 5IAAC 4MJSA 4TUSA 1B43A 3D6JA 1RYRA 2IY1B 5IIMA 2WXLA 4RM9A 1UT8A 3ZVVA 4DOAA 3P42A 1LM8B 3OJ3A 3WU2U 3MR2A 4Q44A 4IOIE 2OH2A 3JPSA 2ZPNA 4PHPA 1RXVA 1WJ4A 4WWNA 5DB9A 1RQNA 1KFTA 2BF8B 1WZ3A 4LZDA 3N1YC 1KN5A 3QXGA 4DFPA 3DWMA 3C21A 2M17A 3GE8C 5IO9A 2Y9UA 2HHTA 4ZRJA 3X23A 1NK5A 5AK3A 1LXDA 4J03A 4ICAA 3UMCA 5JTIA 1D5ZC 1R4MB 2HOIA 5T14A 3BJYA 2FMSA 3ZD8A 5AM0A 3KHLA 1WM3A 5ALGA 3RN9C 4JGHB 1L4ZB 1UELA 4C4RA 8ICNA 1Z1BA 2G0AA 3JPPA 4REZA 2YMPA 1S77D 2O6VB 4DQRA 5MPOA 3AE4B 2P6RA 3KUZA 3Q69A 1NVID 8ICFA 4MGYE 5AKKA 8ICAA 2BCUA 3LVVA 1ZD3A 4WJOA 1KLNA 4EFOA 1QKZA 2L32A 3WK5A 2BS2B 2ZIVB 1S0VA 2AJQA 4UB3A 3OSPA 3W2DA 2KJRA 4GB9A 4WQOB 4FJYA 4US8A 1C76A 8ICUA 4USAA 1DRGA 1WXSA 2ONQA 3C2LA 2HDEA 2DZIA 2IGHA 4F8CB 1ZUD2 3HW8A 4WH4A 2KICA 5J0PA 3VR9B 5D4BA 2DZMA 3BS5A 3CSTA 2FBWB 4M9LA 5J0OA 9ICWA 3NRZA 3NZSA 2ESEA 4JWNA 3H8HA 2ZXHA 3MHZA 1QLNA 2AWTA 4HPMB 4F5PA 2KSOA 1OGWA 1X6JA 3ED5A 4BX9C 4EYIB 5KNIA 4RPXA 3RB4A 2LUMA 2C60A 4J9KA 2K6QA 3T8MA 3NVYA 1YIWA 2GBJA 4XGAB 2BCSA 1JUDA 4BFRA 4ZDVA 5L1KA 9ICLA 1QTMA 1XSNA 4URKA 3BK2A 2W55A 4NLKA 2YQEA 2KZZA 3SHQA 2PMZC 2RDIA 4OVVA 3HPOA 3SI8A 3TIXA 3N1ZC 3IT6B 1ZP0B 1UD7A 5ALZA 5AKGA 1KL9A 1TK0A 5CHFA 1ZD2P 4TUPA 2JGAA 2PXIA 3BYYB 4FBTA 2CHZA 3SYZA 3ZRFA 4N58A 4XE0A 3N97B 2LFIA 3NVVA 4BXOA 1XLOA 1X2IA 4NQLB 2H3ZA 4QAYA 1D8BA 2BQ3A 4GLSC 2HDOA 1ZQSA 1V5OA 3SDLC 3E56A 2QEJC 2KXJA 3WK6A 2C22A 4EBCA 2L3ZA 2LGIA 3M63B 3TFSA 2TSSA 1WIAA 3JVZX 1CI4A 1ZPSA 1TBEA 1P7FA 3TADC 3M8SA 5AM3A 5L1MA 3E9SA 1SBBB 4HKQA 4RUCA 1N60A 2IOFA 3HHMA 1RPLA 5BO4B 3M7DA 3PX6A 1R4NB 1WRIA 2K8CA 2ZJ5A 3EPIA 3H6NA 4PHAA 1H8CA 1UA0A 3V7JA 2HHWA 4IWOA 3HWTA 4IWQA 2LGDA 1WGYA 4P7IA 3RH5A 2R8HA 2ZG6A 2G45B 5HNKA 4RF1A 4UB5A 5EE1A 1TTNA 3TAPA 2KX0A 4DXFA 1ZQCA 2C2RA 4QZEA 3C1YA 1CJEA 4C00A 2NYVA 3ZDBA 5HKHA 3AU6A 4IKGA 4ACOA 2XI9A 4F3OA 2A1JB 2NRXA 4ECWA 1YX6B 1L3VA 2CS4A 3GV5B 2ISPA 4ICUA 4DCCA 2C9WB 3ORYA 1C20A 2K0PA 3RZWC 4KN7A 1J2MA 1HUZA 3NTUA 4NLGA 3C19A 1WJNA 3QYPA 4W9FA 4NLZA 4F72A 2LRWA 1F5SA 2WF7A 3DBHI 1DGSA 1JWAD 2KOXA 5E6NA 3BQ0A 2D8CA 5CJ7A 2BTEA 3PX4A 5J0QA 3W9CB 1KRPA 3MC9A 1SL1A 1BPBA 3Q3NC 3P4QB 4DS5A 4YTNB 2PPHA 3L08A 5DCNA 4FJVB 3PV8A 5ALPA 5IIJA 2CPRA 2WB1C 3F5AA 5B66U 2DNFA 1Z3EB 3QARA 4NM2A 2W04A 2W82A 1T94A 4Y2TA 3EECA 4LNNA 2UVWA 2W9MA 4GOCA 1J7CA 2VA2A 2E1FA 4UAWA 1ZOLA 4UAZA 5L1LA 3DBSA 1IGCA 9ICMA 4DHZB 3S6JA 2H3FA 1PK1B 1N2XA 2W3RA 4US9A 1Q10A 3WANA 4Z6CA 1QQ7A 3W1YA 4R8UB 5CA7A 5DDYA 3R2TA 3NASA 4BAXA 5DBAA 3K4GA 3OTQA 3TMPB 4P0QB 4YD1A 4EEYA 2E5SA 2HD5B 4M2YA 3QE9Y 4MELA 1P0RA 1KOTA 2Y5CA 4M6WB 1I7HA 3UMGA 2KOBA 1L7MA 3M6ZA 4N59A 1ZQPA 2R8GA 2KDBA 4M0WB 3ZYYX 4F7ZA 4MM3A 1D8LA 2FDRA 1JMSA 2XK5A 1SIFA 5C2TB 1PUZA 2GH1A 1E8WA 3T5JA 4J9SA 5H2FU 2JZPA 2ATLA 2HHXA 3OPXA 1E6EB 1HJPA 1V86A 3AM9A 1XO3A 2MLBA 4H2AA 1ET9A 5BPCA 3ZTCA 3T5HA 4FN2A 4DXAB 2ZUCA 3H8SA 1FNWA 3Q8PB 3GDXA 1XQQA 3M1YA 2QILA 5CHGA 4M0WA 3A33B 7ICVA 5AICA 4ARCA 5FKAC 8ICGA 5CB1A 3A1QB 5DGBA 5EWGA 2ASLA 2IPKD 3UIPB 2P6UA 2QSDA 2FIFA 2V4IB 2JZ3B 5KFWA 3G6YA 2V4RA 1YOVB 2NPTA 4J9OA 3ZXVA 4PK1A 3APCA 1FXAA 1HUOA 5J8YA 2FUG1 3RJGA 2HVHA 2YLMA 3RYTA 3ZQ4A 4ANUA 1G6JA 1NBFC 4ECVA 3HM3A 3WK9A 2KO3A 2BYVE 4DL6A 1FD6A 3FDSA 2VJ5A 4AJWA 5KFYA 4BWMA 8ICKA 2IO1B 1N56A 4F5OA 3G6XA 4QZDA 3AEBB 1A70A 3URYA 4RQMA 3I57A 1KLGD 3N7RC 3VC8A 1GNUA 2ZVOA 1NENB 5HI1A 1E7VA 2KHVA 1WX7A 1RAXA 2ZUBA 4NQKE 3V7KA 1MHHE 2JV3A 3CIRB 4GGQA 3ZNID 5LXHA 1L6UA 3MGVA 3MABA 4DL3A 3N1XC 4Y2UA 3PS6A 1A77A 2QB0B 3PSPA 3QU5A 1ZRMA 3BQ1A 4B9MA 1S5LU 4QZIA 2WXJA 2XY7A 3RZFA 5ALYA 2LMRA 2H3QA 3DDHA 4FFDA 2N1VA 3L54A 3FKYA 4B0EA 3M95A 4I2EA 3V05A 1T5XD 1IGDA 1SWWA 2Y0SC 2ZJ8A 4M02A 2LYBA 3SD7A 2BYFA 4XQ8A 3JPTA 1SZHA 4B9NA 3DHHC 4NM1A 8ICWA 2WGSA 1K51A 3NVZA 2F76X 5DQHA 4O5KA 4B9TA 3OJ4B 2BKFA 4ED7A 4OJ6A 1WSPA 1JWBD 4QNLA 3E0FA 2JWUA 2J53A 2DPJA 4KTQA 3R8BA 4J9LA 1KRHA 2RDGA 5KFBA 2VANA 9ICNA 9ICPA 3IFWB 2BKRB 4K7WA 1UGMA 4W9JA 1MJDA 1XT9B 1KLVA 4ZHPA 3MJWA 2VRRB 2ZUDA 3GZNI 3ETRA 2V3PA 5B5EU 2AYOB 2K1FA 1UF0A 4ECSA 5G5HA 1T0SC 2HHVA 2EAMA 1ED1A 2PIAA 4DQSA 1A0PA 4O3PA 1BVSA 5ALSA 3MR3A 1U45A 5AI4A 4UB6U 3AEVA 1F52A 3C1ZA 2D2QA 1M6YA 3M62B 4J6IA 2YX8A 4O0IA 4MFAA 1LO5D 2JEGA 1DOQA 4IR1A 2ACZB 7ICPA 1V6EA 3VTWA 3L17A 2KZRA 4FXCA 3AQFA 4G50A 1ZQVA 1IV8A 2F3NA 8ICZA 4Z6FA 3TSSA 4MH8A 5EE9A 1GC7A 1L0YB 2ZCCA 2WHEA 5A0LA 2A5UA 2ISOA 9ICHA 1RXWA 2LVPA 4ZOHC 1GUAB 2UVUA 1HZ6A 3BINA 3AB5A 4MEMA 4RGNA 1SXEA 4UAVA 5J2RA 2VKQA 2EZZA 4BOZB 1E10A 1S0NA 5AKXA 2XNAC 1ZQYA 1YT3A 5G5GA 1OUQA 4KLHA 4GSWA 4RT2A 2MRLA 5AI0A 2C2DA 1ROEA 3JPRA 4MGKE 5HHHA 4HJKA 4KZ0A 5KFPA 1NK6A 3DHIC 4EENA 1S1QB 4MH0E 1NK9A 1GG3A 3B0XA 2INDC 3AXCA 3U8ZA 1WCNA 5KFDA 3PSTA 2UVRA 4MHVA 1KKXA 1EF5A 4L23A 4KLGA 2D07B 5IIIA 5KG2A 2YMLA 2YEPF 4I28A 2H88B 4NV0A 4J9QA 8ICRA 5JH5C 4R64A 2MU2A 1T7PA 4NY8A 2HTHA 2ASQA 1ZRNA 2L0FA 1X42A 9ICQA 5BYQA 3V6HA 5DB7A 1CQVA 1N61A 4L1BA 3AE2B 4XRHA 3L3FX 2FAZA 5KFGA 5J0XA 8ICSA 3FILA 1TAUA 1EWYC 4WURA 2BYTA 7ICMA 2DL0A 1C79A 5DPTA 5L83A 2L0TA 7ICFA 1WYGA 2WP9B 3DBLB 5DLGA 2LYAA 3ZRCA 3GS2A 4J9PA 2J0MA 3WKBA 4YD2A 1JALA 4K7UA 3SEBA 2I6XA 2BR0A 4TMAB 4QJFB 3RJIA 1JROA 2YTUA 2KFZA 2Y3AA 2MJDA 2N9KA 2KK0A 3MJ5A 4YVZA 1V49A 3C0RB 3Q3OC 1GO3F 2UYZB 3H4BA 5J0RA 2N1RA 1XO1A 1ZW7A 4OVUA 3U26A 2BWES 2V4LA 4PHDA 4YXJA 2KYWA 2AQ2B 4Q2JA 4HDOA 5C1ZA 1K8RB 1J2NA 9ICKA 2KWUB 5AKIA 2XIDA 2LHEA 2LUEA 4DL4A 4R8UA 2IYDB 2NBWB 2CJOA 3QQ8B 5E6OA 3NGDA 1WM2A 3JSVB 4WJPA 1TAMA 4FZLA 2R61A 2MRPA 3BVMA 1SGHA 3V7LA 4RT3A 1WMHA 2R2OA 4JQWC 5AZGA 2PVGC 2ZNVC 1FM0D 4PH5A 4DF4A 3R9KA 4KDLB 3CMMB 1C4AA 2MEKA 4JIOU 2JYEA 7ICIA 2H5XA 3EZ5A 3QCAA 2YB4A 2BPCA 4RQ2A 5HR7A 3A4SC 2JUOA 5L1IA 1KQQA 3M8RA 2HBKA 2OYYA 5ALEA 2M4NA 2DHZA 3IG3A 5KFMA 2KHQA 2J52A 5IIKA 4IRKA 1XNSA 5KAFU 8ICLA 3U30A 2M8SA 1RLFA 3VH4B 2LMCA 4LNIA 4NAMA 5EDSA 1RFKA 4QWCA 2BPFA 5GMVA 5ALJA 3PW5A 4UB4A 3IP4B 1PK3A 3N7PD 2C2EA 1V1PB 4LK0M 1BUIC 1ZQKA 4NJ7A 4MGZE 4MACA 1QOBA 2KC1A 2BDUA 1T3NA 2W9BA 2JXTA 2IDYA 2KQ4X 4G0NB 5J0UA 1UA1A 4K81A 2V1YA 3AMZA 2W9CA 3I28A 2V0GA 1TKDA 1XF5L 3D2QA 1MG4A 4O3RA 2Q4TA 3VQIA 3W1SC 3LYSA 3A9KB 2X8XX 1ZXHA 4MJSB 7ICSA 3RULA 4ACFA 3QU7A 2M1MA 4DO9A 3OHAA 1S9FA 1SE2A 4YTMB 4C8OA 3QAQA 2KDMA 1QF6A 1L8OA 2LJIA 1FNUA 2KK8A 4C8LA 3M9MB 2FCMA 2B6GA 2CJNA 2KIVA 3A9JB 1Q46A 2M19A 4B6JA 3B08A 4ED6A 5J2IA 1RWSA 2MUTB 4HJGE 2KNBA 3RR7A 2DF4B 4CYEA 5D3DA 3DQVA 2BDPA 3SD5A 3UPQA 1NK8A 3WKDA 4NZLB 3BIID 3KFUF 3H4DA 2DWQA 3NOBA 3K9OB 5KAIU 4TQRA 3AUOA 1JI7A 1TK5A 3ZKJC 4AS1A 2QARB 2PE6B 1STEA 2LVQA 5IKCM 4AYBC 1N62A 1NKEA 3NHEB 1B4FA 3BK1A 3PPAA 4M9HA 2KWVB 1YJIA 3DOWA 1JCKB 4UASA 1BNOA 3HIZA 1U49A 5L1JA 2QB0A 2Y0SF 1ZQDA 4XDDA 2OM6A 4I2BA 2ASJA 7ICEA 3L5KA 1LB2B 4CDGA 4P2HA 4OHJA 1KLUD 3RNGC 3TEWA 3ZDMC 1FCCC 2JVCA 2ODGA 3CW2C 2KC2A 4R66A 1LVHA 3KKAC 3I5JC 2WXQA 4IM3A 4PS7A 4DHJD 3SAHA 1JXLA 1NI3A 5BYSA 2KFKB 4FULA 1WMHB 4ECUA 3LJ3A 4CQNA 4E74A 5ALQA 4UARA 4HCPB 1RG6A 3VVWB 4IC9A 1C7YA 3GP7A 1FEHA 3DBHB 1JMLA 2M0NA 1L5UA 3RB6A 2KKVA 2EQYA 3PR5B 2REXA 2WXMA 2HMXA 4FBUA 3R2IA 2AU0A 3PO4A 3PVXA 4X5VA 2HTME 3WA0A 2NPTB 5GXGB 2J6TA 3I3TB 2FPMA 3IAM1 3EGRA 4UATA 1KBUA 2KN4A 4DQOC 4QIWF 2KD0A 1F2RI 1K1QA 2KJ9A 2V3SA 3THVA 3ISCA 2JH1A 3TI0A 4DSIA 1NKBA 3BWUD 2J6UA 4C4VB 1VZ7A 2IGGA 1WGHA 3QZ8A 3M9NB 3BQ7A 1GC6A 2KLCA 3I9V1 2WXHA 1TK8A 1L4DB 5CWRA 4OW0A 4RU9A 3MBYA 3T79A 2MP2A 5J2FA 4M04A 2L7RA 2K8CB 4OD0A 1SL0A 5H92C 1UQVA 3TARA 1N6ZA 2BBCA 2HE7A 4F4XA 3DBRI 3R66C 2FMPA 4KKJA 5EWFA 2QC8A 4KZCA 3PT2B 4FO6A 1V38A 3NUHB 1PGAA 1J8CA 2F8LA 2XGQA 1ZQOA 4KGRA 4TV3A 1WUDA 1AW7A 4W9HA 2KQ7A 3DVNU 3L16A 3EWAA 1N48A 4RF0A 3QNMA 3KKAA 4EZKA 2ZIUA 3G6VA 2CHWA 2Y1JA 4I2DA 3C5GA 1PUTA 4HXDA 1KTQA 1RDFA 4I2AA 4RCOA 2Y5BB 5LXIB 1OQYA 3U52E 5KG1A 5FR6A 2Z8LA 1CZPA 3N4MB 3HK0A 3IG5A 2NBUA 4G3IA 4NXZA 2ZZPB 1ZQWA 4DHZE 3P2BA 4UW9A 9ICBA 1UNSA 2AEHA 4N9F4 2WAQC 3RB0A 1E7UA 2W3SA 1B1ZA 3PREA 1L3TA 2W7PA 3AE5B 2KT7A 3A0HU 2LGXA 4LNFA 2QARA 4QW9A 3BZDB 3ALBA 4DS4A 2F2AB 2MSED 5KT4A 2FLLA 4P0PA 2BWFA 3H1UA 4RQ8A 3ISDA 2QMTA 1ESFA 1EWCA 2F8KA 2KKPA 4DDGD 4KITB 1J97A 2DBYA 5JRTA 4J3OD 5JXVA 3AEEB 4ITKA 4C80A 4X57B 4PHEA 2WDVB 5FR3A 2Z0DB 5KFTA 2XC9A 3SMVA 2GMIC 1QSLA 3MP9A 4PL2A 2HJ8A 3Q8FA 2QKQA 2JF5A 1GOZA 5J2GA 2MBQA 7ICOA 3P4RB 2OWOA 