1FFVA

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
155
Chain Sequence
KKIITVNVNGKAQEKAVEPRTLLIHFLREELNLTGAHIGCETSHCGACTVDIDGRSVKSCTHLAVQCDGSEVLTVEGLANKGVLHAVQEGFYKEHGLQCGFCTPGMLMRAYRFLQENPNPTEAEIRMGMTGNLCRCTGYQNIVKAVQYAARKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 45
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1ffvA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ffvA01
4YXDB 2FBWB 5GXGB 4YT0B 3AN1A 1JWAD 4YTMB 3B2GA 1SIJA 3AE8B 4YSZB 1PFDA 3AECB 3AEDB 3HVZA 2QJLA 3AE6B 3AEBB 4YSXB 1OQRA 3WCQA 1DOXA 2BS2B 3HRDD 1CZPA 1NYRA 3HUIA 3W5VB 3VR8B 3ABVB 3NVYA 1L0VB 4YTPB 2OHFA 1WRIA 2K5PA 2Y5CA 4FXCA 1QF6A 1FO4A 2E3TA 1RM6C 2WDVB 3KWLA 3P4PB 2L83A 2WU2B 5H8YE 4HROA 1TJEA 3VR9B 4YSYB 1N5XA 2MH7A 3W9CB 3P4SB 4C7ZA 1CJEA 1E7PB 1QOFA 1TKYA 3AEFB 1FIQA 5EE9A 3NVWA 2WQYB 4JWSC 3W5UB 1FRDA 4US9A 2CJNA 1J7BA 3CIRB 1L5PA 3PO0A 3P1MA 1QOGA 1XLPA 4KX6B 1PUTA 2MJDA 1SF0A 4C7YA 2H88B 5G5HA 4US8A 2BT6A 4ZHOA 3NVVA 1DOYA 1F0ZA 1R7SA 4LTUA 1OFFA 1ZP0B 2K22A 1JROA 2W54A 2N0SB 2B76B 4ZHPA 1VJKA 2DBYA 1WXQA 4P6VF 1ZUD2 1PDXA 2Q5WD 2PKOA 3AE1B 1FXAA 1GPXA 1FMAD 2QIEB 1TKGA 3SR6A 3AV8A 3P63A 2PVOD 1JRPA 1T3QA 1ZXIA 3AMZA 2KAJA 1NEKB 2M56B 4JWUC 1J7CA 2M19A 1TYGB 1ZOYB 5G5GA 1OQQA 3RPFC 1V8CA 3NRZA 5C3JB 1NYQA 1XLOA 2L52A 3FAHA 3AE2B 3AH7A 4WWMA 5H92C 2WLBA 1VLBA 1E6EB 1FXIA 1RYJA 3AEGB 3SFDB 3NVZA 1KF6B 3AE7B 1YQ3B 1N61A 1FFUA 1N62A 1FRRA 3EUB2 1QOAA 1GAQB 2BS4B 2EKIA 3P4RB 1EWYC 5MPOA 5C2TB 3AE9B 3AE3B 1IUEA 5AUKA 3SFEB 1A70A 1SB3C 2ACZB 1KRHA 1DOIA 4C80A 2PIAA 3AEEB 1E9MA 3B2FA 3ETRA 1QLBB 5AUIA 1NI3A 1E10A 1UWMA 1XLQA 3AB5A 5EE3A 1WGKA 2MJEA 4ZOHC 1NVID 3CWIA 4IDIA 1XO3A 3VRBB 2LEKA 4N59A 1N5WA 2AX5A 3NS1A 3FC4A 1QOBA 1FFVA 2KMMA 3DWMA 1V97A 5EE1A 5EE0A 2G1EA 1AYFA 3BIID 1FM0D 2WDQB 2W3SA 2WS3B 1JW9D 4ITKA 4N6EB 1XLNA 3LXFA 4HRSA 4YTNB 2CJOA 2JX5A 2PVGC 1I7HA 1B9RA 1YQ4B 3ZYYX 1JWBD 1JQ4A 1N60A 1DGJA 1JALA 2BS3B 1L6UA 2WP9B 1E0ZA 2HTME 1WYGA 3AM9A 2K9XA 1YJIA 2JQRB 3DWGC 4WQMA 1J7AA 1L6VA 1AWDA 4A9AA 2WU5B 4N58A 3P4QB 2CU3A 2W55A 2H89B 3L4PA 1TKEA 1KFYB 3AE4B 1ROEA 1QT9A 2MJ3A 3AEAB 4JX1C 1NENB 2W3RA 1RWSA 2WDRB 3AE5B 3VRAB 1WWTA 3B9JA 1YJJA 2DWQA 1N63A 4USAA 1VDVA 3LB8C 1RFKA
chains in the Genus database with same CATH superfamily
8ICSA 5J2GA 1RZTA 3OGUA 2I9GA 5GXGB 3VDZA 3AN1A 1JWAD 4MHVA 2XEWA 2K8BB 5ALOA 3AE8B 5ALPA 2PKEA 4G0NB 2MSNA 1C4AA 4KIKB 3A1QA 3OG5A 4YTPB 4Y2VA 1ZQCA 3WANA 5KFDA 2ZW1A 4YG2A 1TJEA 3C1YA 3L17A 2HOFA 3TMPB 3T3NA 1WM3A 4GOCA 4KV2A 2K4PA 4JWNA 2KFKA 2NBWB 4HJGE 2KD1A 2ZIWB 2VA2A 1FXTB 2LGSA 3V60A 3W5UB 4FJVB 1SV0C 2INPE 5LXHA 1L5UA 3PO0A 3NTUA 4M0WB 3ZD9A 3I3TB 1S8OA 4C7YA 4R64A 2LXAA 4G3IA 4BOZB 3AL0B 3VXWA 4HPMB 1IV8A 2G3QB 4PZNA 3VAWA 3NRWA 3F5AA 2D2QA 3KOOA 2OYYA 3QU9A 1MQ2A 4TQ1A 4X57B 3NY5A 4HCPB 4KN4A 2Q5WD 3AE1B 3IT6B 5AI6A 1WFYA 1L3VA 4EOYA 2DZKA 3R9KA 2H3ZA 2QIEB 3O65B 1XSPA 2FLLA 3KLSX 1SSNA 1JRPA 3ML9A 5IIMA 2KAJA 2IGDA 2VH1A 1E7UA 3IHQB 4XUSA 5C3JB 2IBKA 2XCAA 2J42A 3ZNZB 3ZTDA 9ICBA 3CW2C 1URJA 2FMQA 1ISNA 4I28A 4JV1A 2TSSA 4RMAA 3HKZC 1Q0WB 1SV0A 5AKKA 4L2YA 2WF6A 1QOAA 1NJZA 1ENFA 4WJPA 4O3NA 1ZQJA 2LWPA 4K7UA 4YD2A 2MBBB 1KRPA 2WXLA 2W7OA 2FPMA 4RNOA 5IN7A 1ZQLA 3AULA 4GSWA 4MGIE 1HUZA 4DHZE 1VZ8A 4AS1A 4P16A 5CP2A 3VH3B 2LEKA 3EPIA 1QQ6A 2W9CB 4II2B 4N59A 4FZNA 2DQNB 1TS3A 1O03A 1T3NA 2L3ZA 3A9KB 4YN4A 5ALIA 2W3SA 1SL0A 2IOFK 3ZD8A 4HKQA 2KIWA 3JPRA 1RAXA 2WS3B 5BPCA 3GIJA 3JSVA 4AP9A 4ECXA 2JR5A 5DPTA 2PXIA 4FA6A 3GQCA 4NLBA 4OJOA 2AQ4A 3Q8RB 3ZDTA 1SE3A 1E0ZA 5J2EA 2PE9A 3IG8A 3RFAA 1GC7A 2IO2B 2WXQA 3X0WA 3SV4A 9ICAA 1L6VA 1J97A 1FEZA 2BPCA 4YXMA 1X9MA 5TZVA 1PGBA 2CU3A 3SENA 3HM6X 1UWXA 3Q8MA 1ZQRA 1RRBA 4RM8A 2I6XA 3GFKB 4ZYSA 4DOCA 2YQEA 2YTUA 1Q46A 3Q8SB 4RQ2A 1A76A 1K52A 2QMTA 4ARCA 2IHMA 2JYEA 3Q8CA 3TIXA 3MDCA 3A9JB 2XIDA 5ALUA 1VJ5A 5CHWA 2R8GA 1T5XD 4U6PA 2ISPA 1NYRA 5ALDA 1V1PA 2BDUA 5C5JA 1NOMA 2EH9A 2OXOA 2ISOA 2D6FC 2KDBA 1CUKA 1NBFC 4CF4A 4HROA 7ICNA 3GV5B 2Z8LA 1S76D 2ZXIA 4OJLA 3PS6A 4IW0A 1FIQA 1C77A 3QUCA 4DQRA 5DGAA 1J2MA 2CXYA 3PMNA 1KQQA 4LLGM 4PPXA 1J7BA 5JH5C 1T6BX 2D07B 3QUTA 2MHJA 4KX6B 4RPXA 2MJDA 1XQQA 4ZHOA 1ZXHA 2JUOA 3K1ZA 1SE4A 2KMDA 2ZJ8A 1KBUA 3H7PA 2DKXA 3KHGA 3PW2A 1AROP 3DBLB 5ALJA 3C5GA 5EWFA 4YMNA 3SHQA 3UXOA 2KX3A 2X38A 3AQFA 4EZ9A 1WJUA 3FILA 3VUXA 2M19A 5BYQA 1KL9A 5KFUA 1BT0A 2XK5A 1J8CA 2V4RA 5DLFA 1PVPA 1L8OA 2BQQA 2Y0SC 3PGEA 3EHVA 2WX1A 1UQVA 4II3B 3R66C 3EZ5A 5K4LA 3HILA 4CNQA 1HA5A 2JVCA 4NLZA 1KLNA 1ZW7A 3M9OB 5DPSA 3QQ8B 1G6JA 4IOIE 2N9PC 3TEYA 2DLBA 1XO0A 4KLQA 4ECTA 3QK0A 4XDCA 2N1RA 4ARIA 1JIHA 1F2RC 4A8EA 2BPGA 4NJ6A 1VR9A 1XD3B 3IM1A 1XCTL 2BYEA 3PW5A 4CQNA 2HBKA 1ZQAA 5BOMA 2AXTU 3Q3JA 5KHQA 4JLCA 3EWAA 1N5WA 4FHJA 4W9HA 2NO5A 3ZDMC 1FFVA 1ZETA 2HJ1A 5IIJA 1SL1A 2QILA 2ZIXB 3BZKA 5AKGA 1WG8A 4EYIB 3V72A 1FNVA 1S10A 2LJIA 1ZQSA 2LRWA 2DKZA 2INDC 2NPTB 1DGSA 3ZYYX 5T14A 2M17A 5J2BA 4RT3A 4FBUA 2IYDB 4JB3A 4UB3A 2QLTA 4A3OA 4PS8A 3DEEA 3RTVA 3DV9A 1LGRA 4WJQA 4JK1A 2FE9A 4N58A 2W55A 3I76A 1QQ5A 4M9GA 3WKCA 2Q0ZX 3EPGA 1HTOA 3DBHI 1N48A 1YJ1A 3ZJVA 2ZJ5A 1PVQA 4YXDB 4ANUA 3EFCA 5BYSA 1L4ZB 5DQGA 2O6KA 1I4HA 5BMGA 4EX6A 1WM2A 1S9FA 1PFDA 2DX5B 3WU2U 2AQ2B 3AEDB 3AE6B 3KUDB 2NBVB 9ICQA 4RNAA 1WY8A 2A5UA 9ICGA 1EM7A 4MEMA 2W9MA 2F8KA 2D5GA 3G6XA 3VR9B 1NDDA 2D3AA 5KL1B 4PS7A 4UAWA 1UUPA 3R3MA 1ZQMA 3V05A 2F76X 1ZQKA 1PGXA 3UQ0A 3HVDA 2L0FA 1S97A 4ACFA 1JWSD 3Q3OC 2WTFA 4RGMA 4F93B 1SGGA 7ICJA 3E0FA 2KJRA 1GG3A 1NNLA 5KFIA 2A3VA 3U30A 3OLMD 5AM0A 3DBRB 1NI2A 4XZ4A 5AI8A 3PSPA 5IP4D 1HEKA 2B0CA 1S5LU 4MSQB 1V38A 4C4RA 8ICFA 1WMHB 4MJSA 4NQLB 2PKOA 3Q2AC 4JGHB 4I2IA 3AXCA 4Q8EA 4XX5A 1BPEA 3H8WA 2KJ9A 3AMZA 2CRXA 2UVRA 2ASLA 4WJ3B 3PT2B 4NZLB 1EF1A 3UIPB 4IQTA 1ZD5A 4I2FA 2HHQA 1KN5A 2O6VA 3RPFC 1BGXT 2RDJA 4LZGA 3C19A 3LWLA 3ZW3A 1OQYA 3K9PB 5LNK1 5ALYA 2XI9A 1RYJA 5JHBA 2ZIUB 3GV7B 2LVQA 3TSSA 1TIFA 4ZYNA 3OAWA 5LXIB 1X9SA 2G4DB 2CHZA 5ALWA 2RDIA 4QIWC 5C2TB 1PVRA 4IC9A 2EMSA 4MH0E 3G6VA 4PHAA 4HK2A 3JPOA 2RPVA 1C4PA 4Q44A 2ZVNA 2IGHA 2V9HA 4P0QA 4WH4A 2ZEQA 1C9FA 2V3SA 5ALRA 1T0QC 2AU0A 4EE2A 1KFDA 4ECSA 3NS1A 5EE0A 4ZRQA 3NS8A 2G1EA 3KHHA 1FM0D 1FNWA 3M1YA 2Y3AA 2R8KA 4ITKA 2WNMA 4PGQA 1MVKA 3SEBA 3PRZA 1TAMA 4PT5A 5HNKA 1N60A 4JMUA 4O0IA 2PW9A 8ICKA 1WYGA 1EU4A 4KZ0A 4DS4A 2HBMA 1GC6A 3QC8B 4B0EA 2DENB 3C0RB 1D8LA 2KTRA 5D6JB 5AK5A 1SKSA 4HJKA 3N4MB 4JX1C 2GH1A 4FN2A 2G5HB 2D11A 1D5MC 3QXGA 2E8PA 2R18A 1TK5A 5AI4A 2EANA 4IR9A 5ALMA 1JI7A 1NKCA 4RF1A 4F5PA 5E6JA 4O3RA 1AARA 3B2GA 2ZUDA 3K75D 2IY0B 2VZKB 4N9F4 4Y2JA 4GXBA 2NR2A 2BCSA 4I6NB 5J29A 1DK2A 1JUDA 2KTQA 1CZPA 4JV0A 4ICUA 4KMUA 2HVIA 1LKYB 4GDKA 4DWIA 2VANA 2L83A 4Q2JA 2K4EA 9ICSA 3AUOA 3WKBA 3H8MA 1WWUA 3PHXB 4K7SA 1WUDA 4QZIA 4DL2A 3NUQA 1C4CA 4FJYA 3FM9A 5LLIA 5J2HA 1YN4A 1TAUA 4QZGA 5AEKB 2KFZA 2BWFA 2KACA 4GMVA 4EBDA 2NRZA 5G5HA 1NKEA 3PTFC 5AI0A 4RU9A 4GLXA 3TARA 1ZP0B 2MX2A 1C79A 5L83A 5AZGA 4WURA 2L5YA 4R3DA 3H8HA 3QX7A 1P3QU 5AKEA 2JEIA 4RQ1A 3EGRA 1CMXB 2ZPNA 4I2AA 3A1QB 2BPFA 2LYHA 2WDTB 5L95C 5DB9A 3DCGA 2JMGA 8ICJA 4GIVA 3WAMA 4KLIA 1Z5SB 2M56B 4RQ4A 5DCNA 2EZYA 1U4AA 1SKWA 1ZOYB 4RGTA 2KFKB 3IG5A 5ALGA 1DRGA 3AH7A 4AOFA 1MQ3A 2KXJA 4R8UA 1F0MA 5F9LA 2D3BA 1CI4A 2KQSA 1YQ3B 1Z3EB 4KLSA 3PVLA 4MH8A 4ZRKA 4B6JA 1ZQ1C 4O5EA 4NAWA 2QB1A 8ICCA 1FEHA 4F8RA 4TQSA 3PHWB 5EWEA 7ICMA 1A70A 4KSLC 4RPZA 2K8HA 2K8CA 4FJZA 5HFYA 1MG8A 9ICFA 5KFMA 5AM1A 2INCC 3GE3C 3BQ7A 4R63A 4M9HA 5TISU 1QQRA 4P1BC 2XNAC 2R8JA 1Y56A 4KLMA 2LM1A 4IUMB 9ICLA 4RGOS 4NV0A 2LJ5A 4FE3A 4J9SA 4B9MA 5JHAA 8ICLA 1FNUA 1I7HA 3P42A 4J9QA 4UAZA 4Q45A 3N3KB 4EX7A 2J0JA 2WXRA 4E0DA 3TFSA 4DHJD 2Y9UA 3L3FX 1ZJNA 4ELUA 5KFQA 3IRUA 2AJQA 4DHJB 1CEZA 3CYMA 1JMSA 5KT7A 3P4QB 3L16A 4IC7B 3QU7A 3S6JA 4K4GA 1SE2A 2MA9B 3AE4B 4GFJA 4M04A 2G4SA 3E2EA 2KKPA 3IFWB 1VDVA 3M9MB 4PZOA 2WXKA 1WGDA 4XGAB 3X23A 1SZPA 2N1WA 1ZQWA 1X9WA 3MGIA 1D6EC 3L54A 3DBSA 3BS7A 3GB1A 2DUYA 3M95A 3RJEA 5AI9A 4JE3B 4DF4A 2RDHA 3QX1A 2GO7A 8ICMA 2MQJA 2LBOA 3E9SA 3MJ5A 1N5XA 3EA6A 4RGNA 4MF2A 2HBLA 5ALVA 3ZNGC 5L1MA 4F2RA 1YZ6A 4US9A 2KJHB 5KG0A 5KT4A 4DSEA 2P6RA 3T8MA 5T8IA 4KN7A 1ZQUA 2CHXA 2ONQA 4LJPB 2MRLA 1SF0A 2YB1A 2DZIA 1RFAA 4MSMB 3QWZB 4I2HA 3D2QA 4DFMA 1ZQEA 2G45B 5KFYA 2CPRA 3BQ2A 1R4MB 2W54A 4KLHA 1TT5B 4NM1A 1YX5B 1VJKA 1WXQA 3CP8A 4RQ6A 2UVWA 3A4RA 1F1HA 4BKSA 1TVAA 1RDFA 7ICKA 2VIXA 3RJFA 1LV5A 4RH6A 1TGZB 2OEDA 2RR9A 1SWVA 3RNGC 2MAXA 1NEKB 5J0WA 3D6JA 1I35A 3V6KA 1R4NB 4E71A 5HHIA 2HVHA 2M8SA 1DK3A 5KT2A 1OXJA 3HK0A 5CR0A 1FRRA 2CR5A 2C2RA 4LCDE 5J0PA 4CGZA 5CA7A 1ZD3A 3H7PB 2G06A 4I6LB 1GO3F 1MI0A 1SJHD 1ZGUB 2K0PA 4DEZA 4ECWA 3B2FA 3N30A 4C4VA 1QH9A 1Q10A 3H4DA 2IO3B 2CHWA 2KQ7A 3ZI4A 4GGQA 1HTQA 3C28A 3FILB 5HHDG 4ED0A 8ICVA 2N9XA 3BK1A 4XQ8A 2XGPA 2HHUA 2NVUI 2LYAA 9ICKA 2XK5B 5IKCM 3RB6A 1X9XA 2Q4TA 4N6EB 2KKCA 1WZ3A 2BKRB 7ICOA 4ECUA 2JX5A 4DDGD 3TJPA 1P98A 1YNTE 3ZDEA 1JQ4A 5DG9A 2MW5A 8ICPA 1P7DA 4HEA1 2N7DA 1S3SG 2JQRB 2PJHA 2HSZA 2JZ3B 5HP4A 2BB6A 5IILA 1JWUD 5EWGA 