1FFVA

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
155
Chain Sequence
KKIITVNVNGKAQEKAVEPRTLLIHFLREELNLTGAHIGCETSHCGACTVDIDGRSVKSCTHLAVQCDGSEVLTVEGLANKGVLHAVQEGFYKEHGLQCGFCTPGMLMRAYRFLQENPNPTEAEIRMGMTGNLCRCTGYQNIVKAVQYAARKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 45
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1ffvA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ffvA01
1UWMA 1SIJA 1J7AA 3AE9B 1RWSA 5G5HA 3AECB 4N59A 4A9AA 1OQRA 1ZUD2 1TKEA 4ZOHC 2K5PA 3AE3B 5H92C 1NI3A 1L6VA 2W3RA 2E3TA 4LTUA 1R7SA 3CWIA 3P4QB 3NVVA 3LB8C 1N63A 2L83A 1TKGA 3AE8B 3SFDB 2Q5WD 3AB5A 4YT0B 2BS3B 4C7YA 1JQ4A 2QIEB 2JQRB 1N5XA 1NYQA 2CJNA 3ABVB 3AM9A 1FXIA 1B9RA 1XLPA 1KRHA 3NVWA 1J7CA 2WDVB 3B2FA 4C80A 3AE5B 2K22A 1OQQA 2MJDA 3AE2B 3AEFB 3BIID 1TJEA 2CU3A 3P1MA 4N6EB 5GXGB 1V8CA 3AV8A 2PVOD 3CIRB 3FAHA 2WP9B 2H89B 1FXAA 1EWYC 1PFDA 1RFKA 2DWQA 3P4RB 4IDIA 1E0ZA 2WS3B 1E7PB 1JWAD 4HRSA 1QOBA 2AX5A 3B2GA 2WDRB 3DWMA 1NEKB 2K9XA 1F0ZA 1N62A 5G5GA 2CJOA 2BS4B 1TYGB 2PKOA 1E10A 1JW9D 1SF0A 2H88B 1V97A 3KWLA 1VJKA 2G1EA 2W3SA 5C2TB 3ZYYX 3NS1A 3W5UB 4US9A 1JROA 1I7HA 3AE4B 1YJJA 1RYJA 4WWMA 1NYRA 5EE1A 1RM6C 3P4PB 1FFVA 1PUTA 1VDVA 5EE9A 3SR6A 1ZP0B 4FXCA 4US8A 4JWSC 5AUKA 3VR8B 1QLBB 2BT6A 3HVZA 1ZOYB 2PIAA 1L0VB 4WQMA 1QOAA 1DOYA 1AWDA 1YQ4B 3B9JA 1FMAD 3HUIA 2KMMA 3AH7A 1L5PA 4YTMB 1T3QA 1AYFA 3RPFC 2M56B 1PDXA 3L4PA 2W55A 2BS2B 2Y5CA 3AEAB 2B76B 3AE7B 2WLBA 1JWBD 2M19A 1WYGA 2QJLA 4ITKA 3SFEB 2WU2B 1GPXA 2W54A 2OHFA 2WDQB 3AEEB 3DWGC 4KX6B 2JX5A 3AMZA 3W5VB 2HTME 4YSYB 2PVGC 1XLNA 3AE6B 3VRAB 5EE0A 1KFYB 3W9CB 2WQYB 2MJ3A 1L6UA 2EKIA 3AN1A 4USAA 1WGKA 2L52A 3AEDB 5MPOA 3NRZA 1QF6A 1XLQA 4HROA 1FM0D 5H8YE 3VRBB 1WWTA 1N61A 1WXQA 1VLBA 1E9MA 1GAQB 3NVYA 4ZHOA 1CJEA 1DOXA 1E6EB 2MH7A 3HRDD 1ROEA 1NVID 1J7BA 2LEKA 4YXDB 1KF6B 3P63A 1QT9A 3P4SB 4P6VF 1WRIA 1SB3C 1TKYA 1FIQA 4N58A 1FO4A 3PO0A 4YTNB 1DOIA 3AEBB 1JALA 3VR9B 1FRDA 4JX1C 2WU5B 1QOGA 1ZXIA 1YJIA 1JRPA 3NVZA 1A70A 2ACZB 2KAJA 3WCQA 4C7ZA 1NENB 3ETRA 1XLOA 1N5WA 1FRRA 4YSXB 2DBYA 2MJEA 4JWUC 4YTPB 3AEGB 5C3JB 1QOFA 1OFFA 2N0SB 3FC4A 1CZPA 3AE1B 5EE3A 5AUIA 3EUB2 4ZHPA 1YQ3B 1IUEA 2FBWB 3LXFA 4YSZB 1DGJA 1FFUA 1N60A 1XO3A
chains in the Genus database with same CATH superfamily
3OHAA 1H38A 1E7UA 2KEYA 2HDOA 2DAFA 4KLLA 4DL5A 3I1YA 2Z0DB 2DFLA 2LPEA 2KVSA 3APDA 2NS5A 4C4TA 2IYDB 3N1YC 3N20C 4UB3A 2KQSA 2WXMA 2WTFA 4DHJB 3AE8B 2KFKB 5KFKA 3DVNV 3HKZC 2KZMA 4QNLA 5ALVA 4B0EA 1XD3B 2CJNA 2ZIXA 5JTIA 2MEKA 3LDZE 1WZ0A 3KHHA 4IM2A 3VUWA 1ENFA 2J42A 2BTEA 2I1QA 1MHHE 2FCMA 4XGAB 1V8CA 3C28A 1TY0A 3K75D 3WK6A 5EWFA 4WWPA 2FPMA 4ECYA 2JRZA 3UMCA 8ICCA 2D3CA 3NJTA 1E7PB 3KVFB 2KOBA 3W2DA 2WF9A 4F92B 5BPCA 2ASJA 3DHIC 3NTUA 4FBJB 1SWVA 4NLZA 1Z19A 3B0XA 4C0ZA 1YJJA 2KV2A 1RM6C 2ES6A 2FMSA 2ISOA 4CGZA 3SR6A 1SE3A 2MQJA 2W7OA 4XDCA 2BWFA 4REZA 5KFZA 1ZQLA 3OJUA 2KWUB 1J0GA 1AWDA 3FKYA 2LVQA 1WR6E 4MDKE 2B0CA 2ZIVA 4MEMA 5DB9A 4I2BA 3Q6BA 1ZQCA 4RNNA 2DKZA 3QUTA 3TAPA 2IO0B 4ASWC 3QU9A 4F5OA 3N4MB 2HOFA 3E0FA 4Q43A 2PTLA 4PZOA 1YQBA 1XF5L 3ML8A 4WURA 3JW0X 4WWOA 1GPXA 3TFRA 3ETLA 3DBHB 3DBHI 3U52E 4ED8A 2XY5A 2RHFA 2J0MA 4YSYB 1WI0A 2ZZPB 2JXJA 1SXEA 2ZCBA 3QC8B 2L3ZA 4MH0E 2K1FA 4MJSA 4RGOS 3RNFC 4RPXA 2MA1A 2F3NA 3RH5A 3P2BA 1F1HA 3VRBB 2K4IA 1KFDA 3IV6A 3V6JA 2W03A 2XO7A 3RZFA 4F4WA 2Y0SF 4YR0A 2KJRA 2NTTA 4HPPA 1OTRB 4P4PA 1D5XC 4KGTA 2NRTA 3W1YA 2DPIA 3W1SA 4TQ1A 2KHQA 2KSOB 2DPJA 3R7RA 2ZXIA 4DL4A 7ICRA 1DOIA 2QEJC 5ALRA 2G45B 1YJIA 3OWEB 2H3QA 3QUCA 1C77A 3WAMA 1V5OA 1RPLA 8ICNA 1K5OA 2PFNA 2ZJ5A 2EH9A 1A6SA 3G6XA 1J2NA 4ECTA 1D8BA 1IUEA 4CDGA 3RULA 3V7JA 3WKBA 3MC8A 4DHZB 2HSZA 3R8BA 4JV1A 4DWIA 3LYSA 3QEBZ 5DBBA 2RDGA 3AECB 1WYWB 3TADC 4YMOA 2JU6X 4LLGM 2V0GA 3MBYA 4ZOHC 1YN5A 5E6PA 2V4LA 1X40A 3N97B 2JEIA 2VH2A 4LTUA 2AH5A 2FPLA 3ISDA 1YX5B 3DBSA 8ICZA 1KOTA 2WHEA 3EWAA 1TZ1A 1X1MA 5G55A 5AK3A 3KZIU 2KTFA 4DCCA 1NJZA 1B9RA 2BPFA 2IO2B 2NCNA 2KTRA 7ICFA 1GOZA 2ZNVB 1TE2A 1WFYA 3P1MA 3GB1A 2KQ4X 3WK8A 3SENA 3FAHA 3H4BA 3PW7A 2OYYA 2KJ8A 1V1PA 4Z6EA 1QOBA 3RJEA 4RQNA 8ICJA 1K53A 4WJOA 1ESFA 8ICTA 2AQ4A 3OSNA 2V4IB 1VJKA 2KN5A 1FNVA 3T3OA 1B4FA 3PPAA 3PX0A 4DSEA 2HBLA 1JIHA 2IOHA 2JH7A 1COKA 1SL2A 5LLIA 1NJYA 3PW4A 1FNUA 3VFKA 2ZIUB 3ZNID 4G0NB 2J53A 4P1CC 4BXOA 3UINB 4GFJA 5AKJA 3SYZA 3LVWA 3M8SA 5DLGA 2HOIA 4BOSC 5ALWA 2D3GA 4FS1A 4PHDA 4YMNA 4GLXA 2BHNA 3PR4A 3ISCA 4HJGE 1WYGA 5KFVA 2IPKD 2RDIA 4C8KA 3KHGA 5BOMA 1F44A 3PO5A 2DZIA 3L5KA 4C4VA 4II2B 1L0YB 4FN2A 1XLNA 2DZJA 5EE0A 2P6UA 2KDBA 4DEZA 5J2EA 4NAWB 3M62B 3O0FA 3TBLD 3H9DA 2NBUA 3RUIB 5H8YE 4A6QA 1T0YA 1IG6A 2OM6A 2P66A 3T3NA 4NJ8A 2MUTB 7ICTA 1AN8A 4TUPA 2LASA 3A9KA 1HUOA 4BWJA 9ICAA 1UCVA 1VD2A 2KZRA 4RF1A 1SV4A 4K3CA 2KNJA 3AEBB 5L1LA 3VR9B 4NY8A 1K52A 1CMXB 2G4SA 2HBKA 3LK9A 2MCNB 1LFDA 4R65A 1OGWA 5L1JA 2MU2A 1RAXA 2AWTA 3M3JA 3PLUA 4HCNB 1E8XA 2MRLA 1EF1A 5TISU 2GBRA 1YQ3B 2QHOA 1QQ6A 4MELA 3PREA 2KICA 2LGIA 1DGJA 4UAUA 3RJHA 4MF2A 1RWSA 2MHJA 4UASA 2K8BA 1ZD2P 1YX6B 2VA2A 3MFGA 5L9XA 3THVA 2NBVB 3WK5A 2PE9A 1YMHE 1IP9A 5IIOA 5ALMA 4JK1A 4I2JA 2KFZA 2H3VA 4CRXA 3T8MA 5IIMA 1P7FA 3M63B 5ALSA 2D2QA 3B0YA 1JQ4A 4L1BA 1JWMD 1N5XA 2EELA 1WF9A 5AI4A 1UNSA 2FCQA 2YX8A 4HEA1 5AI0A 1TS2A 1XWLA 4BZAA 1XSPA 1ET6A 2CU3A 1YD8U 3MC0B 5AKYA 4KKIA 4LNOA 1I4QA 3GIIA 5AZFA 3IAM1 5BMGA 2Y5BB 3GV5B 1ZQXA 1E0ZA 3UQ2A 4CE6A 4HRSA 1ECWA 3CYMA 5KT5A 4MFAA 1ZJMA 2K9XA 2M4NA 3IHPC 3QJZA 3DPDA 2PW9A 5DQGA 4PS7A 3IVFA 5C2TB 1V97A 1DOXA 4LNFA 5ALLA 3NS1A 2C2DA 1ZQJA 3ZDMC 1GNUA 2XICA 3KKAA 3KYCD 3M9NB 1VZ8A 1WH3A 2OJRA 1WGHA 2BCSA 4F5NA 2XVTA 2YQEA 2OWOA 2YTUA 2WNMA 3RB4A 2BPSA 2KLCA 2OH2A 2Y3AA 4FULA 1NNLA 2KIVA 4YCXA 1V80A 1X6JA 2W04A 3HVZA 1QOAA 1T0SC 3RB6A 4ZDVA 4Y2YA 3ZI4A 4J9LA 2Z0EB 4OJPA 4E0DA 3EFCA 4M9HA 4PHAA 2C2EA 1WCLA 3WAPA 2ZTEA 3NY5A 2G07A 2I5HA 4P0PB 2V3SA 5HI1A 3ZGZA 3EZ5A 2LYBA 3C21A 3QWZB 5DLFA 2BS2B 1EU3A 2XNAC 4Z6FA 5KFPA 9ICJA 2W8LA 2V3PA 3AE7B 2M19A 2XI9A 2WU2B 8ICVA 8ICQA 1SBBB 4DXGA 2BYTA 8ICPA 2DKXA 1WGDA 2JWZA 2CPRA 4UAVA 2HE7A 1E90A 2HCFA 2MJ3A 1ZRNA 4USAA 4HXDA 2GBJA 4GDKA 1PK3A 4D2KA 4ACFA 2R8JA 5AM0A 2OCEA 2W9BA 4BOZB 3BQTA 4IW0A 1ROEA 1M6YA 5ALPA 5DBCA 4YQWA 1K51A 1TY2A 1FCLA 1L3SA 