3SAGA 8ICJA 2KAJA 2VZKD 2FMQA 4KKIA 4GC6A 2JU6X 9ICAA 1XWLA 2NMQA 5DDMA 4KIKB 1NK7A 2L8JA 1N5XA 2G5IB 2I1QA 1HTOA 2V9HA 3PW2A 1XLPA 4DFDA 3N3KB 2EELA 2FPLA 1ZD4A 2C5LC 4HVBA 4QZ8A 1RRBA 4Y2VA 3T5KA 5T8IA 5D3IB 2HHQA 3JPNA 7ICQA 3IM1A 1VR9A 1Z5SB 3IAS1 4XWTA 2L00B 3GZFA 4ZYNA 1VCBA 2K22A 4OJPA 4MF8A 2XICA 2HBMA 1PVQA 2KJ8A 1YNTE 3PZ8A 2BGWA 4JLCA 2QHOA 3M3JA 2WAQF 5TISU 1JQ4A 3RJHA 1GPXA 4KIKA 1P3QU 4P4MA 2NRVA 3PSFA 2RDHA 3ZDCA 5ALDA 1C78A 2G07A 4Y2YA 2KX3A 4EOYA 4DOCA 5AKZA 4DOBA 8ICCA 5KFFA 1VJKA 3U7ZA 3OWEB 3F53A 2RSUA 1D4BA 3AU4A 2JT4B 3ABVB 1D3ZA 4ZHOA 4BKSA 4Q8EA 1F9JA 1M4VA 2W9BB 4ANVA 2AHOB 2BVCA 1TKYA 1IM4A 4I27A 2QJLA 1CMXB 1A76A 4FLHA 3C5FA 4FHJA 1YJ1A 2ZJDA 3NG0A 1P1AA 5KTQA 5KT3A 3PRPB 1TKEA 4QZHA 2JEJA 2UWQA 5J2HA 2KMCA 3ICXA 4EUTA 3Q8SB 3A4RA 2JPHA 1Y88A 4GXBA 4EEKA 4KMOB 2JH7A 1E7PB 4I29A 3I1YA 1VDVA 4UB1A 3GOEA 1L0XB 4I2IA 1Q3VA 5FP0A 4DQQA 1AROP 5J0WA 4WJNA 4C8NA 1ENFA 3V6JA 2BW2A 2XCAA 3TJPA 2WF9A 1NK4A 2I1KA 2KFJA 3MR5A 1KFDA 2AH5A 3I76A 1N5WA 4YL8A 1V5TA 2BKEA 2FI1A 2VIXA 5JZEB 1BT0A 1PVRA 5F3XB 5AIBA 4XUSA 2HOQA 3NY5A 2Q0ZX 2KZ3A 4XWWA 2J4XA 3TQ1A 3UMBA 3HVZA 3E58A 1NKCA 4K1RB 2W54A 4ELUA 4EKUA 5J18A 3KOOA 2RDBC 4NAWB 4BWJA 2IA6A 5G2NA 4OZAA 2NO5A 3RBEA 2WS3B 1L3SA 2JEIA 3AULA 2WF6A 1NDDA 1PFDA 5D7GA 2KZMA 1TS4A 3EHVA 3T3OA 4LJPB 4DLEA 2JRHA 3FILB 4GDLB 2OOBB 1Z00B 2GB1A 3BQ2A 5IIOA 1YN4A 3D32A 4W9LA 4DLGA 2I5HA 5KFLA 3PSIA 4BZAA 1UBQA 4CO7A 4YR2A 4YP3A 3UGBB 4AP4C 2VZKB 1KW4A 4F71A 3QU4A 4HLEA 3V60A 2WYQA 5KFQA 3Q8KA 5KFRA 3B0AA 5AKLA 1YQ4B 3N20C 4WWMA 4GXJA 1BMLC 2EMSA 5DBCA 2PFQA 2MW5A 5KT7A 1DYQA 5AEKB 3PY8A 5CEHA 4YXMA 4RQ4A 2OEDA 3MR6A 2WF5A 1QILA 1QOGA 4ECXA 2K6DB 3AE1B 4C56C 2MUTA 2OXOA 2LEKA 2K60A 2WQYB 5BOLA 3RAXA 1P9DU 3A9JA 3U7DA 4E0DA 3EA6A 2SEBD 1L8LA 1IPGA 2INCC 4RMAA 4E3CA 3CWIA 1ZQ1C 2G09A 2N7DA 2CHXA 4CHKA 3QEBZ 2H89B 2KJ5A 5CR0A 3SENA 3LWMA 2EAPA 1SXTA 1WGKA 4EYHB 2MP2B 2UU7A 3SU8X 1TVAA 5J0YA 2G4DB 5BMHA 2K4PA 2GWSA 4JWSC 3VUWA 4M0AA 1JRUA 2K8BA 5K4LA 5DGAA 1COOA 3AE9B 1AQ6A 4DK5A 5IN7A 2BS3B 2BYEA 2K25A 1IP9A 1V80A 5J2KA 2E8MA 4LDTB 4JPSA 7ICLA 3GIIA 2MBBB 5D2MB 4YSZB 4PL1A 1V97A 2LI6A 2JRZA 5AI8A 1MQ3A 1ZQHA 3GZNB 3LYYA 1ZOYB 1NOMA 5AHXA 4DSKA 3ZDEA 2BT6A 1N63A 1AARA 3PHXB 3ZIMA 3ZW3A 2K3UA 3ZJTA 4TQSA 3QZ7A 3Q3FA 2BS4B 2FIDA 1BPEA 3QU2A 5KFUA 5J2AA 1ZKHA 5LNK1 3ALRA 1E8ZA 5ALHA 5AK5A 2IMWP 4AYBF 5KT6A 1JWMD 2F1JA 5TR5A 4ZYSA 3O0FA 4DFMA 1TYGB 3EFCA 1Q5WB 3NRWA 5DQGA 3HT3A 2V9WA 2MX2A 2N7JA 3C8YA 4OZBA 4JK1A 1EO6A 5F9LA 4GDLA 2EZXA 1BPYA 4N6EB 1T3QA 1FFUA 2G08A 4D2KA 4A3PA 2XGPA 2Q5WD 4FE3A 1JIHA 2VJ4A 4RQ5A 1ZQRA 1GJZA 4YT0B 5C3JB 1ZQEA 3PV1A 1WX8A 5GTIU 1SE4A 1UWMA 4KDIC 2UVVA 4Y2JA 3BS7A 1C77A 5AK6A 1E90A 4QZFA 2KMDA 3UM9A 5J8YC 2HOFA 4Y2QA 3RJEA 4S17A 4PZOA 9ICJA 4FHKA 2J7QB 3Q8EA 5KFOA 3JSVA 4EZJA 1K50A 4AJYB 4KV2A 3CRXA 1C4PA 1E8XA 4NJCA 4JWMA 1R4NI 2K8AA 3NUQA 1XCQL 2AQ4A 2AGPA 3MC1A 2PJHA 1ZQTA 4RQ3A 3RNBC 2YVCA 4DFJA 3ONNA 3QA8A 1ZJMA 4GN1A 3T3NA 7ICTA 5KFSA 9ICCA 1DGJA 4HWIB 1RYSA 3ONSA 3K9PB 4R65A 3O65B 1XU4A 2RMMA 2Z7JA 2DENB 4A9AA 4W9DA 1SKWA 1AYFA 4EBEA 2NRZA 2BQRA 3H8JA 1VZ8A 2KWCA 2MJ3A 1BGXT 5D6JB 4YSXB 1A5RA 2RPQA 9ICOA 2L76A 2KJHB 2EZYA 4DL2A 2FCNA 4TQ1A 2NO4A 2WXIA 5HMMA 3L0WB 4KLOA 4P0PB 3N28A 4A8EA 2O2VA 2ZIXA 4KLFA 2WXGA 1XO0A 2Y1IA 3CSFA 1ECWA 3TEXA 3MHSD 3OJSA 2F1IA 2LPEA 2FJ6A 1TY0A 1YN3A 4U7CA 3WK4A 1KEJA 4RQ1A 2DX5B 3GB1A 2SAKA 4XZ4A 1ZQIA 1U9LA 5IA7A 4BXOB 1V9PA 3NS1A 1UH6A 1HEKA 2EANA 2A1AA 4DQPA 1YQBA 3ZLZA 4HAIA 3VDZA 3IHQB 4K3CA 3VR8B 3PX0A 4UB2A 1Z2MA 4MDKE 1QLBB 1Q8KA 1C9FA 4HYKA 4W9EA 1NZBA 2FE8A 4B6WA 4KSKC 4BGDA 2BCQA 7ICJA 4W9KA 4EELA 3PLUA 3AU5A 3UQAA 2JMGA 3ZDDA 1ZQUA 2E6XA 2W11A 2XY5A 1J7AA 4O5EA 4NL9C 2JYTA 3AL0B 1SB3C 3ZNZB 4K3BA 2G1EA 2FLPA 1LQBA 3N7SC 2IBIB 4C7YA 2ZIXB 1J0GA 5KFEA 3VFKA 3LDZE 2FCSA 1XSLA 3IXSA 1SJHD 1VJ5A 8ICQA 1LGRA 3AE3B 4K4HA 5KFHA 3QUTA 1HQRD 2OEHA 4GDKB 1TZ1A 2PI4A 3FC4A 3V6EB 2B21A 4WAFA 2AL3A 2KD1A 2YMMA 9ICTA 4WWPA 3WAPA 4QIWC 1UZXB 4ECYA 2K8BB 4MSMB 4IS7A 4QW8A 1X66A 3QEAZ 1V9JA 3KHRA 2DAFA 1SKSA 1RYJA 3W5VB 3TEZA 1WXMA 1FCLA 4TUUA 3Q8BA 2DKXA 3IHPC 1JWSD 1ZDXA 4UAYA 3D2SA 1VZ6A 2NVUI 3BVGA 1RM6C 4Z6DA 3VTVA 1IBXB 1EF1A 2EKEC 1Z19A 2DKZA 2K4HA 4PS8A 2IHMA 1WG8A 2PMVA 2ZXIA 2WX1A 3H7PA 3PR4A 4QWEA 3KUDB 4FS1A 5D46A 1GAQB 3AEAB 3LVWA 4NLBA 4DL7A 3Q8MA 2JZZA 1RYUA 4TKNA 1XXGA 4ECQA 4F5RA 2KTRA 4YSYB 3W5UB 1ZYQA 3DWGC 4KN4A 5JU5A 4KLQA 1P98A 4FJZA 3DV9A 4YMMA 4GFJA 4CCHA 7ICRA 3Q8CA 1K52A 3WKCA 1YZ7A 4ECTA 1PGBA 2KFNA 4JV1A 5KHQA 5AKEA 2N4FA 2ZJAA 5E79U 2M0AA 1I4PA 1BPDA 1WJUA 1WF9A 5CHWA 3TBLD 1QSSA 3KUCB 3AU2A 4QWBA 4O3OA 2LRUA 2LYHA 1TFRA 2NR2A 2WWZA 2XY6A 1S3SG 5HP4A 1MI0A 3GQCA 3DCGA 2BCVA 2MBEA 2VA3A 3TKAA 1IXRA 2C28A 3ZXRA 1URJA 1ZQZA 5C23A 3EYZA 3BZCA 2KVSA 5AUKA 3Q8QB 1ZE3D 4ARIA 3QC8B 5DPRA 2A19A 4DWIA 1KDHA 1VRAB 4YN4A 1ZGUB 3UQ2A 4I2JA 1L5PA 1F0MA 2WTFA 7ICNA 2JRIB 1PQSA 4NPNA 7ICUA 1SIJA 1PGXA 4KLTA 3P4PB 5E6PA 1WYWB 1Y8RC 2H3IA 4IW0A 3RF9A 1SF0A 1X6IA 9ICIA 2ZW0A 3RI7C 2N9EB 2DYMA 4PPXA 2NRWA 3QU9A 4NAWA 3Q8AA 3VXWA 1ZETA 1D9FA 3H8WA 3PGEA 2K89A 2W7OA 5KFNA 5DPWA 2E1EA 5AZHA 1OFFA 1SGGA 1J19A 2MQJA 4RPYA 3JW0X 3N32A 4DXGA 2LGSA 3EFUA 2KKCA 2BPGA 2NV3A 2DYOA 3MTNB 8ICTA 4Y2XA 3BZKA 4XC2A 4JWUC 3UQBA 1I4XA 3U2SC 3IV6A 4GU2A 1E5WA 5CX3A 4IQUA 4F5QA 5ALOA 3AI5A 4JV2A 3TL5A 3B9JA 5DBBA 2DPIA 4YCXA 4PS3A 3SAFA 2OHFA 1UBIA 1YJJA 4O3NA 4CF5A 4TUQA 3PW0A 3UIOB 2WDQB 4ED3A 4HPPA 3KTQA 4DL5A 4YG2A 2GRIA 5KG4A 1S8OA 2E8NA 4M9JA 3RNEC 1MQ2A 4F4ZA 1NJXA 5JHBA 1HEZE 1PVPA 5AZFA 1T0YA 2Z0EB 2LD9A 3LXFA 2HBJA 4BOSC 2N7EA 2WDRB 1D9DA 2IO2B 3MDCA 3H0MB 4O3QA 4BJQA 8ICOA 1EU4A 1PYWD 1T4GA 3PTFC 1NYQA 3Q2AC 3KH0A 2WHIA 1OQRA 2DZKA 1ZQBA 3TACB 2DLBA 4W9CA 4ZH4A 1OXJA 4I2CA 3AE6B 3HUIA 4L2YA 1A6SA 2BPSA 4YTPB 2MHJA 4RM8A 3OGUA 2JXJA 4IC7B 2KVZA 1HIWA 5L95C 2VH2A 4F2SA 1X9SA 4A55A 4DWFA 2EMTA 4LCDE 4B9UA 3NVWA 2PVOD 1WGDA 4I2FA 1WGGA 3OJUA 3TANA 3JPOA 1JX4A 2LGYA 4P4PA 4P4OA 1WJ6A 2B3AA 2GBRA 2RRDA 1DK2A 1P7EA 3QX7A 8ICMA 1T8EA 1KF6B 1CEZA 4RQNA 4YXDB 3RMKC 4GDKA 1NJWA 1J7BA 4QZ9A 1U47A 2IO0B 1OW5A 5HG2A 4DHJB 2Y9TA 4I2HA 3VUXA 4A8XC 4F4YA 1KH0A 2A3VA 4K4IA 4O9MA 1FMAD 1TJEA 1ZQLA 4C7ZA 1H38A 3DBLI 2G06A 2AQ3B 1D6EC 1L7OA 4F8RA 4IM2A 1WXQA 2RLTA 2GLSA 2J42A 3SFEB 4DSLA 5KG7A 1YZ6A 4JUZA 5F9NA 1HTQA 2AL6A 2G3QB 2ZW1A 2ZEQA 2IY0B 1V1PA 5DLFA 3OLMD 4O5CA 4KLLA 3PZDA 3RNAC 3GILA 9ICEA 2KTFA 2PTLA 2WDTB 3RH6A 2LI5A 3BY4B 4RGOS 2PW9A 3VRAB 9ICUA 2AGQA 1XEEA 2RP5A 2P66A 1SKRA 4RNNA 4F92B 2KP7A 4RQ6A 1SEBD 1TV9A 4BKGA 1C3TA 4AUQC 3SV4A 4BBNF 2I1JA 2IJ0A 3J9CA 5KFXA 1MA7A 2OJRA 2KWDA 2WXRA 4MFFA 2KDIA 2FE9A 1SWVA 2EAOA 2G5HB 3QUQA 1I4HA 3NZ3A 3VUYA 2AQ0A 5KFJA 3HJEA 1TKGA 3PSEB 5AKJA 2V4QA 1KTKA 4RH6A 4UDUC 3BQTA 3SV3A 1GB1A 5IINA 2BQQA 4WIPA 3RT3B 3H0RB 3RJJA 4RZRA 3Q8RB 2AXTU 3LDAA 8ICVA 3BDPA 3KWLA 2KSOB 4OJOA 2MSNA 2WB1F 1XSPA 2JSVX 5ALFA 5ALNA 4YR3A 4DSJA 2ZPYA 4UBCA 3TFRA 3KZXA 5CP2A 4J9MA 4ICVA 5DG8A 3ZD9A 2XVTA 2LM4A 1MVKA 4Q45A 2VA8A 3UXPA 2INNE 1ZQJA 2LHTA 2D3GA 1V8CA 2EH9A 4Y2SA 3OSNA 3IDWA 2K39A 1ZQFA 2GBKA 3F2CA 1JWUD 2ZIVA 2DYBA 3RJKA 3C23A 3ZNHB 4BBNC 2PKEA 2C7HA 3PRZA 1WFYA 4YR0A 3B2GA 1TGZB 3PZPA 1X9WA 1E8YA 5IOIA 3T3FA 2JEFA 3L13A 4I6NB 1NNLA 1P7DA 1ACCA 4FA6A 4ELVA 2R2QA 4EEWA 4ED0A 2PI5A 1K5OA 4LZGA 4IRDA 3AV8A 3PRMB 1SXDA 4HRSA 5E6JA 5JHAA 5TSSA 2ZIWA 4ED1A 1D5MC 2FUHB 1CRXA 4ZRKA 3VRBB 4WQMA 2JQRB 2YMQA 4PYZA 5BYRA 1PK1A 2CRXA 8ICIA 2GBNA 1Q1OA 3ML9A 3QUCA 2O6KA 3IVFA 3NS8A 3AEGB 3HKZC 3J81j 7ICGA 2GOLA 5HHIA 3VAWA 2ZTCA 1D5XC 3IBEA 8ICXA 3V62A 4EE2A 1AN8A 1I35A 4B9VA 1COKA 2YN4A 2D3BA 4Z6EA 3OG5A 2HI0A 3HP6A 1MC8A 1D8YA 4P1CC 2PMZF 3TUOA 1L6NA 1XD3B 2AX5A 4F1SA 3MFHA 2HJ1A 4QZAA 3TADA 4KSLC 3RNCC 4C4TA 1F44A 2R8JA 3S2AA 4QZCA 1XC9A 1ZXIA 4GC7A 4CF3A 2C7MB 4JX1C 1R4MI 4P16A 5LLIA 2BCRA 4OJLA 1QOFA 2MBOA 3IT4B 1EXNA 2B76B 3PO0A 2ASDA 2XCPA 3FYHA 3UQ0A 1HA5A 3HM6X 1I42A 1TY2A 3AEFB 1LV5A 2BGFA 1ZQGA 3QUBA 2RR9A 1RZTA 1QQ6A 3H7PB 3HX0A 1YN5A 4YMNA 4M00A 4W9IA 2KVCA 9ICXA 5HFYA 1ZQMA 1QOAA 4PYUA 1PDXA 4RQ0A 2GOWA 2PFNA 2KNJA 4AP9A 4O3MA 5KG6A 3F2BA 1WY8A 7ICKA 2WU5B 1V2YA 2MCNB 2OCEA 4KGTA 1QH9A 2O6VD 2KACA 3ZNGC 1WXVA 3RFZB 1FEZA 1WE7A 4Q8FA 4BDPA 2LXAA 4QWAA 3O13A 2EKIA 7ICHA 3CP8A 5H8YE 