4NPNA 1TKEA 2I2YA 1WGHA 1RYSA 1S0OA 2JXXA 4RNNA 2KFNA 3SZ2A 2KSOA 5AIAA 4TV3A 3V6CB 2YEPB 3Q14C 4TUUA 5CEHA 4DOBA 3T9LA 3HVZA 1Z1BA 3M8SA 1OQRA 1QLNA 1I4RA 2BS2B 2HJ8A 2PEAA 3PSEB 2MEKA 2KVSA 3RJJA 1QF6A 2EQYA 4LNFA 3KWLA 2K3UA 4MGKE 3W9CB 3SV3A 2KTFA 1NK7A 4KLUA 2J0KA 4IKGA 4HXDA 1CJEA 1TKYA 2F3NA 2KZZA 2KC1A 2RGFA 8ICUA 1MJDA 3D32A 3MC9A 3MR2A 1K8RB 2KV2A 1P7FA 4EZKA 1NK9A 2RP5A 3OPXA 3KYCD 1ZQNA 1DOYA 2PMZF 3ZNID 4EKUA 4EBEA 2OOBB 2WGSA 3SEIA 4Y2PA 3K9OB 4DO9A 3IG3A 2KHQA 2NYVA 3EC8A 5IIOA 2HCFA 2ZG6A 5KG1A 5AKLA 4OHJA 2K4IA 2FCSA 3KQ4A 3RNAC 3ZIMA 3RN9C 7ICTA 4HKZE 4JPSA 1TYGB 1ACCA 2E6XA 4YMMA 1WR1A 2RD0A 3HWTA 2ZCCA 3SU8X 3GIKA 1NYQA 8ICIA 1D9FA 3WK7A 5CHGA 2L1AA 3QARA 1S0VA 4DK5A 5J2KA 2LHDA 1E6EB 3GIIA 2J0MA 1HE8A 2LVOA 3H8SA 1SXTA 2W9BA 5AM3A 2Y9TA 4DXFA 7ICUA 2ASJA 2W9AA 1L7NA 1N56A 2C7NB 2BS4B 3CSFA 3UQBA 3VC8A 1QSLA 3WK5A 3QUBA 2KHVA 4PL2A 3OHAA 3VUWA 4W9DA 4JQWC 5DGBA 1UA1A 1SV4A 4LVSA 4MJSB 1A0PA 1Z4NA 2PI5A 5E79U 3PPAA 3H4BA 1E9MA 4Y2TA 1YQBA 3N7RC 4QZCA 4E3CA 4DQIA 3AB5A 2GBKA 5AIBA 2ES6A 1WGKA 4ZOHC 5FP0A 3R2TA 1F77A 3VRBB 1UT5A 1WXVA 4RQ0A 2WF8A 4RF0A 2GOLA 1KLGD 3M6KA 2PLPA 2FCMA 5DB6A 2QC8A 1NZBA 2UVVA 1J19A 2KLCA 3PZPA 2KZ3A 4M8MA 4XE0A 2KEYA 5J2CA 3MR5A 1Z2MA 2E1EA 4KX5A 1YQ4B 2DGZA 3NGDA 3RR7A 1MA7A 1TY0A 3LYYA 3N1ZC 1K50A 3MDAA 2KDIA 4MFCA 2K6QA 3GIMA 9ICIA 1Q5WB 4WQMA 3UGBB 2FLNA 1HZ6A 2JEGA 2JPHA 4PGXA 2KWCA 4IQWA 5KG2A 1NENB 3LDAA 1RWSA 2JF5A 3AE5B 3VTWA 2KT7A 4USAA 4M9LA 3SD5A 1E8XA 5AM4A 1V9JA 2KD0A 4YT0B 3SDLC 4YTMB 2FDRA 3TI0A 3HPOA 3GDXA 1C78A 3ZQ4A 2IPKD 4YSXB 2E8NA 4QWDA 2C60A 1HUOA 3HUIA 5AM2A 4PHEA 1XSNA 2M0NA 2G07A 2DF4B 2E3TA 1IM4A 4LNNA 3ZXVA 4S0RA 2E8MA 2NO4A 4NJ8A 4A20A 4RQNA 4F5RA 2KE7A 3NVWA 2YVCA 1WXAA 2KTRB 4XDDA 4TQRA 1ZQHA 2KHWB 3E56A 2RPQA 1ZOLA 3P1MA 4KITB 4IQVA 4I2JA 3U4EG 1XLPA 1O08A 5L1JA 4TKNA 1WSPA 3ZUNA 1EO6A 3OWEB 9ICJA 3MP9A 3VCBA 3ZDCA 4MFFA 2MUTA 3MR3A 1F9JA 4ZHPA 3AU2A 2BGFA 4M00A 4LDTD 4LDTB 4UAUA 5DBCA 5HHHA 3LK9A 4ECYA 5L9XA 1GB4A 4LK0M 2C5LC 5D7GA 4DOAA 2ESEA 2AGPA 1TZ1A 3GE8C 3BWUD 4CCHA 4XRHA 4BBNF 2DPJA 4NNJB 4QZBA 2N4FA 5KFWA 3MFIA 1L7OA 5DDMA 2V3NA 3ZLZA 3JVZX 2LM4A 4ZRIA 1OGWA 2NRVA 2ALZA 1GJZA 1QZEA 8ICXA 4KGSA 3I5JC 1KW4A 1U9LA 2WXOA 3AE7B 1WCNA 4HDOA 1B43A 2BCQA 1ZQZA 2LGYA 5FKAC 1XC9A 2H3VA 4YD1A 2EZZA 3MC0B 4LJOB 3NG0A 3VFKA 4UAVA 2FMSA 1QCKA 5ALTA 3KHLA 3AE9B 4I2GA 2L8JA 1XSLA 3N28A 3SFEB 4ECRA 1WR6E 3B0YA 1LB2B 4P0PB 3S2AA 2E5SA 3NZSA 8ICZA 2PIAA 2M4NA 5D94A 2QB0A 1U49A 3PR4A 5AUIA 4I2EA 1WJ4A 1E10A 4FBJB 4KGTA 1XWLA 3LDZE 2B6GA 3SD7A 2ZTEA 2JRZA 1KJTA 4IWOA 2LGXA 2OCEA 4JV2A 3BK2A 2MU2A 4QNLA 2M0AA 3QCAA 2ZIVB 2JXJA 1HZ5A 1C1YB 4R8UB 5ALKA 3MBYA 1U45A 4YTNB 1PK1B 1P0RA 2JYTA 4I6PA 3TBLD 1UELA 4NAWB 3ZDDA 1MPEA 3V7KA 1Z00A 2QARA 2W8LA 3MC1A 2KN5A 2N1VA 2RDGA 1I4XA 2K9XA 3DVNV 4AJWA 4AUQC 4PGYA 2KX0A 3MFGA 8ICAA 2K8CB 4G3XB 3RRGA 1OEYA 3WIMA 1T94A 3M63B 3L4PA 2YB4A 1ROEA 3QZ7A 3OJ3A 5KG7A 4MGZE 1JX4A 3UXPA 3ZDBA 2WXPA 2N7JA 2LXCA 2FBWB 2ZXHA 4GC6A 2BCRA 4NY8A 8ICYA 5J0TA 1WGGA 4MM3A 3ISDA 1D4BA 3GV8B 7ICHA 2PFOA 1E90A 5AKJA 3W5VB 2K1FA 1JWMD 2Y1IA 1K53A 2BB5A 4QZFA 3U8ZA 3M6ZA 3ZKJC 4BWMA 2WB1F 4Y2YA 4EYHB 4MT5A 5AM5A 4Y2UA 3RULA 3MABA 5KFNA 3ONNA 1U47A 3I57A 1SE9A 3RNBC 4EEYA 3M62B 1BPBA 1DOQA 4QWCA 3MJWA 1AN8A 4US8A 4UDUC 3T79A 3PRMB 1BPXA 5HR7A 1VRAB 2R2OA 2AL3A 1KH0A 3L10B 1TK8A 2DYBA 4LNIA 5JUMA 4PHDA 4HYKA 3RJIA 2PFQA 1ZUD2 2Y5BB 4K7WA 4P6VF 3R7QA 5KNIA 2JHDA 1ZKHA 1WGYA 3TACB 3GP7A 4F3OA 2PVOD 2EELA 3C8YA 2L76A 4J3OD 3DVNU 5HG2A 5IIKA 4AYBF 5J2IA 4DLEA 3M7DA 5GTIU 5J2JA 2L00B 2H3FA 2BKEA 2ZW0A 1COOA 2HE7A 2K8BA 4UASA 4KKIA 3IAM1 1UGMA 2KNJA 4Z6CA 5AKXA 3VVWB 1DYQA 4KLTA 3TADC 1C7YA 1WI0A 1N62A 3UMGA 2BCVA 2OEHA 2BYTA 3C5FA 4IRCA 3QE9Y 3NHEB 2EKIA 1T8EA 5J2RA 1SXDA 3PLVA 5DKWA 1KLVA 4QZ9A 2QDFA 1V1OA 2OM6A 4LZDA 3C2LA 1DOIA 1IYFA 4Y2XA 3T5LA 2ZIWA 3ETRA 3WK8A 2UVUA 1SEBD 4NJ7A 2LGIA 2GWSA 3ED5A 1I42A 4W9EA 5BMHA 3WAOA 1P9DU 5KT3A 2KFJA 2NCNA 3PX6A 4L1BA 4DSLA 1XT9B 1UH6A 3ETLA 2YX8A 4CYEA 2BDPA 3RAXA 3L0WB 3JPPA 3BQ1A 3RFZB 3BYTB 3KHRA 3LXFA 4CF5A 7ICEA 2CJOA 4OVZA 4XC2A 2K4HA 3TADA 4DL4A 1TS2A 3DBRI 1JWBD 4NLKA 1ZE3D 2NMQA 4B6WA 3RF9A 3UINB 2KZMA 2G09A 5F3XB 3TAQA 4ED6A 4EZJA 4TUPA 4Q43A 2FUHB 3QIJA 2ODGA 1P1AA 4I2CA 1J7AA 1V9PA 4UB4A 4O5KA 4F50A 5J0XA 2AQ1B 2XY5A 3ORYA 2A1JB 3N1XC 2HBJA 2OJRA 5KFRA 5ALHA 1OUQA 3APDA 2N9KA 1HJPA 3HJEA 4J9MA 3ALRA 3BQ0A 2DWQA 5D49A 3U7DA 1KFSA 5FK9C 2HD5B 2AQ3B 3DHHC 2M0XA 2WAQF 3EECA 4NLCA 1YOVB 2F2AB 3Q69A 3ECIA 2LASA 1DOXA 1QSYA 3NJTA 5H2FU 3HRDD 3F2BA 1VZ6A 2K5PA 3RBDA 8ICEA 3H7IA 4UQGA 2RRDA 3P2BA 4WAAA 3MGVA 2W9CA 1WE7A 1Y88A 2R2QA 4KDLB 2JRHA 3CMMB 4C4SA 4YWGG 3QU5A 2WQYB 1PK3A 4OZCA 1SXEA 1ZYQA 1TV9A 4AQ7A 1QOGA 3TEXA 4CRXA 1Z4OA 3RBEA 2WXNA 1F0ZA 2QEJC 3C2KA 2KSOB 1E8WA 5KFTA 4J03A 1JRUA 2VZKD 3QA8A 3IV6A 2WXHA 2KK8A 1WJ6A 1PGAA 2R8HA 4YR3A 2FCNA 2KVRA 4NAMA 2LZ6A 2IA6A 3BQTA 5KFOA 5KFAA 3H6NA 4A3PA 3H8JA 1T3QA 1ZXIA 2JZBA 4GC7A 4MEXA 4DS5A 1ZQQA 4JWUC 3W2DA 1S0MA 3OTQA 5KFSA 4M02A 5KAFU 1V8CA 2JXTA 2L52A 2FLPA 2L32A 2NV3A 5CTRC 2BZFA 3SFDB 3A0HU 5ALZA 5FR3A 2XVTA 4KVGB 2KQ4X 5ALLA 4NQKE 3TANA 1E8ZA 5AUKA 1KLUD 2NBUA 2HW3A 2G9HD 4DSKA 1L2NA 1X6IA 2XO7A 4OJ5A 2MRPA 3ALBA 2KO3A 2BQ3A 2GBJA 3OJSA 3ICXA 3SQIA 1K1SA 3UQ2A 5I4DA 2YMMA 5KFCA 2C22A 2WFAA 1ET6A 1F5SA 2GBMA 3V6EB 3Q8LA 1RQNA 3PO4A 3PO5A 1VZ7A 4MEYA 1NK5A 3N20C 4GDLA 1JW9D 3CF6E 2A19A 2HTHA 2W9BB 3DDCB 3RH5A 1UZXB 2GMIC 4HVBA 3C1ZA 2FUG1 2QSDA 3H1UA 1DGJA 4KLDA 2EZXA 2AHOB 1YJIA 2NTSA 1WXMA 4E74A 4OZAA 2VJ5A 4RQMA 3B1LX 4Y2SA 2ICIA 1T0RC 4FULA 9ICRA 3VH4B 1CQVA 2WDRB 1UT8A 3RR8A 1ZQBA 3IBEA 4RZRA 1RFKA 5KT6A 1D5XC 3NZ3A 4NWIA 3WK9A 1QILA 5CHVC 4DFPA 2SEBD 2ZJAA 4O3OA 2F1HA 3RI7C 2QCZA 3LJ3A 4PYZA 9ICUA 2QJLA 3AEBB 1QQ7A 3T5KA 4ECZA 4F71A 4F4KA 3E58A 2WXFA 4UB2A 1TTNA 2FIFA 2WDVB 3UMCA 1WCLA 4W9FA 3GZNI 3UI3A 2MH7A 3P4SB 4NLGA 3OHBA 3BINA 4C0ZA 4QWEA 3IXSA 4BVUC 5CB1A 1IIPA 1K1QA 2IOHA 1X2IA 4C4TA 3C2MA 1PQSA 2AYOB 3H9DA 2AGOA 2W9NA 4WJOA 4F5NA 3CNHA 3SI8A 2JV3A 2BT6A 3AU5A 1KTQA 5DLGA 2NPTA 3F2CA 2BYVE 5KFXA 1A77A 4CE6A 3LWMA 3GZFA 2DAJA 1WXSA 4RQ3A 7ICFA 2DBYA 5DDYA 3JSVB 1MHXA 3UPQA 3FDSA 2OWOA 2K39A 2F1IA 3PSFA 4P4PA 1ZQYA 3Q3NC 1GPXA 2K6DB 5AI5A 3RNCC 4RQ8A 1NKBA 3ZJTA 5AKHA 2BBCA 2RDBC 3Q8AA 1J7CA 3J9CA 8ICGA 3KZIU 1L7YA 3L08A 5J0YA 1T0YA 3MHSD 3N9YC 4L23A 2XBBC 3QEBZ 5J2AA 4ED8A 3L13A 5BO4B 2HHWA 4KX3A 1FXIA 5AK6A 3AEGB 3NOBA 4KLOA 2KP7A 4FS2A 5HMMA 1T0SC 1OEYJ 4IWPA 4KDIC 1KF6B 3V61A 4PYUA 2BKFA 5AHXA 1JCKB 2AGQA 1E5WA 2RLTA 1EWYC 5IIIA 5MPOA 3LVVA 5IAAC 5KFFA 2MUTB 3LVWA 2QKQA 5KAIU 1X40A 1YN3A 2ACZB 3VHTC 4O3PA 1NK4A 1P7EA 2PE6B 4DL5A 1V1PB 1ESFA 2I1JA 3HP6A 2KVCA 3WKDA 4IWQA 2ON8A 2XGQA 5ALNA 3KD3A 4X5VA 4ELTA 1XO3A 2LI6A 2XY7A 4M47A 2WHIA 4IM3A 2VH2A 1Q3VA 1E7VA 5L1IA 1L3SA 3ZRFA 1SBBB 5EE1A 4QW9A 4KMOB 4CHKA 2YMPA 4U7CA 1XS9D 3BIID 4NM2A 4FLHA 4EEWA 2DYOA 2C7HA 4FS1A 3PY8A 4TURA 1MSWD 3RB4A 3IAS1 2JH1A 1WIAA 4IM2A 5D3IB 2IGGA 4GB9A 1B9RA 4HAIA 1L3TA 4IRKA 4ANVA 4IM0A 1R4MI 2WP9B 3F2DA 4IR1A 3AM9A 4QZHA 2DAFA 3W1SA 2JEJA 3JYUA 2LRUA 4ICAA 1AWDA 4F7ZA 2QB0B 1I4QA 1HXYD 3AEAB 4WWPA 5KFEA 4QZEA 2ZIUA 2W3RA 9ICNA 1NK0A 1ZDVA 2ASQA 1N63A 5JTIA 4ED3A 4GLSC 3PX4A 1NK8A 4PS3A 2J6TA 4BAXA 4K3CA 1TZOA 3CSTA 3U2SC 5DPWA 2IOFA 5J0UA 3KZXA 2VRRB 4YXJA 2OHFA 4C8NA 2XCPA 4NY0A 1PUZA 3GILA 4GXKA 2HHVA 2WU2B 1WH3A 1Z00B 2QARB 1YN5A 5KL8B 4RQ5A 4NXZA 2K89A 5EE9A 3VQIA 1D8YA 3H7SA 2EAPA 1SWWA 4HWIB 2JEFA 2YLMA 4W9KA 2NRTA 5AKYA 3TEWA 1X66A 2H88B 3K4GA 3IN5A 1R7SA 4QAYA 2RMMA 4EUTA 4RFBA 3R7RA 2KOXA 1JROA 2V3PA 3H0RB 4MM3B 8ICWA 4CF3A 1IBXA 1IPGA 4RT2A 4OVUA 4F5QA 2PPHA 4AJYB 2KMAA 4IQUA 2RHFA 4J9LA 2C7MB 2N9LA 2YMLA 2E1FA 3NZUA 3O13A 1WWVA 5AICA 1L4DB 4YQWA 1D3ZA 1VLBA 2LYBA 4F8CB 4F4YA 1DXSA 4F4XA 2GBRA 4OD0A 3UIOB 2KJ5A 3F53A 4UB8U 1N61A 1FFUA 3TUOA 3QEAZ 4B9SA 1SGHA 1U4BA 4M9JA 1GAQB 1SKRA 2KOBA 3V7JA 5J17A 1ECWA 1LKYA 4XA5A 2MBHA 3ENEA 1NZPA 4YR2A 1YIWA 1M6YA 4TMAB 7ICIA 3B0AA 3HM3A 3HKZF 1BMLC 4Z6DA 4ELVA 9ICOA 1L8LA 1MC8A 4FBTA 3CWIA 3KFUF 3TL5A 4C8MA 2LPEA 3J81j 4Q8FA 2IBIB 1ZD2P 4F4ZA 5DB8A 1F2RI 1AYFA 3RZWC 3V3XA 2P35A 2YN4A 1JN3A 1COKA 3QNMA 4IL6U 9ICVA 1LXDA 4DFKA 4EZ6A 3RAQA 2DZMA 4ICVA 3VUYA 4WIPA 3TFRA 3RNEC 2UYZB 5L1LA 3MFHA 1V5OA 2BS3B 3TQ1A 3DVGX 2HTME 2ZUBA 4B9VA 5DG7A 2HI0A 2FE8A 3DVGY 1NJXA 8ICBA 1KFYB 1QT9A 5GTHU 1YJJA 3FYHA 3G6YA 5KFPA 3Q8QB 1D8BA 2O6VD 1VCBA 2O6VB 2W8KA 5CWRA 4DHZB 4UW9A 2AQ0A 5EOZA 3UMBA 2BW2A 4W9CA 1SZHA 9ICEA 2KJ8A 4KLGA 2I38A 5A0LA 4J9KA 4QZ8A 8ICRA 2PMZC 4Y2RA 2KIVA 3PW4A 1L3UA 4OZBA 3V62A 5CRXA 4QWBA 3AEFB 5CJ7A 1S0NA 2N7EA 4JWSC 4P0QB 2L7RA 4RNMA 1IG6A 1UF0A 1EXNA 2KNBA 3DPDA 2G08A 5CHFA 1PUTA 5KFKA 4DSFA 1JXEA 3A0BU 4IRDA 2DZJA 1KFTA 2GLEA 4LTUA 4RUAA 1ZJMA 3QZ8A 4BKTA 1WYWB 3PLUA 2HHTA 1LFDA 1CK1A 5D4BA 1PDXA 4DBGA 1BUIC 4FZLA 5J0SA 2LUMA 3JPNA 1B1ZA 3KW5B 4F91B 2MP2A 2OH2A 5DPRA 2Y1JA 1H8CA 2V4LA 3N7SC 4K81A 5G5GA 1B22A 4YR0A 3NRZA 3AE2B 1ZQXA 1WRDB 2V0GA 2WLBA 