5DG7A 1NK6A 1ZQPA 2KZZA 3DCGA 1YIWA 9ICIA 4N58A 4FS2A 5CX3A 3GDXA 2XC9A 4JX1C 2K8CB 4YN4A 1V1OA 2E1EA 1XO1A 2KLGA 2JY6A 3A33B 3ECIA 5J18A 1D3ZA 2HHQA 2VIXA 1TT5B 4FLHA 2JPHA 2MP2B 2EMSA 2D10A 5EE3A 3RJIA 3VTVA 1I35A 2J6UA 3M95A 2E8NA 3KH0A 4WQOB 5ALFA 1ZQSA 2NV3A 3V6EB 3TSSA 3RR8A 1I4GA 2JHDA 2H3FA 3GOEA 4P4OA 2J6SA 3UMGA 2JH1A 4IRKA 2DYOA 3APCA 9ICHA 3ZRFA 2HHWA 4ED3A 4OJ6A 1T0QC 5J2RA 4NV0A 1KN5A 2BS3B 4WJPA 9ICFA 1LXDA 2KMAA 4J9MA 4WAFA 1ZQHA 5KG5A 1KRHA 2HHTA 3AE2B 3BIID 4Y2TA 3UIOB 2AL6A 2XK5B 4ZYNA 3AV8A 3G6YA 2KWVB 9ICQA 1JWSD 4GGQA 4BWMA 2WFAA 4GC6A 1C3TA 1V6EA 1RG6A 3WK7A 3Q69A 2LVPA 3PW2A 1X42A 4PH5A 2XGPA 2BYVE 3MFHA 2KTQA 3ZYYX 1IXRA 2IO1B 2KJ5A 2BCUA 3AE4B 3EHVA 2BPCA 4M02A 5BMIA 5L1KA 4G11A 4MT5A 4DQRA 1VDVA 4MF8A 4HYKA 2KKVA 4YD2A 2IHNA 5AUKA 4JE3B 3ZDTA 1ZDVA 5DBAA 2NRVA 2KD0A 1L0VB 5BYQA 2K8AA 1WCNA 4UQGA 2FUG1 5CHWA 1EO6A 1KH0A 3Q14C 2KMMA 3HWTA 2WB1F 1PDXA 3L3FX 2LKYA 9ICRA 1WXAA 2DAJA 2VH1A 1UT5A 5J2CA 3NOBA 1WGGA 2QJLA 4FADA 2RDBC 2NO5A 3IHQB 4OZCA 2OHFA 4BKSA 1IPGA 3N9YC 4BUGA 2ZVOA 3IG3A 3QZ7A 1QQ5A 4KIKA 5D3DA 3JSVA 4OZAA 2WQYB 3OGUA 2EKIA 5ALXA 2LWPA 1GO3F 2L8JA 1SXTA 1NJXA 2YMMA 2INDC 1HIWA 3R66C 3H6NA 5J2IA 4IWPA 3C1YA 1IGDA 2HHVA 4A8EA 4J6IA 4DQSA 1CJEA 1IBXA 4QZCA 1HEKA 2ZUDA 4TMAB 1QT9A 1C9FA 3QX7A 4NNJB 2BYFA 1Y88A 2LVOA 1JALA 4S0RA 4W9HA 4KLDA 3Q8AA 3UI3A 5AIAA 1XLOA 7ICEA 3AULA 1H4RA 8ICIA 4RNAA 3SI8A 3ALRA 2DBYA 2F44A 2MJEA 5HP4A 4TKNA 5AUIA 4ZHPA 3MR6A 2CHXA 3TEYA 3CP8A 4NY0A 4GDLA 4TUQA 2MSED 3AI5A 5KFLA 1QKZA 2KANA 2QCZA 2JZZA 4KMUA 4DSKA 1PVPA 1MQ2A 1JMLA 5TSSA 4ZH4A 3UIPB 2NPTA 2BW2A 3E2EA 2W82A 1F52A 4UATA 3C1ZA 3E9SA 4RGNA 4M00A 1ZQNA 1OW5A 1OQRA 2MA9B 4XZ4A 2N1RA 5IIKA 1TKEA 5AI6A 2K5PA 2N9PC 4GMVA 1PVQA 4MM3B 1S3SG 1X9XA 3DBLB 2PMZF 2IDYA 2R8GA 1N63A 2ZW1A 4IQUA 3AB5A 4I2HA 8ICBA 2JF5A 3Q8LA 3AM9A 1FXIA 2XY6A 1GJZA 4K7SA 3U26A 4NLBA 3AE5B 4YR2A 2KZ3A 3UF8A 4LJXA 2HMXA 7ICMA 9ICTA 2QKQA 3H0LB 2WYQA 3HPOA 1AQ6A 1RFKA 2BBCA 3Q8RB 1UQVA 1P9DU 4FE3A 4TQSA 4DS4A 1NEKB 4ELVA 1N62A 1D6EC 3F5AA 3RB3A 1JI7A 5EOZA 2GB1A 2GBMA 3K9PB 2BYEA 3W5UB 5HHIA 4GSWA 1YNTE 4NQKE 2LD9A 5IKCM 2NRXA 4TUUA 5J2JA 4RQ2A 2A3VA 1TIFA 2A5UA 4HLEA 1ED1A 2WXFA 2ZIWA 4K7WA 4US8A 1WJUA 2NR2A 3TIXA 3AXCA 2JGAA 2IZVB 4ELUA 4QZIA 3TQ1A 2M1MA 3MJWA 5KG2A 2AEHA 1WE7A 9ICCA 1NK7A 3OJSA 3R2TA 1KSPA 4IQVA 1ZOLA 2GLEA 3V72A 2PMVA 3Q3FA 4ECUA 2GH1A 3KOOA 2BKRB 3C5FA 3VTUA 4LZGA 4UW9A 1CRXA 2F8LA 3RNCC 9ICLA 4QIWF 4PL2A 3IP4B 4UB4A 2HTME 2VRRB 4QW8A 4W9DA 1A77A 3RRHA 3Q8BA 3VRAB 1WWVA 1ZQQA 1L6UA 4EELA 2K4EA 1WGKA 1XCTL 2OEDA 3EPIA 3NRZA 4Q45A 4ZRJA 5KFCA 3QHTA 1V86A 2KJHB 5DPSA 3V7KA 2A1JB 3O65B 3PS6A 2B3AA 1QSSA 2KMCA 2Y9UA 2WXQA 1D5ZC 3BZDB 2XCPA 1CEZA 2E6XA 1WGRA 3P63A 3PW5A 2ASDA 4PGYA 1Z1VA 3V3XA 3RNGC 2F1IA 4LDTB 3C2MA 2LHEA 3KQ4A 4ECSA 3QUQA 7ICIA 2KK0A 3DDHA 3TCAA 2FAZA 3EGRA 1UPHA 3MHZA 3C19A 2HHXA 4IQTA 3TANA 3A1QB 4L2YA 3T9LA 1EWCA 8ICGA 4PHEA 1LV5A 3AEGB 1JMSA 1NBFC 2V9WA 4O3NA 1XS9D 2F8KA 1S1QB 1AARA 1Z2MA 3AE1B 3B0AA 3H7PB 1QILA 1L8LA 4Y2SA 3RJKA 2K8HA 3N30A 4ZRKA 3I57A 1FFUA 2G09A 1UWMA 4MACA 3GIKA 2D6FC 1HE8A 2KO3A 1TS4A 5KFXA 4GXKA 2C9WB 2D11A 4YP3A 3W1SC 5KT4A 2NMQA 4YXMA 4RQ1A 1WGYA 3BQ7A 5AK5A 2JSVX 4MGZE 1X9SA 9ICMA 5HNKA 4W9IA 1KW4A 4M0WA 3QEAZ 4M9LA 4B95A 4K4GA 4HAIA 1UF0A 8ICHA 4WJNA 5FR6A 4ANUA 2KN7A 2PEAA 5J0SA 3QNMA 5BOLA 3DDCB 3IBEA 2KJ6A 2JQRB 1J19A 3BYYB 3PZ8A 2G5IB 3GP7A 1HZ6A 4XYCA 1X9WA 2ATLA 5FR3A 1OQQA 4EYIB 4GC7A 2DZKA 4QW9A 4HWIB 1L4DB 3WK9A 3UQ0A 3CIRB 3PSTA 2H89B 4IR1A 1FXAA 2M9NA 2KMDA 4JGHB 3VDZA 5ALDA 1TV9A 4B9KA 3UQAA 2UVUA 2MAXA 2V3NA 3U7DA 2KWCA 1V85A 3KWVA 4QAYA 3BK2A 2PLPA 2HHUA 2K25A 2PKOA 1JW9D 3KWLA 1ZQ1C 4TURA 4US9A 4R8UA 4UAYA 4M6WA 1ZJNA 2PKEA 1FFVA 4TQRA 2XEWA 1PUTA 4EE2A 5E6JA 4B9TA 1I4XA 4P0QB 3AQFA 3DOWA 4GB9A 3S6JA 3SDLC 4WQMA 3BS5B 3BVMA 1J97A 5KFSA 3Q8PB 1YQ4B 4M9GA 4NJCA 3HUIA 1NKEA 1PZNA 1WX7A 4IG7B 5KT3A 3L4PA 2QARB 8ICXA 1K1QA 4XWTA 2YEPB 5K4LA 1NK8A 3RBEA 3D32A 4CHKA 3CRXA 5D46A 4MSQB 3CSFA 2RPVA 4FO6A 3ZXRA 4AYBF 1ZQIA 3MR3A 3C2LA 1SZHA 4EEYA 3ZDCA 1BPXA 1UGJA 1U4AA 4KLUA 3A9KB 4BKTA 4QWBA 4F4XA 2UYZB 2HBJA 4BKSD 4ECWA 3ZRCA 3S2AA 4I2AA 2EQYA 3F2BA 3ZDBA 2W9NA 4W9EA 2IY1B 2WXOA 2O6KA 1E9MA 4F8CB 1KLVA 1YOVB 1XSNA 2JUOA 2BQUA 3HKZF 3AL0B 4C4SA 4GLSC 1SB3C 1WUDA 5HG2A 2FCSA 3TARA 3QYPA 3PO0A 3KUDB 1ZQUA 5DDYA 1XT9B 4FJVB 1QOGA 4NJ6A 4AOFA 1V9PA 3C0RB 1R4MB 3PSPA 4RH6A 1RYUA 3WCQA 2BGWA 1U47A 5AM2A 1R4MI 4IKGA 1S8OA 1ZD3A 1PK1A 1MVKA 3L16A 4PHPA 1LKYB 5JUMA 1WWUA 3D2QA 3EUB2 2R2OA 3QCAA 2FBWB 2D8CA 3OPXA 3RJFA 3KLSX 5J0UA 4A55A 2HTHA 5I4DA 4F8RA 1K8RB 4FFDA 3OHBA 4O3MA 2C7MB 3T5KA 5H92C 3RCZA 1L6VA 3PV1A 2MX2A 1SEBD 2JEJA 2RR9A 1J8CA 3H8SA 3NVVA 3MDAA 1NJWA 1V38A 2R18A 4C7YA 3ZKJC 3Q8QB 4DF8A 2N7JA 2G06A 3ABVB 3I63C 2FIFA 3RMKC 3N28A 3B2FA 3H8HA 3PLVA 3MJ5A 4OJOA 2JZBA 5C0YA 1TJEA 1SIFA 2GOLA 4GN1A 4N6EB 4MHVA 2JWUA 2W9CA 1NOMA 4B9VA 9ICOA 3H0MB 1CI4A 4X5VA 2A4ZA 3PT2B 4UB2A 3TAQA 1JWAD 2ICIA 3Q8KA 2EZZA 5KHOA 2M17A 1ZD5A 2M0XA 2L7RA 7ICHA 2YEPF 4KGSA 1F0ZA 5KT7A 1KLGD 2DENB 2WXJA 1U4BA 1WXSA 4KZ0A 3VXWA 1I7HA 2G4DB 3PVXA 5EE1A 3N32A 3LVVA 2X38A 3NASA 3M1YA 1N2XA 3QE9Y 3B9JA 1NK5A 2FMPA 5JRTA 4HVBA 2D5GA 4M9JA 3HK0A 5JXVA 4GIVA 1CUKA 3NZ3A 2BKFA 1N48A 2M56B 4J3OD 3X23A 2W55A 1IYFA 3GILA 4IRCA 4RQ8A 1EXNA 2K4HA 2YY6A 3RAXA 3SFEB 3SU8X 4ELTA 3GQCA 1TVAA 3KKAC 4GDKB 2KDMA 3DWGC 2JX5A 4ICAA 1RFAA 2RPQA 3ZTDA 3B1LX 2N9EB 1NZPA 3M9MB 2HVIA 1SKRA 2WGSA 5IO9A 3UMBA 1GB1A 1ZRMA 1V49A 4KLQA 4XA5A 1X9MA 9ICKA 3IT4B 4W9KA 2HOQA 1FM0D 1WWTA 2L76A 3IN5A 1T4GA 5FKAC 4ZHOA 3FILA 3Q2AC 3UGBB 3IG8A 2J52A 2IGDA 5J2AA 3P4SB 3ZDEA 4KKJA 1V5TA 1LGRA 3U30A 2JMGA 1FPYA 1RZTA 3MFIA 3OLMD 4X57B 2A1AA 2WU5B 4HKQA 3NVZA 2O6VA 4K7UA 5EDSA 1BNOA 3ZJUA 3EPGA 5AM5A 4Y2UA 5KFHA 3WKEA 2LMRA 3ONNA 4JWUC 5CEHA 3KTQA 3FC4A 3PY8A 5DPTA 4BGDA 7ICOA 3WKCA 2D3AA 3GS2A 2KP7A 4QZFA 3F2DA 1C7YA 5J2HA 4DOBA 3H7SA 1XNSA 2OEHA 2KDIA 2KFKA 3OSPA 1N60A 4CF4A 1L7NA 5CTRC 2H3IA 1L0XB 2E8OA 3UXOA 3SMVA 2GMIC 3BS7A 4J9SA 2K6DB 2C2RA 3TUOA 4J9NA 2I1JA 1HUZA 4ICUA 2XGQA 4DLEA 3RJJA 2W11A 5AK4A 2KK8A 4DOAA 1C1YB 2N7EA 2AJQA 2INPE 1UT8A 4KLSA 3Q8MA 2K0PA 4GU2A 4L23A 1ZQFA 3VH4B 3HP6A 4PYUA 2PE6B 4B9MA 