3N9YC 5KL8B 5ALVA 3PW4A 2D6FC 2NTSA 1WI0A 1VD2A 2YEPB 1FFVA 4HROA 5KFVA 4KVGB 4UAUA 3SQIA 3RD2A 2P35A 4RNOA 2KIWA 2EDUA 2RDJA 4P0QA 4CE6A 1V85A 4ZRQA 3RUIB 4WJQA 1UT5A 5KG0A 5DG9A 2W9CB 4LTUA 4PZNA 4CGZA 4RNAA 3DBRB 4M9NA 4R3DA 1SJED 2RGFA 4A90A 1HE8A 2B0CA 1L2NA 1ET6A 4KLMA 4RPZA 3GV8B 2J0KA 4M47A 3DDCB 4LNKA 1B0XA 2K4IA 5AM2A 3OHBA 1UUPA 1DXSA 1XLQA 3UINB 5CRXA 2N9LA 3EC8A 3UI3A 2JX5A 2KJ6A 3LK9A 1MG8A 1ISNA 2F77X 4RQ7A 4M01A 3WK8A 5KG5A 4TQ0A 4PJ0U 1TAQA 3FAHA 5J0TA 2O6VA 3GFKB 2R8KA 4NLCA 2HHSA 5KFKA 4OO1J 2BB5A 2QCZA 1X9XA 3U4EG 4F2RA 2KDEB 4ASWC 4LVSA 3HKZF 3HVDA 1UPHA 1Z4OA 5KFAA 3A1QA 4LDTD 3T5LA 3H7IA 2O2VB 1I4QA 4KLUA 1WE6A 2I9GA 3BVZA 5AUIA 1AWDA 1ZQNA 2F1HA 2W8LA 4FZMA 1Q0WB 3H8MA 4IQVA 4Y2PA 4GLXA 1WGRA 1WWUA 1WZ0A 4GXIA 1BXTA 2KANA 1WH3A 5ALMA 1NEKB 2FNJB 1FXTB 2DFLA 1F2RC 4XA5A 5BMIA 5AM4A 5DKWA 2L1AA 1B22A 2MAXA 5KFCA 3GIJA 2IO3B 2QB1A 5AM5A 1PZNA 4I6LB 2XBBC 4IWPA 5ALWA 3V61A 3F5EA 3Q14C 1S0OA 3IRUA 3V6KA 1BPXA 2KMMA 2KG5A 1CK1A 1TT5B 3KYCD 3WKEA 3FM9A 3RJFA 8ICPA 1L6VA 1SZPA 3VTUA 3RCZA 4G3XB 4BKSD 4G11A 3V72A 3Q3JA 1DOYA 2D3AA 4DSEA 4AQ7A 2PLPA 5EWEA 3AE7B 5AM1A 8ICHA 3PVLA 3ZJVA 3SR6A 2I2YA 1S0MA 3OAWA 3NJTA 4HKZE 2A1JA 3PW7A 1M94A 2E3TA 3PLVA 2ES6A 3SZ2A 2CR5A 4RFBA 2RPVA 4NLNA 2IOFK 1T0QC 4KX5A 5AI6A 1MPEA 2PEAA 2BB6A 3Q8LA 3PNCA 3ISBA 2V3NA 2D3DA 4YFKA 4RUAA 4M6WA 3Q3MC 1BNPA 3DVGX 1UGJA 1QQ5A 1RFAA 1YX5B 3GIMA 2LASA 1FXIA 2D5GA 3UF8A 2BHNA 3T9LA 3ZGZA 5KFIA 2JXXA 1IUEA 3CF6E 4EX6A 2DAJA 4UQGA 1Z1VA 4CNQA 3V3XA 5ALRA 1FO4A 4LNOA 4EBDA 1SE3A 2QIEB 1NI2A 2AGOA 1X9MA 1O03A 2DQNB 4EZ9A 2WXPA 1U4BA 2I38A 1E0ZA 1JRPA 9ICFA 4W9GA 5HR6A 2WF8A 4IDIA 1TE2A 2FPKA 4B9SA 2PE9A 2X38A 4ANXA 5J2CA 2ZVNA 5DB6A 1H4RA 5D49A 2JR5A 4YMOA 3QHTA 3ENEA 3AQEA 1SSNA 1Q3UA 2DGZA 2NRTA 4OJ5A 5KHOA 2LZ6A 2CXYA 4YQWA 2MWSB 1NK0A 2W9AA 4HCNB 1L7PA 1XS9D 3RPFC 3IG8A 3X0WA 1MHXA 3QJZA 4NJ8A
chains in the Genus database with same CATH topology
4RF1A 5EE1A 3NUHB 1PGAA 4DXFA 4KGRA 1MI0A 1AW7A 1CJEA 4IKGA 4RF0A 1L0VB 5AUKA 1ZE3D 1PUTA 4KGSA 4RCOA 4MM3B 2ICIA 4ARIA 1VRAB 3U52E 2K0PA 1L5PA 1DOIA 2Z8LA 1CZPA 5EE0A 1SIJA 3P4SB 1PGXA 2K9XA 1B9RA 3P4PB 1JWAD 3AH7A 3MFGA 1UNSA 3P63A 2BTEA 2W3SA 1SF0A 1B1ZA 2ZW0A 3AE5B 3W9CB 2DYMA 3MC0B 2MH7A 3P4QB 3BZDB 3Q8AA 4YTNB 1OFFA 2QMTA 1ESFA 1EWCA 2DBYA 4J3OD 4DXGA 4OZCA 2W82A 5JXVA 3AEEB 4ITKA 4C80A 2DYOA 2WDVB 2L83A 4JWUC 1I4XA 5FR3A 3U2SC 1J7CA 3B2FA 3MP9A 1TS5A 1IGCA 3Q8FA 1GOZA 3B9JA 3P4RB 2W3RA 2OHFA 2KAJA 4US9A 1Q10A 2VZKD 4KKIA 1YJJA 2JU6X 2WXNA 2NMQA 2WDQB 3R2TA 1FIQA 1N5XA 2GRIA 1XLPA 2EELA 4TSSA 1HEZE 2IGDA 4PT5A 5T8IA 2Y5CA 3LXFA 5D3IB 1I7HA 4XDCA 1VR9A 3IAS1 4N59A 4XWTA 3ZYYX 2K22A 1F77A 5C2TB 2WDRB 2AQ1B 1TS3A 1YNTE 3PZ8A 4ZRPA 2JZPA 1EU4A 2WXKA 1PYWD 1JQ4A 1GPXA 1E6EB 2RDHA 1NYQA 1XO3A 3AM9A 1C78A 4H2AA 1HZ5A 1ET9A 1OQRA 5BMGA 2DLBA 1F0ZA 5EE3A 3AE6B 1QQRA 1VJKA 3HUIA 4L2YA 3U7ZA 4YTPB 3OWEB 3KLSX 1FRRA 1EM7A 1FNWA 3SFDB 1D4BA 4KX6B 2QILA 3ABVB 4M0WA 4ZHOA 4ARCA 1M4VA 1MHXA 5FKAC 1E9MA 4A55A 1TKYA 2IPKD 2QJLA 2QSDA 3KWVA 3NVWA 2PVOD 2V4IB 3TEYA 1FXAA 1P7EA 1KF6B 2FUG1 4RGTA 3ZQ4A 4YXDB 1TKEA 1J7BA 2K5PA 5HG2A 1FD6A 4A8XC 2XN9C 1E7PB 1KH0A 1FMAD 1VDVA 1T6BX 1TJEA 4C7ZA 1L0XB 1DOXA 3AEBB 1A70A 3URYA 2WLBA 2AQ3B 1D6EC 1KLGD 3I57A 3AECB 1NENB 5HI1A 4B0MA 1ENFA 1I4GA 3L4PA 1WXQA 2BW2A 2J42A 3SFEB 1MHHE 3CIRB 2ZW1A 1N5WA 2WXFA 1V1PA 1K53A 1L6UA 2PTLA 1OQQA 1XLNA 1EU3A 2WXJA 4RGOS 2PW9A 3VRAB 1XEEA 1YMHE 4YWGG 1SEBD 4XWWA 2J4XA 3HVZA 5FK9C 4B0EA 2IJ0A 3J9CA 2W54A 3V05A 1T5XD 1IGDA 4NAWB 2KWDA 2WXRA 1I4HA 3AE8B 3W1SA 4OZAA 1FRDA 3NZ3A 2WS3B 1IBXA 1K51A 1TKGA 3NVZA 1PFDA 5D7GA 1KTKA 4RH6A 1TS4A 4UDUC 1GB1A 1WSPA 1KFYB 1JWBD 2JWUA 3T3OA 2J53A 1I4RA 4WIPA 3R8BA 3FILB 4GDLB 1KRHA 2RDGA 1XCTL 4JE3B 2GB1A 1YN4A 3KWLA 3AEDB 1HXYD 2JSVX 4ZHPA 1R7SA 2M56B 3ETRA 2V3PA 2PKOA 2G9HD 5G5HA 2VZKB 4HEA1 2PIAA 1MVKA 3BYTB 3ZJUA 1QT9A 1TS2A 2INNE 1YQ4B 2ACZB 4WWMA 1LO5D 4A6QA 1BMLC 2LHDA 1TZOA 1V8CA 4FXCA 1DYQA 2MJEA 1JWUD 2OEDA 3TSSA 4MH8A 5EE9A 1QILA 1L0YB 1WWTA 1QOGA 1ZDVA 3AE1B 3B2GA 4C56C 4ZOHC 1ACCA 1HZ6A 1C4CA 2LEKA 3AB5A 3AV8A 4RGNA 2WQYB 4HRSA 5E6JA 5TSSA 2ON8A 1D5MC 1E10A 2Y5PA 3VRBB 3EA6A 2SEBD 2XNAC 4WQMA 5G5GA 2JQRB 3KQ4A 3CWIA 5BYRA 1YQ3B 1ROEA 2H89B 5HHDG 3AEGB 3P1MA 1SXTA 1WGKA 4L23A 3EUB2 1D5XC 5BMHA 4JWSC 2YEPF 4EE2A 1AN8A 3AN1A 3AE9B 4P6VF 2H88B 2BS3B 4JPSA 1Y56A 3HRDD 4O1NA 2L52A 4RGMA 4YSZB 4MT5A 1V97A 5BYQA 1CQVA 1N61A 4L1BA 3TUOA 3AE2B 2AX5A 3LYYA 1ZOYB 1FNVA 1V1OA 4OVZA 3PZ7A 2BT6A 1N63A 3ZJTA 2K3UA 3FILA 4WURA 1EWYC 1VLBA 2BYTA 1ZXIA 5I4DA 2BS4B 4JX1C 2GI9A 1UWXA 1C79A 3WCQA 4P16A 2WP9B 1WYGA 5LNK1 1QOFA 3GS2A 2NTTA 3IT4B 3PO0A 2B76B 1JALA 1JWMD 1HA5A 3SEBA 2WXOA 4ZYSA 2INPE 4TMAB 1JROA 3LB8C 1TYGB 2CU3A 1TY2A 2N7JA 2Y3AA 3AEFB 3C8YA 2MJDA 2N9KA 4OZBA 3MJ5A 2WU2B 1YN5A 4N6EB 1T3QA 1FFUA 4D2KA 5HFYA 1QOAA 2Q5WD 4Q2JA 2AQ2B 1JW9D 1PDXA 4YT0B 5C3JB 2N0SB 1SE4A 1UWMA 2LHEA 2WU5B 1C77A 2CJOA 4KGTA 2WNMA 4LLGM 2KACA 1GB4A 2R61A 3BVMA 3RFZB 1NYRA 3Q8EA 3O13A 2EKIA 1K50A 2PVGC 1FM0D 2WXLA 5H8YE 1C4PA 3N9YC 2NTSA 4NJCA 1C4AA 2MEKA 3P42A 2JYEA 2YEPB 1FFVA 4HROA 1XCQL 4ZRQA 4IOIE 4LTUA 4RNAA 4R3DA 4A90A 1SJED 2J52A 3T3NA 3DWMA 1DGJA 2LMCA 4NAMA 1ET6A 1RFKA 2RMMA 1V1PB 4LK0M 4A9AA 1BUIC 1AYFA 1D5ZC 1UUPA 4MACA 1QOBA 1XLQA 2N9LA 2JXTA 1VZ8A 2MJ3A 3UI3A 4YSXB 2IDYA 2KQ4X 4TQ0A 3FAHA 1L4ZB 3AMZA 4TQ1A 2V0GA 1XF5L 2WXIA 2BB5A 3U4EG 4REZA 3VQIA 5MPOA 1ZXHA 2WXGA 3AE4B 3Q69A 3HVDA 1NVID 3TEXA 1I4QA 5AUIA 3BVZA 1SE2A 1AWDA 4YTMB 1TY0A 2KDMA 1YN3A 1QF6A 1QKZA 1BXTA 2L32A 1FNUA 2LJIA 1NEKB 2BS2B 1F2RC 2CJNA 5BMIA 3GB1A 2SAKA 2M19A 3W2DA 2L1AA 3NS1A 1RWSA 4US8A 1C76A 4HJGE 4USAA 5D3DA 2ONQA 2HDEA 2IGHA 4NZLB 2KMMA 3BIID 1CK1A 1ZUD2 4WH4A 1L6VA 3VR8B 3VR9B 1C9FA 2DWQA 1QLBB 2FBWB 2FE8A 4AS1A 3NRZA 1DOYA 1STEA 3H8HA 4AQ7A 3MHZA 1N62A 2PLPA 3AE7B 3ZJVA 3SR6A 2I2YA 3BK1A 2E6XA 1YJIA 1J7AA 4HKZE 2JYTA 2LUMA 1JCKB 2E3TA 1SB3C 3NVYA 2G1EA 4XDDA 4RFBA 2RPVA 4C7YA 4OHJA 3BK2A 2W55A 1KLUD 3TEWA 1MPEA 3IXSA 1FCCC 1SJHD 2BB6A 3AE3B 2V3NA 2WXQA 1HQRD 3IT6B 1ZP0B 4GDKB 1NI3A 1UGJA 3FC4A 5BYSA 4WAFA 3BYYB 1FXIA 4N58A 4CQNA 2D5GA 4XE0A 2LFIA 3NVVA 3ZGZA 1XLOA 1IUEA 3GP7A 1FEHA 1JMLA 4GLSC 3V3XA 1RYJA 3W5VB 3TEZA 1FCLA 3Q8BA 1FO4A 1JWSD 1ZDXA 1SE3A 1VZ6A 2QEJC 2QIEB 2WXMA 3BVGA 3E56A 1RM6C 3R2IA 1IBXB 2HTME 2WXPA 5GXGB 2LGIA 2I38A 2PMVA 1E0ZA 1JRPA 3IAM1 3EGRA 4IDIA 2KN4A 2TSSA 2X38A 4DQOC 1F2RI 1ZPSA 1P7FA 1GAQB 3AEAB 3BWUD 3E9SA 1SBBB 4HKQA 1SSNA 1VZ7A 1N60A 1XXGA 2IGGA 4YSYB 3W5UB 3DWGC 1WRIA 3I9V1 3Q8CA 1K52A 2WXHA 1PGBA 1L4DB 4OW0A 5H92C 2BBCA 2M0AA 1I4PA 3RPFC 4KKJA 2JX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXA A;  5EE1 A;  2H89 B;  1KF6 B;  5MPO A;  4YXD B;  3AE4 B;  3AEG B;  1CJE A;  1NVI D;  1TKE A;  1J7B A;  1WGK A;  3P1M A;  2K5P A;  3EUB 2;  5AUI A;  1L0V B;  4JWS C;  1AWD A;  1E7P B;  5AUK A;  4YTM B;  1FMA D;  1VDV A;  3AN1 A;  1PUT A;  1TJE A;  3AE9 B;  4C7Z A;  2H88 B;  4P6V F;  1QF6 A;  2BS3 B;  3AEB B;  1DOX A;  1L5P A;  1A70 A;  1NEK B;  1DOI A;  2BS2 B;  2WLB A;  2CJN A;  1CZP A;  5EE0 A;  3HRD D;  3AEC B;  1NEN B;  2L52 A;  2M19 A;  4YSZ B;  1V97 A;  3L4P A;  1WXQ A;  1SIJ A;  3SFE B;  1N61 A;  3NS1 A;  2K9X A;  3P4S B;  3AE2 B;  1B9R A;  1RWS A;  4US8 A;  1JWA D;  2AX5 A;  3AH7 A;  4USA A;  3CIR B;  1ZOY B;  3P4P B;  3P63 A;  1N5W A;  2BT6 A;  1N63 A;  1L6U A;  2W3S A;  1SF0 A;  2KMM A;  1ZUD 2;  3AE5 B;  1EWY C;  1VLB A;  1L6V A;  1ZXI A;  3BII D;  3VR8 B;  3VR9 B;  3W9C B;  2DWQ A;  2BS4 B;  1QLB B;  1OQQ A;  1XLN A;  2MH7 A;  3P4Q B;  4JX1 C;  3WCQ A;  4YTN B;  3VRA B;  2FBW B;  2WP9 B;  1WYG A;  3NRZ A;  1QOF A;  1DOY A;  3PO0 A;  2B76 B;  1N62 A;  1JAL A;  1OFF A;  3AE7 B;  3SR6 A;  1JRO A;  3LB8 C;  1TYG B;  2DBY A;  1YJI A;  3HVZ A;  2CU3 A;  1J7A A;  3AEF B;  2MJD A;  2W54 A;  2E3T A;  1SB3 C;  3NVY A;  3AEE B;  4ITK A;  4C80 A;  2G1E A;  2WU2 B;  2WDV B;  2L83 A;  4JWU C;  1J7C A;  3AE8 B;  1T3Q A;  4C7Y A;  1FRD A;  3B2F A;  1FFU A;  2WS3 B;  4N6E B;  2W55 A;  1QOA A;  2Q5W D;  3B9J A;  3P4R B;  1TKG A;  3NVZ A;  1JW9 D;  1PDX A;  2W3R A;  1PFD A;  2OHF A;  2KAJ A;  4US9 A;  3AE3 B;  4YT0 B;  5C3J B;  2N0S B;  1YJJ A;  1KFY B;  1JWB D;  1UWM A;  1ZP0 B;  2WDQ B;  1NI3 A;  2WU5 B;  3FC4 A;  2CJO A;  1KRH A;  1FIQ A;  1N5X A;  1FXI A;  3KWL A;  4N58 A;  1XLP A;  3AED B;  1NYR A;  3NVV A;  1XLO A;  4ZHP A;  1IUE A;  2EKI A;  1R7S A;  2M56 B;  2PVG C;  1FM0 D;  3ETR A;  5H8Y E;  2Y5C A;  3LXF A;  1RYJ A;  1I7H A;  2PKO A;  3W5V B;  1FFV A;  5G5H A;  4HRO A;  1FO4 A;  4N59 A;  3ZYY X;  2PIA A;  2QIE B;  1RM6 C;  2K22 A;  5C2T B;  2HTM E;  1QT9 A;  2WDR B;  3CWI A;  5GXG B;  4LTU A;  1JQ4 A;  1YQ4 B;  1JRP A;  1E0Z A;  1GPX A;  2ACZ B;  1E6E B;  4WWM A;  4IDI A;  1NYQ A;  1XO3 A;  3AM9 A;  1V8C A;  4FXC A;  3DWM A;  1OQR A;  1DGJ A;  1GAQ B;  2MJE A;  3AEA B;  1F0Z A;  5EE3 A;  3AE6 B;  1RFK A;  5EE9 A;  1N60 A;  1VJK A;  3HUI A;  1WWT A;  4YSY B;  3W5U B;  3DWG C;  1QOG A;  3AE1 B;  3B2G A;  1WRI A;  4YTP B;  1AYF A;  4A9A A;  1FRR A;  4ZOH C;  3SFD B;  1QOB A;  1XLQ A;  3AB5 A;  2LEK A;  4KX6 B;  3ABV B;  3AV8 A;  4ZHO A;  2WQY B;  2MJ3 A;  4HRS A;  4YSX B;  1E9M A;  5H92 C;  1E10 A;  1TKY A;  2QJL A;  3FAH A;  3VRB B;  3AMZ A;  3NVW A;  2PVO D;  5G5G A;  4WQM A;  3RPF C;  2JQR B;  2JX5 A;  1YQ3 B;  1ROE A; 