4RCOA 4OO1J 2HMXA 2W82A 2C2DA 4M01A 2JSVX 5IINA 3U26A 1TK0A 3RZFA 4UARA 2JWUA 3EUB2 4ASWC 1BVSA 3KYDD 4P7IA 2YEPF 4KSKC 5KFLA 4K4HA 4RQ7A 5G2NA 1CRXA 2JWZA 2J6UA 4ED7A 1LVHA 1ZQVA 2Y0SF 4GU2A 2DL0A 2LKYA 3CRXA 4GN1A 1YZ7A 3A33B 2GRIA 4BXOA 1UWMA 4GDKB 2WXIA 1NVID 3R8BA 3WAPA 4EENA 2JZBB 4QZDA 3WALA 3M8RA 3PZDA 4UB5A 3RJHA 2RSUA 2B21A 5GMVA 4DFJA 4DL6A 2BPSA 1QOBA 3DWMA 1V97A 7ICVA 4M6WA 2O2VA 1FCLA 1XLNA 5D46A 3HHMA 1D5ZC 1Q8KA 3QJZA 2PVGC 5L1KA 1Y8RC 2PI4A 1ZQDA 3RRHA 3Q8EA 4AP4C 1TS5A 2D3DA 1WX7A 3PZ7A 3MHZA 4QWAA 2VKQA 4MFAA 2YY6A 4EELA 4FO6A 1RQLA 2NS5A 1C3TA 5KFVA 2KK0A 4BWJA 4DFDA 3RT3B 1XF5L 3KUZA 3O0FA 5BYRA 2CKHB 3DOWA 4ZH4A 9ICMA 3B9JA 1H38A 3ZVVA 2VJ4A 4DWFA 1MN8A 5J2FA 4MACA 1BPZA 3KUCB 1S77D 4GDLB 4H2AA 4ZDVA 4GXIA 2BQUA 3IT4B 3TKAA 2KANA 4XWWA 4UATA 2Y5CA 1WRIA 5E6NA 1RM6C 3DBLI 4KLFA 2R61A 4YSYB 4K4IA 7ICQA 1L7MA 3LYSA 3DHIC 1UA0A 3I1YA 3WK4A 8ICHA 4QZAA 4MDKE 2BHNA 1M4VA 2KC2A 2EKEC 2V4QA 3TCAA 2J53A 3CIRB 2ASDA 3BJYA 4LNOA 1V81A 5JRTA 4GIBA 3GU3A 4W9IA 3TEZA 4BBNC 3OJUA 1XXGA 2WXJA 2Z0DB 3ML8A 2E8OA 1KDHA 2B76B 2KJ6A 5J0RA 4ANXA 5KFJA 2JU6X 4EEKA 2KWUB 5KFHA 3PSTA 4PL1A 3GOEA 2KLGA 3AV8A 2RQ5A 2AEHA 3SAHA 2N9EB 4FFDA 2MCNB 4TSSA 1ZPSA 4BUGA 4DQQA 3KKAC 5ALEA 3V7LA 2A1AA 1ZQIA 1WF9A 2ZNVB 3DBHB 1Z19A 2BQRA 1RG6A 1XLOA 4WWMA 4NLNA 1IXRA 1XO1A 2CU1A 1WX8A 2J52A 5H92C 4CO7A 3N32A 5DQIA 1PZNA 4B95A 1N2XA 3RJKA 9ICPA 2IO1B 3PW7A 2Y5PA 3WKEA 1C76A 5J0OA 3PMLA 2DPIA 4J9RA 5KG5A 1SB3C 3RB0A 3IP4B 3BS5A 5KG4A 3H0LB 1I4GA 2HHSA 2GLSA 4IDIA 2MBEA 1WGRA 2HDOA 2XICA 2IZVB 1MFWA 1EWCA 4QIWF 3BZCA 1ZRMA 2KZRA 3FC4A 3KKAA 5D2MB 5AKZA 2PTLA 4A55A 3KH0A 3QAQA 2JH7A 2J4XA 4J9PA 4M0AA 2FAZA 3U7ZA 3UF8A 4KIKA 3C21A 3KBBA 5D3DA 1GUAB 2K25A 1C20A 4DQOC 4TUSA 2LFIA 1IGDA 4TQ0A 3QU2A 2IJ0A 4DSIA 3RNFC 1L6UA 3SYZA 5KFBA 1WJNA 3V6HA 1OW5A 2EDUA 4BGDA 4BKSD 2FIDA 3BYYB 1D9DA 4A9AA 2WU5B 1XU4A 3RMKC 4I2DA 3KTQA 2WXGA 2PFPA 2HOQA 1V49A 4M0WA 2WWZA 1WWTA 1FD6A 1TFRA 2I1KA 1AQ6A 2JT4B 1SIFA 2KN7A 3DWGC 2WB1C 2BWES 2C28A 3Q3MC 4DL7A 1T7PA 2Z7JA 1ZQOA 1XNSA 3SAGA 1UGJA 2AWTA 2Z0EB 4JL9A 3VTVA 4YSZB 9ICTA 3JW0X 3WCQA 5DBAA 2WX0A 4UAYA 3A4SC 1OTRB 5AZFA 2FPKA 4A90A 1JMLA 3T3OA 2W04A 5JXVA 2D10A 1RPLA 4J6IA 4JIOU 2MBQA 4C7ZA 4Z6FA 5HR6A 1QOFA 4KTQA 2KDMA 2ZCBA 4XYCA 2DYMA 3WA0A 4YCXA 4C4VB 2IMWP 1FRDA 2I5HA 2BTEA 4C8KA 8ICNA 2KYWA 2REXA 2FNJB 4BDPA 3AI5A 2H3QA 1A6SA 2NRXA 4AYBC 2K22A 3AEVA 3W1YA 3RB3A 1YD8U 2KWDA 4FZMA 5DB7A 2FPLA 3PREA 5TR5A 3EYZA 1WZ0A 3K1RB 4ZRPA 1FXAA 4O3QA 1BPYA 3MTNB 2W11A 2K8AA 3I28A 2WF5A 8ICTA 1B0XA 1X42A 4M2YA 3T3FA 3MC8A 2LMRA 1L0YB 5HMLA 3D2NA 4QJFB 3F5EA 2G5IB 3SAFA 1OQQA 2XN9C 5ALFA 1YMHE 4I2BA 4BJQA 5JZEB 2PFNA 3FAHA 3A9KA 2DNFA 1KTKA 2BR0A 3ZNHB 2A4ZA 3PV8A 4M9NA 1J0GA 3L5KA 1UNSA 2KICA 3V6JA 4RPYA 3WKAA 3UM9A 4UB6U 2LI5A 3DHGC 1TS4A 4KZCA 3HT3A 5KFGA 3AE3B 1IUEA 4A6QA 5KG3A 4W9LA 4K1RB 1GNUA 2BVCA 3BVMA 1UCVA 1IBXB 2I1QA 5ALQA 4C80A 2B3AA 4A8XC 2KVZA 3PV1A 2D3CA 1NI3A 1H4RA 1XLQA 4ED2A 2MJEA 1E8YA 2KDFB 3BY4B 1RXWA 5KHOA 5JU5A 5F9NA 4UBCA 1F52A 1RLFA 3M3JA 4OW0A 4WQOB 2YMQA 2AX5A 4DCCA 2KMMA 2MWSB 3TAPA 2KKVA 1L0XB 1QKZA 4JWMA 3A9JA 4C56C 9ICCA 1IP9A 2ZPYA 4HLEA 2BF8B 2J7QB 1V85A 3AQEA 1TAQA 1B4FA 4KLEA 1TY2A 2INNE 4HRSA 5TSSA 2R8IA 2H3IA 1JALA 2LD9A 3UXNA 2KWVB 3AU6A 3QHTA 2WAQC 2JZPA 2FMPA 1EU3A 2AH5A 4S17A 4O3SA 2EAOA 2C2EA 1ET9A 3C29A 2WF9A 2BCUA 1ZQGA 1VD2A 2PMVA 1RXVA 3OJ4B 4F1SA 1UPHA 3VRAB 4KLLA 1KM7A 3ZO5B 4YMOA 4F2SA 9ICXA 5AZHA 3ZDAA 4B9TA 3AU4A 9ICHA 3ZJUA 1KKXA 5DBBA 5HI1A 2W43A 2DHZA 2HDEA 1SIJA 4DDID 7ICPA 1BXTA 4C8LA 4J9OA 4I29A 2GBNA 2UU7A 1ED1A 4P0PA 2NTTA 1ZRNA 1V5TA 3IVFA 4D2KA 3PNCA 2WHEA 3VR8B 3WK6A 1L0VB 3R2IA 4LNKA 4R65A 2LHEA 2W7PA 4DQSA 2V1YA 2ZNVC 1FO4A 2H5XA 3DQVA 3P4PB 5J2DA 5BMIA 4MF8A 3PR5B 4URKA 2X8XX 1TKDA 3T5HA 1ZQPA 5IO9A 1E7PB 4NJCA 3H40A 1V86A 2ZIVA 2CJNA 2UWQA 1V80A 1WX9A 5FR6A 1L6NA 4ACOA 5J8YC 3PX0A 1HEZE 2LMCA 2P66A 5BOLA 2DFLA 5KT5A 1PK1A 4DF8A 2L0TA 4F92B 3NVVA 5ALSA 2IY1B 1T4GA 3BVGA 1Q3UA 1FPYA 4OJ6A 1MG4A 1L7PA 5KTQA 1OFFA 2V4IB 5IOIA 4HPPA 2P6UA 2K60A 2BGWA 5C23A 1U48A 1QTMA 1STEA 4OCZA 3GZNB 3DDHA 1V6EA 1QSSA 1MHHE 4YL8A 5DG8A 4P4OA 1YT3A 4XWTA 3P63A 4LJXA 3RD2A 3RUIB 2JRIB 4UB1A 3N7PD 2OJWA 1KEJA 3H0MB 3HW8A 4ED1A 5AK3A 5J0QA 1TBEA 2MBOA 3QUQA 4UBBA 3RYTA 4OJPA 2CN1A 2C9WB 3KVFB 4J9NA 7ICLA 1NK6A 4DSJA 1RYRA 2G0AA 2ZIXA 1ZQTA 4WJNA 2EAMA 1S1QB 4ECVA 2F44A 5J8YA 4PHPA 2W03A 2ZZPB 1XCQL 4ZRJA 4ANWA 4B9LA 3P4RB 3GS2A 4TUQA 4QW8A 3QYPA 1N6ZA 3C23A 5EDSA 3PW0A 4R66A 2JY6A 3BDPA 3B0XA 2ZVOA 5B66U 4F72A 3N97B 1F44A 2ZTDA 2IO0B 1QLBB 4HCNB 4F4WA 3Q8KA 2QHOA 4WWNA 2SAKA 7ICSA 2MP2B 1I4PA 3ZRCA 4FADA 3NASA 1Q1OA 4RM9A 3T5JA 1RYUA 7ICRA 9ICWA 2WDQB 2MSED 2F1JA 3EFUA 1EUVB 1SL2A 2J6SA 5IA7A 1A5RA 1KOTA 2AL6A 3MGHA 3MR6A 8ICQA 4DXAB 2KDEB 8ICOA 1AW7A 5KG6A 1WE6A 4G11A 3W1SC 3RH4A 3ZXRA 2IHNA 2FCQA 3ISBA 3RJGA 2HHXA 2LVPA 5HKHA 4NL9C 3I9V1 3ONSA 5ALXA 5E6PA 3NUHB 4MELA 3Q3FA 1YX6B 4G50A 2MJ3A 4BXOB 4MGYE 5DQHA 4W9JA 1K5OA 2HOIA 2JZZA 3LB8C 3APFA 4HDQA 4F5OA 3KWVA 7ICGA 1IGCA 2MLBA 4WAFA 1BNPA 2CS4A 4JUZA 4C00A 4M6WB 3SMVA 4KLJA 2GB1A 3AECB 1WMHA 2F8LA 4PH5A 2O2VB 2FI1A 4KGRA 2VA8A 3ZTCA 3QU4A 3ABVB 2M9NA 2KG5A 3NVYA 3HIZA 2WF7A 4FXCA 1KSPA 4KKJA 4I27A 2GI9A 4OVVA 4W9GA 5H8YE 2D3GA 1EF5A 1V2YA 4EZLA 3APCA 2LHTA 5AKIA 2XC9A 5AK4A 4DL3A 4P1CC 5C1ZA 4NL9A 4B0MA 1LO5D 5CX3A 2Z59B 1L5PA 3Q8FA 5J18A 3N1YC 4FHKA 4Y2QA 4Z6EA 1SJED 1R4NI 2IDYA 2M1MA 2LGDA 2MA1A 3JPQA 4C8OA 1UBQA 3Q6BA 4DQPA 2N0SB 1TE2A 5B5EU 2ZTCA 3VTUA 3JPTA 2A1JA 3RH6A 4AWJA 4REZA 1FMAD 1NJYA 1TKGA 2VA3A 3SR6A 3PZ8A 4HPLB 1JXLA 4DLGA 2KMCA 2WYQA 2V9WA 3D2SA 3U52E 2ATLA 4RUCA 3IHPC 3Q8BA 4PJ0U 2F77X 3EW9A 2D8CA 5E6OA 4IG7B 1GB1A 4BOSC 3B08A 4YP3A 4O1NA 3NVZA 4B9KA 1UHUA 3OSPA 3IDWA 1HQRD 1ZDXA 4GXJA 2XY6A 4BX9C 1HIWA 3HX0A 2NRWA 3URYA 5KFZA 2ZUCA 1UBIA 3I63C 3JPSA 4EFOA 1KRHA 2L05A 4IS7A 4BKGA 3BVZA 4ECQA 3AEEB 4M8NA 4DXGA 4P2HA 5EE3A 1LM8B 3THVA 1BPDA 3Q8PB 3FKYA 2BYFA 2FJ6A 4O5CA 2WXMA 3UQAA 1X1MA 1UD7A 4PK1A 1PYWD 1X6JA 2KN4A 4CDGA 4K3BA 1XEEA 3ZGZA 4P4MA 1ZQFA 3OSNA 1BNOA 4BFRA 4EBCA 4BZAA 5G55A 1ZD4A 3PVXA 4G9BA 3ISCA 4B9UA 1FCCC 1LQBA 4O3MA 4WWOA 4B9NA 2LUEA 1K51A 1J2NA 3PSIA 4YVZA 3M9NB 1GOZA 2GOWA 2EMTA 2ZJDA 1NJWA 3RCZA 3PRPB 3BZDB 2JGAA 1Z1VA 2H89B 4YFKA 4O9MA 3BS5B 1M94A 5C0YA
chains in the Genus database with same CATH topology
5FK9C 2AQ3B 5GXGB 3AN1A 1JWAD 4MACA 3AE8B 3Q69A 1D6EC 4H2AA 4GDLB 1C4AA 1DOXA 3GB1A 3IT4B 3HRDD 4XWWA 4YTPB 2Y5CA 1VZ6A 1WRIA 2K5PA 4JE3B 1RM6C 2RDHA 2ZW1A 2R61A 3E9SA 1TJEA 3MJ5A 4YSYB 1N5XA 3EA6A 3T3NA 4RGNA 4HJGE 4YWGG 1M4VA 2WQYB 3W5UB 4US9A 4OZCA 2INPE 2J53A 3CIRB 3PO0A 5T8IA 4AQ7A 1QOGA 2ONQA 3TEXA 3TEZA 1SF0A 2WXNA 4C7YA 1F0ZA 2QEJC 1XXGA 2WXJA 2VZKD 2WXHA 2W54A 4TQ1A 2B76B 1PGAA 1VJKA 1WXQA 4NAMA 2Q5WD 2JU6X 3AE1B 3IT6B 4RH6A 2OEDA 2QIEB 3KLSX 3AV8A 1SSNA 1JRPA 1T3QA 1ZXIA 4TSSA 1ZPSA 2KAJA 1NEKB 2IGDA 4JWUC 3W2DA 5C3JB 1V8CA 2J42A 1XLOA 2JXTA 2L52A 4WWMA 5H92C 2J52A 2L32A 2TSSA 3SFDB 5FR3A 4L2YA 1FRRA 1QOAA 2KQ4X 1ENFA 2Y5PA 1C76A 2WXLA 5AUKA 1KLUD 1SB3C 2G9HD 1MI0A 1SJHD 2K0PA 3B2FA 1Q10A 1I4GA 4IDIA 1VZ8A 5I4DA 4AS1A 4P16A 1ET6A 2LEKA 3FILB 4N59A 5HHDG 1EWCA 1TS3A 3BK1A 3FC4A 2PTLA 4A55A 1VZ7A 2J4XA 2W3SA 3U7ZA 4HKQA 2WS3B 1JW9D 4N6EB 5D3DA 2JX5A 4DQOC 1YNTE 2LFIA 1IGDA 4TQ0A 2FUG1 2QSDA 1JQ4A 1DGJA 2IJ0A 1SE3A 1L6UA 1E0ZA 4HEA1 1YJIA 2JQRB 2NTSA 2WXQA 4OZAA 1L6VA 3BYYB 1PGBA 4A9AA 2BB6A 2WU5B 1JWUD 2CU3A 2WXGA 1TKEA 1UWXA 2I2YA 2ICIA 4M0WA 1CQVA 2WDRB 1FD6A 1WWTA 4ZYSA 3NZ3A 1RFKA 3DWGC 1D5XC 1QILA 1K52A 2YEPB 2QMTA 2SEBD 4ARCA 1UGJA 2JYEA 4YSZB 3Q8CA 3HVZA 2QJLA 3AEBB 2WXKA 1OQRA 3WCQA 1I4RA 1T5XD 2BS2B 1NYRA 1V1PA 2WXFA 2MEKA 1QF6A 2WDVB 3KWLA 1JMLA 4A90A 2K3UA 3T3OA 4HROA 3UI3A 3W9CB 2MH7A 3P4SB 2Z8LA 5JXVA 4IKGA 3IXSA 4C7ZA 1CJEA 1QOFA 2KDMA 1TKYA 1FIQA 1C77A 2DYMA 1FRDA 4LLGM 1J7BA 2BTEA 1T6BX 4KX6B 1P7FA 2MJDA 4ZHOA 2BT6A 1ZXHA 1DOYA 1SE4A 2K22A 2KWDA 2DBYA 1MHXA 4ZRPA 1FXAA 1GPXA 4OHJA 3KQ4A 3ZJTA 2X38A 3FILA 2BBCA 1L0YB 3Q8AA 4HKZE 1J7CA 4JPSA 2M19A 1TYGB 1ACCA 3J9CA 2E6XA 3N9YC 4L23A 5BYQA 1OQQA 2XN9C 1YMHE 1NYQA 3FAHA 2L1AA 2LHDA 1KTKA 1E6EB 1FXIA 3AEGB 1SXTA 1KF6B 4DXFA 1UNSA 1HA5A 1JCKB 2BS4B 1EWYC 5MPOA 1TS4A 4IOIE 3TEYA 3AE3B 2DLBA 1IUEA 4A6QA 4XDCA 1YN3A 2ACZB 4ARIA 1F2RC 3BVMA 1VR9A 1P7EA 1IBXB 4C80A 1E9MA 1V1PB 1XCTL 4A8XC 4CQNA 1NI3A 1ESFA 1XLQA 3AB5A 1WGKA 2MJEA 4ZOHC 3R2TA 2ON8A 1XO3A 1F77A 3VRBB 4OW0A 1N5WA 2AX5A 1SBBB 4RF0A 2KMMA 1FFVA 2PLPA 1KLGD 5EE1A 3BIID 1L0XB 1QKZA 2DYOA 4C56C 2QILA 3IAS1 4XE0A 4HRSA 1FNVA 1TY2A 2INNE 2LJIA 5D3IB 5TSSA 2IGGA 1YQ4B 3ZYYX 1B9RA 1JALA 1TY0A 3LYYA 1K50A 2WP9B 2JZPA 1EU3A 3AM9A 4WQMA 1HZ6A 3W1SA 1ET9A 1AWDA 2PMVA 4N58A 2W55A 1I4QA 1HXYD 3AEAB 1NENB 2W3RA 1RWSA 3VRAB 1ZDVA 3AE5B 1N63A 4USAA 4GLSC 3ZJVA 4YXDB 4YT0B 3ZJUA 4YTMB 5HI1A 5BYSA 1L4ZB 1TZOA 1I4HA 1SIJA 2HDEA 5BMGA 1BXTA 1PFDA 1C78A 3ZQ4A 2AQ2B 2IPKD 3AEDB 3U2SC 3AE6B 4YSXB 2NTTA 4RNAA 4D2KA 3HUIA 3VR8B 1L0VB 3R2IA 1EM7A 