1Z00B 4IC9A 1QLNA 1DGSA 2PJHA 2CR5A 4KDLB 1E5WA 2KKPA 1EWYC 4PJ0U 2RGFA 4KLFA 2AHOB 4J9PA 4KLTA 3DWMA 3H0RB 2R2QA 2EANA 5G5GA 2CJOA 3GZNI 2C28A 2KDFB 3LYYA 3GZFA 1LB2B 3MP9A 1M94A 8ICUA 5IIJA 1OUQA 1S10A 5J0WA 2X8XX 9ICEA 4WWMA 5ALOA 1COOA 2LZ6A 3QU7A 4ZRIA 2MBBB 3MTNB 1T7PA 3R9KA 1ZOYB 1TAMA 1Q10A 2GO7A 2K39A 5DPWA 5AIBA 4RPYA 4KLEA 4ANWA 3X0WA 3BY4B 2CHWA 4ZRPA 1HA5A 1S0NA 2JXXA 1ZQRA 1L5PA 3R3MA 2J6TA 2PFPA 3RPFC 4Y2JA 1JWUD 1EUVB 4P2HA 1TS3A 2K3UA 2WXIA 4WJQA 3AEVA 3KD3A 2BR0A 5KFEA 2L00B 1QCKA 1NKBA 4W9CA 2WDQB 8ICAA 2BQQA 4I2EA 3GV8B 1B1ZA 1P3QU 1PGXA 1UD7A 4RQ5A 2O2VB 3B08A 3ENEA 3J9CA 2YMQA 4HPMB 4LNKA 3PR5B 2LGXA 4QZHA 3HW8A 2LGYA 5JH5C 2J7QB 2KSOA 1RXWA 3K4GA 2L0TA 3ML9A 3PMNA 1A0PA 3BINA 2KXJA 1KLNA 1WR1A 4K1RB 4KZCA 2ESEA 3VUXA 2F1JA 4F5RA 3LWMA 3I76A 1KL9A 1ZQAA 2JRHA 2A19A 3SAHA 5J2GA 1ZQEA 4MFCA 4Q2JA 4W9GA 3WU2U 1ACCA 1LVHA 4GDLB 2J0JA 3NS8A 2WAQC 2ZJDA 4AP9A 3F2CA 3MGIA 2VZKD 3Q8EA 1PGBA 4LK0M 3L17A 1KKXA 4O5EA 2WHIA 4YTPB 3VTWA 5KFGA 1RYRA 3QK0A 2Q0ZX 4PPXA 3BK1A 1KFTA 4GXBA 3V6KA 4KGRA 2EZXA 2EKEC 3SZ2A 4JB3A 3M7DA 2LYHA 3GV7B 1L5UA 2Y9TA 4K3BA 3HILA 2I38A 2AQ3B 5F9NA 4RZRA 3ZW3A 4XRHA 3CWIA 2MBEA 1OXJA 4WH4A 3L54A 4EKUA 4Y2RA 3QQ8B 2FMQA 3BYTB 2OXOA 3NVWA 4Y2PA 4A20A 1WX9A 1FEZA 4I6LB 3DV9A 3RN9C 2WXKA 3JPPA 4LJPB 4UB5A 1VZ6A 2E1FA 4O9MA 1T3NA 3ZDAA 1HQRD 4NJ7A 2SAKA 2WP9B 2DWQA 1PFDA 2EMTA 5KAIU 1SKSA 2JYTA 1SJHD 5DG9A 4J9OA 2ZIUA 3H40A 7ICKA 4AS1A 4K4HA 3B2GA 1C76A 4IM3A 1D5MC 4J9QA 3Q3NC 2CHZA 3SD7A 2R8HA 4Y2QA 4A3OA 4OZBA 3KHRA 5DCNA 2WXHA 1ISNA 3KFUF 1XO0A 4UAZA 4ANXA 5F3XB 4IWQA 2BT6A 3Q3MC 3ZIMA 3U8ZA 5J2BA 3TFSA 2H5XA 2FI1A 4EZJA 2FNJB 3M9OB 4F7ZA 2ZUCA 4U7CA 2G9HD 2WX1A 4EZKA 3KW5B 3NUQA 2ASQA 3KYDD 1C4PA 3PGEA 5ALTA 2NBWB 4NAWA 4ECZA 2LI5A 4NLCA 2L32A 3PRMB 2HVHA 3BZKA 3ORYA 3AEEB 3RYTA 3EW9A 4F2SA 4F72A 2MUTA 1Q5WB 1MSWD 4UARA 3UQBA 3ALBA 2JR5A 1SGGA 2P6RA 5C5JA 5G2NA 1WX8A 3SV3A 5DGAA 3WK4A 1PUZA 3AN1A 1KM7A 5IP4D 1YT3A 4M8NA 4FJZA 3APFA 4GXIA 2BF8B 4DQOC 4EX7A 4KLGA 1YZ7A 3URYA 3VH3B 1ZQTA 2UVRA 3DBRI 4C8MA 5H2FU 4F4YA 4RM9A 4ZYSA 2DX5B 3NZSA 3MHSD 2MBOA 2RMMA 9ICBA 3V6CB 5ALIA 4RQ3A 1XQQA 2AXTU 2BQ3A 3EYZA 4G50A 3QARA 4PZNA 2INNE 2WXLA 3SD5A 5HKHA 1N5WA 5GTHU 2ZJAA 3M8RA 2VA8A 2LGSA 5A0LA 5J29A 2BGFA 3FYHA 1KTQA 2VANA 5ALQA 3JPNA 3JPOA 2O6VD 2AGOA 4M0WB 3O13A 2YN4A 4C8NA 3VCBA 4IL6U 4WAAA 1WMHB 5ALUA 4ACOA 4NAMA 1SSNA 3V62A 3AE3B 1NI3A 3RH4A 4DHJD 1HTQA 4DL3A 2W3RA 3RH6A 5KFMA 2DLBA 1R7SA 3TJPA 4F71A 7ICPA 3P4QB 4TQ0A 1A5RA 3VUYA 4IS7A 3C29A 3IM1A 4KLOA 1C4AA 3ED5A 3RF9A 3ZD9A 1J7CA 1EU4A 1VCBA 3WIMA 2HW3A 1ZD4A 5KFAA 1I4HA 4NL9A 1Y56A 2PVOD 2GRIA 2KNBA 2GBKA 2XBBC 1KQQA 2WS3B 4FHKA 2FCNA 1NK9A 1DK3A 4DL7A 1BPYA 5FP0A 2ZIXB 1Z4NA 5ALZA 5KG0A 4HK2A 3TKAA 1YN4A 4KLIA 8ICRA 4O3SA 2W3SA 4DQQA 4P0PA 1NYRA 3NZUA 2B6GA 1RYSA 4RGMA 4YL8A 4BBNC 4B0MA 5J2KA 4JQWC 3VR8B 3T5JA 1Z1BA 1QLBB 5HR7A 4Q44A 2R61A 8ICLA 5AI8A 4OHJA 2WXGA 3VQIA 3MR5A 2V4RA 1FMAD 3OTQA 2Q4TA 2RD0A 4YG2A 3CSTA 5AI9A 1I42A 1T5XD 3RNEC 2Y5CA 3ZDDA 3AUOA 1N6ZA 3AEAB 2KVZA 3N7RC 4R64A 2WLBA 3Q8CA 4II3B 4RQMA 4KN7A 3WANA 1DRGA 1TKDA 1P7DA 2ZTCA 4I6NB 1DOQA 3V7LA 4RMAA 5CJ7A 2V1YA 4KLMA 2H3ZA 3HM6X 1BPDA 2PVGC 2ZIVB 4RQ0A 4MGYE 4NQLB 5CWRA 4Y2XA 4WJ3B 3N3KB 3JPTA 1U48A 1JRUA 3AU2A 4F3OA 1RQLA 2FE9A 2K8CA 2M0NA 2Z7JA 4DFMA 4MFFA 1MJDA 1AROP 4K81A 4HCPB 3ONSA 4NXZA 2JXTA 4YXDB 2I1KA 2MP2A 4RF0A 1WRDB 4MJSB 2WF6A 4P1BC 4RNOA 2KWDA 1FIQA 3R2IA 3V05A 2KN4A 3IXSA 2AQ2B 2KJ9A 5KL8B 2KAJA 3SQIA 2OOBB 5E6NA 5IA7A 1OEYA 1WG8A 3I9V1 1O08A 4OVVA 5AKXA 1T8EA 4AQ7A 2ZJ8A 2AGPA 4F4ZA 3N7PD 4R63A 2AGQA 4Z6CA 1TAUA 3QA8A 3RI7C 1L3UA 4HPLB 4ARIA 2KVCA 1MG4A 2INCC 5JZEB 4DSIA 4FBUA 2Z59B 4FBTA 3MC1A 2YLMA 4IOIE 4O3RA 1HJPA 4ED6A 2DNFA 2XK5A 2KE7A 2G08A 2DUYA 4B6WA 3SFDB 3SAFA 1C79A 4EZLA 5KFOA 2Y1JA 5DPRA 2ONQA 1WSPA 5C23A 2W8KA 4P7IA 2K22A 1IGCA 2Y5PA 5TR5A 2DYMA 2KVRA 3RFZB 1KJTA 1UGMA 4C4RA 4PGXA 7ICLA 1CK1A 3MR2A 8ICOA 2AX5A 3VVWB 2BS4B 1DXSA 2LUEA 1Q3UA 2KOXA 4IC7B 4DSJA 2KTRB 5AM1A 4C56C 3ZO5B 4EBCA 4DL2A 2WF8A 3H8JA 5F9LA 5CRXA 2L0FA 4F2RA 1ZP0B 4EFOA 5J0XA 4M8MA 1V1PB 1GUAB 3U7ZA 5DB7A 4E71A 7ICVA 5HHHA 2C7HA 4XDDA 1MC8A 4KTQA 2Z8LA 2YB1A 4R66A 3GIMA 4RGTA 4QJFB 4I2CA 4JPSA 2RLTA 2CU1A 1ZQVA 2I6XA 5ALJA 3PZPA 4DXAB 4NM2A 1BNPA 2C5LC 4BXOB 5KG3A 2W54A 2EZYA 3W5VB 2NTSA 5J8YA 5KTQA 3G6VA 3A4RA 4PL1A 4O3QA 5AKEA 4RU9A 1SL0A 2DF4B 2DHZA 1S97A 2EAOA 2LM1A 3RTVA 1BPZA 4C8LA 9ICVA 2L52A 4OW0A 4AJWA 3V61A 2W7PA 4O3OA 4CNQA 1M4VA 4F91B 1Q1OA 8ICMA 5AZGA 4C4VB 2YB4A 3GE3C 1NKCA 3ICXA 3RB0A 5DQIA 2JV3A 1SV0A 4YWGG 4P6VF 4IRDA 4QZGA 2GOWA 3RBDA 2JEGA 1Z5SB 5KFWA 1TK8A 3BQ0A 3PX4A 4AWJA 9ICWA 1L4ZB 4RT2A 5EWGA 2HJ8A 2R8IA 5CP2A 4NLGA 1HEZE 1UZXB 1ZQWA 3IG5A 4ECQA 1UBQA 3QAQA 5IOIA 1SWWA 2K89A 5DKWA 1PGAA 4MM3A 1ZXHA 2NRWA 3NG0A 1MPEA 2LGDA 4JV2A 4ED1A 4N9F4 1FD6A 4DQPA 1J7AA 4IWOA 1BGXT 5T8IA 1ZUD2 2IA6A 2ASLA 3NRWA 2D3BA 3WKDA 1B22A 1D8LA 1S5LU 4YXJA 1V2YA 1XU4A 4I2FA 3ZJTA 2Y0SC 4FJYA 4F5QA 4UBBA 2GLSA 4O1NA 1UELA 2K8BB 1WJ6A 3GIJA 1QSYA 3TACB 4C80A 1FEHA 4FZMA 1MG8A 3RT3B 3TEXA 1RRBA 2IO3B 2WWZA 2YVCA 2HI0A 1MN8A 3KUZA 2WF5A 3KZXA 3M6KA 2NO4A 3UXNA 4G3IA 4E3CA 2LJ5A 4KVGB 2WDRB 3UM9A 1XCQL 5KT2A 5KFRA 5KHQA 2HBMA 3BZCA 3BQ1A 2Y1IA 4I6PA 5KFBA 2KHVA 7ICQA 1D9DA 1T6BX 4TV3A 1G6JA 2MSNA 4DFJA 1QSLA 1NDDA 1WXMA 4EOYA 2LI6A 5KFUA 8ICFA 1ZGUB 4OJLA 1KBUA 3D2NA 4KX5A 4NPNA 2LHDA 4JMUA 4DOCA 2F77X 2CRXA 4O3PA 5CHVC 4I2DA 1ZPSA 4G3XB 4EBDA 1L7MA 3A9JA 3RFAA 1L7PA 1O03A 4YTMB 1AYFA 2PFQA 4M9NA 4RNMA 2GWSA 1ZQYA 9ICNA 2IMWP 1GC7A 2PFOA 1WIAA 4ITKA 3F5EA 3CMMB 1JXEA 5L95C 3TEZA 1JN3A 2LHTA 1T94A 2A1JA 3WA0A 2I2YA 3AU5A 2E8PA 1RLFA 1I4PA 1GG3A 1BVSA 4UB8U 2QSDA 2IGHA 4KN4A 3AEDB 2N9KA 5MPOA 4J03A 4MGIE 1ZQOA 1JUDA 4HROA 3C8YA 3OJ4B 1N61A 3ZNHB 4MEYA 4HKZE 2N1VA 3QU4A 3A1QA 4K4IA 2MH7A 3HX0A 1NVID 3K9OB 1J7BA 3V60A 1KF6B 1P1AA 2WXRA 5KAFU 1LM8B 2CXYA 4CQNA 4QZDA 2PXIA 1UWXA 1Q46A 1U9LA 2QB0A 2JZPA 3H7PA 4UDUC 3R7QA 2FPKA 4C00A 4LJOB 2KDEB 1WXVA 1ZXIA 1A70A 2KFJA 4CF3A 4B9UA 1RQNA 2FE8A 4C7ZA 4TUSA 4PK1A 2W9BB 5ALEA 4O5CA 1HXYD 1P7EA 2QDFA 5C1ZA 4RPZA 1QOFA 2N0SB 3TI0A 5D7GA 4GOCA 4KITB 4QZEA 2VA3A 1V81A 2FLNA 1YJ1A 5IINA 4JUZA 4NLKA 1TS5A 3SEBA 1SZPA 