#chains in the Genus database with same CATH topology
 2QLT A;  4IRC A;  8ICY A;  2HVI A;  4DDI D;  5ALI A;  4O3S A;  1L0V B;  3WAO A;  4B9L A;  4II3 B;  3D2N A;  4KGS A;  4MM3 B;  2ICI A;  4MGI E;  5BOM A;  1U48 A;  4E71 A;  1DOI A;  1YD8 U;  5EE0 A;  2ZIW B;  8ICE A;  4B95 A;  1KM7 A;  3P4S B;  1WR6 E;  5ALX A;  2K9X A;  2KN7 A;  1MSW D;  1B9R A;  5C0Y A;  3AH7 A;  2J0J A;  1Z4N A;  3MFG A;  3P63 A;  2D11 A;  2M0X A;  3MC0 B;  4A20 A;  1L3U A;  2IHN A;  1UHU A;  4OCZ A;  1S76 D;  2MA9 B;  4PGX A;  2MH7 A;  4DSF A;  3PHW B;  1EUV B;  1SE9 A;  2W9N A;  3IN5 A;  2HSZ A;  3UXO A;  2M9N A;  5DQI A;  1BPZ A;  3C2K A;  4NNJ B;  3ZUN A;  5C5J A;  2KDF B;  2IZV B;  1QZE A;  4K4G A;  4OZC A;  4XX5 A;  2OJW A;  2KFK A;  2GLE A;  5J2J A;  2L83 A;  2IBK A;  3B2F A;  2W43 A;  3RRG A;  4CF4 A;  8ICB A;  1TS5 A;  2LWP A;  4IQT A;  2YB1 A;  3KW5 B;  4QZB A;  3H7S A;  2JWZ A;  5J17 A;  3K75 D;  4F4K A;  2A4Z A;  3RH4 A;  3ML8 A;  2CKH B;  1OEY A;  1L7Y A;  3UXN A;  2WXN A;  3VHT C;  4I2G A;  2XEW A;  3MC8 A;  1FIQ A;  5KL1 B;  4MEX A;  1QSY A;  1SV0 C;  1MN8 A;  3M9O B;  2YY6 A;  4TSS A;  3RNF C;  1Z00 A;  2LVO A;  2PFO A;  2IGD A;  3R3M A;  4PT5 A;  4PGQ A;  4KLD A;  4XDC A;  4UB8 U;  3WIM A;  4MFC A;  1F77 A;  2L05 A;  4KLS A;  1WXA A;  2AQ1 B;  3PMN A;  4F50 A;  1TS3 A;  2KVR A;  4ZRP A;  4IR9 A;  2HHU A;  2R8I A;  2D10 A;  2WXK A;  3JYU A;  2XK5 B;  2ZCB A;  5AKH A;  1TIF A;  1HZ5 A;  5DB8 A;  3PML A;  5BMG A;  3F2D A;  3DVG Y;  2W03 A;  2RD0 A;  5EE3 A;  4MF2 A;  1F0Z A;  1QQR A;  1QCK A;  3VCB A;  3KZI U;  3C2M A;  3KLS X;  2KV2 A;  1FRR A;  1EM7 A;  2ZTD A;  2JHD A;  1WR1 A;  4KX3 A;  3SFD B;  4C8M A;  4KX6 B;  5ALU A;  3C28 A;  1DK3 A;  5IP4 D;  1E9M A;  3KWV A;  5GTH U;  3TCA A;  2LKY A;  1L7N A;  3TEY A;  1LKY A;  3C29 A;  2ALZ A;  4GIV A;  4G9B A;  5J2E A;  3VH3 B;  1C1Y B;  3ECI A;  4RGT A;  4S0R A;  3QK0 A;  4F5N A;  4B9K A;  3B0Y A;  4J9R A;  4RNM A;  2K5P A;  1JN3 A;  5TZV A;  3ZTD A;  2XN9 C;  4Y2R A;  3PO5 A;  3H9D A;  1T0R C;  1T6B X;  2LJ5 A;  3ZI4 A;  4JV0 A;  4LJO B;  1DOX A;  2JZB B;  1SV4 A;  5AI5 A;  3HIL A;  2WLB A;  1SV0 A;  4C4S A;  3RR8 A;  3AEC B;  4B0M A;  1I4G A;  3L4P A;  3KHG A;  5EOZ A;  1ZQA A;  3ETL A;  2MBH A;  2GO7 A;  2D3C A;  4HPL B;  4M9G A;  4EZ6 A;  4HK2 A;  3H0L B;  2WXF A;  1RQL A;  1K53 A;  3DEE A;  3MGI A;  4KLJ A;  1OQQ A;  1XLN A;  1EU3 A;  1F1H A;  1V81 A;  2CN1 A;  4F4W A;  3I63 C;  3RRH A;  1YMH E;  2NCN A;  5L9X A;  4YWG G;  5J2B A;  2JY6 A;  2RHF A;  1SL2 A;  1NJY A;  4LJX A;  3MFI A;  4M8M A;  3DVN V;  5FK9 C;  1K1S A;  1ZQX A;  3MGH A;  3RB3 A;  1S10 A;  4KLI A;  4EX7 A;  4UBB A;  2J6S A;  1OEY J;  2GBM A;  2E8O A;  3DPD A;  4ECR A;  5AIA A;  4QZG A;  3AE8 B;  2HCF A;  3W1S A;  1FRD A;  2FCQ A;  4BVU C;  3WK7 A;  3KYD D;  2KEY A;  4A3O A;  3V6C B;  5AI9 A;  1IBX A;  2N9X A;  2G4S A;  4JMU A;  3K1R B;  4ED2 A;  5KT5 A;  2C7N B;  4C8K A;  1ZQQ A;  5J2D A;  4KMU A;  1KFY B;  2WX0 A;  3ZDA A;  4WAA A;  2L5Y A;  1I4R A;  2N9P C;  4M8N A;  2JZB A;  3LWL A;  1XCT L;  4JE3 B;  2LBO A;  2KTQ A;  1KJT A;  5DG7 A;  3AED B;  4PGY A;  1HXY D;  5J29 A;  5JUM A;  1WRD B;  2CU1 A;  1X40 A;  3GIK A;  2DZJ A;  2H3V A;  2R18 A;  2F44 A;  1R7S A;  1LFD A;  2M56 B;  1UCV A;  2ZTE A;  4I6P A;  2DUY A;  4GMV A;  4DBG A;  2PKO A;  4BUG A;  2G9H D;  4FBJ B;  3A9K A;  3BS5 B;  4HEA 1;  1WWV A;  4DFK A;  2HBL A;  5ALL A;  3BYT B;  4ELT A;  1QT9 A;  3ZJU A;  1TS2 A;  4ZRI A;  3KVF B;  2LXC A;  1CUK A;  3GE3 C;  3RBD A;  4DF8 A;  3WAM A;  3ZDT A;  4IQW A;  4A6Q A;  5KG3 A;  2LHD A;  3GV7 B;  4HDQ A;  1TZO A;  4FS2 A;  3H40 A;  1KSP A;  4AOF A;  5AK4 A;  2N1W A;  3R7R A;  3EPG A;  2MJE A;  2KMA A;  4DQI A;  5CTR C;  2LM1 A;  1WWT A;  3QX1 A;  3Q6B A;  1ZDV A;  1ZJN A;  2KN5 A;  5ALK A;  4C0Z A;  3N30 A;  5D94 A;  4TUR A;  1C4C A;  2NBV B;  1OTR B;  3M6K A;  5J0S A;  4NJ6 A;  2ON8 A;  3A0B U;  3MDA A;  9ICS A;  2Y5P A;  5HML A;  3KQ4 A;  4R63 A;  1YQ3 B;  4EZL A;  1KFS A;  4ECZ A;  3EW9 A;  5HHD G;  3KBB A;  1WCL A;  3P1M A;  2BQU A;  4IM0 A;  3EUB 2;  3ZO5 B;  2VH1 A;  4F91 B;  4AWJ A;  5KT2 A;  4WJ3 B;  4DEZ A;  4XYC A;  4FAD A;  3AN1 A;  2ZIU B;  2E8P A;  4MEY A;  4P6V F;  2K4E A;  2IOH A;  3DHG C;  3RAQ A;  4NY0 A;  4ANW A;  3JPQ A;  3RFA A;  4IUM B;  1Y56 A;  3HRD D;  4O1N A;  2L52 A;  4RGM A;  4MT5 A;  2WFA A;  3E2E A;  4Q43 A;  2XO7 A;  1U4A A;  3TAQ A;  2NS5 A;  3QIJ A;  4IG7 B;  4JB3 A;  1O08 A;  4FZN A;  1NJZ A;  2RQ5 A;  2W8K A;  1X1M A;  2HW3 A;  1FNV A;  1V1O A;  4OVZ A;  3PZ7 A;  5CHV C;  2KTR B;  1IIP A;  1VLB A;  2BZF A;  3CYM A;  3APF A;  5I4D A;  4QWD A;  3CNH A;  2GI9 A;  1UWX A;  3K1Z A;  3WCQ A;  5KFZ A;  4ED8 A;  4IL6 U;  9ICR A;  1NZP A;  3KD3 A;  4F93 B;  2NTT A;  3L10 B;  5DPS A;  9ICV A;  2KLG A;  1ZD5 A;  2WXO A;  2INP E;  3LB8 C;  4GXK A;  2CU3 A;  4K7S A;  3SEI A;  2ZNV B;  1S97 A;  1IYF A;  2KQS A;  2WU2 B;  3R7Q A;  1MFW A;  4CRX A;  2KHW B;  3GU3 A;  5ALT A;  4KLE A;  4NL9 A;  4GIB A;  4MSQ B;  4BKT A;  4U6P A;  4J9N A;  5IIL A;  3WAL A;  1LKY B;  4C4V A;  2FLN A;  1JW9 D;  2KE7 A;  3RTV A;  1IG6 A;  1FPY A;  2N0S B;  9ICG A;  1JXE A;  2K8H A;  4WWO A;  4II2 B;  2PFP A;  2QDF A;  3APD A;  4JL9 A;  3B1L X;  4NWI A;  2Z59 B;  2WNM A;  4LLG M;  1GB4 A;  2MA1 A;  1WX9 A;  5G55 A;  3NZU A;  4P1B C;  3WKA A;  3QWZ B;  5AKY A;  3KHH A;  1NYR A;  5IAA C;  4MJS A;  4TUS A;  1B43 A;  3D6J A;  1RYR A;  2IY1 B;  5IIM A;  2WXL A;  4RM9 A;  1UT8 A;  3ZVV A;  4DOA A;  3P42 A;  1LM8 B;  3OJ3 A;  3WU2 U;  3MR2 A;  4Q44 A;  4IOI E;  2OH2 A;  3JPS A;  2ZPN A;  4PHP A;  1RXV A;  1WJ4 A;  4WWN A;  5DB9 A;  1RQN A;  1KFT A;  2BF8 B;  1WZ3 A;  4LZD A;  3N1Y C;  1KN5 A;  3QXG A;  4DFP A;  3DWM A;  3C21 A;  2M17 A;  3GE8 C;  5IO9 A;  2Y9U A;  2HHT A;  4ZRJ A;  3X23 A;  1NK5 A;  5AK3 A;  1LXD A;  4J03 A;  4ICA A;  3UMC A;  5JTI A;  1D5Z C;  1R4M B;  2HOI A;  5T14 A;  3BJY A;  2FMS A;  3ZD8 A;  5AM0 A;  3KHL A;  1WM3 A;  5ALG A;  3RN9 C;  4JGH B;  1L4Z B;  1UEL A;  4C4R A;  8ICN A;  1Z1B A;  2G0A A;  3JPP A;  4REZ A;  2YMP A;  1S77 D;  2O6V B;  4DQR A;  5MPO A;  3AE4 B;  2P6R A;  3KUZ A;  3Q69 A;  1NVI D;  8ICF A;  4MGY E;  5AKK A;  8ICA A;  2BCU A;  3LVV A;  1ZD3 A;  4WJO A;  1KLN A;  4EFO A;  1QKZ A;  2L32 A;  3WK5 A;  2BS2 B;  2ZIV B;  1S0V A;  2AJQ A;  4UB3 A;  3OSP A;  3W2D A;  2KJR A;  4GB9 A;  4WQO B;  4FJY A;  4US8 A;  1C76 A;  8ICU A;  4USA A;  1DRG A;  1WXS A;  2ONQ A;  3C2L A;  2HDE A;  2DZI A;  2IGH A;  4F8C B;  1ZUD 2;  3HW8 A;  4WH4 A;  2KIC A;  5J0P A;  3VR9 B;  5D4B A;  2DZM A;  3BS5 A;  3CST A;  2FBW B;  4M9L A;  5J0O A;  9ICW A;  3NRZ A;  3NZS A;  2ESE A;  4JWN A;  3H8H A;  2ZXH A;  3MHZ A;  1QLN A;  2AWT A;  4HPM B;  4F5P A;  2KSO A;  1OGW A;  1X6J A;  3ED5 A;  4BX9 C;  4EYI B;  5KNI A;  4RPX A;  3RB4 A;  2LUM A;  2C60 A;  4J9K A;  2K6Q A;  3T8M A;  3NVY A;  1YIW A;  2GBJ A;  4XGA B;  2BCS A;  1JUD A;  4BFR A;  4ZDV A;  5L1K A;  9ICL A;  1QTM A;  1XSN A;  4URK A;  3BK2 A;  2W55 A;  4NLK A;  2YQE A;  2KZZ A;  3SHQ A;  2PMZ C;  