2LHEA 2OHFA 1FO4A 2E3TA 3P4PB 2D5GA 5BMIA 2WU2B 3VR9B 1YN5A 1UUPA 3V05A 1E7PB 4NJCA 1PGXA 5EE9A 3VQIA 3NVWA 3HVDA 2CJNA 4XDDA 1JWSD 3E56A 3P1MA 1HEZE 3U4EG 4RGMA 1XLPA 2LMCA 3TEWA 1WSPA 2H88B 3OWEB 3NVVA 3BVGA 1R7SA 1OFFA 2RMMA 2V4IB 3MP9A 4RFBA 1JROA 2V3PA 4MM3B 4ZHPA 1STEA 1IBXA 2PKOA 1GB4A 1MHHE 4LK0M 5D7GA 4XWTA 3BWUD 3P63A 2N9LA 3AMZA 4NZLB 2V3NA 3RPFC 3O13A 5LNK1 1L4DB 1VLBA 4KGSA 1RYJA 3TSSA 2WXOA 3AE7B 1N61A 1FFUA 3TUOA 5FKAC 1XCQL 1GAQB 3P4RB 3GS2A 3MC0B 5C2TB 3AE9B 3SFEB 4TMAB 2RPVA 1C4PA 2PIAA 2IGHA 1QLBB 5AUIA 1E10A 4WH4A 1BMLC 4KGTA 2SAKA 1C9FA 3CWIA 1I4PA 4EE2A 3BK2A 3NS1A 5EE0A 2M0AA 4ZRQA 1F2RI 2G1EA 1AYFA 3V3XA 1FM0D 2WDQB 1FNWA 1HZ5A 2Y3AA 4ITKA 2WNMA 1MVKA 4YTNB 3SEBA 4PT5A 4WIPA 2JYTA 1AW7A 1N60A 4NAWB 1MPEA 2BS3B 2PW9A 2RDGA 2HTME 1WYGA 1I4XA 2K9XA 1EU4A 2FE8A 3MFGA 4B0EA 3I9V1 3L4PA 3NUHB 4JX1C 1KFYB 1ROEA 1QT9A 2MJ3A 1D5MC 1YJJA 2WXPA 2N7JA 3LB8C 4RF1A 5E6JA 2FBWB 3KWVA 1IGCA 3B2GA 4WAFA 2VZKB 1D4BA 2GB1A 2BW2A 3AECB 2I38A 4KGRA 1CZPA 3W5VB 3ABVB 1JWMD 3NVYA 1K53A 2BB5A 4FXCA 4KKJA 2GI9A 2L83A 5H8YE 4Q2JA 4MT5A 4OZBA 1C4CA 3AEFB 4JWSC 1YN4A 4B0MA 1LO5D 1L5PA 2KACA 3I57A 3Q8FA 1PUTA 1AN8A 5G5HA 4US8A 1SJED 4UDUC 2IDYA 4LTUA 1ZP0B 1C79A 1VRAB 1KH0A 2N0SB 4WURA 4R3DA 3H8HA 3EGRA 4P6VF 1CK1A 1ZUD2 1PDXA 1BUIC 2LUMA 3GP7A 1FMAD 4REZA 1B1ZA 1TKGA 3SR6A 3PZ8A 2PVOD 2EELA 3C8YA 4J3OD 5HG2A 2M56B 1ZOYB 4RGTA 5G5GA 3U52E 3Q8BA 3NRZA 2ZW0A 3AE2B 3AH7A 1GB1A 2V0GA 2WLBA 4RCOA 4KKIA 3IAM1 4O1NA 2W82A 1DYQA 3NVZA 2JSVX 1YQ3B 4MH8A 1N62A 2BYTA 2JWUA 3EUB2 1HQRD 1ZDXA 2EKIA 2YEPF 1FEHA 3URYA 1A70A 1V1OA 1KRHA 3BVZA 5HFYA 1DOIA 3AEEB 4DXGA 3ETRA 1SEBD 2GRIA 1UWMA 2LGIA 5EE3A 4GDKB 2WXIA 1NVID 3R8BA 5BMHA 2WXMA 1QQRA 2XNAC 4L1BA 1Y56A 1QOBA 3DWMA 1PYWD 1V97A 4RGOS 2KN4A 3RFZB 3ZGZA 1XEEA 1FCLA 3BYTB 1XLNA 3LXFA 1D5ZC 2CJOA 2PVGC 1FNUA 1I7HA 4OVZA 3P42A 1FCCC 1TS2A 1JWBD 1ZE3D 2NMQA 2WXRA 1K51A 3Q8EA 1GOZA 1TS5A 3PZ7A 1J7AA 3MHZA 2AQ1B 3BZDB 3P4QB 2H89B 1XF5L 2N9KA 3AE4B 1SE2A 5BYRA 3B9JA 2DWQA 1VDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD B;  2FBW B;  5GXG B;  4YT0 B;  3AN1 A;  1JWA D;  4YTM B;  3B2G A;  1SIJ A;  3AE8 B;  4YSZ B;  1PFD A;  3AEC B;  3AED B;  3HVZ A;  2QJL A;  3AE6 B;  3AEB B;  4YSX B;  1OQR A;  3WCQ A;  1DOX A;  2BS2 B;  3HRD D;  1CZP A;  1NYR A;  3HUI A;  3W5V B;  3VR8 B;  3ABV B;  3NVY A;  1L0V B;  4YTP B;  2OHF A;  1WRI A;  2K5P A;  2Y5C A;  4FXC A;  1QF6 A;  1FO4 A;  2E3T A;  1RM6 C;  2WDV B;  3KWL A;  3P4P B;  2L83 A;  2WU2 B;  5H8Y E;  4HRO A;  1TJE A;  3VR9 B;  4YSY B;  1N5X A;  2MH7 A;  3W9C B;  3P4S B;  4C7Z A;  1CJE A;  1E7P B;  1QOF A;  1TKY A;  3AEF B;  1FIQ A;  5EE9 A;  3NVW A;  2WQY B;  4JWS C;  3W5U B;  1FRD A;  4US9 A;  2CJN A;  1J7B A;  3CIR B;  1L5P A;  3PO0 A;  3P1M A;  1QOG A;  1XLP A;  4KX6 B;  1PUT A;  2MJD A;  1SF0 A;  4C7Y A;  2H88 B;  5G5H A;  4US8 A;  2BT6 A;  4ZHO A;  3NVV A;  1DOY A;  1F0Z A;  1R7S A;  4LTU A;  1OFF A;  1ZP0 B;  2K22 A;  1JRO A;  2W54 A;  2N0S B;  2B76 B;  4ZHP A;  1VJK A;  2DBY A;  1WXQ A;  4P6V F;  1ZUD 2;  1PDX A;  2Q5W D;  2PKO A;  3AE1 B;  1FXA A;  1GPX A;  1FMA D;  2QIE B;  1TKG A;  3SR6 A;  3AV8 A;  3P63 A;  2PVO D;  1JRP A;  1T3Q A;  1ZXI A;  3AMZ A;  2KAJ A;  1NEK B;  2M56 B;  4JWU C;  1J7C A;  2M19 A;  1TYG B;  1ZOY B;  5G5G A;  1OQQ A;  3RPF C;  1V8C A;  3NRZ A;  5C3J B;  1NYQ A;  1XLO A;  2L52 A;  3FAH A;  3AE2 B;  3AH7 A;  4WWM A;  5H92 C;  2WLB A;  1VLB A;  1E6E B;  1FXI A;  1RYJ A;  3AEG B;  3SFD B;  3NVZ A;  1KF6 B;  3AE7 B;  1YQ3 B;  1N61 A;  1FFU A;  1N62 A;  1FRR A;  3EUB 2;  1QOA A;  1GAQ B;  2BS4 B;  2EKI A;  3P4R B;  1EWY C;  5MPO A;  5C2T B;  3AE9 B;  3AE3 B;  1IUE A;  5AUK A;  3SFE B;  1A70 A;  1SB3 C;  2ACZ B;  1KRH A;  1DOI A;  4C80 A;  2PIA A;  3AEE B;  1E9M A;  3B2F A;  3ETR A;  1QLB B;  5AUI A;  1NI3 A;  1E10 A;  1UWM A;  1XLQ A;  3AB5 A;  5EE3 A;  1WGK A;  2MJE A;  4ZOH C;  1NVI D;  3CWI A;  4IDI A;  1XO3 A;  3VRB B;  2LEK A;  4N59 A;  1N5W A;  2AX5 A;  3NS1 A;  3FC4 A;  1QOB A;  1FFV A;  2KMM A;  3DWM A;  1V97 A;  5EE1 A;  5EE0 A;  2G1E A;  1AYF A;  3BII D;  1FM0 D;  2WDQ B;  2W3S A;  2WS3 B;  1JW9 D;  4ITK A;  4N6E B;  1XLN A;  3LXF A;  4HRS A;  4YTN B;  2CJO A;  2JX5 A;  2PVG C;  1I7H A;  1B9R A;  1YQ4 B;  3ZYY X;  1JWB D;  1JQ4 A;  1N60 A;  1DGJ A;  1JAL A;  2BS3 B;  1L6U A;  2WP9 B;  1E0Z A;  2HTM E;  1WYG A;  3AM9 A;  2K9X A;  1YJI A;  2JQR B;  3DWG C;  4WQM A;  1J7A A;  1L6V A;  1AWD A;  4A9A A;  2WU5 B;  4N58 A;  3P4Q B;  2CU3 A;  2W55 A;  2H89 B;  3L4P A;  1TKE A;  1KFY B;  3AE4 B;  1ROE A;  1QT9 A;  2MJ3 A;  3AEA B;  4JX1 C;  1NEN B;  2W3R A;  1RWS A;  2WDR B;  3AE5 B;  3VRA B;  1WWT A;  3B9J A;  1YJJ A;  2DWQ A;  1N63 A;  4USA A;  1VDV A;  3LB8 C;  1RFK A; 
#chains in the Genus database with same CATH topology
 8ICS A;  5J2G A;  1RZT A;  3OGU A;  2I9G A;  5GXG B;  3VDZ A;  3AN1 A;  1JWA D;  4MHV A;  2XEW A;  2K8B B;  5ALO A;  3AE8 B;  5ALP A;  2PKE A;  4G0N B;  2MSN A;  1C4A A;  4KIK B;  3A1Q A;  3OG5 A;  4YTP B;  4Y2V A;  1ZQC A;  3WAN A;  5KFD A;  2ZW1 A;  4YG2 A;  1TJE A;  3C1Y A;  3L17 A;  2HOF A;  3TMP B;  3T3N A;  1WM3 A;  4GOC A;  4KV2 A;  2K4P A;  4JWN A;  2KFK A;  2NBW B;  4HJG E;  2KD1 A;  2ZIW B;  2VA2 A;  1FXT B;  2LGS A;  3V60 A;  3W5U B;  4FJV B;  1SV0 C;  2INP E;  5LXH A;  1L5U A;  3PO0 A;  3NTU A;  4M0W B;  3ZD9 A;  3I3T B;  1S8O A;  4C7Y A;  4R64 A;  2LXA A;  4G3I A;  4BOZ B;  3AL0 B;  3VXW A;  4HPM B;  1IV8 A;  2G3Q B;  4PZN A;  3VAW A;  3NRW A;  3F5A A;  2D2Q A;  3KOO A;  2OYY A;  3QU9 A;  1MQ2 A;  4TQ1 A;  4X57 B;  3NY5 A;  4HCP B;  4KN4 A;  2Q5W D;  3AE1 B;  3IT6 B;  5AI6 A;  1WFY A;  1L3V A;  4EOY A;  2DZK A;  3R9K A;  2H3Z A;  2QIE B;  3O65 B;  1XSP A;  2FLL A;  3KLS X;  1SSN A;  1JRP A;  3ML9 A;  5IIM A;  2KAJ A;  2IGD A;  2VH1 A;  1E7U A;  3IHQ B;  4XUS A;  5C3J B;  2IBK A;  2XCA A;  2J42 A;  3ZNZ B;  3ZTD A;  9ICB A;  3CW2 C;  1URJ A;  2FMQ A;  1ISN A;  4I28 A;  4JV1 A;  2TSS A;  4RMA A;  3HKZ C;  1Q0W B;  1SV0 A;  5AKK A;  4L2Y A;  2WF6 A;  1QOA A;  1NJZ A;  1ENF A;  4WJP A;  4O3N A;  1ZQJ A;  2LWP A;  4K7U A;  4YD2 A;  2MBB B;  1KRP A;  2WXL A;  2W7O A;  2FPM A;  4RNO A;  5IN7 A;  1ZQL A;  3AUL A;  4GSW A;  4MGI E;  1HUZ A;  4DHZ E;  1VZ8 A;  4AS1 A;  4P16 A;  5CP2 A;  3VH3 B;  2LEK A;  3EPI A;  1QQ6 A;  2W9C B;  4II2 B;  4N59 A;  4FZN A;  2DQN B;  1TS3 A;  1O03 A;  1T3N A;  2L3Z A;  3A9K B;  4YN4 A;  5ALI A;  2W3S A;  1SL0 A;  2IOF K;  3ZD8 A;  4HKQ A;  2KIW A;  3JPR A;  1RAX A;  2WS3 B;  5BPC A;  3GIJ A;  3JSV A;  4AP9 A;  4ECX A;  2JR5 A;  5DPT A;  2PXI A;  4FA6 A;  3GQC A;  4NLB A;  4OJO A;  2AQ4 A;  3Q8R B;  3ZDT A;  1SE3 A;  1E0Z A;  5J2E A;  2PE9 A;  3IG8 A;  3RFA A;  1GC7 A;  2IO2 B;  2WXQ A;  3X0W A;  3SV4 A;  9ICA A;  1L6V A;  1J97 A;  1FEZ A;  2BPC A;  4YXM A;  1X9M A;  5TZV A;  1PGB A;  2CU3 A;  3SEN A;  3HM6 X;  1UWX A;  3Q8M A;  1ZQR A;  1RRB A;  4RM8 A;  2I6X A;  3GFK B;  4ZYS A;  4DOC A;  2YQE A;  2YTU A;  1Q46 A;  3Q8S B;  4RQ2 A;  1A76 A;  1K52 A;  2QMT A;  4ARC A;  2IHM A;  2JYE A;  3Q8C A;  3TIX A;  3MDC A;  3A9J B;  2XID A;  5ALU A;  1VJ5 A;  5CHW A;  2R8G A;  1T5X D;  4U6P A;  2ISP A;  1NYR A;  5ALD A;  1V1P A;  2BDU A;  5C5J A;  1NOM A;  2EH9 A;  2OXO A;  2ISO A;  2D6F C;  2KDB A;  1CUK A;  1NBF C;  4CF4 A;  4HRO A;  7ICN A;  3GV5 B;  2Z8L A;  1S76 D;  2ZXI A;  4OJL A;  3PS6 A;  4IW0 A;  1FIQ A;  1C77 A;  3QUC A;  4DQR A;  5DGA A;  1J2M A;  2CXY A;  3PMN A;  1KQQ A;  4LLG M;  4PPX A;  1J7B A;  5JH5 C;  1T6B X;  2D07 B;  3QUT A;  2MHJ A;  4KX6 B;  4RPX A;  2MJD A;  1XQQ A;  4ZHO A;  1ZXH A;  2JUO A;  3K1Z A;  1SE4 A;  2KMD A;  2ZJ8 A;  1KBU A;  3H7P A;  2DKX A;  3KHG A;  3PW2 A;  1ARO P;  3DBL B;  5ALJ A;  3C5G A;  5EWF A;  4YMN A;  3SHQ A;  3UXO A;  2KX3 A;  2X38 A;  3AQF A;  4EZ9 A;  1WJU A;  3FIL A;  3VUX A;  2M19 A;  5BYQ A;  1KL9 A;  5KFU A;  1BT0 A;  2XK5 A;  1J8C A;  2V4R A;  5DLF A;  1PVP A;  1L8O A;  2BQQ A;  2Y0S C;  3PGE A;  3EHV A;  2WX1 A;  1UQV A;  4II3 B;  3R66 C;  3EZ5 A;  5K4L A;  3HIL A;  4CNQ A;  1HA5 A;  2JVC A;  4NLZ A;  1KLN A;  1ZW7 A;  3M9O B;  5DPS A;  3QQ8 B;  1G6J A;  4IOI E;  2N9P C;  3TEY A;  2DLB A;  1XO0 A;  4KLQ A;  4ECT A;  3QK0 A;  4XDC A;  2N1R A;  4ARI A;  1JIH A;  1F2R C;  4A8E A;  2BPG A;  4NJ6 A;  1VR9 A;  1XD3 B;  3IM1 A;  1XCT L;  2BYE A;  3PW5 A;  4CQN A;  2HBK A;  1ZQA A;  5BOM A;  2AXT U;  3Q3J A;  5KHQ A;  4JLC A;  3EWA A;  1N5W A;  4FHJ A;  4W9H A;  2NO5 A;  3ZDM C;  1FFV A;  1ZET A;  2HJ1 A;  5IIJ A;  1SL1 A;  2QIL A;  2ZIX B;  3BZK A;  5AKG A;  1WG8 A;  4EYI B;  3V72 A;  1FNV A;  1S10 A;  2LJI A;  1ZQS A;  2LRW A;  2DKZ A;  2IND C;  2NPT B;  1DGS A;  3ZYY X;  5T14 A;  2M17 A;  5J2B A;  4RT3 A;  4FBU A;  2IYD B;  4JB3 A;  4UB3 A;  2QLT A;  4A3O A;  4PS8 A;  3DEE A;  3RTV A;  3DV9 A;  1LGR A;  4WJQ A;  4JK1 A;  2FE9 A;  4N58 A;  2W55 A;  3I76 A;  1QQ5 A;  4M9G A;  3WKC A;  2Q0Z