3PHWB 1JX4A 4I2GA 2MBHA 4BFRA 2DGZA 2DYBA 5AKGA 2UVVA 1BPBA 3Q8FA 1I4RA 4XWWA 3D2SA 2ZCCA 1SJED 3BWUD 2E8MA 4WIPA 3EA6A 1F5SA 5AICA 4YMMA 7ICSA 2UVWA 2Q5WD 4F4KA 1QTMA 4DBGA 5J17A 4M47A 2K6QA 2IY0B 2MWSB 5L83A 2BPGA 5KFIA 1UUPA 1TBEA 1L6NA 2QILA 5GXGB 4OVUA 4QWEA 7ICGA 4OO1J 4PS3A 4M0AA 3OG5A 2BVCA 4M01A 2KQ7A 4P0QA 4NM1A 3LWLA 4LNNA 3RD2A 4RUCA 2REXA 2ZNVC 5J0PA 3RZWC 3BS5A 3K1RB 1Q0WB 1F2RI 1TYGB 1E10A 2CS4A 3ZXVA 1JROA 4RFBA 2BKEA 2ALZA 1SE9A 2K4PA 3P4PB 2LUMA 4E74A 2HDEA 4EX6A 4JWSC 2QARA 3NHEB 3M6ZA 5L1MA 1ZW7A 5IAAC 3DQVA 1DOYA 4W9LA 2M0AA 2FDRA 3E56A 4BVUC 2MRPA 1TFRA 4Q8FA 1ZQKA 2JZ3B 1SXDA 4BJQA 4DO9A 1TK5A 4U6PA 2KX0A 1OEYJ 4QWCA 2FIDA 4DHZE 2HHSA 2ZVNA 5J0RA 1JWBD 2IBIB 3HM3A 4OVZA 2W9MA 2DZMA 3GZNB 1Y8RC 3H7IA 1HTOA 2MLBA 4UB6U 4RQ7A 4URKA 1KLUD 3DHGC 3OJ3A 2RRDA 2G0AA 4F93B 3J81j 4R3DA 3AQEA 1SL1A 1TAQA 5AZHA 2HD5B 2CKHB 4QZBA 4DL6A 1KTKA 4IR9A 2G3QB 2LMCA 1F2RC 1LQBA 2ZEQA 4KLJA 3IRUA 1J2MA 3Q8SB 3I28A 4XQ8A 4RT3A 4RQ6A 1VRAB 1XLQA 2YMLA 4WWNA 3P42A 1D8YA 2LYAA 4DK5A 3CF6E 5LXHA 3NVYA 2ON8A 1S77D 1BPEA 4OD0A 1C20A 4KIKB 3I5JC 4KMOB 3JSVB 5ALHA 4LZDA 4HJKA 4EZ9A 1URJA 4JWMA 3TADA 3L0WB 1LKYA 3MABA 1ZQBA 1QZEA 3PTFC 1TKYA 2UU7A 3HHMA 3HVDA 4S17A 3L10B 4NLNA 1WZ3A 3AU4A 5GTIU 1ZYQA 4ANVA 2N9LA 4B9NA 1KDHA 9ICSA 1PYWD 1ZETA 1SE2A 1IBXB 1PVRA 5KG7A 4MEXA 5AKHA 3H4DA 3NGDA 5J2DA 5C3JB 1P98A 5AKZA 3QU2A 3MC9A 3AU6A 4I2IA 2IHMA 3RNAC 2VJ5A 5E6OA 4JWNA 1KFSA 4N59A 1WM2A 2BWES 1XSLA 2C7NB 4QZAA 4PT5A 2WX0A 9ICPA 4LCDE 3BQ2A 2BCQA 1Z4OA 3HJEA 1SE4A 3PZ7A 4ECXA 1D4BA 5ALNA 2KHWB 3JPSA 4BX9C 5KL1B 2KFNA 2NPTB 2QIEB 4KLHA 5D4BA 2BQRA 3N1XC 5E79U 3A0BU 2JRIB 3VAWA 4AJYB 3AEFB 2QC8A 5CB1A 1B0XA 1ZDXA 5HMLA 2F1HA 1L8OA 1BMLC 1VZ7A 1BUIC 4YD1A 1L7OA 3TMPB 4IDIA 2LXAA 3P4RB 5KFNA 1ZQGA 8ICSA 3SAGA 1E8ZA 4IUMB 4F50A 5AM4A 5B66U 1N56A 4DFKA 1SF0A 5CR0A 4RUAA 4PYZA 3PO4A 2ZTDA 1IV8A 4CF5A 2BB6A 1RYJA 1WJNA 1X2IA 3GE8C 3PVLA 5KG4A 2VKQA 5AHXA 1K50A 1F77A 4AUQC 3LJ3A 3L08A 4GIBA 4NL9C 1WE6A 4DQIA 1YN3A 2LXCA 4BKGA 2WAQF 3QU5A 4CYEA 1NI2A 4O0IA 3C23A 3OAWA 4A8XC 1STEA 2NVUI 2ZIWB 2KX3A 2TSSA 1UA0A 4PS8A 3DVNU 4CO7A 5BO4B 4O5KA 3AMZA 3D6JA 4IM0A 1TK0A 1L2NA 2B21A 4IQWA 3RAQA 1E8YA 3W9CB 1GB4A 2IOFA 1TTNA 3ZNZB 5AEKB 4A90A 4EBEA 5D49A 2W43A 3DVGX 2KIWA 2DL0A 1Z3EB 2FJ6A 4H2AA 3KUCB 5DDMA 4ED0A 2XIDA 1ZQZA 5D3IB 3ZQ4A 4UB1A 1L3VA 3C5GA 1QQ7A 3HRDD 4UBCA 4LDTD 1S0MA 4G9BA 5AKLA 3JPQA 4DDID 5KFFA 1NZBA 3RRGA 3IAS1 5HR6A 5JHBA 1FO4A 4YTNB 2KYWA 4DWFA 3EC8A 2N4FA 4BDPA 1JRPA 1C78A 4JIOU 2G5HB 2QMTA 3ETRA 2D3DA 2WB1C 4EEWA 1FRRA 4A3PA 5IN7A 5IIIA 3MGVA 1WY8A 3LDAA 5AI5A 1OFFA 1XEEA 4UAWA 3GU3A 3T5LA 3PMLA 4M04A 3LXFA 4XC2A 2CN1A 3RNBC 1QQRA 4I28A 4JLCA 2EDUA 4RCOA 5D6JB 1SIJA 5DGBA 2LBOA 3AE9B 4DDGD 3DBRB 2LFIA 7ICNA 5BYSA 5D2MB 2V4QA 2OJWA 4QZ9A 4W9JA 4EENA 3IFWB 2EAMA 2XY7A 1VR9A 2W9AA 2QB1A 2FUHB 2GBNA 1OQYA 1MFWA 2GI9A 1UBIA 5T14A 4Z6DA 3ZJVA 1Z00A 2E3TA 2XCAA 4DFPA 4LVSA 5BMHA 2JVCA 2MW5A 3LB8C 1KRPA 2L83A 2YMPA 3ZD8A 2NRZA 5ALKA 7ICUA 1BXTA 2SEBD 3N7SC 2UWQA 2KC1A 2FLLA 4B9LA 2AU0A 4YT0B 1MHXA 3VHTC 3CNHA 5J2FA 1NYQA 1MA7A 2AL3A 1XLPA 2IGGA 3ZVVA 4I29A 3QZ8A 1LO5D 4ZRQA 1R4NB 3WALA 3NUHB 1R4NI 3T5HA 3QIJA 5J0OA 4EUTA 3PX6A 5KFYA 5HMMA 3PSIA 1E8WA 1NK0A 2V9HA 2N7DA 4OCZA 1NK4A 1ZQDA 1UA1A 3E58A 1IIPA 2H88B 5DG8A 3ZUNA 3PW0A 1YZ6A 4FZNA 1WJ4A 5CA7A 1Q3VA 5AM3A 7ICJA 3GFKB 5HHDG 5KFJA 2BZFA 2AQ0A 2ISPA 5CHFA 4Y2VA 2K60A 3H1UA 1HZ5A 3SV4A 3K1ZA 1BT0A 1RDFA 3V6HA 9ICXA 4XUSA 1DK2A 4DF4A 2PMZC 1X66A 1L7YA 4XE0A 1L3TA 2KACA 3QUBA 2O2VA 5JHAA 4R8UB 4M6WB 4C8OA 4EYHB 2J4XA 3WAOA 5ALGA 1QH9A 5J0YA 1F9JA 5BYRA 2C22A 2B76B 3ZTCA 1FNWA 4KSLC 4W9FA 2L05A 1H8CA 3N1ZC 4RM8A 4QWDA 4KX6B 5KT6A 2NYVA 3T79A 1FXTB 5AKKA 1JCKB 1S0VA 2PPHA 2WF7A 2ZPYA 5EWEA 2EAPA 1EF5A 1TZOA 2ZW0A 3JYUA 3PZDA 4DS5A 3T3FA 3JVZX 4KX3A 2IJ0A 5L1IA 4NWIA 1ZQMA 1FCCC 4CCHA 1QF6A 3KBBA 4JV0A 1MI0A 1WXQA 1GAQB 5AKIA 4OJ5A 1XC9A 2KT7A 2AQ1B 1GC6A 3MGHA 2RP5A 5IILA 2BCRA 1F0MA 3UPQA 2I9GA 5KG1A 1T0RC 2WXNA 3RR7A 5J8YC 4B9SA 4HDOA 3HIZA 2ZG6A 2JT4B 2ACZB 3EFUA 3DBLI 2M8SA 4ECRA 2LRWA 1TGZB 5AK6A 4ED2A 3EECA 5B5EU 1CQVA 4YSXB 2VZKB 1S76D 1AW7A 3UXPA 4QZ8A 3BDPA 1CZPA 3DEEA 2JEFA 4YVZA 2WDTB 4QIWC 4ED7A 1XO3A 3BVGA 2KC2A 1SV0C 4KDIC 1ET9A 2PI4A 5G5HA 4A9AA 1K1SA 1EM7A 4F1SA 1PK1B 4BBNF 4F5PA 4FZLA 3FM9A 5DB8A 1U49A 1P0RA 4J9RA 2D07B 3L13A 4RQ4A 1ZE3D 3U2SC 2KG5A 4QWAA 4GXJA 2MBQA 5KG6A 5J0QA 3IDWA 1A76A 2L5YA 1TKGA 5LXIB 3A0HU 2BDPA 1S0OA 3KHLA 3JPRA 3RJGA 2WDVB 2ZPNA 4FXCA 2MJDA 1JXLA 3Q3OC 2ODGA 3HT3A 2WXPA 3I3TB 1Q8KA 1RXVA 3IT6B 4DSFA 2ZXHA 4YFKA 4BAXA 3A4SC 2LJIA 1C4CA 2N9XA 4PGQA 4DSLA 2L1AA 1VJ5A 4ECVA 5KNIA 3PNCA 5CHGA 2RQ5A 4J9KA 1U45A 5J0TA 2RDJA 3CW2C 5DB6A 1E7VA 1XXGA 2G1EA 2JZBB 2JYEA 4NZLB 1DYQA 4MGKE 3BJYA 2W9CB 4Q8EA 2RSUA 5ALYA 5DQHA 2R8KA 3SEIA 3A9JB 4JL9A 4B6JA 5GMVA 4FA6A 8ICYA 2LRUA 4P4MA 2C60A 4HDQA 5EE9A 8ICWA 4TSSA 1S9FA 1KEJA 2PIAA 3QX1A 2AYOB 5JU5A 2N1WA 8ICEA 2DQNB 2HJ1A 3AH7A 2BB5A 1T3QA 3TL5A 4MSMB 3DVGY 4I27A 3PHXB 3MDCA 4M2YA 8ICKA 4DFDA 5KFTA 3PSEB 4LNIA 1ZKHA 5D94A 3F53A 2BCVA 2P35A 1IM4A 2KD1A 4DXFA 1WM3A 2F2AB 3PV8A 5TZVA 4FHJA 1UHUA 3AE6B 3BVZA 2FLPA 1KFYB 3ZLZA 3WKAA 3H8MA 4P16A 1V9JA 3VC8A 2RDHA 5KFQA 4ARCA 3FDSA 2QB0B 9ICGA 2F76X 2XN9C 5LNK1 3PRZA 2LM4A 5FK9C 1VLBA 1D9FA 3Q3JA 1SGHA 5KFDA 4XX5A 3TEWA 4DLGA 3PSFA 1E6EB 1UH6A 2LEKA 2IOFK 4KSKC 1WRIA 3H8WA 1SKWA 4KV2A 3DHHC 5HFYA 4EZ6A 4ICVA 2J0KA 1X6IA 1FRDA 2KKCA 4MH8A 3ZNGC 2QLTA 1NENB 2E5SA 3U4EG 1WMHA 2VJ4A 3FILB 9ICUA 1PQSA 2PI5A 3ISBA 4EEKA 3SHQA 3QXGA 4YR3A 2ZUBA 4AP4C 3PRPB 2IBKA 4YSZB 1B43A 4AYBC 3C2KA 2BDUA 1MQ3A 2O6VB
chains in the Genus database with same CATH topology