2RDI A;  4OVV A;  3HPO A;  3SI8 A;  3TIX A;  3N1Z C;  3IT6 B;  1ZP0 B;  1UD7 A;  5ALZ A;  5AKG A;  1KL9 A;  1TK0 A;  5CHF A;  1ZD2 P;  4TUP A;  2JGA A;  2PXI A;  3BYY B;  4FBT A;  2CHZ A;  3SYZ A;  3ZRF A;  4N58 A;  4XE0 A;  3N97 B;  2LFI A;  3NVV A;  4BXO A;  1XLO A;  1X2I A;  4NQL B;  2H3Z A;  4QAY A;  1D8B A;  2BQ3 A;  4GLS C;  2HDO A;  1ZQS A;  1V5O A;  3SDL C;  3E56 A;  2QEJ C;  2KXJ A;  3WK6 A;  2C22 A;  4EBC A;  2L3Z A;  2LGI A;  3M63 B;  3TFS A;  2TSS A;  1WIA A;  3JVZ X;  1CI4 A;  1ZPS A;  1TBE A;  1P7F A;  3TAD C;  3M8S A;  5AM3 A;  5L1M A;  3E9S A;  1SBB B;  4HKQ A;  4RUC A;  1N60 A;  2IOF A;  3HHM A;  1RPL A;  5BO4 B;  3M7D A;  3PX6 A;  1R4N B;  1WRI A;  2K8C A;  2ZJ5 A;  3EPI A;  3H6N A;  4PHA A;  1H8C A;  1UA0 A;  3V7J A;  2HHW A;  4IWO A;  3HWT A;  4IWQ A;  2LGD A;  1WGY A;  4P7I A;  3RH5 A;  2R8H A;  2ZG6 A;  2G45 B;  5HNK A;  4RF1 A;  4UB5 A;  5EE1 A;  1TTN A;  3TAP A;  2KX0 A;  4DXF A;  1ZQC A;  2C2R A;  4QZE A;  3C1Y A;  1CJE A;  4C00 A;  2NYV A;  3ZDB A;  5HKH A;  3AU6 A;  4IKG A;  4ACO A;  2XI9 A;  4F3O A;  2A1J B;  2NRX A;  4ECW A;  1YX6 B;  1L3V A;  2CS4 A;  3GV5 B;  2ISP A;  4ICU A;  4DCC A;  2C9W B;  3ORY A;  1C20 A;  2K0P A;  3RZW C;  4KN7 A;  1J2M A;  1HUZ A;  3NTU A;  4NLG A;  3C19 A;  1WJN A;  3QYP A;  4W9F A;  4NLZ A;  4F72 A;  2LRW A;  1F5S A;  2WF7 A;  3DBH I;  1DGS A;  1JWA D;  2KOX A;  5E6N A;  3BQ0 A;  2D8C A;  5CJ7 A;  2BTE A;  3PX4 A;  5J0Q A;  3W9C B;  1KRP A;  3MC9 A;  1SL1 A;  1BPB A;  3Q3N C;  3P4Q B;  4DS5 A;  4YTN B;  2PPH A;  3L08 A;  5DCN A;  4FJV B;  3PV8 A;  5ALP A;  5IIJ A;  2CPR A;  2WB1 C;  3F5A A;  5B66 U;  2DNF A;  1Z3E B;  3QAR A;  4NM2 A;  2W04 A;  2W82 A;  1T94 A;  4Y2T A;  3EEC A;  4LNN A;  2UVW A;  2W9M A;  4GOC A;  1J7C A;  2VA2 A;  2E1F A;  4UAW A;  1ZOL A;  4UAZ A;  5L1L A;  3DBS A;  1IGC A;  9ICM A;  4DHZ B;  3S6J A;  2H3F A;  1PK1 B;  1N2X A;  2W3R A;  4US9 A;  1Q10 A;  3WAN A;  4Z6C A;  1QQ7 A;  3W1Y A;  4R8U B;  5CA7 A;  5DDY A;  3R2T A;  3NAS A;  4BAX A;  5DBA A;  3K4G A;  3OTQ A;  3TMP B;  4P0Q B;  4YD1 A;  4EEY A;  2E5S A;  2HD5 B;  4M2Y A;  3QE9 Y;  4MEL A;  1P0R A;  1KOT A;  2Y5C A;  4M6W B;  1I7H A;  3UMG A;  2KOB A;  1L7M A;  3M6Z A;  4N59 A;  1ZQP A;  2R8G A;  2KDB A;  4M0W B;  3ZYY X;  4F7Z A;  4MM3 A;  1D8L A;  2FDR A;  1JMS A;  2XK5 A;  1SIF A;  5C2T B;  1PUZ A;  2GH1 A;  1E8W A;  3T5J A;  4J9S A;  5H2F U;  2JZP A;  2ATL A;  2HHX A;  3OPX A;  1E6E B;  1HJP A;  1V86 A;  3AM9 A;  1XO3 A;  2MLB A;  4H2A A;  1ET9 A;  5BPC A;  3ZTC A;  3T5H A;  4FN2 A;  4DXA B;  2ZUC A;  3H8S A;  1FNW A;  3Q8P B;  3GDX A;  1XQQ A;  3M1Y A;  2QIL A;  5CHG A;  4M0W A;  3A33 B;  7ICV A;  5AIC A;  4ARC A;  5FKA C;  8ICG A;  5CB1 A;  3A1Q B;  5DGB A;  5EWG A;  2ASL A;  2IPK D;  3UIP B;  2P6U A;  2QSD A;  2FIF A;  2V4I B;  2JZ3 B;  5KFW A;  3G6Y A;  2V4R A;  1YOV B;  2NPT A;  4J9O A;  3ZXV A;  4PK1 A;  3APC A;  1FXA A;  1HUO A;  5J8Y A;  2FUG 1;  3RJG A;  2HVH A;  2YLM A;  3RYT A;  3ZQ4 A;  4ANU A;  1G6J A;  1NBF C;  4ECV A;  3HM3 A;  3WK9 A;  2KO3 A;  2BYV E;  4DL6 A;  1FD6 A;  3FDS A;  2VJ5 A;  4AJW A;  5KFY A;  4BWM A;  8ICK A;  2IO1 B;  1N56 A;  4F5O A;  3G6X A;  4QZD A;  3AEB B;  1A70 A;  3URY A;  4RQM A;  3I57 A;  1KLG D;  3N7R C;  3VC8 A;  1GNU A;  2ZVO A;  1NEN B;  5HI1 A;  1E7V A;  2KHV A;  1WX7 A;  1RAX A;  2ZUB A;  4NQK E;  3V7K A;  1MHH E;  2JV3 A;  3CIR B;  4GGQ A;  3ZNI D;  5LXH A;  1L6U A;  3MGV A;  3MAB A;  4DL3 A;  3N1X C;  4Y2U A;  3PS6 A;  1A77 A;  2QB0 B;  3PSP A;  3QU5 A;  1ZRM A;  3BQ1 A;  4B9M A;  1S5L U;  4QZI A;  2WXJ A;  2XY7 A;  3RZF A;  5ALY A;  2LMR A;  2H3Q A;  3DDH A;  4FFD A;  2N1V A;  3L54 A;  3FKY A;  4B0E A;  3M95 A;  4I2E A;  3V05 A;  1T5X D;  1IGD A;  1SWW A;  2Y0S C;  2ZJ8 A;  4M02 A;  2LYB A;  3SD7 A;  2BYF A;  4XQ8 A;  3JPT A;  1SZH A;  4B9N A;  3DHH C;  4NM1 A;  8ICW A;  2WGS A;  1K51 A;  3NVZ A;  2F76 X;  5DQH A;  4O5K A;  4B9T A;  3OJ4 B;  2BKF A;  4ED7 A;  4OJ6 A;  1WSP A;  1JWB D;  4QNL A;  3E0F A;  2JWU A;  2J53 A;  2DPJ A;  4KTQ A;  3R8B A;  4J9L A;  1KRH A;  2RDG A;  5KFB A;  2VAN A;  9ICN A;  9ICP A;  3IFW B;  2BKR B;  4K7W A;  1UGM A;  4W9J A;  1MJD A;  1XT9 B;  1KLV A;  4ZHP A;  3MJW A;  2VRR B;  2ZUD A;  3GZN I;  3ETR A;  2V3P A;  5B5E U;  2AYO B;  2K1F A;  1UF0 A;  4ECS A;  5G5H A;  1T0S C;  2HHV A;  2EAM A;  1ED1 A;  2PIA A;  4DQS A;  1A0P A;  4O3P A;  1BVS A;  5ALS A;  3MR3 A;  1U45 A;  5AI4 A;  4UB6 U;  3AEV A;  1F52 A;  3C1Z A;  2D2Q A;  1M6Y A;  3M62 B;  4J6I A;  2YX8 A;  4O0I A;  4MFA A;  1LO5 D;  2JEG A;  1DOQ A;  4IR1 A;  2ACZ B;  7ICP A;  1V6E A;  3VTW A;  3L17 A;  2KZR A;  4FXC A;  3AQF A;  4G50 A;  1ZQV A;  1IV8 A;  2F3N A;  8ICZ A;  4Z6F A;  3TSS A;  4MH8 A;  5EE9 A;  1GC7 A;  1L0Y B;  2ZCC A;  2WHE A;  5A0L A;  2A5U A;  2ISO A;  9ICH A;  1RXW A;  2LVP A;  4ZOH C;  1GUA B;  2UVU A;  1HZ6 A;  3BIN A;  3AB5 A;  4MEM A;  4RGN A;  1SXE A;  4UAV A;  5J2R A;  2VKQ A;  2EZZ A;  4BOZ B;  1E10 A;  1S0N A;  5AKX A;  2XNA C;  1ZQY A;  1YT3 A;  5G5G A;  1OUQ A;  4KLH A;  4GSW A;  4RT2 A;  2MRL A;  5AI0 A;  2C2D A;  1ROE A;  3JPR A;  4MGK E;  5HHH A;  4HJK A;  4KZ0 A;  5KFP A;  1NK6 A;  3DHI C;  4EEN A;  1S1Q B;  4MH0 E;  1NK9 A;  1GG3 A;  3B0X A;  2IND C;  3AXC A;  3U8Z A;  1WCN A;  5KFD A;  3PST A;  2UVR A;  4MHV A;  1KKX A;  1EF5 A;  4L23 A;  4KLG A;  2D07 B;  5III A;  5KG2 A;  2YML A;  2YEP F;  4I28 A;  2H88 B;  4NV0 A;  4J9Q A;  8ICR A;  5JH5 C;  4R64 A;  2MU2 A;  1T7P A;  4NY8 A;  2HTH A;  2ASQ A;  1ZRN A;  2L0F A;  1X42 A;  9ICQ A;  5BYQ A;  3V6H A;  5DB7 A;  1CQV A;  1N61 A;  4L1B A;  3AE2 B;  4XRH A;  3L3F X;  2FAZ A;  5KFG A;  5J0X A;  8ICS A;  3FIL A;  1TAU A;  1EWY C;  4WUR A;  2BYT A;  7ICM A;  2DL0 A;  1C79 A;  5DPT A;  5L83 A;  2L0T A;  7ICF A;  1WYG A;  2WP9 B;  3DBL B;  5DLG A;  2LYA A;  3ZRC A;  3GS2 A;  4J9P A;  2J0M A;  3WKB A;  4YD2 A;  1JAL A;  4K7U A;  3SEB A;  2I6X A;  2BR0 A;  4TMA B;  4QJF B;  3RJI A;  1JRO A;  2YTU A;  2KFZ A;  2Y3A A;  2MJD A;  2N9K A;  2KK0 A;  3MJ5 A;  4YVZ A;  1V49 A;  3C0R B;  3Q3O C;  1GO3 F;  2UYZ B;  3H4B A;  5J0R A;  2N1R A;  1XO1 A;  1ZW7 A;  4OVU A;  3U26 A;  2BWE S;  2V4L A;  4PHD A;  4YXJ A;  2KYW A;  2AQ2 B;  4Q2J A;  4HDO A;  5C1Z A;  1K8R B;  1J2N A;  9ICK A;  2KWU B;  5AKI A;  2XID A;  2LHE A;  2LUE A;  4DL4 A;  4R8U A;  2IYD B;  2NBW B;  2CJO A;  3QQ8 B;  5E6O A;  3NGD A;  1WM2 A;  3JSV B;  4WJP A;  1TAM A;  4FZL A;  2R61 A;  2MRP A;  3BVM A;  1SGH A;  3V7L A;  4RT3 A;  1WMH A;  2R2O A;  4JQW C;  5AZG A;  2PVG C;  2ZNV C;  1FM0 D;  4PH5 A;  4DF4 A;  3R9K A;  4KDL B;  3CMM B;  1C4A A;  2MEK A;  4JIO U;  2JYE A;  7ICI A;  2H5X A;  3EZ5 A;  3QCA A;  2YB4 A;  2BPC A;  4RQ2 A;  5HR7 A;  3A4S C;  2JUO A;  5L1I A;  1KQQ A;  3M8R A;  2HBK A;  2OYY A;  5ALE A;  2M4N A;  2DHZ A;  3IG3 A;  5KFM A;  2KHQ A;  2J52 A;  5IIK A;  4IRK A;  1XNS A;  5KAF U;  8ICL A;  3U30 A;  2M8S A;  1RLF A;  3VH4 B;  2LMC A;  4LNI A;  4NAM A;  5EDS A;  1RFK A;  4QWC A;  2BPF A;  5GMV A;  5ALJ A;  3PW5 A;  4UB4 A;  3IP4 B;  1PK3 A;  3N7P D;  2C2E A;  1V1P B;  4LK0 M;  1BUI C;  1ZQK A;  4NJ7 A;  4MGZ E;  4MAC A;  1QOB A;  2KC1 A;  2BDU A;  1T3N A;  2W9B A;  2JXT A;  2IDY A;  2KQ4 X;  4G0N B;  5J0U A;  1UA1 A;  4K81 A;  2V1Y A;  3AMZ A;  2W9C A;  3I28 A;  2V0G A;  1TKD A;  1XF5 L;  3D2Q A;  1MG4 A;  4O3R A;  2Q4T A;  3VQI A;  3W1S C;  3LYS A;  3A9K B;  2X8X X;  1ZXH A;  4MJS B;  7ICS A;  3RUL A;  4ACF A;  3QU7 A;  2M1M A;  4DO9 A;  3OHA A;  1S9F A;  1SE2 A;  4YTM B;  4C8O A;  3QAQ A;  2KDM A;  1QF6 A;  1L8O A;  2LJI A;  1FNU A;  2KK8 A;  4C8L A;  3M9M B;  2FCM A;  2B6G A;  2CJN A;  2KIV A;  3A9J B;  1Q46 A;  2M19 A;  4B6J A;  3B08 A;  4ED6 A;  5J2I A;  1RWS A;  2MUT B;  4HJG E;  2KNB A;  3RR7 A;  2DF4 B;  4CYE A;  5D3D A;  3DQV A;  2BDP A;  3SD5 A;  3UPQ A;  1NK8 A;  3WKD A;  4NZL B;  3BII D;  3KFU F;  3H4D A;  2DWQ A;  3NOB A;  3K9O B;  5KAI U;  4TQR A;  3AUO A;  1JI7 A;  1TK5 A;  3ZKJ C;  4AS1 A;  2QAR B;  2PE6 B;  1STE A;  2LVQ A;  5IKC M;  4AYB C;  1N62 A;  1NKE A;  3NHE B;  1B4F A;  3BK1 A;  3PPA A;  4M9H A;  2KWV B;  1YJI A;  3DOW A;  1JCK B;  4UAS A;  1BNO A;  3HIZ A;  