X;  3EPG A;  1HTO A;  3DBH I;  1N48 A;  1YJ1 A;  3ZJV A;  2ZJ5 A;  1PVQ A;  4YXD B;  4ANU A;  3EFC A;  5BYS A;  1L4Z B;  5DQG A;  2O6K A;  1I4H A;  5BMG A;  4EX6 A;  1WM2 A;  1S9F A;  1PFD A;  2DX5 B;  3WU2 U;  2AQ2 B;  3AED B;  3AE6 B;  3KUD B;  2NBV B;  9ICQ A;  4RNA A;  1WY8 A;  2A5U A;  9ICG A;  1EM7 A;  4MEM A;  2W9M A;  2F8K A;  2D5G A;  3G6X A;  3VR9 B;  1NDD A;  2D3A A;  5KL1 B;  4PS7 A;  4UAW A;  1UUP A;  3R3M A;  1ZQM A;  3V05 A;  2F76 X;  1ZQK A;  1PGX A;  3UQ0 A;  3HVD A;  2L0F A;  1S97 A;  4ACF A;  1JWS D;  3Q3O C;  2WTF A;  4RGM A;  4F93 B;  1SGG A;  7ICJ A;  3E0F A;  2KJR A;  1GG3 A;  1NNL A;  5KFI A;  2A3V A;  3U30 A;  3OLM D;  5AM0 A;  3DBR B;  1NI2 A;  4XZ4 A;  5AI8 A;  3PSP A;  5IP4 D;  1HEK A;  2B0C A;  1S5L U;  4MSQ B;  1V38 A;  4C4R A;  8ICF A;  1WMH B;  4MJS A;  4NQL B;  2PKO A;  3Q2A C;  4JGH B;  4I2I A;  3AXC A;  4Q8E A;  4XX5 A;  1BPE A;  3H8W A;  2KJ9 A;  3AMZ A;  2CRX A;  2UVR A;  2ASL A;  4WJ3 B;  3PT2 B;  4NZL B;  1EF1 A;  3UIP B;  4IQT A;  1ZD5 A;  4I2F A;  2HHQ A;  1KN5 A;  2O6V A;  3RPF C;  1BGX T;  2RDJ A;  4LZG A;  3C19 A;  3LWL A;  3ZW3 A;  1OQY A;  3K9P B;  5LNK 1;  5ALY A;  2XI9 A;  1RYJ A;  5JHB A;  2ZIU B;  3GV7 B;  2LVQ A;  3TSS A;  1TIF A;  4ZYN A;  3OAW A;  5LXI B;  1X9S A;  2G4D B;  2CHZ A;  5ALW A;  2RDI A;  4QIW C;  5C2T B;  1PVR A;  4IC9 A;  2EMS A;  4MH0 E;  3G6V A;  4PHA A;  4HK2 A;  3JPO A;  2RPV A;  1C4P A;  4Q44 A;  2ZVN A;  2IGH A;  2V9H A;  4P0Q A;  4WH4 A;  2ZEQ A;  1C9F A;  2V3S A;  5ALR A;  1T0Q C;  2AU0 A;  4EE2 A;  1KFD A;  4ECS A;  3NS1 A;  5EE0 A;  4ZRQ A;  3NS8 A;  2G1E A;  3KHH A;  1FM0 D;  1FNW A;  3M1Y A;  2Y3A A;  2R8K A;  4ITK A;  2WNM A;  4PGQ A;  1MVK A;  3SEB A;  3PRZ A;  1TAM A;  4PT5 A;  5HNK A;  1N60 A;  4JMU A;  4O0I A;  2PW9 A;  8ICK A;  1WYG A;  1EU4 A;  4KZ0 A;  4DS4 A;  2HBM A;  1GC6 A;  3QC8 B;  4B0E A;  2DEN B;  3C0R B;  1D8L A;  2KTR A;  5D6J B;  5AK5 A;  1SKS A;  4HJK A;  3N4M B;  4JX1 C;  2GH1 A;  4FN2 A;  2G5H B;  2D11 A;  1D5M C;  3QXG A;  2E8P A;  2R18 A;  1TK5 A;  5AI4 A;  2EAN A;  4IR9 A;  5ALM A;  1JI7 A;  1NKC A;  4RF1 A;  4F5P A;  5E6J A;  4O3R A;  1AAR A;  3B2G A;  2ZUD A;  3K75 D;  2IY0 B;  2VZK B;  4N9F 4;  4Y2J A;  4GXB A;  2NR2 A;  2BCS A;  4I6N B;  5J29 A;  1DK2 A;  1JUD A;  2KTQ A;  1CZP A;  4JV0 A;  4ICU A;  4KMU A;  2HVI A;  1LKY B;  4GDK A;  4DWI A;  2VAN A;  2L83 A;  4Q2J A;  2K4E A;  9ICS A;  3AUO A;  3WKB A;  3H8M A;  1WWU A;  3PHX B;  4K7S A;  1WUD A;  4QZI A;  4DL2 A;  3NUQ A;  1C4C A;  4FJY A;  3FM9 A;  5LLI A;  5J2H A;  1YN4 A;  1TAU A;  4QZG A;  5AEK B;  2KFZ A;  2BWF A;  2KAC A;  4GMV A;  4EBD A;  2NRZ A;  5G5H A;  1NKE A;  3PTF C;  5AI0 A;  4RU9 A;  4GLX A;  3TAR A;  1ZP0 B;  2MX2 A;  1C79 A;  5L83 A;  5AZG A;  4WUR A;  2L5Y A;  4R3D A;  3H8H A;  3QX7 A;  1P3Q U;  5AKE A;  2JEI A;  4RQ1 A;  3EGR A;  1CMX B;  2ZPN A;  4I2A A;  3A1Q B;  2BPF A;  2LYH A;  2WDT B;  5L95 C;  5DB9 A;  3DCG A;  2JMG A;  8ICJ A;  4GIV A;  3WAM A;  4KLI A;  1Z5S B;  2M56 B;  4RQ4 A;  5DCN A;  2EZY A;  1U4A A;  1SKW A;  1ZOY B;  4RGT A;  2KFK B;  3IG5 A;  5ALG A;  1DRG A;  3AH7 A;  4AOF A;  1MQ3 A;  2KXJ A;  4R8U A;  1F0M A;  5F9L A;  2D3B A;  1CI4 A;  2KQS A;  1YQ3 B;  1Z3E B;  4KLS A;  3PVL A;  4MH8 A;  4ZRK A;  4B6J A;  1ZQ1 C;  4O5E A;  4NAW A;  2QB1 A;  8ICC A;  1FEH A;  4F8R A;  4TQS A;  3PHW B;  5EWE A;  7ICM A;  1A70 A;  4KSL C;  4RPZ A;  2K8H A;  2K8C A;  4FJZ A;  5HFY A;  1MG8 A;  9ICF A;  5KFM A;  5AM1 A;  2INC C;  3GE3 C;  3BQ7 A;  4R63 A;  4M9H A;  5TIS U;  1QQR A;  4P1B C;  2XNA C;  2R8J A;  1Y56 A;  4KLM A;  2LM1 A;  4IUM B;  9ICL A;  4RGO S;  4NV0 A;  2LJ5 A;  4FE3 A;  4J9S A;  4B9M A;  5JHA A;  8ICL A;  1FNU A;  1I7H A;  3P42 A;  4J9Q A;  4UAZ A;  4Q45 A;  3N3K B;  4EX7 A;  2J0J A;  2WXR A;  4E0D A;  3TFS A;  4DHJ D;  2Y9U A;  3L3F X;  1ZJN A;  4ELU A;  5KFQ A;  3IRU A;  2AJQ A;  4DHJ B;  1CEZ A;  3CYM A;  1JMS A;  5KT7 A;  3P4Q B;  3L16 A;  4IC7 B;  3QU7 A;  3S6J A;  4K4G A;  1SE2 A;  2MA9 B;  3AE4 B;  4GFJ A;  4M04 A;  2G4S A;  3E2E A;  2KKP A;  3IFW B;  1VDV A;  3M9M B;  4PZO A;  2WXK A;  1WGD A;  4XGA B;  3X23 A;  1SZP A;  2N1W A;  1ZQW A;  1X9W A;  3MGI A;  1D6E C;  3L54 A;  3DBS A;  3BS7 A;  3GB1 A;  2DUY A;  3M95 A;  3RJE A;  5AI9 A;  4JE3 B;  4DF4 A;  2RDH A;  3QX1 A;  2GO7 A;  8ICM A;  2MQJ A;  2LBO A;  3E9S A;  3MJ5 A;  1N5X A;  3EA6 A;  4RGN A;  4MF2 A;  2HBL A;  5ALV A;  3ZNG C;  5L1M A;  4F2R A;  1YZ6 A;  4US9 A;  2KJH B;  5KG0 A;  5KT4 A;  4DSE A;  2P6R A;  3T8M A;  5T8I A;  4KN7 A;  1ZQU A;  2CHX A;  2ONQ A;  4LJP B;  2MRL A;  1SF0 A;  2YB1 A;  2DZI A;  1RFA A;  4MSM B;  3QWZ B;  4I2H A;  3D2Q A;  4DFM A;  1ZQE A;  2G45 B;  5KFY A;  2CPR A;  3BQ2 A;  1R4M B;  2W54 A;  4KLH A;  1TT5 B;  4NM1 A;  1YX5 B;  1VJK A;  1WXQ A;  3CP8 A;  4RQ6 A;  2UVW A;  3A4R A;  1F1H A;  4BKS A;  1TVA A;  1RDF A;  7ICK A;  2VIX A;  3RJF A;  1LV5 A;  4RH6 A;  1TGZ B;  2OED A;  2RR9 A;  1SWV A;  3RNG C;  2MAX A;  1NEK B;  5J0W A;  3D6J A;  1I35 A;  3V6K A;  1R4N B;  4E71 A;  5HHI A;  2HVH A;  2M8S A;  1DK3 A;  5KT2 A;  1OXJ A;  3HK0 A;  5CR0 A;  1FRR A;  2CR5 A;  2C2R A;  4LCD E;  5J0P A;  4CGZ A;  5CA7 A;  1ZD3 A;  3H7P B;  2G06 A;  4I6L B;  1GO3 F;  1MI0 A;  1SJH D;  1ZGU B;  2K0P A;  4DEZ A;  4ECW A;  3B2F A;  3N30 A;  4C4V A;  1QH9 A;  1Q10 A;  3H4D A;  2IO3 B;  2CHW A;  2KQ7 A;  3ZI4 A;  4GGQ A;  1HTQ A;  3C28 A;  3FIL B;  5HHD G;  4ED0 A;  8ICV A;  2N9X A;  3BK1 A;  4XQ8 A;  2XGP A;  2HHU A;  2NVU I;  2LYA A;  9ICK A;  2XK5 B;  5IKC M;  3RB6 A;  1X9X A;  2Q4T A;  4N6E B;  2KKC A;  1WZ3 A;  2BKR B;  7ICO A;  4ECU A;  2JX5 A;  4DDG D;  3TJP A;  1P98 A;  1YNT E;  3ZDE A;  1JQ4 A;  5DG9 A;  2MW5 A;  8ICP A;  1P7D A;  4HEA 1;  2N7D A;  1S3S G;  2JQR B;  2PJH A;  2HSZ A;  2JZ3 B;  5HP4 A;  2BB6 A;  5IIL A;  1JWU D;  5EWG A;  4NPN A;  1TKE A;  2I2Y A;  1WGH A;  1RYS A;  1S0O A;  2JXX A;  4RNN A;  2KFN A;  3SZ2 A;  2KSO A;  5AIA A;  4TV3 A;  3V6C B;  2YEP B;  3Q14 C;  4TUU A;  5CEH A;  4DOB A;  3T9L A;  3HVZ A;  1Z1B A;  3M8S A;  1OQR A;  1QLN A;  1I4R A;  2BS2 B;  2HJ8 A;  2PEA A;  3PSE B;  2MEK A;  2KVS A;  3RJJ A;  1QF6 A;  2EQY A;  4LNF A;  3KWL A;  2K3U A;  4MGK E;  3W9C B;  3SV3 A;  2KTF A;  1NK7 A;  4KLU A;  2J0K A;  4IKG A;  4HXD A;  1CJE A;  1TKY A;  2F3N A;  2KZZ A;  2KC1 A;  2RGF A;  8ICU A;  1MJD A;  3D32 A;  3MC9 A;  3MR2 A;  1K8R B;  2KV2 A;  1P7F A;  4EZK A;  1NK9 A;  2RP5 A;  3OPX A;  3KYC D;  1ZQN A;  1DOY A;  2PMZ F;  3ZNI D;  4EKU A;  4EBE A;  2OOB B;  2WGS A;  3SEI A;  4Y2P A;  3K9O B;  4DO9 A;  3IG3 A;  2KHQ A;  2NYV A;  3EC8 A;  5IIO A;  2HCF A;  2ZG6 A;  5KG1 A;  5AKL A;  4OHJ A;  2K4I A;  2FCS A;  3KQ4 A;  3RNA C;  3ZIM A;  3RN9 C;  7ICT A;  4HKZ E;  4JPS A;  1TYG B;  1ACC A;  2E6X A;  4YMM A;  1WR1 A;  2RD0 A;  3HWT A;  2ZCC A;  3SU8 X;  3GIK A;  1NYQ A;  8ICI A;  1D9F A;  3WK7 A;  5CHG A;  2L1A A;  3QAR A;  1S0V A;  4DK5 A;  5J2K A;  2LHD A;  1E6E B;  3GII A;  2J0M A;  1HE8 A;  2LVO A;  3H8S A;  1SXT A;  2W9B A;  5AM3 A;  2Y9T A;  4DXF A;  7ICU A;  2ASJ A;  2W9A A;  1L7N A;  1N56 A;  2C7N B;  2BS4 B;  3CSF A;  3UQB A;  3VC8 A;  1QSL A;  3WK5 A;  3QUB A;  2KHV A;  4PL2 A;  3OHA A;  3VUW A;  4W9D A;  4JQW C;  5DGB A;  1UA1 A;  1SV4 A;  4LVS A;  4MJS B;  1A0P A;  1Z4N A;  2PI5 A;  5E79 U;  3PPA A;  3H4B A;  1E9M A;  4Y2T A;  1YQB A;  3N7R C;  4QZC A;  4E3C A;  4DQI A;  3AB5 A;  2GBK A;  5AIB A;  2ES6 A;  1WGK A;  4ZOH C;  5FP0 A;  3R2T A;  1F77 A;  3VRB B;  1UT5 A;  1WXV A;  4RQ0 A;  2WF8 A;  4RF0 A;  2GOL A;  1KLG D;  3M6K A;  2PLP A;  2FCM A;  5DB6 A;  2QC8 A;  1NZB A;  2UVV A;  1J19 A;  2KLC A;  3PZP A;  2KZ3 A;  4M8M A;  4XE0 A;  2KEY A;  5J2C A;  3MR5 A;  1Z2M A;  2E1E A;  4KX5 A;  1YQ4 B;  2DGZ A;  3NGD A;  3RR7 A;  1MA7 A;  1TY0 A;  3LYY A;  3N1Z C;  1K50 A;  3MDA A;  2KDI A;  4MFC A;  2K6Q A;  3GIM A;  9ICI A;  1Q5W B;  4WQM A;  3UGB B;  2FLN A;  1HZ6 A;  2JEG A;  2JPH A;  4PGX A;  2KWC A;  4IQW A;  5KG2 A;  1NEN B;  3LDA A;  1RWS A;  2JF5 A;  3AE5 B;  3VTW A;  2KT7 A;  4USA A;  4M9L A;  3SD5 A;  1E8X A;  5AM4 A;  1V9J A;  2KD0 A;  4YT0 B;  3SDL C;  4YTM B;  2FDR A;  3TI0 A;  3HPO A;  3GDX A;  1C78 A;  3ZQ4 A;  2IPK D;  4YSX B;  2E8N A;  4QWD A;  2C60 A;  1HUO A;  3HUI A;  5AM2 A;  4PHE A;  1XSN A;  2M0N A;  2G07 A;  2DF4 B;  2E3T A;  1IM4 A;  4LNN A;  3ZXV A;  4S0R A;  2E8M A;  2NO4 A;  4NJ8 A;  4A20 A;  4RQN A;  4F5R A;  2KE7 A;  3NVW A;  2YVC A;  1WXA A;  2KTR B;  4XDD A;  4TQR A;  1ZQH A;  2KHW B;  3E56 A;  2RPQ A;  1ZOL A;  3P1M A;  4KIT B;  4IQV A;  4I2J A;  3U4E G;  1XLP A;  1O08 A;  5L1J A;  4TKN A;  1WSP A;  3ZUN A;  1EO6 A;  3OWE B;  9ICJ A;  3MP9 A;  3VCB A;  3ZDC A;  4MFF A;  2MUT A;  3MR3 A;  1F9J A;  4ZHP A;  3AU2 A;  2BGF A;  4M00 A;  4LDT D;  4LDT B;  4UAU A;  5DBC A;  5HHH A;  3LK9 A;  4ECY A;  5L9X A;  1GB4 A;  4LK0 M;  2C5L C;  5D7G A;  4DOA A;  