2BW2A 2W82A 4RGNA 3E9SA 1OQRA 3Q8FA 1I4RA 1TKEA 2K5PA 4XWWA 2I38A 1SJED 2AQ3B 3BWUD 5TSSA 4WIPA 3EA6A 4MM3B 3CWIA 2IDYA 2WXMA 1N63A 2ZW1A 3AE8B 2Q5WD 3AB5A 4WH4A 4B0EA 2CJNA 3AM9A 1FXIA 2MEKA 3BYTB 3NVWA 3AE5B 1UUPA 2WXKA 1ENFA 2J42A 2BTEA 1VZ6A 2QILA 1MHHE 1HQRD 5GXGB 1V8CA 1TY0A 2SAKA 2WP9B 1PFDA 2DWQA 1RFKA 2BBCA 2JYTA 1E7PB 1SJHD 4AS1A 3B2GA 3W2DA 1C76A 1NEKB 1N62A 1D6EC 1F2RI 1TYGB 1E10A 1D5MC 2GB1A 3W5UB 1JROA 4RFBA 4OZBA 1YJJA 1YNTE 2WXHA 1RM6C 3P4PB 2LUMA 2HDEA 3SR6A 1SE3A 2WXFA 4US8A 4JWSC 4XDCA 2BT6A 4REZA 1DOYA 1AWDA 2M0AA 2G9HD 3E56A 3R2TA 1C4PA 2PMVA 1JWBD 4OVZA 2L32A 2PTLA 1XF5L 4WURA 1GPXA 3AEEB 1KLUD 3U52E 2HTME 4R3DA 4YSYB 3Q8BA 2LMCA 3VRAB 1KTKA 1F2RC 1L6UA 3AN1A 1WGKA 1XCTL 2OEDA 4RGOS 3NRZA 1VRAB 1XLQA 3P42A 3VRBB 4DQOC 3NVYA 2ON8A 3URYA 2NTTA 2WXQA 1D5ZC 3BZDB 2E6XA 4ZYSA 1D5XC 3P63A 4KGTA 3V3XA 2RMMA 3W1SA 4TQ1A 1TKYA 2LHEA 3HVDA 1DOIA 2QEJC 3KQ4A 1YJIA 3EGRA 2INNE 2N9LA 1C77A 2WXLA 3OWEB 3MHZA 1N5WA 1SE2A 1PYWD 1IBXB 4L2YA 1EWCA 5C3JB 3AEGB 3AE1B 1IUEA 1QILA 3O13A 3R8BA 3I57A 1FFUA 1UWMA 2RDGA 4MACA 3AECB 4N59A 1TS4A 2JU6X 4NAMA 4LLGM 2V0GA 1SSNA 2NMQA 4ZOHC 4PT5A 1YN5A 3AE3B 1NI3A 2JSVX 2W3RA 2DLBA 4LTUA 1R7SA 4M0WA 1SE4A 3PZ7A 1D4BA 3P4QB 4TQ0A 2QIEB 2JQRB 3BYYB 3PZ8A 3GP7A 1HZ6A 1B9RA 1C4AA 1J7CA 1EU4A 5FR3A 3AEFB 1OQQA 1GOZA 1ZDXA 3P1MA 1I4HA 1L4DB 3GB1A 1BMLC 1Y56A 1VZ7A 2KQ4X 1BUIC 3FAHA 2PVOD 3CIRB 2GRIA 1FXAA 2H89B 4IDIA 3P4RB 2WS3B 1V1PA 1QOBA 1K53A 2V3NA 3KWVA 3BK2A 2PLPA 1ESFA 1YN4A 2PKOA 1JW9D 1SF0A 2V4IB 3KWLA 1VJKA 2W3SA 1FNVA 3T3OA 4US9A 2BB6A 1RYJA 1NYRA 1FFVA 4RGMA 1PUTA 1FNUA 4B0MA 4EE2A 5E6JA 3VR8B 1I4XA 1K50A 1F77A 1QLBB 2J53A 2R61A 4WQMA 3BVMA 1YN3A 4OHJA 1YQ4B 2WXGA 3VQIA 4NJCA 1FMAD 3HUIA 1T5XD 4A8XC 2Y5CA 3L4PA 1STEA 3AEAB 2WLBA 3Q8CA 4HJGE 1WYGA 4XWTA 2YEPB 2TSSA 2IPKD 3AMZA 2RPVA 1L0YB 2PVGC 1XLNA 5EE0A 1UGJA 3W9CB 1GB4A 4A90A 4NAWB 4H2AA 5H8YE 4A6QA 2WXOA 1E9MA 3T3NA 5D3IB 3ZQ4A 1AN8A 3HRDD 2JXTA 4YXDB 4RF0A 4GLSC 1SB3C 5HG2A 3IAS1 2KWDA 1FIQA 4RF1A 1FO4A 3R2IA 3PO0A 4YTNB 3V05A 2KN4A 3AEBB 3IXSA 2AQ2B 3VR9B 1QOGA 1K52A 1JRPA 1C78A 2KAJA 4RH6A 2QMTA 3WCQA 3ETRA 4IKGA 1FRRA 3I9V1 1MVKA 4AQ7A 1OFFA 1XEEA 3EUB2 1YQ3B 2FBWB 3LXFA 2LGIA 1DGJA 1QQRA 4ARIA 4RCOA 1SIJA 3KLSX 3AE9B 5BYSA 1RWSA 2LFIA 4A55A 5I4DA 4IOIE 1VR9A 3MFGA 5H92C 2GI9A 1YMHE 1L6VA 3ZJVA 2E3TA 5BMHA 1SEBD 3NVVA 3LB8C 2L83A 3SFDB 1P7FA 2SEBD 1BXTA 4YT0B 1C79A 4C7YA 4L1BA 1JQ4A 1JWMD 1MHXA 2N7JA 1N5XA 1NYQA 2EELA 1WSPA 2ONQA 3ABVB 1XLPA 1UNSA 2IGGA 3B2FA 3H8HA 4HEA1 2K22A 1IGCA 2Y5PA 3MJ5A 1TS2A 1TJEA 1LO5D 4ZRQA 1ET6A 2CU3A 2DYMA 3MC0B 2JWUA 4KKIA 3NUHB 1I4QA 4N6EB 3RFZB 3IAM1 1CK1A 5BMGA 1E0ZA 1JWAD 2ICIA 4HRSA 2AX5A 2YEPF 4KGSA 2K9XA 1F0ZA 2BS4B 2PW9A 1KLGD 2H88B 5C2TB 1V97A 1DOXA 2WXJA 4C56C 3NS1A 1I7HA 5HHDG 1VZ8A 5EE1A 2X38A 1ZP0B 2WNMA 1V1PB 2Y3AA 1HZ5A 3U7ZA 3HVZA 1QOAA 4XE0A 3B9JA 2KACA 4XDDA 2Z8LA 2D5GA 5JXVA 3ZGZA 5HI1A 2J4XA 3NZ3A 4RGTA 2M56B 2BS2B 2XNAC 2W55A 1EU3A 4J3OD 4JPSA 5BYRA 2B76B 3AE7B 1FNWA 2V3PA 2M19A 3SFEB 2WU2B 2W54A 1SBBB 2KDMA 3DWGC 4GDKB 2NTSA 2JX5A 4KX6B 3W5VB 4DXGA 2BYTA 1JCKB 1TZOA 2ZW0A 1GB1A 2MJ3A 2IJ0A 4OW0A 4USAA 2L52A 1FCCC 3IT4B 1QF6A 1FM0D 1WWTA 1M4VA 1MI0A 1GAQB 1WXQA 5FKAC 4D2KA 4ZHOA 3FILA 2AQ1B 1ROEA 2J52A 2IGDA 1K51A 4YWGG 1TY2A 3P4SB 4KKJA 4P6VF 1FCLA 4N58A 2WXNA 4JX1C 2WU5B 2ACZB 1L4ZB 1V1OA 3NVZA 4HKQA 3ZJUA 1HEZE 1CQVA 4YSXB 2VZKB 1AW7A 4JWUC 3FC4A 1CZPA 5EE3A 3GS2A 1PGAA 1ZXHA 1MPEA 1N60A 1XO3A 3BVGA 1FD6A 1J7AA 1ET9A 1L0XB 5G5HA 3TSSA 4A9AA 1EM7A 1I4GA 5T8IA 1ZUD2 2DYOA 1ZE3D 3U2SC 3TUOA 3ZJTA 1TKGA 2BS3B 2INPE 4O1NA 2K0PA 4WAFA 1KRHA 2WDVB 4FXCA 4L23A 4C80A 1FEHA 3AE2B 2MJDA 3BIID 3TEXA 2WXPA 3AV8A 3IT6B 1JWSD 1EWYC 2LJIA 1C4CA 2L1AA 2WDRB 3DWMA 3Q69A 1XCQL 2CJOA 5G5GA 3LYYA 1XXGA 2JYEA 2G1EA 3MP9A 3ZYYX 1T6BX 4NZLB 1DYQA 3AE4B 4WWMA 5BMIA 4MT5A 1VDVA 5EE9A 5AUKA 4JE3B 1ZDVA 4TSSA 1ZOYB 2PIAA 1L0VB 1Q10A 5BYQA 2LHDA 2FUG1 1ZPSA 1KH0A 4ZRPA 2KMMA 1HA5A 3AH7A 1L5PA 4YTMB 2BB5A 1T3QA 1AYFA 3RPFC 1PDXA 1JWUD 1TS3A 2K3UA 2WXIA 2QJLA 4ITKA 3TEZA 4OZCA 2OHFA 2WDQB 3N9YC 2I2YA 1B1ZA 1PGXA 4DXFA 3J9CA 1I4PA 5D3DA 3AE6B 3BVZA 1KFYB 4OZAA 2QSDA 2WQYB 2EKIA 2IGHA 3AEDB 4P16A 2N9KA 2RDHA 5MPOA 4ARCA 1SXTA 2XN9C 5LNK1 4HROA 3C8YA 1N61A 5FK9C 1VLBA 1IGDA 4HKZE 1CJEA 1IBXA 3TEWA 1E6EB 2MH7A 1NVID 4TMAB 1J7BA 2LEKA 1KF6B 4Q2JA 1QT9A 1WRIA 2WXRA 1C9FA 4CQNA 1UWXA 2JZPA 1ACCA 5HFYA 4GDLB 4UDUC 1JALA 1FRDA 1ZXIA 4MH8A 1A70A 3Q8AA 3UI3A 2FE8A 2VZKD 4C7ZA 1NENB 1PGBA 3Q8EA 1XLOA 4LK0M 3U4EG 3FILB 4RNAA 1HXYD 1P7EA 2DBYA 2MJEA 4YTPB 1QOFA 2N0SB 5AUIA 4ZHPA 5D7GA 3TEYA 3BK1A 4KGRA 4YSZB 1QKZA 1TS5A 3SEBA 1JMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWM A;  1SIJ A;  1J7A A;  3AE9 B;  1RWS A;  5G5H A;  3AEC B;  4N59 A;  4A9A A;  1OQR A;  1ZUD 2;  1TKE A;  4ZOH C;  2K5P A;  3AE3 B;  5H92 C;  1NI3 A;  1L6V A;  2W3R A;  2E3T A;  4LTU A;  1R7S A;  3CWI A;  3P4Q B;  3NVV A;  3LB8 C;  1N63 A;  2L83 A;  1TKG A;  3AE8 B;  3SFD B;  2Q5W D;  3AB5 A;  4YT0 B;  2BS3 B;  4C7Y A;  1JQ4 A;  2QIE B;  2JQR B;  1N5X A;  1NYQ A;  2CJN A;  3ABV B;  3AM9 A;  1FXI A;  1B9R A;  1XLP A;  1KRH A;  3NVW A;  1J7C A;  2WDV B;  3B2F A;  4C80 A;  3AE5 B;  2K22 A;  1OQQ A;  2MJD A;  3AE2 B;  3AEF B;  3BII D;  1TJE A;  2CU3 A;  3P1M A;  4N6E B;  5GXG B;  1V8C A;  3AV8 A;  2PVO D;  3CIR B;  3FAH A;  2WP9 B;  2H89 B;  1FXA A;  1EWY C;  1PFD A;  1RFK A;  2DWQ A;  3P4R B;  4IDI A;  1E0Z A;  2WS3 B;  1E7P B;  1JWA D;  4HRS A;  1QOB A;  2AX5 A;  3B2G A;  2WDR B;  3DWM A;  1NEK B;  2K9X A;  1F0Z A;  1N62 A;  5G5G A;  2CJO A;  2BS4 B;  1TYG B;  2PKO A;  1E10 A;  1JW9 D;  1SF0 A;  2H88 B;  1V97 A;  3KWL A;  1VJK A;  2G1E A;  2W3S A;  5C2T B;  3ZYY X;  3NS1 A;  3W5U B;  4US9 A;  1JRO A;  1I7H A;  3AE4 B;  1YJJ A;  1RYJ A;  4WWM A;  1NYR A;  5EE1 A;  1RM6 C;  3P4P B;  1FFV A;  1PUT A;  1VDV A;  5EE9 A;  3SR6 A;  1ZP0 B;  4FXC A;  4US8 A;  4JWS C;  5AUK A;  3VR8 B;  1QLB B;  2BT6 A;  3HVZ A;  1ZOY B;  2PIA A;  1L0V B;  4WQM A;  1QOA A;  1DOY A;  1AWD A;  1YQ4 B;  3B9J A;  1FMA D;  3HUI A;  2KMM A;  3AH7 A;  1L5P A;  4YTM B;  1T3Q A;  1AYF A;  3RPF C;  2M56 B;  1PDX A;  3L4P A;  2W55 A;  2BS2 B;  2Y5C A;  3AEA B;  2B76 B;  3AE7 B;  2WLB A;  1JWB D;  2M19 A;  1WYG A;  2QJL A;  4ITK A;  3SFE B;  2WU2 B;  1GPX A;  2W54 A;  2OHF A;  2WDQ B;  3AEE B;  3DWG C;  4KX6 B;  2JX5 A;  3AMZ A;  3W5V B;  2HTM E;  4YSY B;  2PVG C;  1XLN A;  3AE6 B;  3VRA B;  5EE0 A;  1KFY B;  3W9C B;  2WQY B;  2MJ3 A;  1L6U A;  2EKI A;  3AN1 A;  4USA A;  1WGK A;  2L52 A;  3AED B;  5MPO A;  3NRZ A;  1QF6 A;  1XLQ A;  4HRO A;  1FM0 D;  5H8Y E;  3VRB B;  1WWT A;  1N61 A;  1WXQ A;  1VLB A;  1E9M A;  1GAQ B;  3NVY A;  4ZHO A;  1CJE A;  1DOX A;  1E6E B;  2MH7 A;  3HRD D;  1ROE A;  1NVI D;  1J7B A;  2LEK A;  4YXD B;  1KF6 B;  3P63 A;  1QT9 A;  3P4S B;  4P6V F;  1WRI A;  1SB3 C;  1TKY A;  1FIQ A;  4N58 A;  1FO4 A;  3PO0 A;  4YTN B;  1DOI A;  3AEB B;  1JAL A;  3VR9 B;  1FRD A;  4JX1 C;  2WU5 B;  1QOG A;  1ZXI A;  1YJI A;  1JRP A;  3NVZ A;  1A70 A;  2ACZ B;  2KAJ A;  3WCQ A;  4C7Z A;  1NEN B;  3ETR A;  1XLO A;  1N5W A;  1FRR A;  4YSX B;  2DBY A;  2MJE A;  4JWU C;  4YTP B;  3AEG B;  5C3J B;  1QOF A;  1OFF A;  2N0S B;  3FC4 A;  1CZP A;  3AE1 B;  5EE3 A;  5AUI A;  3EUB 2;  4ZHP A;  1YQ3 B;  1IUE A;  2FBW B;  3LXF A;  4YSZ B;  1DGJ A;  1FFU A;  1N60 A;  1XO3 A; 