1U49 A;  5L1J A;  2QB0 A;  2Y0S F;  1ZQD A;  4XDD A;  2OM6 A;  4I2B A;  2ASJ A;  7ICE A;  3L5K A;  1LB2 B;  4CDG A;  4P2H A;  4OHJ A;  1KLU D;  3RNG C;  3TEW A;  3ZDM C;  1FCC C;  2JVC A;  2ODG A;  3CW2 C;  2KC2 A;  4R66 A;  1LVH A;  3KKA C;  3I5J C;  2WXQ A;  4IM3 A;  4PS7 A;  4DHJ D;  3SAH A;  1JXL A;  1NI3 A;  5BYS A;  2KFK B;  4FUL A;  1WMH B;  4ECU A;  3LJ3 A;  4CQN A;  4E74 A;  5ALQ A;  4UAR A;  4HCP B;  1RG6 A;  3VVW B;  4IC9 A;  1C7Y A;  3GP7 A;  1FEH A;  3DBH B;  1JML A;  2M0N A;  1L5U A;  3RB6 A;  2KKV A;  2EQY A;  3PR5 B;  2REX A;  2WXM A;  2HMX A;  4FBU A;  3R2I A;  2AU0 A;  3PO4 A;  3PVX A;  4X5V A;  2HTM E;  3WA0 A;  2NPT B;  5GXG B;  2J6T A;  3I3T B;  2FPM A;  3IAM 1;  3EGR A;  4UAT A;  1KBU A;  2KN4 A;  4DQO C;  4QIW F;  2KD0 A;  1F2R I;  1K1Q A;  2KJ9 A;  2V3S A;  3THV A;  3ISC A;  2JH1 A;  3TI0 A;  4DSI A;  1NKB A;  3BWU D;  2J6U A;  4C4V B;  1VZ7 A;  2IGG A;  1WGH A;  3QZ8 A;  3M9N B;  3BQ7 A;  1GC6 A;  2KLC A;  3I9V 1;  2WXH A;  1TK8 A;  1L4D B;  5CWR A;  4OW0 A;  4RU9 A;  3MBY A;  3T79 A;  2MP2 A;  5J2F A;  4M04 A;  2L7R A;  2K8C B;  4OD0 A;  1SL0 A;  5H92 C;  1UQV A;  3TAR A;  1N6Z A;  2BBC A;  2HE7 A;  4F4X A;  3DBR I;  3R66 C;  2FMP A;  4KKJ A;  5EWF A;  2QC8 A;  4KZC A;  3PT2 B;  4FO6 A;  1V38 A;  3NUH B;  1PGA A;  1J8C A;  2F8L A;  2XGQ A;  1ZQO A;  4KGR A;  4TV3 A;  1WUD A;  1AW7 A;  4W9H A;  2KQ7 A;  3DVN U;  3L16 A;  3EWA A;  1N48 A;  4RF0 A;  3QNM A;  3KKA A;  4EZK A;  2ZIU A;  3G6V A;  2CHW A;  2Y1J A;  4I2D A;  3C5G A;  1PUT A;  4HXD A;  1KTQ A;  1RDF A;  4I2A A;  4RCO A;  2Y5B B;  5LXI B;  1OQY A;  3U52 E;  5KG1 A;  5FR6 A;  2Z8L A;  1CZP A;  3N4M B;  3HK0 A;  3IG5 A;  2NBU A;  4G3I A;  4NXZ A;  2ZZP B;  1ZQW A;  4DHZ E;  3P2B A;  4UW9 A;  9ICB A;  1UNS A;  2AEH A;  4N9F 4;  2WAQ C;  3RB0 A;  1E7U A;  2W3S A;  1B1Z A;  3PRE A;  1L3T A;  2W7P A;  3AE5 B;  2KT7 A;  3A0H U;  2LGX A;  4LNF A;  2QAR A;  4QW9 A;  3BZD B;  3ALB A;  4DS4 A;  2F2A B;  2MSE D;  5KT4 A;  2FLL A;  4P0P A;  2BWF A;  3H1U A;  4RQ8 A;  3ISD A;  2QMT A;  1ESF A;  1EWC A;  2F8K A;  2KKP A;  4DDG D;  4KIT B;  1J97 A;  2DBY A;  5JRT A;  4J3O D;  5JXV A;  3AEE B;  4ITK A;  4C80 A;  4X57 B;  4PHE A;  2WDV B;  5FR3 A;  2Z0D B;  5KFT A;  2XC9 A;  3SMV A;  2GMI C;  1QSL A;  3MP9 A;  4PL2 A;  2HJ8 A;  3Q8F A;  2QKQ A;  2JF5 A;  1GOZ A;  5J2G A;  2MBQ A;  7ICO A;  3P4R B;  2OWO A;  3SAG A;  8ICJ A;  2KAJ A;  2VZK D;  2FMQ A;  4KKI A;  4GC6 A;  2JU6 X;  9ICA A;  1XWL A;  2NMQ A;  5DDM A;  4KIK B;  1NK7 A;  2L8J A;  1N5X A;  2G5I B;  2I1Q A;  1HTO A;  2V9H A;  3PW2 A;  1XLP A;  4DFD A;  3N3K B;  2EEL A;  2FPL A;  1ZD4 A;  2C5L C;  4HVB A;  4QZ8 A;  1RRB A;  4Y2V A;  3T5K A;  5T8I A;  5D3I B;  2HHQ A;  3JPN A;  7ICQ A;  3IM1 A;  1VR9 A;  1Z5S B;  3IAS 1;  4XWT A;  2L00 B;  3GZF A;  4ZYN A;  1VCB A;  2K22 A;  4OJP A;  4MF8 A;  2XIC A;  2HBM A;  1PVQ A;  2KJ8 A;  1YNT E;  3PZ8 A;  2BGW A;  4JLC A;  2QHO A;  3M3J A;  2WAQ F;  5TIS U;  1JQ4 A;  3RJH A;  1GPX A;  4KIK A;  1P3Q U;  4P4M A;  2NRV A;  3PSF A;  2RDH A;  3ZDC A;  5ALD A;  1C78 A;  2G07 A;  4Y2Y A;  2KX3 A;  4EOY A;  4DOC A;  5AKZ A;  4DOB A;  8ICC A;  5KFF A;  1VJK A;  3U7Z A;  3OWE B;  3F53 A;  2RSU A;  1D4B A;  3AU4 A;  2JT4 B;  3ABV B;  1D3Z A;  4ZHO A;  4BKS A;  4Q8E A;  1F9J A;  1M4V A;  2W9B B;  4ANV A;  2AHO B;  2BVC A;  1TKY A;  1IM4 A;  4I27 A;  2QJL A;  1CMX B;  1A76 A;  4FLH A;  3C5F A;  4FHJ A;  1YJ1 A;  2ZJD A;  3NG0 A;  1P1A A;  5KTQ A;  5KT3 A;  3PRP B;  1TKE A;  4QZH A;  2JEJ A;  2UWQ A;  5J2H A;  2KMC A;  3ICX A;  4EUT A;  3Q8S B;  3A4R A;  2JPH A;  1Y88 A;  4GXB A;  4EEK A;  4KMO B;  2JH7 A;  1E7P B;  4I29 A;  3I1Y A;  1VDV A;  4UB1 A;  3GOE A;  1L0X B;  4I2I A;  1Q3V A;  5FP0 A;  4DQQ A;  1ARO P;  5J0W A;  4WJN A;  4C8N A;  1ENF A;  3V6J A;  2BW2 A;  2XCA A;  3TJP A;  2WF9 A;  1NK4 A;  2I1K A;  2KFJ A;  3MR5 A;  1KFD A;  2AH5 A;  3I76 A;  1N5W A;  4YL8 A;  1V5T A;  2BKE A;  2FI1 A;  2VIX A;  5JZE B;  1BT0 A;  1PVR A;  5F3X B;  5AIB A;  4XUS A;  2HOQ A;  3NY5 A;  2Q0Z X;  2KZ3 A;  4XWW A;  2J4X A;  3TQ1 A;  3UMB A;  3HVZ A;  3E58 A;  1NKC A;  4K1R B;  2W54 A;  4ELU A;  4EKU A;  5J18 A;  3KOO A;  2RDB C;  4NAW B;  4BWJ A;  2IA6 A;  5G2N A;  4OZA A;  2NO5 A;  3RBE A;  2WS3 B;  1L3S A;  2JEI A;  3AUL A;  2WF6 A;  1NDD A;  1PFD A;  5D7G A;  2KZM A;  1TS4 A;  3EHV A;  3T3O A;  4LJP B;  4DLE A;  2JRH A;  3FIL B;  4GDL B;  2OOB B;  1Z00 B;  2GB1 A;  3BQ2 A;  5IIO A;  1YN4 A;  3D32 A;  4W9L A;  4DLG A;  2I5H A;  5KFL A;  3PSI A;  4BZA A;  1UBQ A;  4CO7 A;  4YR2 A;  4YP3 A;  3UGB B;  4AP4 C;  2VZK B;  1KW4 A;  4F71 A;  3QU4 A;  4HLE A;  3V60 A;  2WYQ A;  5KFQ A;  3Q8K A;  5KFR A;  3B0A A;  5AKL A;  1YQ4 B;  3N20 C;  4WWM A;  4GXJ A;  1BML C;  2EMS A;  5DBC A;  2PFQ A;  2MW5 A;  5KT7 A;  1DYQ A;  5AEK B;  3PY8 A;  5CEH A;  4YXM A;  4RQ4 A;  2OED A;  3MR6 A;  2WF5 A;  1QIL A;  1QOG A;  4ECX A;  2K6D B;  3AE1 B;  4C56 C;  2MUT A;  2OXO A;  2LEK A;  2K60 A;  2WQY B;  5BOL A;  3RAX A;  1P9D U;  3A9J A;  3U7D A;  4E0D A;  3EA6 A;  2SEB D;  1L8L A;  1IPG A;  2INC C;  4RMA A;  4E3C A;  3CWI A;  1ZQ1 C;  2G09 A;  2N7D A;  2CHX A;  4CHK A;  3QEB Z;  2H89 B;  2KJ5 A;  5CR0 A;  3SEN A;  3LWM A;  2EAP A;  1SXT A;  1WGK A;  4EYH B;  2MP2 B;  2UU7 A;  3SU8 X;  1TVA A;  5J0Y A;  2G4D B;  5BMH A;  2K4P A;  2GWS A;  4JWS C;  3VUW A;  4M0A A;  1JRU A;  2K8B A;  5K4L A;  5DGA A;  1COO A;  3AE9 B;  1AQ6 A;  4DK5 A;  5IN7 A;  2BS3 B;  2BYE A;  2K25 A;  1IP9 A;  1V80 A;  5J2K A;  2E8M A;  4LDT B;  4JPS A;  7ICL A;  3GII A;  2MBB B;  5D2M B;  4YSZ B;  4PL1 A;  1V97 A;  2LI6 A;  2JRZ A;  5AI8 A;  1MQ3 A;  1ZQH A;  3GZN B;  3LYY A;  1ZOY B;  1NOM A;  5AHX A;  4DSK A;  3ZDE A;  2BT6 A;  1N63 A;  1AAR A;  3PHX B;  3ZIM A;  3ZW3 A;  2K3U A;  3ZJT A;  4TQS A;  3QZ7 A;  3Q3F A;  2BS4 B;  2FID A;  1BPE A;  3QU2 A;  5KFU A;  5J2A A;  1ZKH A;  5LNK 1;  3ALR A;  1E8Z A;  5ALH A;  5AK5 A;  2IMW P;  4AYB F;  5KT6 A;  1JWM D;  2F1J A;  5TR5 A;  4ZYS A;  3O0F A;  4DFM A;  1TYG B;  3EFC A;  1Q5W B;  3NRW A;  5DQG A;  3HT3 A;  2V9W A;  2MX2 A;  2N7J A;  3C8Y A;  4OZB A;  4JK1 A;  1EO6 A;  5F9L A;  4GDL A;  2EZX A;  1BPY A;  4N6E B;  1T3Q A;  1FFU A;  2G08 A;  4D2K A;  4A3P A;  2XGP A;  2Q5W D;  4FE3 A;  1JIH A;  2VJ4 A;  4RQ5 A;  1ZQR A;  1GJZ A;  4YT0 B;  5C3J B;  1ZQE A;  3PV1 A;  1WX8 A;  5GTI U;  1SE4 A;  1UWM A;  4KDI C;  2UVV A;  4Y2J A;  3BS7 A;  1C77 A;  5AK6 A;  1E90 A;  4QZF A;  2KMD A;  3UM9 A;  5J8Y C;  2HOF A;  4Y2Q A;  3RJE A;  4S17 A;  4PZO A;  9ICJ A;  4FHK A;  2J7Q B;  3Q8E A;  5KFO A;  3JSV A;  4EZJ A;  1K50 A;  4AJY B;  4KV2 A;  3CRX A;  1C4P A;  1E8X A;  4NJC A;  4JWM A;  1R4N I;  2K8A A;  3NUQ A;  1XCQ L;  2AQ4 A;  2AGP A;  3MC1 A;  2PJH A;  1ZQT A;  4RQ3 A;  3RNB C;  2YVC A;  4DFJ A;  3ONN A;  3QA8 A;  1ZJM A;  4GN1 A;  3T3N A;  7ICT A;  5KFS A;  9ICC A;  1DGJ A;  4HWI B;  1RYS A;  3ONS A;  3K9P B;  4R65 A;  3O65 B;  1XU4 A;  2RMM A;  2Z7J A;  2DEN B;  4A9A A;  4W9D A;  1SKW A;  1AYF A;  4EBE A;  2NRZ A;  2BQR A;  3H8J A;  1VZ8 A;  2KWC A;  2MJ3 A;  1BGX T;  5D6J B;  4YSX B;  1A5R A;  2RPQ A;  9ICO A;  2L76 A;  2KJH B;  2EZY A;  4DL2 A;  2FCN A;  4TQ1 A;  2NO4 A;  2WXI A;  5HMM A;  3L0W B;  4KLO A;  4P0P B;  3N28 A;  4A8E A;  2O2V A;  2ZIX A;  4KLF A;  2WXG A;  1XO0 A;  2Y1I A;  3CSF A;  1ECW A;  3TEX A;  3MHS D;  3OJS A;  2F1I A;  2LPE A;  2FJ6 A;  1TY0 A;  1YN3 A;  4U7C A;  3WK4 A;  1KEJ A;  4RQ1 A;  2DX5 B;  3GB1 A;  2SAK A;  4XZ4 A;  1ZQI A;  1U9L A;  5IA7 A;  4BXO B;  1V9P A;  3NS1 A;  1UH6 A;  1HEK A;  2EAN A;  2A1A A;  4DQP A;  1YQB A;  3ZLZ A;  4HAI A;  3VDZ A;  3IHQ B;  4K3C A;  3VR8 B;  3PX0 A;  4UB2 A;  1Z2M A;  4MDK E;  1QLB B;  1Q8K A;  1C9F A;  4HYK A;  4W9E A;  1NZB A;  2FE8 A;  4B6W A;  4KSK C;  4BGD A;  2BCQ A;  7ICJ A;  4W9K A;  4EEL A;  3PLU A;  3AU5 A;  3UQA A;  2JMG A;  3ZDD A;  1ZQU A;  2E6X A;  2W11 A;  2XY5 A;  1J7A A;  4O5E A;  4NL9 C;  2JYT A;  3AL0 B;  1SB3 C;  3ZNZ B;  4K3B A;  2G1E A;  2FLP A;  1LQB A;  3N7S C;  2IBI B;  4C7Y A;  2ZIX B;  1J0G A;  5KFE A;  3VFK A;  3LDZ E;  2FCS A;  1XSL A;  3IXS A;  1SJH D;  1VJ5 A;  8ICQ A;  1LGR A;  3AE3 