2ESE A;  2AGP A;  1TZ1 A;  3GE8 C;  3BWU D;  4CCH A;  4XRH A;  4BBN F;  2DPJ A;  4NNJ B;  4QZB A;  2N4F A;  5KFW A;  3MFI A;  1L7O A;  5DDM A;  2V3N A;  3ZLZ A;  3JVZ X;  2LM4 A;  4ZRI A;  1OGW A;  2NRV A;  2ALZ A;  1GJZ A;  1QZE A;  8ICX A;  4KGS A;  3I5J C;  1KW4 A;  1U9L A;  2WXO A;  3AE7 B;  1WCN A;  4HDO A;  1B43 A;  2BCQ A;  1ZQZ A;  2LGY A;  5FKA C;  1XC9 A;  2H3V A;  4YD1 A;  2EZZ A;  3MC0 B;  4LJO B;  3NG0 A;  3VFK A;  4UAV A;  2FMS A;  1QCK A;  5ALT A;  3KHL A;  3AE9 B;  4I2G A;  2L8J A;  1XSL A;  3N28 A;  3SFE B;  4ECR A;  1WR6 E;  3B0Y A;  1LB2 B;  4P0P B;  3S2A A;  2E5S A;  3NZS A;  8ICZ A;  2PIA A;  2M4N A;  5D94 A;  2QB0 A;  1U49 A;  3PR4 A;  5AUI A;  4I2E A;  1WJ4 A;  1E10 A;  4FBJ B;  4KGT A;  1XWL A;  3LDZ E;  2B6G A;  3SD7 A;  2ZTE A;  2JRZ A;  1KJT A;  4IWO A;  2LGX A;  2OCE A;  4JV2 A;  3BK2 A;  2MU2 A;  4QNL A;  2M0A A;  3QCA A;  2ZIV B;  2JXJ A;  1HZ5 A;  1C1Y B;  4R8U B;  5ALK A;  3MBY A;  1U45 A;  4YTN B;  1PK1 B;  1P0R A;  2JYT A;  4I6P A;  3TBL D;  1UEL A;  4NAW B;  3ZDD A;  1MPE A;  3V7K A;  1Z00 A;  2QAR A;  2W8L A;  3MC1 A;  2KN5 A;  2N1V A;  2RDG A;  1I4X A;  2K9X A;  3DVN V;  4AJW A;  4AUQ C;  4PGY A;  2KX0 A;  3MFG A;  8ICA A;  2K8C B;  4G3X B;  3RRG A;  1OEY A;  3WIM A;  1T94 A;  3M63 B;  3L4P A;  2YB4 A;  1ROE A;  3QZ7 A;  3OJ3 A;  5KG7 A;  4MGZ E;  1JX4 A;  3UXP A;  3ZDB A;  2WXP A;  2N7J A;  2LXC A;  2FBW B;  2ZXH A;  4GC6 A;  2BCR A;  4NY8 A;  8ICY A;  5J0T A;  1WGG A;  4MM3 A;  3ISD A;  1D4B A;  3GV8 B;  7ICH A;  2PFO A;  1E90 A;  5AKJ A;  3W5V B;  2K1F A;  1JWM D;  2Y1I A;  1K53 A;  2BB5 A;  4QZF A;  3U8Z A;  3M6Z A;  3ZKJ C;  4BWM A;  2WB1 F;  4Y2Y A;  4EYH B;  4MT5 A;  5AM5 A;  4Y2U A;  3RUL A;  3MAB A;  5KFN A;  3ONN A;  1U47 A;  3I57 A;  1SE9 A;  3RNB C;  4EEY A;  3M62 B;  1BPB A;  1DOQ A;  4QWC A;  3MJW A;  1AN8 A;  4US8 A;  4UDU C;  3T79 A;  3PRM B;  1BPX A;  5HR7 A;  1VRA B;  2R2O A;  2AL3 A;  1KH0 A;  3L10 B;  1TK8 A;  2DYB A;  4LNI A;  5JUM A;  4PHD A;  4HYK A;  3RJI A;  2PFQ A;  1ZUD 2;  2Y5B B;  4K7W A;  4P6V F;  3R7Q A;  5KNI A;  2JHD A;  1ZKH A;  1WGY A;  3TAC B;  3GP7 A;  4F3O A;  2PVO D;  2EEL A;  3C8Y A;  2L76 A;  4J3O D;  3DVN U;  5HG2 A;  5IIK A;  4AYB F;  5J2I A;  4DLE A;  3M7D A;  5GTI U;  5J2J A;  2L00 B;  2H3F A;  2BKE A;  2ZW0 A;  1COO A;  2HE7 A;  2K8B A;  4UAS A;  4KKI A;  3IAM 1;  1UGM A;  2KNJ A;  4Z6C A;  5AKX A;  3VVW B;  1DYQ A;  4KLT A;  3TAD C;  1C7Y A;  1WI0 A;  1N62 A;  3UMG A;  2BCV A;  2OEH A;  2BYT A;  3C5F A;  4IRC A;  3QE9 Y;  3NHE B;  2EKI A;  1T8E A;  5J2R A;  1SXD A;  3PLV A;  5DKW A;  1KLV A;  4QZ9 A;  2QDF A;  1V1O A;  2OM6 A;  4LZD A;  3C2L A;  1DOI A;  1IYF A;  4Y2X A;  3T5L A;  2ZIW A;  3ETR A;  3WK8 A;  2UVU A;  1SEB D;  4NJ7 A;  2LGI A;  2GWS A;  3ED5 A;  1I42 A;  4W9E A;  5BMH A;  3WAO A;  1P9D U;  5KT3 A;  2KFJ A;  2NCN A;  3PX6 A;  4L1B A;  4DSL A;  1XT9 B;  1UH6 A;  3ETL A;  2YX8 A;  4CYE A;  2BDP A;  3RAX A;  3L0W B;  3JPP A;  3BQ1 A;  3RFZ B;  3BYT B;  3KHR A;  3LXF A;  4CF5 A;  7ICE A;  2CJO A;  4OVZ A;  4XC2 A;  2K4H A;  3TAD A;  4DL4 A;  1TS2 A;  3DBR I;  1JWB D;  4NLK A;  1ZE3 D;  2NMQ A;  4B6W A;  3RF9 A;  3UIN B;  2KZM A;  2G09 A;  5F3X B;  3TAQ A;  4ED6 A;  4EZJ A;  4TUP A;  4Q43 A;  2FUH B;  3QIJ A;  2ODG A;  1P1A A;  4I2C A;  1J7A A;  1V9P A;  4UB4 A;  4O5K A;  4F50 A;  5J0X A;  2AQ1 B;  2XY5 A;  3ORY A;  2A1J B;  3N1X C;  2HBJ A;  2OJR A;  5KFR A;  5ALH A;  1OUQ A;  3APD A;  2N9K A;  1HJP A;  3HJE A;  4J9M A;  3ALR A;  3BQ0 A;  2DWQ A;  5D49 A;  3U7D A;  1KFS A;  5FK9 C;  2HD5 B;  2AQ3 B;  3DHH C;  2M0X A;  2WAQ F;  3EEC A;  4NLC A;  1YOV B;  2F2A B;  3Q69 A;  3ECI A;  2LAS A;  1DOX A;  1QSY A;  3NJT A;  5H2F U;  3HRD D;  3F2B A;  1VZ6 A;  2K5P A;  3RBD A;  8ICE A;  3H7I A;  4UQG A;  2RRD A;  3P2B A;  4WAA A;  3MGV A;  2W9C A;  1WE7 A;  1Y88 A;  2R2Q A;  4KDL B;  2JRH A;  3CMM B;  4C4S A;  4YWG G;  3QU5 A;  2WQY B;  1PK3 A;  4OZC A;  1SXE A;  1ZYQ A;  1TV9 A;  4AQ7 A;  1QOG A;  3TEX A;  4CRX A;  1Z4O A;  3RBE A;  2WXN A;  1F0Z A;  2QEJ C;  3C2K A;  2KSO B;  1E8W A;  5KFT A;  4J03 A;  1JRU A;  2VZK D;  3QA8 A;  3IV6 A;  2WXH A;  2KK8 A;  1WJ6 A;  1PGA A;  2R8H A;  4YR3 A;  2FCN A;  2KVR A;  4NAM A;  2LZ6 A;  2IA6 A;  3BQT A;  5KFO A;  5KFA A;  3H6N A;  4A3P A;  3H8J A;  1T3Q A;  1ZXI A;  2JZB A;  4GC7 A;  4MEX A;  4DS5 A;  1ZQQ A;  4JWU C;  3W2D A;  1S0M A;  3OTQ A;  5KFS A;  4M02 A;  5KAF U;  1V8C A;  2JXT A;  2L52 A;  2FLP A;  2L32 A;  2NV3 A;  5CTR C;  2BZF A;  3SFD B;  3A0H U;  5ALZ A;  5FR3 A;  2XVT A;  4KVG B;  2KQ4 X;  5ALL A;  4NQK E;  3TAN A;  1E8Z A;  5AUK A;  1KLU D;  2NBU A;  2HW3 A;  2G9H D;  4DSK A;  1L2N A;  1X6I A;  2XO7 A;  4OJ5 A;  2MRP A;  3ALB A;  2KO3 A;  2BQ3 A;  2GBJ A;  3OJS A;  3ICX A;  3SQI A;  1K1S A;  3UQ2 A;  5I4D A;  2YMM A;  5KFC A;  2C22 A;  2WFA A;  1ET6 A;  1F5S A;  2GBM A;  3V6E B;  3Q8L A;  1RQN A;  3PO4 A;  3PO5 A;  1VZ7 A;  4MEY A;  1NK5 A;  3N20 C;  4GDL A;  1JW9 D;  3CF6 E;  2A19 A;  2HTH A;  2W9B B;  3DDC B;  3RH5 A;  1UZX B;  2GMI C;  4HVB A;  3C1Z A;  2FUG 1;  2QSD A;  3H1U A;  1DGJ A;  4KLD A;  2EZX A;  2AHO B;  1YJI A;  2NTS A;  1WXM A;  4E74 A;  4OZA A;  2VJ5 A;  4RQM A;  3B1L X;  4Y2S A;  2ICI A;  1T0R C;  4FUL A;  9ICR A;  3VH4 B;  1CQV A;  2WDR B;  1UT8 A;  3RR8 A;  1ZQB A;  3IBE A;  4RZR A;  1RFK A;  5KT6 A;  1D5X C;  3NZ3 A;  4NWI A;  3WK9 A;  1QIL A;  5CHV C;  4DFP A;  2SEB D;  2ZJA A;  4O3O A;  2F1H A;  3RI7 C;  2QCZ A;  3LJ3 A;  4PYZ A;  9ICU A;  2QJL A;  3AEB B;  1QQ7 A;  3T5K A;  4ECZ A;  4F71 A;  4F4K A;  3E58 A;  2WXF A;  4UB2 A;  1TTN A;  2FIF A;  2WDV B;  3UMC A;  1WCL A;  4W9F A;  3GZN I;  3UI3 A;  2MH7 A;  3P4S B;  4NLG A;  3OHB A;  3BIN A;  4C0Z A;  4QWE A;  3IXS A;  4BVU C;  5CB1 A;  1IIP A;  1K1Q A;  2IOH A;  1X2I A;  4C4T A;  3C2M A;  1PQS A;  2AYO B;  3H9D A;  2AGO A;  2W9N A;  4WJO A;  4F5N A;  3CNH A;  3SI8 A;  2JV3 A;  2BT6 A;  3AU5 A;  1KTQ A;  5DLG A;  2NPT A;  3F2C A;  2BYV E;  5KFX A;  1A77 A;  4CE6 A;  3LWM A;  3GZF A;  2DAJ A;  1WXS A;  4RQ3 A;  7ICF A;  2DBY A;  5DDY A;  3JSV B;  1MHX A;  3UPQ A;  3FDS A;  2OWO A;  2K39 A;  2F1I A;  3PSF A;  4P4P A;  1ZQY A;  3Q3N C;  1GPX A;  2K6D B;  5AI5 A;  3RNC C;  4RQ8 A;  1NKB A;  3ZJT A;  5AKH A;  2BBC A;  2RDB C;  3Q8A A;  1J7C A;  3J9C A;  8ICG A;  3KZI U;  1L7Y A;  3L08 A;  5J0Y A;  1T0Y A;  3MHS D;  3N9Y C;  4L23 A;  2XBB C;  3QEB Z;  5J2A A;  4ED8 A;  3L13 A;  5BO4 B;  2HHW A;  4KX3 A;  1FXI A;  5AK6 A;  3AEG B;  3NOB A;  4KLO A;  2KP7 A;  4FS2 A;  5HMM A;  1T0S C;  1OEY J;  4IWP A;  4KDI C;  1KF6 B;  3V61 A;  4PYU A;  2BKF A;  5AHX A;  1JCK B;  2AGQ A;  1E5W A;  2RLT A;  1EWY C;  5III A;  5MPO A;  3LVV A;  5IAA C;  5KFF A;  2MUT B;  3LVW A;  2QKQ A;  5KAI U;  1X40 A;  1YN3 A;  2ACZ B;  3VHT C;  4O3P A;  1NK4 A;  1P7E A;  2PE6 B;  4DL5 A;  1V1P B;  1ESF A;  2I1J A;  3HP6 A;  2KVC A;  3WKD A;  4IWQ A;  2ON8 A;  2XGQ A;  5ALN A;  3KD3 A;  4X5V A;  4ELT A;  1XO3 A;  2LI6 A;  2XY7 A;  4M47 A;  2WHI A;  4IM3 A;  2VH2 A;  1Q3V A;  1E7V A;  5L1I A;  1L3S A;  3ZRF A;  1SBB B;  5EE1 A;  4QW9 A;  4KMO B;  4CHK A;  2YMP A;  4U7C A;  1XS9 D;  3BII D;  4NM2 A;  4FLH A;  4EEW A;  2DYO A;  2C7H A;  4FS1 A;  3PY8 A;  4TUR A;  1MSW D;  3RB4 A;  3IAS 1;  2JH1 A;  1WIA A;  4IM2 A;  5D3I B;  2IGG A;  4GB9 A;  1B9R A;  4HAI A;  1L3T A;  4IRK A;  4ANV A;  4IM0 A;  1R4M I;  2WP9 B;  3F2D A;  4IR1 A;  3AM9 A;  4QZH A;  2DAF A;  3W1S A;  2JEJ A;  3JYU A;  2LRU A;  4ICA A;  1AWD A;  4F7Z A;  2QB0 B;  1I4Q A;  1HXY D;  3AEA B;  4WWP A;  5KFE A;  4QZE A;  2ZIU A;  2W3R A;  9ICN A;  1NK0 A;  1ZDV A;  2ASQ A;  1N63 A;  5JTI A;  4ED3 A;  4GLS C;  3PX4 A;  1NK8 A;  4PS3 A;  2J6T A;  4BAX A;  4K3C A;  1TZO A;  3CST A;  3U2S C;  5DPW A;  2IOF A;  5J0U A;  3KZX A;  2VRR B;  4YXJ A;  2OHF A;  4C8N A;  2XCP A;  4NY0 A;  1PUZ A;  3GIL A;  4GXK A;  2HHV A;  2WU2 B;  1WH3 A;  1Z00 B;  2QAR B;  1YN5 A;  5KL8 B;  4RQ5 A;  4NXZ A;  2K89 A;  5EE9 A;  3VQI A;  1D8Y A;  3H7S A;  2EAP A;  1SWW A;  4HWI B;  2JEF A;  2YLM A;  4W9K A;  2NRT A;  5AKY A;  3TEW A;  1X66 A;  2H88 B;  3K4G A;  3IN5 A;  1R7S A;  4QAY A;  2RMM A;  4EUT A;  4RFB A;  3R7R A;  2KOX A;  1JRO A;  2V3P A;  3H0R B;  4MM3 B;  8ICW A;  4CF3 A;  1IBX A;  1IPG A;  4RT2 A;  4OVU A;  4F5Q A;  2PPH A;  4AJY B;  2KMA A;  4IQU A;  2RHF A;  4J9L A;  2C7M B;  2N9L A;  2YML A;  2E1F A;  3NZU A;  3O13 A;  1WWV A;  5AIC A;  1L4D B;  4YQW A;  1D3Z A;  1VLB A;  2LYB A;  4F8C B;  4F4Y A;  1DXS A;  4F4X A;  2GBR A;  4OD0 A;  3UIO B;  2KJ5 A;  3F53 A;  4UB8 U;  1N61 A;  1FFU A;  3TUO A;  3QEA Z;  4B9S A;  1SGH A;  1U4B A;  4M9J A;  1GAQ B;  1SKR A;  2KOB A;  3V7J A;  5J17 A;  1ECW A;  1LKY A;  4XA5 A;  2MBH A;  3ENE A;  1NZP A;  4YR2 A;  1YIW A;  1M6Y A;  4TMA B;  7ICI A;  3B0A A;  3HM3 A;  3HKZ F;  1BML C;  4Z6D A;  4ELV A;  9ICO A;  1L8L A;  1MC8 A;  4FBT A;  