#chains in the Genus database with same CATH topology
 3OHA A;  1H38 A;  1E7U A;  2KEY A;  2HDO A;  2DAF A;  4KLL A;  4DL5 A;  3I1Y A;  2Z0D B;  2DFL A;  2LPE A;  2KVS A;  3APD A;  2NS5 A;  4C4T A;  2IYD B;  3N1Y C;  3N20 C;  4UB3 A;  2KQS A;  2WXM A;  2WTF A;  4DHJ B;  3AE8 B;  2KFK B;  5KFK A;  3DVN V;  3HKZ C;  2KZM A;  4QNL A;  5ALV A;  4B0E A;  1XD3 B;  2CJN A;  2ZIX A;  5JTI A;  2MEK A;  3LDZ E;  1WZ0 A;  3KHH A;  4IM2 A;  3VUW A;  1ENF A;  2J42 A;  2BTE A;  2I1Q A;  1MHH E;  2FCM A;  4XGA B;  1V8C A;  3C28 A;  1TY0 A;  3K75 D;  3WK6 A;  5EWF A;  4WWP A;  2FPM A;  4ECY A;  2JRZ A;  3UMC A;  8ICC A;  2D3C A;  3NJT A;  1E7P B;  3KVF B;  2KOB A;  3W2D A;  2WF9 A;  4F92 B;  5BPC A;  2ASJ A;  3DHI C;  3NTU A;  4FBJ B;  1SWV A;  4NLZ A;  1Z19 A;  3B0X A;  4C0Z A;  1YJJ A;  2KV2 A;  1RM6 C;  2ES6 A;  2FMS A;  2ISO A;  4CGZ A;  3SR6 A;  1SE3 A;  2MQJ A;  2W7O A;  4XDC A;  2BWF A;  4REZ A;  5KFZ A;  1ZQL A;  3OJU A;  2KWU B;  1J0G A;  1AWD A;  3FKY A;  2LVQ A;  1WR6 E;  4MDK E;  2B0C A;  2ZIV A;  4MEM A;  5DB9 A;  4I2B A;  3Q6B A;  1ZQC A;  4RNN A;  2DKZ A;  3QUT A;  3TAP A;  2IO0 B;  4ASW C;  3QU9 A;  4F5O A;  3N4M B;  2HOF A;  3E0F A;  4Q43 A;  2PTL A;  4PZO A;  1YQB A;  1XF5 L;  3ML8 A;  4WUR A;  3JW0 X;  4WWO A;  1GPX A;  3TFR A;  3ETL A;  3DBH B;  3DBH I;  3U52 E;  4ED8 A;  2XY5 A;  2RHF A;  2J0M A;  4YSY B;  1WI0 A;  2ZZP B;  2JXJ A;  1SXE A;  2ZCB A;  3QC8 B;  2L3Z A;  4MH0 E;  2K1F A;  4MJS A;  4RGO S;  3RNF C;  4RPX A;  2MA1 A;  2F3N A;  3RH5 A;  3P2B A;  1F1H A;  3VRB B;  2K4I A;  1KFD A;  3IV6 A;  3V6J A;  2W03 A;  2XO7 A;  3RZF A;  4F4W A;  2Y0S F;  4YR0 A;  2KJR A;  2NTT A;  4HPP A;  1OTR B;  4P4P A;  1D5X C;  4KGT A;  2NRT A;  3W1Y A;  2DPI A;  3W1S A;  4TQ1 A;  2KHQ A;  2KSO B;  2DPJ A;  3R7R A;  2ZXI A;  4DL4 A;  7ICR A;  1DOI A;  2QEJ C;  5ALR A;  2G45 B;  1YJI A;  3OWE B;  2H3Q A;  3QUC A;  1C77 A;  3WAM A;  1V5O A;  1RPL A;  8ICN A;  1K5O A;  2PFN A;  2ZJ5 A;  2EH9 A;  1A6S A;  3G6X A;  1J2N A;  4ECT A;  1D8B A;  1IUE A;  4CDG A;  3RUL A;  3V7J A;  3WKB A;  3MC8 A;  4DHZ B;  2HSZ A;  3R8B A;  4JV1 A;  4DWI A;  3LYS A;  3QEB Z;  5DBB A;  2RDG A;  3AEC B;  1WYW B;  3TAD C;  4YMO A;  2JU6 X;  4LLG M;  2V0G A;  3MBY A;  4ZOH C;  1YN5 A;  5E6P A;  2V4L A;  1X40 A;  3N97 B;  2JEI A;  2VH2 A;  4LTU A;  2AH5 A;  2FPL A;  3ISD A;  1YX5 B;  3DBS A;  8ICZ A;  1KOT A;  2WHE A;  3EWA A;  1TZ1 A;  1X1M A;  5G55 A;  5AK3 A;  3KZI U;  2KTF A;  4DCC A;  1NJZ A;  1B9R A;  2BPF A;  2IO2 B;  2NCN A;  2KTR A;  7ICF A;  1GOZ A;  2ZNV B;  1TE2 A;  1WFY A;  3P1M A;  3GB1 A;  2KQ4 X;  3WK8 A;  3SEN A;  3FAH A;  3H4B A;  3PW7 A;  2OYY A;  2KJ8 A;  1V1P A;  4Z6E A;  1QOB A;  3RJE A;  4RQN A;  8ICJ A;  1K53 A;  4WJO A;  1ESF A;  8ICT A;  2AQ4 A;  3OSN A;  2V4I B;  1VJK A;  2KN5 A;  1FNV A;  3T3O A;  1B4F A;  3PPA A;  3PX0 A;  4DSE A;  2HBL A;  1JIH A;  2IOH A;  2JH7 A;  1COK A;  1SL2 A;  5LLI A;  1NJY A;  3PW4 A;  1FNU A;  3VFK A;  2ZIU B;  3ZNI D;  4G0N B;  2J53 A;  4P1C C;  4BXO A;  3UIN B;  4GFJ A;  5AKJ A;  3SYZ A;  3LVW A;  3M8S A;  5DLG A;  2HOI A;  4BOS C;  5ALW A;  2D3G A;  4FS1 A;  4PHD A;  4YMN A;  4GLX A;  2BHN A;  3PR4 A;  3ISC A;  4HJG E;  1WYG A;  5KFV A;  2IPK D;  2RDI A;  4C8K A;  3KHG A;  5BOM A;  1F44 A;  3PO5 A;  2DZI A;  3L5K A;  4C4V A;  4II2 B;  1L0Y B;  4FN2 A;  1XLN A;  2DZJ A;  5EE0 A;  2P6U A;  2KDB A;  4DEZ A;  5J2E A;  4NAW B;  3M62 B;  3O0F A;  3TBL D;  3H9D A;  2NBU A;  3RUI B;  5H8Y E;  4A6Q A;  1T0Y A;  1IG6 A;  2OM6 A;  2P66 A;  3T3N A;  4NJ8 A;  2MUT B;  7ICT A;  1AN8 A;  4TUP A;  2LAS A;  3A9K A;  1HUO A;  4BWJ A;  9ICA A;  1UCV A;  1VD2 A;  2KZR A;  4RF1 A;  1SV4 A;  4K3C A;  2KNJ A;  3AEB B;  5L1L A;  3VR9 B;  4NY8 A;  1K52 A;  1CMX B;  2G4S A;  2HBK A;  3LK9 A;  2MCN B;  1LFD A;  4R65 A;  1OGW A;  5L1J A;  2MU2 A;  1RAX A;  2AWT A;  3M3J A;  3PLU A;  4HCN B;  1E8X A;  2MRL A;  1EF1 A;  5TIS U;  2GBR A;  1YQ3 B;  2QHO A;  1QQ6 A;  4MEL A;  3PRE A;  2KIC A;  2LGI A;  1DGJ A;  4UAU A;  3RJH A;  4MF2 A;  1RWS A;  2MHJ A;  4UAS A;  2K8B A;  1ZD2 P;  1YX6 B;  2VA2 A;  3MFG A;  5L9X A;  3THV A;  2NBV B;  3WK5 A;  2PE9 A;  1YMH E;  1IP9 A;  5IIO A;  5ALM A;  4JK1 A;  4I2J A;  2KFZ A;  2H3V A;  4CRX A;  3T8M A;  5IIM A;  1P7F A;  3M63 B;  5ALS A;  2D2Q A;  3B0Y A;  1JQ4 A;  4L1B A;  1JWM D;  1N5X A;  2EEL A;  1WF9 A;  5AI4 A;  1UNS A;  2FCQ A;  2YX8 A;  4HEA 1;  5AI0 A;  1TS2 A;  1XWL A;  4BZA A;  1XSP A;  1ET6 A;  2CU3 A;  1YD8 U;  3MC0 B;  5AKY A;  4KKI A;  4LNO A;  1I4Q A;  3GII A;  5AZF A;  3IAM 1;  5BMG A;  2Y5B B;  3GV5 B;  1ZQX A;  1E0Z A;  3UQ2 A;  4CE6 A;  4HRS A;  1ECW A;  3CYM A;  5KT5 A;  4MFA A;  1ZJM A;  2K9X A;  2M4N A;  3IHP C;  3QJZ A;  3DPD A;  2PW9 A;  5DQG A;  4PS7 A;  3IVF A;  5C2T B;  1V97 A;  1DOX A;  4LNF A;  5ALL A;  3NS1 A;  2C2D A;  1ZQJ A;  3ZDM C;  1GNU A;  2XIC A;  3KKA A;  3KYC D;  3M9N B;  1VZ8 A;  1WH3 A;  2OJR A;  1WGH A;  2BCS A;  4F5N A;  2XVT A;  2YQE A;  2OWO A;  2YTU A;  2WNM A;  3RB4 A;  2BPS A;  2KLC A;  2OH2 A;  2Y3A A;  4FUL A;  1NNL A;  2KIV A;  4YCX A;  1V80 A;  1X6J A;  2W04 A;  3HVZ A;  1QOA A;  1T0S C;  3RB6 A;  4ZDV A;  4Y2Y A;  3ZI4 A;  4J9L A;  2Z0E B;  4OJP A;  4E0D A;  3EFC A;  4M9H A;  4PHA A;  2C2E A;  1WCL A;  3WAP A;  2ZTE A;  3NY5 A;  2G07 A;  2I5H A;  4P0P B;  2V3S A;  5HI1 A;  3ZGZ A;  3EZ5 A;  2LYB A;  3C21 A;  3QWZ B;  5DLF A;  2BS2 B;  1EU3 A;  2XNA C;  4Z6F A;  5KFP A;  9ICJ A;  2W8L A;  2V3P A;  3AE7 B;  2M19 A;  