B;  4K4H A;  5KFH A;  3QUT A;  1HQR D;  2OEH A;  4GDK B;  1TZ1 A;  2PI4 A;  3FC4 A;  3V6E B;  2B21 A;  4WAF A;  2AL3 A;  2KD1 A;  2YMM A;  9ICT A;  4WWP A;  3WAP A;  4QIW C;  1UZX B;  4ECY A;  2K8B B;  4MSM B;  4IS7 A;  4QW8 A;  1X66 A;  3QEA Z;  1V9J A;  3KHR A;  2DAF A;  1SKS A;  1RYJ A;  3W5V B;  3TEZ A;  1WXM A;  1FCL A;  4TUU A;  3Q8B A;  2DKX A;  3IHP C;  1JWS D;  1ZDX A;  4UAY A;  3D2S A;  1VZ6 A;  2NVU I;  3BVG A;  1RM6 C;  4Z6D A;  3VTV A;  1IBX B;  1EF1 A;  2EKE C;  1Z19 A;  2DKZ A;  2K4H A;  4PS8 A;  2IHM A;  1WG8 A;  2PMV A;  2ZXI A;  2WX1 A;  3H7P A;  3PR4 A;  4QWE A;  3KUD B;  4FS1 A;  5D46 A;  1GAQ B;  3AEA B;  3LVW A;  4NLB A;  4DL7 A;  3Q8M A;  2JZZ A;  1RYU A;  4TKN A;  1XXG A;  4ECQ A;  4F5R A;  2KTR A;  4YSY B;  3W5U B;  1ZYQ A;  3DWG C;  4KN4 A;  5JU5 A;  4KLQ A;  1P98 A;  4FJZ A;  3DV9 A;  4YMM A;  4GFJ A;  4CCH A;  7ICR A;  3Q8C A;  1K52 A;  3WKC A;  1YZ7 A;  4ECT A;  1PGB A;  2KFN A;  4JV1 A;  5KHQ A;  5AKE A;  2N4F A;  2ZJA A;  5E79 U;  2M0A A;  1I4P A;  1BPD A;  1WJU A;  1WF9 A;  5CHW A;  3TBL D;  1QSS A;  3KUC B;  3AU2 A;  4QWB A;  4O3O A;  2LRU A;  2LYH A;  1TFR A;  2NR2 A;  2WWZ A;  2XY6 A;  1S3S G;  5HP4 A;  1MI0 A;  3GQC A;  3DCG A;  2BCV A;  2MBE A;  2VA3 A;  3TKA A;  1IXR A;  2C28 A;  3ZXR A;  1URJ A;  1ZQZ A;  5C23 A;  3EYZ A;  3BZC A;  2KVS A;  5AUK A;  3Q8Q B;  1ZE3 D;  4ARI A;  3QC8 B;  5DPR A;  2A19 A;  4DWI A;  1KDH A;  1VRA B;  4YN4 A;  1ZGU B;  3UQ2 A;  4I2J A;  1L5P A;  1F0M A;  2WTF A;  7ICN A;  2JRI B;  1PQS A;  4NPN A;  7ICU A;  1SIJ A;  1PGX A;  4KLT A;  3P4P B;  5E6P A;  1WYW B;  1Y8R C;  2H3I A;  4IW0 A;  3RF9 A;  1SF0 A;  1X6I A;  9ICI A;  2ZW0 A;  3RI7 C;  2N9E B;  2DYM A;  4PPX A;  2NRW A;  3QU9 A;  4NAW A;  3Q8A A;  3VXW A;  1ZET A;  1D9F A;  3H8W A;  3PGE A;  2K89 A;  2W7O A;  5KFN A;  5DPW A;  2E1E A;  5AZH A;  1OFF A;  1SGG A;  1J19 A;  2MQJ A;  4RPY A;  3JW0 X;  3N32 A;  4DXG A;  2LGS A;  3EFU A;  2KKC A;  2BPG A;  2NV3 A;  2DYO A;  3MTN B;  8ICT A;  4Y2X A;  3BZK A;  4XC2 A;  4JWU C;  3UQB A;  1I4X A;  3U2S C;  3IV6 A;  4GU2 A;  1E5W A;  5CX3 A;  4IQU A;  4F5Q A;  5ALO A;  3AI5 A;  4JV2 A;  3TL5 A;  3B9J A;  5DBB A;  2DPI A;  4YCX A;  4PS3 A;  3SAF A;  2OHF A;  1UBI A;  1YJJ A;  4O3N A;  4CF5 A;  4TUQ A;  3PW0 A;  3UIO B;  2WDQ B;  4ED3 A;  4HPP A;  3KTQ A;  4DL5 A;  4YG2 A;  2GRI A;  5KG4 A;  1S8O A;  2E8N A;  4M9J A;  3RNE C;  1MQ2 A;  4F4Z A;  1NJX A;  5JHB A;  1HEZ E;  1PVP A;  5AZF A;  1T0Y A;  2Z0E B;  2LD9 A;  3LXF A;  2HBJ A;  4BOS C;  2N7E A;  2WDR B;  1D9D A;  2IO2 B;  3MDC A;  3H0M B;  4O3Q A;  4BJQ A;  8ICO A;  1EU4 A;  1PYW D;  1T4G A;  3PTF C;  1NYQ A;  3Q2A C;  3KH0 A;  2WHI A;  1OQR A;  2DZK A;  1ZQB A;  3TAC B;  2DLB A;  4W9C A;  4ZH4 A;  1OXJ A;  4I2C A;  3AE6 B;  3HUI A;  4L2Y A;  1A6S A;  2BPS A;  4YTP B;  2MHJ A;  4RM8 A;  3OGU A;  2JXJ A;  4IC7 B;  2KVZ A;  1HIW A;  5L95 C;  2VH2 A;  4F2S A;  1X9S A;  4A55 A;  4DWF A;  2EMT A;  4LCD E;  4B9U A;  3NVW A;  2PVO D;  1WGD A;  4I2F A;  1WGG A;  3OJU A;  3TAN A;  3JPO A;  1JX4 A;  2LGY A;  4P4P A;  4P4O A;  1WJ6 A;  2B3A A;  2GBR A;  2RRD A;  1DK2 A;  1P7E A;  3QX7 A;  8ICM A;  1T8E A;  1KF6 B;  1CEZ A;  4RQN A;  4YXD B;  3RMK C;  4GDK A;  1NJW A;  1J7B A;  4QZ9 A;  1U47 A;  2IO0 B;  1OW5 A;  5HG2 A;  4DHJ B;  2Y9T A;  4I2H A;  3VUX A;  4A8X C;  4F4Y A;  1KH0 A;  2A3V A;  4K4I A;  4O9M A;  1FMA D;  1TJE A;  1ZQL A;  4C7Z A;  1H38 A;  3DBL I;  2G06 A;  2AQ3 B;  1D6E C;  1L7O A;  4F8R A;  4IM2 A;  1WXQ A;  2RLT A;  2GLS A;  2J42 A;  3SFE B;  4DSL A;  5KG7 A;  1YZ6 A;  4JUZ A;  5F9N A;  1HTQ A;  2AL6 A;  2G3Q B;  2ZW1 A;  2ZEQ A;  2IY0 B;  1V1P A;  5DLF A;  3OLM D;  4O5C A;  4KLL A;  3PZD A;  3RNA C;  3GIL A;  9ICE A;  2KTF A;  2PTL A;  2WDT B;  3RH6 A;  2LI5 A;  3BY4 B;  4RGO S;  2PW9 A;  3VRA B;  9ICU A;  2AGQ A;  1XEE A;  2RP5 A;  2P66 A;  1SKR A;  4RNN A;  4F92 B;  2KP7 A;  4RQ6 A;  1SEB D;  1TV9 A;  4BKG A;  1C3T A;  4AUQ C;  3SV4 A;  4BBN F;  2I1J A;  2IJ0 A;  3J9C A;  5KFX A;  1MA7 A;  2OJR A;  2KWD A;  2WXR A;  4MFF A;  2KDI A;  2FE9 A;  1SWV A;  2EAO A;  2G5H B;  3QUQ A;  1I4H A;  3NZ3 A;  3VUY A;  2AQ0 A;  5KFJ A;  3HJE A;  1TKG A;  3PSE B;  5AKJ A;  2V4Q A;  1KTK A;  4RH6 A;  4UDU C;  3BQT A;  3SV3 A;  1GB1 A;  5IIN A;  2BQQ A;  4WIP A;  3RT3 B;  3H0R B;  3RJJ A;  4RZR A;  3Q8R B;  2AXT U;  3LDA A;  8ICV A;  3BDP A;  3KWL A;  2KSO B;  4OJO A;  2MSN A;  2WB1 F;  1XSP A;  2JSV X;  5ALF A;  5ALN A;  4YR3 A;  4DSJ A;  2ZPY A;  4UBC A;  3TFR A;  3KZX A;  5CP2 A;  4J9M A;  4ICV A;  5DG8 A;  3ZD9 A;  2XVT A;  2LM4 A;  1MVK A;  4Q45 A;  2VA8 A;  3UXP A;  2INN E;  1ZQJ A;  2LHT A;  2D3G A;  1V8C A;  2EH9 A;  4Y2S A;  3OSN A;  3IDW A;  2K39 A;  1ZQF A;  2GBK A;  3F2C A;  1JWU D;  2ZIV A;  2DYB A;  3RJK A;  3C23 A;  3ZNH B;  4BBN C;  2PKE A;  2C7H A;  3PRZ A;  1WFY A;  4YR0 A;  3B2G A;  1TGZ B;  3PZP A;  1X9W A;  1E8Y A;  5IOI A;  3T3F A;  2JEF A;  3L13 A;  4I6N B;  1NNL A;  1P7D A;  1ACC A;  4FA6 A;  4ELV A;  2R2Q A;  4EEW A;  4ED0 A;  2PI5 A;  1K5O A;  4LZG A;  4IRD A;  3AV8 A;  3PRM B;  1SXD A;  4HRS A;  5E6J A;  5JHA A;  5TSS A;  2ZIW A;  4ED1 A;  1D5M C;  2FUH B;  1CRX A;  4ZRK A;  3VRB B;  4WQM A;  2JQR B;  2YMQ A;  4PYZ A;  5BYR A;  1PK1 A;  2CRX A;  8ICI A;  2GBN A;  1Q1O A;  3ML9 A;  3QUC A;  2O6K A;  3IVF A;  3NS8 A;  3AEG B;  3HKZ C;  3J81 j;  7ICG A;  2GOL A;  5HHI A;  3VAW A;  2ZTC A;  1D5X C;  3IBE A;  8ICX A;  3V62 A;  4EE2 A;  1AN8 A;  1I35 A;  4B9V A;  1COK A;  2YN4 A;  2D3B A;  4Z6E A;  3OG5 A;  2HI0 A;  3HP6 A;  1MC8 A;  1D8Y A;  4P1C C;  2PMZ F;  3TUO A;  1L6N A;  1XD3 B;  2AX5 A;  4F1S A;  3MFH A;  2HJ1 A;  4QZA A;  3TAD A;  4KSL C;  3RNC C;  4C4T A;  1F44 A;  2R8J A;  3S2A A;  4QZC A;  1XC9 A;  1ZXI A;  4GC7 A;  4CF3 A;  2C7M B;  4JX1 C;  1R4M I;  4P16 A;  5LLI A;  2BCR A;  4OJL A;  1QOF A;  2MBO A;  3IT4 B;  1EXN A;  2B76 B;  3PO0 A;  2ASD A;  2XCP A;  3FYH A;  3UQ0 A;  1HA5 A;  3HM6 X;  1I42 A;  1TY2 A;  3AEF B;  1LV5 A;  2BGF A;  1ZQG A;  3QUB A;  2RR9 A;  1RZT A;  1QQ6 A;  3H7P B;  3HX0 A;  1YN5 A;  4YMN A;  4M00 A;  4W9I A;  2KVC A;  9ICX A;  5HFY A;  1ZQM A;  1QOA A;  4PYU A;  1PDX A;  4RQ0 A;  2GOW A;  2PFN A;  2KNJ A;  4AP9 A;  4O3M A;  5KG6 A;  3F2B A;  1WY8 A;  7ICK A;  2WU5 B;  1V2Y A;  2MCN B;  2OCE A;  4KGT A;  1QH9 A;  2O6V D;  2KAC A;  3ZNG C;  1WXV A;  3RFZ B;  1FEZ A;  1WE7 A;  4Q8F A;  4BDP A;  2LXA A;  4QWA A;  3O13 A;  2EKI A;  7ICH A;  3CP8 A;  5H8Y E;  3N9Y C;  5KL8 B;  5ALV A;  3PW4 A;  2D6F C;  2NTS A;  1WI0 A;  1VD2 A;  2YEP B;  1FFV A;  4HRO A;  5KFV A;  4KVG B;  4UAU A;  3SQI A;  3RD2 A;  2P35 A;  4RNO A;  2KIW A;  2EDU A;  2RDJ A;  4P0Q A;  4CE6 A;  1V85 A;  4ZRQ A;  3RUI B;  4WJQ A;  1UT5 A;  5KG0 A;  5DG9 A;  2W9C B;  4LTU A;  4PZN A;  4CGZ A;  4RNA A;  3DBR B;  4M9N A;  4R3D A;  1SJE D;  2RGF A;  4A90 A;  1HE8 A;  2B0C A;  1L2N A;  1ET6 A;  4KLM A;  4RPZ A;  3GV8 B;  2J0K A;  4M47 A;  3DDC B;  4LNK A;  1B0X A;  2K4I A;  5AM2 A;  3OHB A;  1UUP A;  1DXS A;  1XLQ A;  3UIN B;  5CRX A;  2N9L A;  3EC8 A;  3UI3 A;  2JX5 A;  2KJ6 A;  3LK9 A;  1MG8 A;  1ISN A;  2F77 X;  4RQ7 A;  4M01 A;  3WK8 A;  5KG5 A;  4TQ0 A;  4PJ0 U;  1TAQ A;  3FAH A;  5J0T A;  2O6V A;  3GFK B;  2R8K A;  4NLC A;  2HHS A;  5KFK A;  4OO1 J;  2BB5 A;  2QCZ A;  1X9X A;  3U4E G;  4F2R A;  2KDE B;  4ASW C;  4LVS A;  3HKZ F;  3HVD A;  1UPH A;  1Z4O A;  5KFA A;  3A1Q A;  4LDT D;  3T5L A;  3H7I A;  2O2V B;  1I4Q A;  4KLU A;  1WE6 A;  2I9G A;  3BVZ A;  5AUI A;  1AWD A;  1ZQN A;  2F1H A;  2W8L A;  4FZM A;  1Q0W B;  3H8M A;  4IQV A;  4Y2P A;  4GLX A;  1WGR A;  1WWU A;  1WZ0 A;  4GXI A;  1BXT A;  2KAN A;  1WH3 A;  5ALM A;  1NEK B;  2FNJ B;  1FXT B;  2DFL A;  1F2R C;  4XA5 A;  5BMI A;  5AM4 A;  5DKW A;  2L1A A;  1B22 A;  2MAX A;  5KFC A;  3GIJ A;  2IO3 B;  2QB1 A;  5AM5 A;  1PZN A;  4I6L B;  2XBB C;  4IWP A;  5ALW A;  3V61 A;  3F5E A;  3Q14 C;  1S0O A;  3IRU A;  3V6K A;  1BPX A;  2KMM A;  2KG5 A;  1CK1 A;  1TT5 B;  3KYC D;  3WKE A;  3FM9 A;  3RJF A;  8ICP A;  1L6V A;  1SZP A;  3VTU A;  3RCZ A;  4G3X B;  4BKS D;  4G11 A;  3V72 A;  3Q3J A;  1DOY A;  2D3A A;  4DSE A;  4AQ7 A;  2PLP A;  5EWE A;  3AE7 B;  5AM1 A;  8ICH A;  3PVL A;  3ZJV A;  3SR6 A;  2I2Y A;  1S0M A;  3OAW A;  3NJT A;  4HKZ E;  2A1J A;  3PW7 A;  1M94 A;  2E3T A;  3PLV A;  2ES6 A;  3SZ2 A;  2CR5 A;  4RFB A;  2RPV A;  4NLN A;  2IOF K;  1T0Q C;  4KX5 A;  5AI6 A;  1MPE A;  2PEA A;  2BB6 A;  3Q8L A;  3PNC A;  3ISB A;  2V3N A;  2D3D A;  4YFK A;  4RUA A;  4M6W A;  3Q3M C;  1BNP A;  3DVG X;  1UGJ A;  1QQ5 A;  1RFA A;  1YX5 B;  3GIM A;  2LAS A;  1FXI A;  2D5G A;  3UF8 A;  2BHN A;  3T9L A;  3ZGZ A;  5KFI A;  2JXX A;  1IUE A;  3CF6 E;  4EX6 A;  2DAJ A;  4UQG A;  1Z1V A;  4CNQ A;  3V3X A;  5ALR A;  1FO4 A;  4LNO A;  4EBD A;  1SE3 A;  2QIE B;  1NI2 A;  2AGO A;  1X9M A;  1O03 A;  2DQN B;  4EZ9 A;  2WXP A;  1U4B A;  2I38 A;  1E0Z A;  1JRP A;  9ICF A;  4W9G A;  5HR6 A;  2WF8 A;  4IDI A;  1TE2 A;  2FPK A;  4B9S A;  2PE9 A;  2X38 A;  4ANX A;  5J2C A;  2ZVN A;  5DB6 A;  1H4R A;  5D49 A;  2JR5 A;  4YMO A;  3QHT A;  3ENE A;  3AQE A;  1SSN A;  1Q3U A;  2DGZ A;  2NRT A;  4OJ5 A;  5KHO A;  2LZ6 A;  2CXY A;  4YQW A;  2MWS B;  1NK0 A;  2W9A A;  4HCN B;  1L7P A;  1XS9 D;  3RPF C;  3IG8 A;  3X0W A;  1MHX A;  3QJZ A;  4NJ8 A; 