3CWI A;  3KFU F;  3TL5 A;  4C8M A;  2LPE A;  3J81 j;  4Q8F A;  2IBI B;  1ZD2 P;  4F4Z A;  5DB8 A;  1F2R I;  1AYF A;  3RZW C;  3V3X A;  2P35 A;  2YN4 A;  1JN3 A;  1COK A;  3QNM A;  4IL6 U;  9ICV A;  1LXD A;  4DFK A;  4EZ6 A;  3RAQ A;  2DZM A;  4ICV A;  3VUY A;  4WIP A;  3TFR A;  3RNE C;  2UYZ B;  5L1L A;  3MFH A;  1V5O A;  2BS3 B;  3TQ1 A;  3DVG X;  2HTM E;  2ZUB A;  4B9V A;  5DG7 A;  2HI0 A;  2FE8 A;  3DVG Y;  1NJX A;  8ICB A;  1KFY B;  1QT9 A;  5GTH U;  1YJJ A;  3FYH A;  3G6Y A;  5KFP A;  3Q8Q B;  1D8B A;  2O6V D;  1VCB A;  2O6V B;  2W8K A;  5CWR A;  4DHZ B;  4UW9 A;  2AQ0 A;  5EOZ A;  3UMB A;  2BW2 A;  4W9C A;  1SZH A;  9ICE A;  2KJ8 A;  4KLG A;  2I38 A;  5A0L A;  4J9K A;  4QZ8 A;  8ICR A;  2PMZ C;  4Y2R A;  2KIV A;  3PW4 A;  1L3U A;  4OZB A;  3V62 A;  5CRX A;  4QWB A;  3AEF B;  5CJ7 A;  1S0N A;  2N7E A;  4JWS C;  4P0Q B;  2L7R A;  4RNM A;  1IG6 A;  1UF0 A;  1EXN A;  2KNB A;  3DPD A;  2G08 A;  5CHF A;  1PUT A;  5KFK A;  4DSF A;  1JXE A;  3A0B U;  4IRD A;  2DZJ A;  1KFT A;  2GLE A;  4LTU A;  4RUA A;  1ZJM A;  3QZ8 A;  4BKT A;  1WYW B;  3PLU A;  2HHT A;  1LFD A;  1CK1 A;  5D4B A;  1PDX A;  4DBG A;  1BUI C;  4FZL A;  5J0S A;  2LUM A;  3JPN A;  1B1Z A;  3KW5 B;  4F91 B;  2MP2 A;  2OH2 A;  5DPR A;  2Y1J A;  1H8C A;  2V4L A;  3N7S C;  4K81 A;  5G5G A;  1B22 A;  4YR0 A;  3NRZ A;  3AE2 B;  1ZQX A;  1WRD B;  2V0G A;  2WLB A;  4RCO A;  4OO1 J;  2HMX A;  2W82 A;  2C2D A;  4M01 A;  2JSV X;  5IIN A;  3U26 A;  1TK0 A;  3RZF A;  4UAR A;  2JWU A;  3EUB 2;  4ASW C;  1BVS A;  3KYD D;  4P7I A;  2YEP F;  4KSK C;  5KFL A;  4K4H A;  4RQ7 A;  5G2N A;  1CRX A;  2JWZ A;  2J6U A;  4ED7 A;  1LVH A;  1ZQV A;  2Y0S F;  4GU2 A;  2DL0 A;  2LKY A;  3CRX A;  4GN1 A;  1YZ7 A;  3A33 B;  2GRI A;  4BXO A;  1UWM A;  4GDK B;  2WXI A;  1NVI D;  3R8B A;  3WAP A;  4EEN A;  2JZB B;  4QZD A;  3WAL A;  3M8R A;  3PZD A;  4UB5 A;  3RJH A;  2RSU A;  2B21 A;  5GMV A;  4DFJ A;  4DL6 A;  2BPS A;  1QOB A;  3DWM A;  1V97 A;  7ICV A;  4M6W A;  2O2V A;  1FCL A;  1XLN A;  5D46 A;  3HHM A;  1D5Z C;  1Q8K A;  3QJZ A;  2PVG C;  5L1K A;  1Y8R C;  2PI4 A;  1ZQD A;  3RRH A;  3Q8E A;  4AP4 C;  1TS5 A;  2D3D A;  1WX7 A;  3PZ7 A;  3MHZ A;  4QWA A;  2VKQ A;  4MFA A;  2YY6 A;  4EEL A;  4FO6 A;  1RQL A;  2NS5 A;  1C3T A;  5KFV A;  2KK0 A;  4BWJ A;  4DFD A;  3RT3 B;  1XF5 L;  3KUZ A;  3O0F A;  5BYR A;  2CKH B;  3DOW A;  4ZH4 A;  9ICM A;  3B9J A;  1H38 A;  3ZVV A;  2VJ4 A;  4DWF A;  1MN8 A;  5J2F A;  4MAC A;  1BPZ A;  3KUC B;  1S77 D;  4GDL B;  4H2A A;  4ZDV A;  4GXI A;  2BQU A;  3IT4 B;  3TKA A;  2KAN A;  4XWW A;  4UAT A;  2Y5C A;  1WRI A;  5E6N A;  1RM6 C;  3DBL I;  4KLF A;  2R61 A;  4YSY B;  4K4I A;  7ICQ A;  1L7M A;  3LYS A;  3DHI C;  1UA0 A;  3I1Y A;  3WK4 A;  8ICH A;  4QZA A;  4MDK E;  2BHN A;  1M4V A;  2KC2 A;  2EKE C;  2V4Q A;  3TCA A;  2J53 A;  3CIR B;  2ASD A;  3BJY A;  4LNO A;  1V81 A;  5JRT A;  4GIB A;  3GU3 A;  4W9I A;  3TEZ A;  4BBN C;  3OJU A;  1XXG A;  2WXJ A;  2Z0D B;  3ML8 A;  2E8O A;  1KDH A;  2B76 B;  2KJ6 A;  5J0R A;  4ANX A;  5KFJ A;  2JU6 X;  4EEK A;  2KWU B;  5KFH A;  3PST A;  4PL1 A;  3GOE A;  2KLG A;  3AV8 A;  2RQ5 A;  2AEH A;  3SAH A;  2N9E B;  4FFD A;  2MCN B;  4TSS A;  1ZPS A;  4BUG A;  4DQQ A;  3KKA C;  5ALE A;  3V7L A;  2A1A A;  1ZQI A;  1WF9 A;  2ZNV B;  3DBH B;  1Z19 A;  2BQR A;  1RG6 A;  1XLO A;  4WWM A;  4NLN A;  1IXR A;  1XO1 A;  2CU1 A;  1WX8 A;  2J52 A;  5H92 C;  4CO7 A;  3N32 A;  5DQI A;  1PZN A;  4B95 A;  1N2X A;  3RJK A;  9ICP A;  2IO1 B;  3PW7 A;  2Y5P A;  3WKE A;  1C76 A;  5J0O A;  3PML A;  2DPI A;  4J9R A;  5KG5 A;  1SB3 C;  3RB0 A;  3IP4 B;  3BS5 A;  5KG4 A;  3H0L B;  1I4G A;  2HHS A;  2GLS A;  4IDI A;  2MBE A;  1WGR A;  2HDO A;  2XIC A;  2IZV B;  1MFW A;  1EWC A;  4QIW F;  3BZC A;  1ZRM A;  2KZR A;  3FC4 A;  3KKA A;  5D2M B;  5AKZ A;  2PTL A;  4A55 A;  3KH0 A;  3QAQ A;  2JH7 A;  2J4X A;  4J9P A;  4M0A A;  2FAZ A;  3U7Z A;  3UF8 A;  4KIK A;  3C21 A;  3KBB A;  5D3D A;  1GUA B;  2K25 A;  1C20 A;  4DQO C;  4TUS A;  2LFI A;  1IGD A;  4TQ0 A;  3QU2 A;  2IJ0 A;  4DSI A;  3RNF C;  1L6U A;  3SYZ A;  5KFB A;  1WJN A;  3V6H A;  1OW5 A;  2EDU A;  4BGD A;  4BKS D;  2FID A;  3BYY B;  1D9D A;  4A9A A;  2WU5 B;  1XU4 A;  3RMK C;  4I2D A;  3KTQ A;  2WXG A;  2PFP A;  2HOQ A;  1V49 A;  4M0W A;  2WWZ A;  1WWT A;  1FD6 A;  1TFR A;  2I1K A;  1AQ6 A;  2JT4 B;  1SIF A;  2KN7 A;  3DWG C;  2WB1 C;  2BWE S;  2C28 A;  3Q3M C;  4DL7 A;  1T7P A;  2Z7J A;  1ZQO A;  1XNS A;  3SAG A;  1UGJ A;  2AWT A;  2Z0E B;  4JL9 A;  3VTV A;  4YSZ B;  9ICT A;  3JW0 X;  3WCQ A;  5DBA A;  2WX0 A;  4UAY A;  3A4S C;  1OTR B;  5AZF A;  2FPK A;  4A90 A;  1JML A;  3T3O A;  2W04 A;  5JXV A;  2D10 A;  1RPL A;  4J6I A;  4JIO U;  2MBQ A;  4C7Z A;  4Z6F A;  5HR6 A;  1QOF A;  4KTQ A;  2KDM A;  2ZCB A;  4XYC A;  2DYM A;  3WA0 A;  4YCX A;  4C4V B;  2IMW P;  1FRD A;  2I5H A;  2BTE A;  4C8K A;  8ICN A;  2KYW A;  2REX A;  2FNJ B;  4BDP A;  3AI5 A;  2H3Q A;  1A6S A;  2NRX A;  4AYB C;  2K22 A;  3AEV A;  3W1Y A;  3RB3 A;  1YD8 U;  2KWD A;  4FZM A;  5DB7 A;  2FPL A;  3PRE A;  5TR5 A;  3EYZ A;  1WZ0 A;  3K1R B;  4ZRP A;  1FXA A;  4O3Q A;  1BPY A;  3MTN B;  2W11 A;  2K8A A;  3I28 A;  2WF5 A;  8ICT A;  1B0X A;  1X42 A;  4M2Y A;  3T3F A;  3MC8 A;  2LMR A;  1L0Y B;  5HML A;  3D2N A;  4QJF B;  3F5E A;  2G5I B;  3SAF A;  1OQQ A;  2XN9 C;  5ALF A;  1YMH E;  4I2B A;  4BJQ A;  5JZE B;  2PFN A;  3FAH A;  3A9K A;  2DNF A;  1KTK A;  2BR0 A;  3ZNH B;  2A4Z A;  3PV8 A;  4M9N A;  1J0G A;  3L5K A;  1UNS A;  2KIC A;  3V6J A;  4RPY A;  3WKA A;  3UM9 A;  4UB6 U;  2LI5 A;  3DHG C;  1TS4 A;  4KZC A;  3HT3 A;  5KFG A;  3AE3 B;  1IUE A;  4A6Q A;  5KG3 A;  4W9L A;  4K1R B;  1GNU A;  2BVC A;  3BVM A;  1UCV A;  1IBX B;  2I1Q A;  5ALQ A;  4C80 A;  2B3A A;  4A8X C;  2KVZ A;  3PV1 A;  2D3C A;  1NI3 A;  1H4R A;  1XLQ A;  4ED2 A;  2MJE A;  1E8Y A;  2KDF B;  3BY4 B;  1RXW A;  5KHO A;  5JU5 A;  5F9N A;  4UBC A;  1F52 A;  1RLF A;  3M3J A;  4OW0 A;  4WQO B;  2YMQ A;  2AX5 A;  4DCC A;  2KMM A;  2MWS B;  3TAP A;  2KKV A;  1L0X B;  1QKZ A;  4JWM A;  3A9J A;  4C56 C;  9ICC A;  1IP9 A;  2ZPY A;  4HLE A;  2BF8 B;  2J7Q B;  1V85 A;  3AQE A;  1TAQ A;  1B4F A;  4KLE A;  1TY2 A;  2INN E;  4HRS A;  5TSS A;  2R8I A;  2H3I A;  1JAL A;  2LD9 A;  3UXN A;  2KWV B;  3AU6 A;  3QHT A;  2WAQ C;  2JZP A;  2FMP A;  1EU3 A;  2AH5 A;  4S17 A;  4O3S A;  2EAO A;  2C2E A;  1ET9 A;  3C29 A;  2WF9 A;  2BCU A;  1ZQG A;  1VD2 A;  2PMV A;  1RXV A;  3OJ4 B;  4F1S A;  1UPH A;  3VRA B;  4KLL A;  1KM7 A;  3ZO5 B;  4YMO A;  4F2S A;  9ICX A;  5AZH A;  3ZDA A;  4B9T A;  3AU4 A;  9ICH A;  3ZJU A;  1KKX A;  5DBB A;  5HI1 A;  2W43 A;  2DHZ A;  2HDE A;  1SIJ A;  4DDI D;  7ICP A;  1BXT A;  4C8L A;  4J9O A;  4I29 A;  2GBN A;  2UU7 A;  1ED1 A;  4P0P A;  2NTT A;  1ZRN A;  1V5T A;  3IVF A;  4D2K A;  3PNC A;  2WHE A;  3VR8 B;  3WK6 A;  1L0V B;  3R2I A;  4LNK A;  4R65 A;  2LHE A;  2W7P A;  4DQS A;  2V1Y A;  2ZNV C;  1FO4 A;  2H5X A;  3DQV A;  3P4P B;  5J2D A;  5BMI A;  4MF8 A;  3PR5 B;  4URK A;  2X8X X;  1TKD A;  3T5H A;  1ZQP A;  5IO9 A;  1E7P B;  4NJC A;  3H40 A;  1V86 A;  2ZIV A;  2CJN A;  2UWQ A;  1V80 A;  1WX9 A;  5FR6 A;  1L6N A;  4ACO A;  5J8Y C;  3PX0 A;  1HEZ E;  2LMC A;  2P66 A;  5BOL A;  2DFL A;  5KT5 A;  1PK1 A;  4DF8 A;  2L0T A;  4F92 B;  3NVV A;  5ALS A;  2IY1 B;  1T4G A;  3BVG A;  1Q3U A;  1FPY A;  4OJ6 A;  1MG4 A;  1L7P A;  5KTQ A;  1OFF A;  2V4I B;  5IOI A;  4HPP A;  2P6U A;  2K60 A;  2BGW A;  5C23 A;  1U48 A;  1QTM A;  1STE A;  4OCZ A;  3GZN B;  3DDH A;  1V6E A;  1QSS A;  1MHH E;  4YL8 A;  5DG8 A;  4P4O A;  1YT3 A;  4XWT A;  3P63 A;  4LJX A;  3RD2 A;  3RUI B;  2JRI B;  4UB1 A;  3N7P D;  2OJW A;  1KEJ A;  3H0M B;  3HW8 A;  4ED1 A;  5AK3 A;  5J0Q A;  1TBE A;  2MBO A;  3QUQ A;  4UBB A;  3RYT A;  4OJP A;  2CN1 A;  2C9W B;  3KVF B;  4J9N A;  7ICL A;  1NK6 A;  4DSJ A;  1RYR A;  2G0A A;  2ZIX A;  1ZQT A;  4WJN A;  2EAM A;  1S1Q B;  4ECV A;  2F44 A;  5J8Y A;  4PHP A;  2W03 A;  2ZZP B;  1XCQ L;  4ZRJ A;  4ANW A;  4B9L A;  3P4R B;  3GS2 A;  4TUQ A;  4QW8 A;  3QYP A;  1N6Z A;  3C23 A;  5EDS A;  3PW0 A;  4R66 A;  2JY6 A;  3BDP A;  3B0X A;  2ZVO A;  5B66 U;  4F72 A;  3N97 B;  1F44 A;  2ZTD A;  2IO0 B;  1QLB B;  4HCN B;  4F4W A;  3Q8K A;  2QHO A;  4WWN A;  2SAK A;  7ICS A;  2MP2 B;  1I4P A;  3ZRC A;  4FAD A;  3NAS A;  1Q1O A;  4RM9 A;  3T5J A;  1RYU A;  7ICR A;  9ICW A;  2WDQ B;  2MSE D;  2F1J A;  3EFU A;  1EUV B;  1SL2 A;  2J6S A;  5IA7 A;  1A5R A;  1KOT A;  2AL6 A;  3MGH A;  3MR6 A;  8ICQ A;  4DXA B;  2KDE B;  8ICO A;  1AW7 A;  5KG6 A;  1WE6 A;  4G11 A;  3W1S C;  3RH4 A;  3ZXR A;  2IHN A;  2FCQ A;  3ISB A;  3RJG A;  2HHX A;  2LVP A;  5HKH A;  4NL9 C;  3I9V 1;  3ONS A;  5ALX A;  5E6P A;  3NUH B;  4MEL A;  3Q3F A;  1YX6 B;  4G50 A;  2MJ3 A;  4BXO B;  4MGY E;  5DQH A;  4W9J A;  1K5O A;  2HOI A;  2JZZ A;  3LB8 C;  3APF A;  4HDQ A;  4F5O A;  3KWV A;  7ICG A;  