2XI9 A;  2WU2 B;  8ICV A;  8ICQ A;  1SBB B;  4DXG A;  2BYT A;  8ICP A;  2DKX A;  1WGD A;  2JWZ A;  2CPR A;  4UAV A;  2HE7 A;  1E90 A;  2HCF A;  2MJ3 A;  1ZRN A;  4USA A;  4HXD A;  2GBJ A;  4GDK A;  1PK3 A;  4D2K A;  4ACF A;  2R8J A;  5AM0 A;  2OCE A;  2W9B A;  4BOZ B;  3BQT A;  4IW0 A;  1ROE A;  1M6Y A;  5ALP A;  5DBC A;  4YQW A;  1K51 A;  1TY2 A;  1FCL A;  1L3S A;  5DG7 A;  1NK6 A;  1ZQP A;  2KZZ A;  3DCG A;  1YIW A;  9ICI A;  4N58 A;  4FS2 A;  5CX3 A;  3GDX A;  2XC9 A;  4JX1 C;  2K8C B;  4YN4 A;  1V1O A;  2E1E A;  1XO1 A;  2KLG A;  2JY6 A;  3A33 B;  3ECI A;  5J18 A;  1D3Z A;  2HHQ A;  2VIX A;  1TT5 B;  4FLH A;  2JPH A;  2MP2 B;  2EMS A;  2D10 A;  5EE3 A;  3RJI A;  3VTV A;  1I35 A;  2J6U A;  3M95 A;  2E8N A;  3KH0 A;  4WQO B;  5ALF A;  1ZQS A;  2NV3 A;  3V6E B;  3TSS A;  3RR8 A;  1I4G A;  2JHD A;  2H3F A;  3GOE A;  4P4O A;  2J6S A;  3UMG A;  2JH1 A;  4IRK A;  2DYO A;  3APC A;  9ICH A;  3ZRF A;  2HHW A;  4ED3 A;  4OJ6 A;  1T0Q C;  5J2R A;  4NV0 A;  1KN5 A;  2BS3 B;  4WJP A;  9ICF A;  1LXD A;  2KMA A;  4J9M A;  4WAF A;  1ZQH A;  5KG5 A;  1KRH A;  2HHT A;  3AE2 B;  3BII D;  4Y2T A;  3UIO B;  2AL6 A;  2XK5 B;  4ZYN A;  3AV8 A;  3G6Y A;  2KWV B;  9ICQ A;  1JWS D;  4GGQ A;  4BWM A;  2WFA A;  4GC6 A;  1C3T A;  1V6E A;  1RG6 A;  3WK7 A;  3Q69 A;  2LVP A;  3PW2 A;  1X42 A;  4PH5 A;  2XGP A;  2BYV E;  3MFH A;  2KTQ A;  3ZYY X;  1IXR A;  2IO1 B;  2KJ5 A;  2BCU A;  3AE4 B;  3EHV A;  2BPC A;  4M02 A;  5BMI A;  5L1K A;  4G11 A;  4MT5 A;  4DQR A;  1VDV A;  4MF8 A;  4HYK A;  2KKV A;  4YD2 A;  2IHN A;  5AUK A;  4JE3 B;  3ZDT A;  1ZDV A;  5DBA A;  2NRV A;  2KD0 A;  1L0V B;  5BYQ A;  2K8A A;  1WCN A;  4UQG A;  2FUG 1;  5CHW A;  1EO6 A;  1KH0 A;  3Q14 C;  2KMM A;  3HWT A;  2WB1 F;  1PDX A;  3L3F X;  2LKY A;  9ICR A;  1WXA A;  2DAJ A;  2VH1 A;  1UT5 A;  5J2C A;  3NOB A;  1WGG A;  2QJL A;  4FAD A;  2RDB C;  2NO5 A;  3IHQ B;  4OZC A;  2OHF A;  4BKS A;  1IPG A;  3N9Y C;  4BUG A;  2ZVO A;  3IG3 A;  3QZ7 A;  1QQ5 A;  4KIK A;  5D3D A;  3JSV A;  4OZA A;  2WQY B;  3OGU A;  2EKI A;  5ALX A;  2LWP A;  1GO3 F;  2L8J A;  1SXT A;  1NJX A;  2YMM A;  2IND C;  1HIW A;  3R66 C;  3H6N A;  5J2I A;  4IWP A;  3C1Y A;  1IGD A;  2HHV A;  4A8E A;  4J6I A;  4DQS A;  1CJE A;  1IBX A;  4QZC A;  1HEK A;  2ZUD A;  4TMA B;  1QT9 A;  1C9F A;  3QX7 A;  4NNJ B;  2BYF A;  1Y88 A;  2LVO A;  1JAL A;  4S0R A;  4W9H A;  4KLD A;  3Q8A A;  3UI3 A;  5AIA A;  1XLO A;  7ICE A;  3AUL A;  1H4R A;  8ICI A;  4RNA A;  3SI8 A;  3ALR A;  2DBY A;  2F44 A;  2MJE A;  5HP4 A;  4TKN A;  5AUI A;  4ZHP A;  3MR6 A;  2CHX A;  3TEY A;  3CP8 A;  4NY0 A;  4GDL A;  4TUQ A;  2MSE D;  3AI5 A;  5KFL A;  1QKZ A;  2KAN A;  2QCZ A;  2JZZ A;  4KMU A;  4DSK A;  1PVP A;  1MQ2 A;  1JML A;  5TSS A;  4ZH4 A;  3UIP B;  2NPT A;  2BW2 A;  3E2E A;  2W82 A;  1F52 A;  4UAT A;  3C1Z A;  3E9S A;  4RGN A;  4M00 A;  1ZQN A;  1OW5 A;  1OQR A;  2MA9 B;  4XZ4 A;  2N1R A;  5IIK A;  1TKE A;  5AI6 A;  2K5P A;  2N9P C;  4GMV A;  1PVQ A;  4MM3 B;  1S3S G;  1X9X A;  3DBL B;  2PMZ F;  2IDY A;  2R8G A;  1N63 A;  2ZW1 A;  4IQU A;  3AB5 A;  4I2H A;  8ICB A;  2JF5 A;  3Q8L A;  3AM9 A;  1FXI A;  2XY6 A;  1GJZ A;  4K7S A;  3U26 A;  4NLB A;  3AE5 B;  4YR2 A;  2KZ3 A;  3UF8 A;  4LJX A;  2HMX A;  7ICM A;  9ICT A;  2QKQ A;  3H0L B;  2WYQ A;  3HPO A;  1AQ6 A;  1RFK A;  2BBC A;  3Q8R B;  1UQV A;  1P9D U;  4FE3 A;  4TQS A;  4DS4 A;  1NEK B;  4ELV A;  1N62 A;  1D6E C;  3F5A A;  3RB3 A;  1JI7 A;  5EOZ A;  2GB1 A;  2GBM A;  3K9P B;  2BYE A;  3W5U B;  5HHI A;  4GSW A;  1YNT E;  4NQK E;  2LD9 A;  5IKC M;  2NRX A;  4TUU A;  5J2J A;  4RQ2 A;  2A3V A;  1TIF A;  2A5U A;  4HLE A;  1ED1 A;  2WXF A;  2ZIW A;  4K7W A;  4US8 A;  1WJU A;  2NR2 A;  3TIX A;  3AXC A;  2JGA A;  2IZV B;  4ELU A;  4QZI A;  3TQ1 A;  2M1M A;  3MJW A;  5KG2 A;  2AEH A;  1WE7 A;  9ICC A;  1NK7 A;  3OJS A;  3R2T A;  1KSP A;  4IQV A;  1ZOL A;  2GLE A;  3V72 A;  2PMV A;  3Q3F A;  4ECU A;  2GH1 A;  3KOO A;  2BKR B;  3C5F A;  3VTU A;  4LZG A;  4UW9 A;  1CRX A;  2F8L A;  3RNC C;  9ICL A;  4QIW F;  4PL2 A;  3IP4 B;  4UB4 A;  2HTM E;  2VRR B;  4QW8 A;  4W9D A;  1A77 A;  3RRH A;  3Q8B A;  3VRA B;  1WWV A;  1ZQQ A;  1L6U A;  4EEL A;  2K4E A;  1WGK A;  1XCT L;  2OED A;  3EPI A;  3NRZ A;  4Q45 A;  4ZRJ A;  5KFC A;  3QHT A;  1V86 A;  2KJH B;  5DPS A;  3V7K A;  2A1J B;  3O65 B;  3PS6 A;  2B3A A;  1QSS A;  2KMC A;  2Y9U A;  2WXQ A;  1D5Z C;  3BZD B;  2XCP A;  1CEZ A;  2E6X A;  1WGR A;  3P63 A;  3PW5 A;  2ASD A;  4PGY A;  1Z1V A;  3V3X A;  3RNG C;  2F1I A;  4LDT B;  3C2M A;  2LHE A;  3KQ4 A;  4ECS A;  3QUQ A;  7ICI A;  2KK0 A;  3DDH A;  3TCA A;  2FAZ A;  3EGR A;  1UPH A;  3MHZ A;  3C19 A;  2HHX A;  4IQT A;  3TAN A;  3A1Q B;  4L2Y A;  3T9L A;  1EWC A;  8ICG A;  4PHE A;  1LV5 A;  3AEG B;  1JMS A;  1NBF C;  2V9W A;  4O3N A;  1XS9 D;  2F8K A;  1S1Q B;  1AAR A;  1Z2M A;  3AE1 B;  3B0A A;  3H7P B;  1QIL A;  1L8L A;  4Y2S A;  3RJK A;  2K8H A;  3N30 A;  4ZRK A;  3I57 A;  1FFU A;  2G09 A;  1UWM A;  4MAC A;  3GIK A;  2D6F C;  1HE8 A;  2KO3 A;  1TS4 A;  5KFX A;  4GXK A;  2C9W B;  2D11 A;  4YP3 A;  3W1S C;  5KT4 A;  2NMQ A;  4YXM A;  4RQ1 A;  1WGY A;  3BQ7 A;  5AK5 A;  2JSV X;  4MGZ E;  1X9S A;  9ICM A;  5HNK A;  4W9I A;  1KW4 A;  4M0W A;  3QEA Z;  4M9L A;  4B95 A;  4K4G A;  4HAI A;  1UF0 A;  8ICH A;  4WJN A;  5FR6 A;  4ANU A;  2KN7 A;  2PEA A;  5J0S A;  3QNM A;  5BOL A;  3DDC B;  3IBE A;  2KJ6 A;  2JQR B;  1J19 A;  3BYY B;  3PZ8 A;  2G5I B;  3GP7 A;  1HZ6 A;  4XYC A;  1X9W A;  2ATL A;  5FR3 A;  1OQQ A;  4EYI B;  4GC7 A;  2DZK A;  4QW9 A;  4HWI B;  1L4D B;  3WK9 A;  3UQ0 A;  3CIR B;  3PST A;  2H89 B;  4IR1 A;  1FXA A;  2M9N A;  2KMD A;  4JGH B;  3VDZ A;  5ALD A;  1TV9 A;  4B9K A;  3UQA A;  2UVU A;  2MAX A;  2V3N A;  3U7D A;  2KWC A;  1V85 A;  3KWV A;  4QAY A;  3BK2 A;  2PLP A;  2HHU A;  2K25 A;  2PKO A;  1JW9 D;  3KWL A;  1ZQ1 C;  4TUR A;  4US9 A;  4R8U A;  4UAY A;  4M6W A;  1ZJN A;  2PKE A;  1FFV A;  4TQR A;  2XEW A;  1PUT A;  4EE2 A;  5E6J A;  4B9T A;  1I4X A;  4P0Q B;  3AQF A;  3DOW A;  4GB9 A;  3S6J A;  3SDL C;  4WQM A;  3BS5 B;  3BVM A;  1J97 A;  5KFS A;  3Q8P B;  1YQ4 B;  4M9G A;  4NJC A;  3HUI