#chains in the Genus database with same CATH homology
 4RF1 A;  5EE1 A;  3NUH B;  1PGA A;  4DXF A;  4KGR A;  1MI0 A;  1AW7 A;  1CJE A;  4IKG A;  4RF0 A;  1L0V B;  5AUK A;  1ZE3 D;  1PUT A;  4KGS A;  4RCO A;  4MM3 B;  2ICI A;  4ARI A;  1VRA B;  3U52 E;  2K0P A;  1L5P A;  1DOI A;  2Z8L A;  1CZP A;  5EE0 A;  1SIJ A;  3P4S B;  1PGX A;  2K9X A;  1B9R A;  3P4P B;  1JWA D;  3AH7 A;  3MFG A;  1UNS A;  3P63 A;  2BTE A;  2W3S A;  1SF0 A;  1B1Z A;  2ZW0 A;  3AE5 B;  3W9C B;  2DYM A;  3MC0 B;  2MH7 A;  3P4Q B;  3BZD B;  3Q8A A;  4YTN B;  1OFF A;  2QMT A;  1ESF A;  1EWC A;  2DBY A;  4J3O D;  4DXG A;  4OZC A;  2W82 A;  5JXV A;  3AEE B;  4ITK A;  4C80 A;  2DYO A;  2WDV B;  2L83 A;  4JWU C;  1I4X A;  5FR3 A;  3U2S C;  1J7C A;  3B2F A;  3MP9 A;  1TS5 A;  1IGC A;  3Q8F A;  1GOZ A;  3B9J A;  3P4R B;  2W3R A;  2OHF A;  2KAJ A;  4US9 A;  1Q10 A;  2VZK D;  4KKI A;  1YJJ A;  2JU6 X;  2WXN A;  2NMQ A;  2WDQ B;  3R2T A;  1FIQ A;  1N5X A;  2GRI A;  1XLP A;  2EEL A;  4TSS A;  1HEZ E;  2IGD A;  4PT5 A;  5T8I A;  2Y5C A;  3LXF A;  5D3I B;  1I7H A;  4XDC A;  1VR9 A;  3IAS 1;  4N59 A;  4XWT A;  3ZYY X;  2K22 A;  1F77 A;  5C2T B;  2WDR B;  2AQ1 B;  1TS3 A;  1YNT E;  3PZ8 A;  4ZRP A;  2JZP A;  1EU4 A;  2WXK A;  1PYW D;  1JQ4 A;  1GPX A;  1E6E B;  2RDH A;  1NYQ A;  1XO3 A;  3AM9 A;  1C78 A;  4H2A A;  1HZ5 A;  1ET9 A;  1OQR A;  5BMG A;  2DLB A;  1F0Z A;  5EE3 A;  3AE6 B;  1QQR A;  1VJK A;  3HUI A;  4L2Y A;  3U7Z A;  4YTP B;  3OWE B;  3KLS X;  1FRR A;  1EM7 A;  1FNW A;  3SFD B;  1D4B A;  4KX6 B;  2QIL A;  3ABV B;  4M0W A;  4ZHO A;  4ARC A;  1M4V A;  1MHX A;  5FKA C;  1E9M A;  4A55 A;  1TKY A;  2IPK D;  2QJL A;  2QSD A;  3KWV A;  3NVW A;  2PVO D;  2V4I B;  3TEY A;  1FXA A;  1P7E A;  1KF6 B;  2FUG 1;  4RGT A;  3ZQ4 A;  4YXD B;  1TKE A;  1J7B A;  2K5P A;  5HG2 A;  1FD6 A;  4A8X C;  2XN9 C;  1E7P B;  1KH0 A;  1FMA D;  1VDV A;  1T6B X;  1TJE A;  4C7Z A;  1L0X B;  1DOX A;  3AEB B;  1A70 A;  3URY A;  2WLB A;  2AQ3 B;  1D6E C;  1KLG D;  3I57 A;  3AEC B;  1NEN B;  5HI1 A;  4B0M A;  1ENF A;  1I4G A;  3L4P A;  1WXQ A;  2BW2 A;  2J42 A;  3SFE B;  1MHH E;  3CIR B;  2ZW1 A;  1N5W A;  2WXF A;  1V1P A;  1K53 A;  1L6U A;  2PTL A;  1OQQ A;  1XLN A;  1EU3 A;  2WXJ A;  4RGO S;  2PW9 A;  3VRA B;  1XEE A;  1YMH E;  4YWG G;  1SEB D;  4XWW A;  2J4X A;  3HVZ A;  5FK9 C;  4B0E A;  2IJ0 A;  3J9C A;  2W54 A;  3V05 A;  1T5X D;  1IGD A;  4NAW B;  2KWD A;  2WXR A;  1I4H A;  3AE8 B;  3W1S A;  4OZA A;  1FRD A;  3NZ3 A;  2WS3 B;  1IBX A;  1K51 A;  1TKG A;  3NVZ A;  1PFD A;  5D7G A;  1KTK A;  4RH6 A;  1TS4 A;  4UDU C;  1GB1 A;  1WSP A;  1KFY B;  1JWB D;  2JWU A;  3T3O A;  2J53 A;  1I4R A;  4WIP A;  3R8B A;  3FIL B;  4GDL B;  1KRH A;  2RDG A;  1XCT L;  4JE3 B;  2GB1 A;  1YN4 A;  3KWL A;  3AED B;  1HXY D;  2JSV X;  4ZHP A;  1R7S A;  2M56 B;  3ETR A;  2V3P A;  2PKO A;  2G9H D;  5G5H A;  2VZK B;  4HEA 1;  2PIA A;  1MVK A;  3BYT B;  3ZJU A;  1QT9 A;  1TS2 A;  2INN E;  1YQ4 B;  2ACZ B;  4WWM A;  1LO5 D;  4A6Q A;  1BML C;  2LHD A;  1TZO A;  1V8C A;  4FXC A;  1DYQ A;  2MJE A;  1JWU D;  2OED A;  3TSS A;  4MH8 A;  5EE9 A;  1QIL A;  1L0Y B;  1WWT A;  1QOG A;  1ZDV A;  3AE1 B;  3B2G A;  4C56 C;  4ZOH C;  1ACC A;  1HZ6 A;  1C4C A;  2LEK A;  3AB5 A;  3AV8 A;  4RGN A;  2WQY B;  4HRS A;  5E6J A;  5TSS A;  2ON8 A;  1D5M C;  1E10 A;  2Y5P A;  3VRB B;  3EA6 A;  2SEB D;  2XNA C;  4WQM A;  5G5G A;  2JQR B;  3KQ4 A;  3CWI A;  5BYR A;  1YQ3 B;  1ROE A;  2H89 B;  5HHD G;  3AEG B;  3P1M A;  1SXT A;  1WGK A;  4L23 A;  3EUB 2;  1D5X C;  5BMH A;  4JWS C;  2YEP F;  4EE2 A;  1AN8 A;  3AN1 A;  3AE9 B;  4P6V F;  2H88 B;  2BS3 B;  4JPS A;  1Y56 A;  3HRD D;  4O1N A;  2L52 A;  4RGM A;  4YSZ B;  4MT5 A;  1V97 A;  5BYQ A;  1CQV A;  1N61 A;  4L1B A;  3TUO A;  3AE2 B;  2AX5 A;  3LYY A;  1ZOY B;  1FNV A;  1V1O A;  4OVZ A;  3PZ7 A;  2BT6 A;  1N63 A;  3ZJT A;  2K3U A;  3FIL A;  4WUR A;  1EWY C;  1VLB A;  2BYT A;  1ZXI A;  5I4D A;  2BS4 B;  4JX1 C;  2GI9 A;  1UWX A;  1C79 A;  3WCQ A;  4P16 A;  2WP9 B;  1WYG A;  5LNK 1;  1QOF A;  3GS2 A;  2NTT A;  3IT4 B;  3PO0 A;  2B76 B;  1JAL A;  1JWM D;  1HA5 A;  3SEB A;  2WXO A;  4ZYS A;  2INP E;  4TMA B;  1JRO A;  3LB8 C;  1TYG B;  2CU3 A;  1TY2 A;  2N7J A;  2Y3A A;  3AEF B;  3C8Y A;  2MJD A;  2N9K A;  4OZB A;  3MJ5 A;  2WU2 B;  1YN5 A;  4N6E B;  1T3Q A;  1FFU A;  4D2K A;  5HFY A;  1QOA A;  2Q5W D;  4Q2J A;  2AQ2 B;  1JW9 D;  1PDX A;  4YT0 B;  5C3J B;  2N0S B;  1SE4 A;  1UWM A;  2LHE A;  2WU5 B;  1C77 A;  2CJO A;  4KGT A;  2WNM A;  4LLG M;  2KAC A;  1GB4 A;  2R61 A;  3BVM A;  3RFZ B;  1NYR A;  3Q8E A;  3O13 A;  2EKI A;  1K50 A;  2PVG C;  1FM0 D;  2WXL A;  5H8Y E;  1C4P A;  3N9Y C;  2NTS A;  4NJC A;  1C4A A;  2MEK A;  3P42 A;  2JYE A;  2YEP B;  1FFV A;  4HRO A;  1XCQ L;  4ZRQ A;  4IOI E;  4LTU A;  4RNA A;  4R3D A;  4A90 A;  1SJE D;  2J52 A;  3T3N A;  3DWM A;  1DGJ A;  2LMC A;  4NAM A;  1ET6 A;  1RFK A;  2RMM A;  1V1P B;  4LK0 M;  4A9A A;  1BUI C;  1AYF A;  1D5Z C;  1UUP A;  4MAC A;  1QOB A;  1XLQ A;  2N9L A;  2JXT A;  1VZ8 A;  2MJ3 A;  3UI3 A;  4YSX B;  2IDY A;  2KQ4 X;  4TQ0 A;  3FAH A;  1L4Z B;  3AMZ A;  4TQ1 A;  2V0G A;  1XF5 L;  2WXI A;  2BB5 A;  3U4E G;  4REZ A;  3VQI A;  5MPO A;  1ZXH A;  2WXG A;  3AE4 B;  3Q69 A;  3HVD A;  1NVI D;  3TEX A;  1I4Q A;  5AUI A;  3BVZ A;  1SE2 A;  1AWD A;  4YTM B;  1TY0 A;  2KDM A;  1YN3 A;  1QF6 A;  1QKZ A;  1BXT A;  2L32 A;  1FNU A;  2LJI A;  1NEK B;  2BS2 B;  1F2R C;  2CJN A;  5BMI A;  3GB1 A;  2SAK A;  2M19 A;  3W2D A;  2L1A A;  3NS1 A;  1RWS A;  4US8 A;  1C76 A;  4HJG E;  4USA A;  5D3D A;  2ONQ A;  2HDE A;  2IGH A;  4NZL B;  2KMM A;  3BII D;  1CK1 A;  1ZUD 2;  4WH4 A;  1L6V A;  3VR8 B;  3VR9 B;  1C9F A;  2DWQ A;  1QLB B;  2FBW B;  2FE8 A;  4AS1 A;  3NRZ A;  1DOY A;  1STE A;  3H8H A;  4AQ7 A;  3MHZ A;  1N62 A;  2PLP A;  3AE7 B;  3ZJV A;  3SR6 A;  2I2Y A;  3BK1 A;  2E6X A;  1YJI A;  1J7A A;  4HKZ E;  2JYT A;  2LUM A;  1JCK B;  2E3T A;  1SB3 C;  3NVY A;  2G1E A;  4XDD A;  4RFB A;  2RPV A;  4C7Y A;  4OHJ A;  3BK2 A;  2W55 A;  1KLU D;  3TEW A;  1MPE A;  3IXS A;  1FCC C;  1SJH D;  2BB6 A;  3AE3 B;  2V3N A;  2WXQ A;  1HQR D;  3IT6 B;  1ZP0 B;  4GDK B;  1NI3 A;  1UGJ A;  3FC4 A;  5BYS A;  4WAF A;  3BYY B;  1FXI A;  4N58 A;  4CQN A;  2D5G A;  4XE0 A;  2LFI A;  3NVV A;  3ZGZ A;  1XLO A;  1IUE A;  3GP7 A;  1FEH A;  1JML A;  4GLS C;  3V3X A;  1RYJ A;  3W5V B;  3TEZ A;  1FCL A;  3Q8B A;  1FO4 A;  1JWS D;  1ZDX A;  1SE3 A;  1VZ6 A;  2QEJ C;  2QIE B;  2WXM A;  3BVG A;  3E56 A;  1RM6 C;  3R2I A;  1IBX B;  2HTM E;  2WXP A;  5GXG B;  2LGI A;  2I38 A;  2PMV A;  1E0Z A;  1JRP A;  3IAM 1;  3EGR A;  4IDI A;  2KN4 A;  2TSS A;  2X38 A;  4DQO C;  1F2R I;  1ZPS A;  1P7F A;  1GAQ B;  3AEA B;  3BWU D;  3E9S A;  1SBB B;  4HKQ A;  1SSN A;  1VZ7 A;  1N60 A;  1XXG A;  2IGG A;  4YSY B;  3W5U B;  3DWG C;  1WRI A;  3I9V 1;  3Q8C A;  1K52 A;  2WXH A;  1PGB A;  1L4D B;  4OW0 A;  5H92 C;  2BBC A;  2M0A A;  1I4P A;  3RPF C;  4KKJ A;  2JX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...