1IGC A;  2MLB A;  4WAF A;  1BNP A;  2CS4 A;  4JUZ A;  4C00 A;  4M6W B;  3SMV A;  4KLJ A;  2GB1 A;  3AEC B;  1WMH A;  2F8L A;  4PH5 A;  2O2V B;  2FI1 A;  4KGR A;  2VA8 A;  3ZTC A;  3QU4 A;  3ABV B;  2M9N A;  2KG5 A;  3NVY A;  3HIZ A;  2WF7 A;  4FXC A;  1KSP A;  4KKJ A;  4I27 A;  2GI9 A;  4OVV A;  4W9G A;  5H8Y E;  2D3G A;  1EF5 A;  1V2Y A;  4EZL A;  3APC A;  2LHT A;  5AKI A;  2XC9 A;  5AK4 A;  4DL3 A;  4P1C C;  5C1Z A;  4NL9 A;  4B0M A;  1LO5 D;  5CX3 A;  2Z59 B;  1L5P A;  3Q8F A;  5J18 A;  3N1Y C;  4FHK A;  4Y2Q A;  4Z6E A;  1SJE D;  1R4N I;  2IDY A;  2M1M A;  2LGD A;  2MA1 A;  3JPQ A;  4C8O A;  1UBQ A;  3Q6B A;  4DQP A;  2N0S B;  1TE2 A;  5B5E U;  2ZTC A;  3VTU A;  3JPT A;  2A1J A;  3RH6 A;  4AWJ A;  4REZ A;  1FMA D;  1NJY A;  1TKG A;  2VA3 A;  3SR6 A;  3PZ8 A;  4HPL B;  1JXL A;  4DLG A;  2KMC A;  2WYQ A;  2V9W A;  3D2S A;  3U52 E;  2ATL A;  4RUC A;  3IHP C;  3Q8B A;  4PJ0 U;  2F77 X;  3EW9 A;  2D8C A;  5E6O A;  4IG7 B;  1GB1 A;  4BOS C;  3B08 A;  4YP3 A;  4O1N A;  3NVZ A;  4B9K A;  1UHU A;  3OSP A;  3IDW A;  1HQR D;  1ZDX A;  4GXJ A;  2XY6 A;  4BX9 C;  1HIW A;  3HX0 A;  2NRW A;  3URY A;  5KFZ A;  2ZUC A;  1UBI A;  3I63 C;  3JPS A;  4EFO A;  1KRH A;  2L05 A;  4IS7 A;  4BKG A;  3BVZ A;  4ECQ A;  3AEE B;  4M8N A;  4DXG A;  4P2H A;  5EE3 A;  1LM8 B;  3THV A;  1BPD A;  3Q8P B;  3FKY A;  2BYF A;  2FJ6 A;  4O5C A;  2WXM A;  3UQA A;  1X1M A;  1UD7 A;  4PK1 A;  1PYW D;  1X6J A;  2KN4 A;  4CDG A;  4K3B A;  1XEE A;  3ZGZ A;  4P4M A;  1ZQF A;  3OSN A;  1BNO A;  4BFR A;  4EBC A;  4BZA A;  5G55 A;  1ZD4 A;  3PVX A;  4G9B A;  3ISC A;  4B9U A;  1FCC C;  1LQB A;  4O3M A;  4WWO A;  4B9N A;  2LUE A;  1K51 A;  1J2N A;  3PSI A;  4YVZ A;  3M9N B;  1GOZ A;  2GOW A;  2EMT A;  2ZJD A;  1NJW A;  3RCZ A;  3PRP B;  3BZD B;  2JGA A;  1Z1V A;  2H89 B;  4YFK A;  4O9M A;  3BS5 B;  1M94 A;  5C0Y A; 
#chains in the Genus database with same CATH homology
 5FK9 C;  2AQ3 B;  5GXG B;  3AN1 A;  1JWA D;  4MAC A;  3AE8 B;  3Q69 A;  1D6E C;  4H2A A;  4GDL B;  1C4A A;  1DOX A;  3GB1 A;  3IT4 B;  3HRD D;  4XWW A;  4YTP B;  2Y5C A;  1VZ6 A;  1WRI A;  2K5P A;  4JE3 B;  1RM6 C;  2RDH A;  2ZW1 A;  2R61 A;  3E9S A;  1TJE A;  3MJ5 A;  4YSY B;  1N5X A;  3EA6 A;  3T3N A;  4RGN A;  4HJG E;  4YWG G;  1M4V A;  2WQY B;  3W5U B;  4US9 A;  4OZC A;  2INP E;  2J53 A;  3CIR B;  3PO0 A;  5T8I A;  4AQ7 A;  1QOG A;  2ONQ A;  3TEX A;  3TEZ A;  1SF0 A;  2WXN A;  4C7Y A;  1F0Z A;  2QEJ C;  1XXG A;  2WXJ A;  2VZK D;  2WXH A;  2W54 A;  4TQ1 A;  2B76 B;  1PGA A;  1VJK A;  1WXQ A;  4NAM A;  2Q5W D;  2JU6 X;  3AE1 B;  3IT6 B;  4RH6 A;  2OED A;  2QIE B;  3KLS X;  3AV8 A;  1SSN A;  1JRP A;  1T3Q A;  1ZXI A;  4TSS A;  1ZPS A;  2KAJ A;  1NEK B;  2IGD A;  4JWU C;  3W2D A;  5C3J B;  1V8C A;  2J42 A;  1XLO A;  2JXT A;  2L52 A;  4WWM A;  5H92 C;  2J52 A;  2L32 A;  2TSS A;  3SFD B;  5FR3 A;  4L2Y A;  1FRR A;  1QOA A;  2KQ4 X;  1ENF A;  2Y5P A;  1C76 A;  2WXL A;  5AUK A;  1KLU D;  1SB3 C;  2G9H D;  1MI0 A;  1SJH D;  2K0P A;  3B2F A;  1Q10 A;  1I4G A;  4IDI A;  1VZ8 A;  5I4D A;  4AS1 A;  4P16 A;  1ET6 A;  2LEK A;  3FIL B;  4N59 A;  5HHD G;  1EWC A;  1TS3 A;  3BK1 A;  3FC4 A;  2PTL A;  4A55 A;  1VZ7 A;  2J4X A;  2W3S A;  3U7Z A;  4HKQ A;  2WS3 B;  1JW9 D;  4N6E B;  5D3D A;  2JX5 A;  4DQO C;  1YNT E;  2LFI A;  1IGD A;  4TQ0 A;  2FUG 1;  2QSD A;  1JQ4 A;  1DGJ A;  2IJ0 A;  1SE3 A;  1L6U A;  1E0Z A;  4HEA 1;  1YJI A;  2JQR B;  2NTS A;  2WXQ A;  4OZA A;  1L6V A;  3BYY B;  1PGB A;  4A9A A;  2BB6 A;  2WU5 B;  1JWU D;  2CU3 A;  2WXG A;  1TKE A;  1UWX A;  2I2Y A;  2ICI A;  4M0W A;  1CQV A;  2WDR B;  1FD6 A;  1WWT A;  4ZYS A;  3NZ3 A;  1RFK A;  3DWG C;  1D5X C;  1QIL A;  1K52 A;  2YEP B;  2QMT A;  2SEB D;  4ARC A;  1UGJ A;  2JYE A;  4YSZ B;  3Q8C A;  3HVZ A;  2QJL A;  3AEB B;  2WXK A;  1OQR A;  3WCQ A;  1I4R A;  1T5X D;  2BS2 B;  1NYR A;  1V1P A;  2WXF A;  2MEK A;  1QF6 A;  2WDV B;  3KWL A;  1JML A;  4A90 A;  2K3U A;  3T3O A;  4HRO A;  3UI3 A;  3W9C B;  2MH7 A;  3P4S B;  2Z8L A;  5JXV A;  4IKG A;  3IXS A;  4C7Z A;  1CJE A;  1QOF A;  2KDM A;  1TKY A;  1FIQ A;  1C77 A;  2DYM A;  1FRD A;  4LLG M;  1J7B A;  2BTE A;  1T6B X;  4KX6 B;  1P7F A;  2MJD A;  4ZHO A;  2BT6 A;  1ZXH A;  1DOY A;  1SE4 A;  2K22 A;  2KWD A;  2DBY A;  1MHX A;  4ZRP A;  1FXA A;  1GPX A;  4OHJ A;  3KQ4 A;  3ZJT A;  2X38 A;  3FIL A;  2BBC A;  1L0Y B;  3Q8A A;  4HKZ E;  1J7C A;  4JPS A;  2M19 A;  1TYG B;  1ACC A;  3J9C A;  2E6X A;  3N9Y C;  4L23 A;  5BYQ A;  1OQQ A;  2XN9 C;  1YMH E;  1NYQ A;  3FAH A;  2L1A A;  2LHD A;  1KTK A;  1E6E B;  1FXI A;  3AEG B;  1SXT A;  1KF6 B;  4DXF A;  1UNS A;  1HA5 A;  1JCK B;  2BS4 B;  1EWY C;  5MPO A;  1TS4 A;  4IOI E;  3TEY A;  3AE3 B;  2DLB A;  1IUE A;  4A6Q A;  4XDC A;  1YN3 A;  2ACZ B;  4ARI A;  1F2R C;  3BVM A;  1VR9 A;  1P7E A;  1IBX B;  4C80 A;  1E9M A;  1V1P B;  1XCT L;  4A8X C;  4CQN A;  1NI3 A;  1ESF A;  1XLQ A;  3AB5 A;  1WGK A;  2MJE A;  4ZOH C;  3R2T A;  2ON8 A;  1XO3 A;  1F77 A;  3VRB B;  4OW0 A;  1N5W A;  2AX5 A;  1SBB B;  4RF0 A;  2KMM A;  1FFV A;  2PLP A;  1KLG D;  5EE1 A;  3BII D;  1L0X B;  1QKZ A;  2DYO A;  4C56 C;  2QIL A;  3IAS 1;  4XE0 A;  4HRS A;  1FNV A;  1TY2 A;  2INN E;  2LJI A;  5D3I B;  5TSS A;  2IGG A;  1YQ4 B;  3ZYY X;  1B9R A;  1JAL A;  1TY0 A;  3LYY A;  1K50 A;  2WP9 B;  2JZP A;  1EU3 A;  3AM9 A;  4WQM A;  1HZ6 A;  3W1S A;  1ET9 A;  1AWD A;  2PMV A;  4N58 A;  2W55 A;  1I4Q A;  1HXY D;  3AEA B;  1NEN B;  2W3R A;  1RWS A;  3VRA B;  1ZDV A;  3AE5 B;  1N63 A;  4USA A;  4GLS C;  3ZJV A;  4YXD B;  4YT0 B;  3ZJU A;  4YTM B;  5HI1 A;  5BYS A;  1L4Z B;  1TZO A;  1I4H A;  1SIJ A;  2HDE A;  5BMG A;  1BXT A;  1PFD A;  1C78 A;  3ZQ4 A;  2AQ2 B;  2IPK D;  3AED B;  3U2S C;  3AE6 B;  4YSX B;  2NTT A;  4RNA A;  4D2K A;  3HUI A;  3VR8 B;  1L0V B;  3R2I A;  1EM7 A;  2LHE A;  2OHF A;  1FO4 A;  2E3T A;  3P4P B;  2D5G A;  5BMI A;  2WU2 B;  3VR9 B;  1YN5 A;  1UUP A;  3V05 A;  1E7P B;  4NJC A;  1PGX A;  5EE9 A;  3VQI A;  3NVW A;  3HVD A;  2CJN A;  4XDD A;  1JWS D;  3E56 A;  3P1M A;  1HEZ E;  3U4E G;  4RGM A;  1XLP A;  2LMC A;  3TEW A;  1WSP A;  2H88 B;  3OWE B;  3NVV A;  3BVG A;  1R7S A;  1OFF A;  2RMM A;  2V4I B;  3MP9 A;  4RFB A;  1JRO A;  2V3P A;  4MM3 B;  4ZHP A;  1STE A;  1IBX A;  2PKO A;  1GB4 A;  1MHH E;  4LK0 M;  5D7G A;  4XWT A;  3BWU D;  3P63 A;  2N9L A;  3AMZ A;  4NZL B;  2V3N A;  3RPF C;  3O13 A;  5LNK 1;  1L4D B;  1VLB A;  4KGS A;  1RYJ A;  3TSS A;  2WXO A;  3AE7 B;  1N61 A;  1FFU A;  3TUO A;  5FKA C;  1XCQ L;  1GAQ B;  3P4R B;  3GS2 A;  3MC0 B;  5C2T B;  3AE9 B;  3SFE B;  4TMA B;  2RPV A;  1C4P A;  2PIA A;  2IGH A;  1QLB B;  5AUI A;  1E10 A;  4WH4 A;  1BML C;  4KGT A;  2SAK A;  1C9F A;  3CWI A;  1I4P A;  4EE2 A;  3BK2 A;  3NS1 A;  5EE0 A;  2M0A A;  4ZRQ A;  1F2R I;  2G1E A;  1AYF A;  3V3X A;  1FM0 D;  2WDQ B;  1FNW A;  1HZ5 A;  2Y3A A;  4ITK A;  2WNM A;  1MVK A;  4YTN B;  3SEB A;  4PT5 A;  4WIP A;  2JYT A;  1AW7 A;  1N60 A;  4NAW B;  1MPE A;  2BS3 B;  2PW9 A;  2RDG A;  2HTM E;  1WYG A;  1I4X A;  2K9X A;  1EU4 A;  2FE8 A;  3MFG A;  4B0E A;  3I9V 1;  3L4P A;  3NUH B;  4JX1 C;  1KFY B;  1ROE A;  1QT9 A;  2MJ3 A;  1D5M C;  1YJJ A;  2WXP A;  2N7J A;  3LB8 C;  4RF1 A;  5E6J A;  2FBW B;  3KWV A;  1IGC A;  3B2G A;  4WAF A;  2VZK B;  1D4B A;  2GB1 A;  2BW2 A;  3AEC B;  2I38 A;  4KGR A;  1CZP A;  3W5V B;  3ABV B;  1JWM D;  3NVY A;  1K53 A;  2BB5 A;  4FXC A;  4KKJ A;  2GI9 A;  2L83 A;  5H8Y E;  4Q2J A;  4MT5 A;  4OZB A;  1C4C A;  3AEF B;  4JWS C;  1YN4 A;  4B0M A;  1LO5 D;  1L5P A;  2KAC A;  3I57 A;  3Q8F A;  1PUT A;  1AN8 A;  5G5H A;  4US8 A;  1SJE D;  4UDU C;  2IDY A;  4LTU A;  1ZP0 B;  1C79 A;  1VRA B;  1KH0 A;  2N0S B;  4WUR A;  4R3D A;  3H8H A;  3EGR A;  4P6V F;  1CK1 A;  1ZUD 2;  1PDX A;  1BUI C;  2LUM A;  3GP7 A;  1FMA D;  4REZ A;  1B1Z A;  1TKG A;  3SR6 A;  3PZ8 A;  2PVO D;  2EEL A;  3C8Y A;  4J3O D;  5HG2 A;  2M56 B;  1ZOY B;  4RGT A;  5G5G A;  3U52 E;  3Q8B A;  3NRZ A;  2ZW0 A;  3AE2 B;  3AH7 A;  1GB1 A;  2V0G A;  2WLB A;  4RCO A;  4KKI A;  3IAM 1;  4O1N A;  2W82 A;  1DYQ A;  3NVZ A;  2JSV X;  1YQ3 B;  4MH8 A;  1N62 A;  2BYT A;  2JWU A;  3EUB 2;  1HQR D;  1ZDX A;  2EKI A;  2YEP F;  1FEH A;  3URY A;  1A70 A;  1V1O A;  1KRH A;  3BVZ A;  5HFY A;  1DOI A;  3AEE B;  4DXG A;  3ETR A;  1SEB D;  2GRI A;  1UWM A;  2LGI A;  5EE3 A;  4GDK B;  2WXI A;  1NVI D;  3R8B A;  5BMH A;  2WXM A;  1QQR A;  2XNA C;  4L1B A;  1Y56 A;  1QOB A;  3DWM A;  1PYW D;  1V97 A;  4RGO S;  2KN4 A;  3RFZ B;  3ZGZ A;  1XEE A;  1FCL A;  3BYT B;  1XLN A;  3LXF A;  1D5Z C;  2CJO A;  2PVG C;  1FNU A;  1I7H A;  4OVZ A;  3P42 A;  1FCC C;  1TS2 A;  1JWB D;  1ZE3 D;  2NMQ A;  2WXR A;  1K51 A;  3Q8E A;  1GOZ A;  1TS5 A;  3PZ7 A;  1J7A A;  3MHZ A;  2AQ1 B;  3BZD B;  3P4Q B;  2H89 B;  1XF5 L;  2N9K A;  3AE4 B;  1SE2 A;  5BYR A;  3B9J A;  2DWQ A;  1VDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...