A;  1NKE A;  1PZN A;  1WX7 A;  4IG7 B;  5KT3 A;  3L4P A;  2QAR B;  8ICX A;  1K1Q A;  4XWT A;  2YEP B;  5K4L A;  1NK8 A;  3RBE A;  3D32 A;  4CHK A;  3CRX A;  5D46 A;  4MSQ B;  3CSF A;  2RPV A;  4FO6 A;  3ZXR A;  4AYB F;  1ZQI A;  3MR3 A;  3C2L A;  1SZH A;  4EEY A;  3ZDC A;  1BPX A;  1UGJ A;  1U4A A;  4KLU A;  3A9K B;  4BKT A;  4QWB A;  4F4X A;  2UYZ B;  2HBJ A;  4BKS D;  4ECW A;  3ZRC A;  3S2A A;  4I2A A;  2EQY A;  3F2B A;  3ZDB A;  2W9N A;  4W9E A;  2IY1 B;  2WXO A;  2O6K A;  1E9M A;  4F8C B;  1KLV A;  1YOV B;  1XSN A;  2JUO A;  2BQU A;  3HKZ F;  3AL0 B;  4C4S A;  4GLS C;  1SB3 C;  1WUD A;  5HG2 A;  2FCS A;  3TAR A;  3QYP A;  3PO0 A;  3KUD B;  1ZQU A;  5DDY A;  1XT9 B;  4FJV B;  1QOG A;  4NJ6 A;  4AOF A;  1V9P A;  3C0R B;  1R4M B;  3PSP A;  4RH6 A;  1RYU A;  3WCQ A;  2BGW A;  1U47 A;  5AM2 A;  1R4M I;  4IKG A;  1S8O A;  1ZD3 A;  1PK1 A;  1MVK A;  3L16 A;  4PHP A;  1LKY B;  5JUM A;  1WWU A;  3D2Q A;  3EUB 2;  2R2O A;  3QCA A;  2FBW B;  2D8C A;  3OPX A;  3RJF A;  3KLS X;  5J0U A;  4A55 A;  2HTH A;  5I4D A;  4F8R A;  1K8R B;  4FFD A;  3OHB A;  4O3M A;  2C7M B;  3T5K A;  5H92 C;  3RCZ A;  1L6V A;  3PV1 A;  2MX2 A;  1SEB D;  2JEJ A;  2RR9 A;  1J8C A;  3H8S A;  3NVV A;  3MDA A;  1NJW A;  1V38 A;  2R18 A;  4C7Y A;  3ZKJ C;  3Q8Q B;  4DF8 A;  2N7J A;  2G06 A;  3ABV B;  3I63 C;  2FIF A;  3RMK C;  3N28 A;  3B2F A;  3H8H A;  3PLV A;  3MJ5 A;  4OJO A;  2JZB A;  5C0Y A;  1TJE A;  1SIF A;  2GOL A;  4GN1 A;  4N6E B;  4MHV A;  2JWU A;  2W9C A;  1NOM A;  4B9V A;  9ICO A;  3H0M B;  1CI4 A;  4X5V A;  2A4Z A;  3PT2 B;  4UB2 A;  3TAQ A;  1JWA D;  2ICI A;  3Q8K A;  2EZZ A;  5KHO A;  2M17 A;  1ZD5 A;  2M0X A;  2L7R A;  7ICH A;  2YEP F;  4KGS A;  1F0Z A;  5KT7 A;  1KLG D;  2DEN B;  2WXJ A;  1U4B A;  1WXS A;  4KZ0 A;  3VXW A;  1I7H A;  2G4D B;  3PVX A;  5EE1 A;  3N32 A;  3LVV A;  2X38 A;  3NAS A;  3M1Y A;  1N2X A;  3QE9 Y;  3B9J A;  1NK5 A;  2FMP A;  5JRT A;  4HVB A;  2D5G A;  4M9J A;  3HK0 A;  5JXV A;  4GIV A;  1CUK A;  3NZ3 A;  2BKF A;  1N48 A;  2M56 B;  4J3O D;  3X23 A;  2W55 A;  1IYF A;  3GIL A;  4IRC A;  4RQ8 A;  1EXN A;  2K4H A;  2YY6 A;  3RAX A;  3SFE B;  3SU8 X;  4ELT A;  3GQC A;  1TVA A;  3KKA C;  4GDK B;  2KDM A;  3DWG C;  2JX5 A;  4ICA A;  1RFA A;  2RPQ A;  3ZTD A;  3B1L X;  2N9E B;  1NZP A;  3M9M B;  2HVI A;  1SKR A;  2WGS A;  5IO9 A;  3UMB A;  1GB1 A;  1ZRM A;  1V49 A;  4KLQ A;  4XA5 A;  1X9M A;  9ICK A;  3IT4 B;  4W9K A;  2HOQ A;  1FM0 D;  1WWT A;  2L76 A;  3IN5 A;  1T4G A;  5FKA C;  4ZHO A;  3FIL A;  3Q2A C;  3UGB B;  3IG8 A;  2J52 A;  2IGD A;  5J2A A;  3P4S B;  3ZDE A;  4KKJ A;  1V5T A;  1LGR A;  3U30 A;  2JMG A;  1FPY A;  1RZT A;  3MFI A;  3OLM D;  4X57 B;  2A1A A;  2WU5 B;  4HKQ A;  3NVZ A;  2O6V A;  4K7U A;  5EDS A;  1BNO A;  3ZJU A;  3EPG A;  5AM5 A;  4Y2U A;  5KFH A;  3WKE A;  2LMR A;  3ONN A;  4JWU C;  5CEH A;  3KTQ A;  3FC4 A;  3PY8 A;  5DPT A;  4BGD A;  7ICO A;  3WKC A;  2D3A A;  3GS2 A;  2KP7 A;  4QZF A;  3F2D A;  1C7Y A;  5J2H A;  4DOB A;  3H7S A;  1XNS A;  2OEH A;  2KDI A;  2KFK A;  3OSP A;  1N60 A;  4CF4 A;  1L7N A;  5CTR C;  2H3I A;  1L0X B;  2E8O A;  3UXO A;  3SMV A;  2GMI C;  3BS7 A;  4J9S A;  2K6D B;  2C2R A;  3TUO A;  4J9N A;  2I1J A;  1HUZ A;  4ICU A;  2XGQ A;  4DLE A;  3RJJ A;  2W11 A;  5AK4 A;  2KK8 A;  4DOA A;  1C1Y B;  2N7E A;  2AJQ A;  2INP E;  1UT8 A;  4KLS A;  3Q8M A;  2K0P A;  4GU2 A;  4L23 A;  1ZQF A;  3VH4 B;  3HP6 A;  4PYU A;  2PE6 B;  4B9M A;  1Z00 B;  4IC9 A;  1QLN A;  1DGS A;  2PJH A;  2CR5 A;  4KDL B;  1E5W A;  2KKP A;  1EWY C;  4PJ0 U;  2RGF A;  4KLF A;  2AHO B;  4J9P A;  4KLT A;  3DWM A;  3H0R B;  2R2Q A;  2EAN A;  5G5G A;  2CJO A;  3GZN I;  2C28 A;  2KDF B;  3LYY A;  3GZF A;  1LB2 B;  3MP9 A;  1M94 A;  8ICU A;  5IIJ A;  1OUQ A;  1S10 A;  5J0W A;  2X8X X;  9ICE A;  4WWM A;  5ALO A;  1COO A;  2LZ6 A;  3QU7 A;  4ZRI A;  2MBB B;  3MTN B;  1T7P A;  3R9K A;  1ZOY B;  1TAM A;  1Q10 A;  2GO7 A;  2K39 A;  5DPW A;  5AIB A;  4RPY A;  4KLE A;  4ANW A;  3X0W A;  3BY4 B;  2CHW A;  4ZRP A;  1HA5 A;  1S0N A;  2JXX A;  1ZQR A;  1L5P A;  3R3M A;  2J6T A;  2PFP A;  3RPF C;  4Y2J A;  1JWU D;  1EUV B;  4P2H A;  1TS3 A;  2K3U A;  2WXI A;  4WJQ A;  3AEV A;  3KD3 A;  2BR0 A;  5KFE A;  2L00 B;  1QCK A;  1NKB A;  4W9C A;  2WDQ B;  8ICA A;  2BQQ A;  4I2E A;  3GV8 B;  1B1Z A;  1P3Q U;  1PGX A;  1UD7 A;  4RQ5 A;  2O2V B;  3B08 A;  3ENE A;  3J9C A;  2YMQ A;  4HPM B;  4LNK A;  3PR5 B;  2LGX A;  4QZH A;  3HW8 A;  2LGY A;  5JH5 C;  2J7Q B;  2KSO A;  1RXW A;  3K4G A;  2L0T A;  3ML9 A;  3PMN A;  1A0P A;  3BIN A;  2KXJ A;  1KLN A;  1WR1 A;  4K1R B;  4KZC A;  2ESE A;  3VUX A;  2F1J A;  4F5R A;  3LWM A;  3I76 A;  1KL9 A;  1ZQA A;  2JRH A;  2A19 A;  3SAH A;  5J2G A;  1ZQE A;  4MFC A;  4Q2J A;  4W9G A;  3WU2 U;  1ACC A;  1LVH A;  4GDL B;  2J0J A;  3NS8 A;  2WAQ C;  2ZJD A;  4AP9 A;  3F2C A;  3MGI A;  2VZK D;  3Q8E A;  1PGB A;  4LK0 M;  3L17 A;  1KKX A;  4O5E A;  2WHI A;  4YTP B;  3VTW A;  5KFG A;  1RYR A;  3QK0 A;  2Q0Z X;  4PPX A;  3BK1 A;  1KFT A;  4GXB A;  3V6K A;  4KGR A;  2EZX A;  2EKE C;  3SZ2 A;  4JB3 A;  3M7D A;  2LYH A;  3GV7 B;  1L5U A;  2Y9T A;  4K3B A;  3HIL A;  2I38 A;  2AQ3 B;  5F9N A;  4RZR A;  3ZW3 A;  4XRH A;  3CWI A;  2MBE A;  1OXJ A;  4WH4 A;  3L54 A;  4EKU A;  4Y2R A;  3QQ8 B;  2FMQ A;  3BYT B;  2OXO A;  3NVW A;  4Y2P A;  4A20 A;  1WX9 A;  1FEZ A;  4I6L B;  3DV9 A;  3RN9 C;  2WXK A;  3JPP A;  4LJP B;  4UB5 A;  1VZ6 A;  2E1F A;  4O9M A;  1T3N A;  3ZDA A;  1HQR D;  4NJ7 A;  2SAK A;  2WP9 B;  2DWQ A;  1PFD A;  2EMT A;  5KAI U;  1SKS A;  2JYT A;  1SJH D;  5DG9 A;  4J9O A;  2ZIU A;  3H40 A;  7ICK A;  4AS1 A;  4K4H A;  3B2G A;  1C76 A;  4IM3 A;  1D5M C;  4J9Q A;  3Q3N C;  2CHZ A;  3SD7 A;  2R8H A;  4Y2Q A;  4A3O A;  4OZB A;  3KHR A;  5DCN A;  2WXH A;  1ISN A;  3KFU F;  1XO0 A;  4UAZ A;  4ANX A;  5F3X B;  4IWQ A;  2BT6 A;  3Q3M C;  3ZIM A;  3U8Z A;  5J2B A;  3TFS A;  2H5X A;  2FI1 A;  4EZJ A;  2FNJ B;  3M9O B;  4F7Z A;  2ZUC A;  4U7C A;  2G9H D;  2WX1 A;  4EZK A;  3KW5 B;  3NUQ A;  2ASQ A;  3KYD D;  1C4P A;  3PGE A;  5ALT A;  2NBW B;  4NAW A;  4ECZ A;  2LI5 A;  4NLC A;  2L32 A;  3PRM B;  2HVH A;  3BZK A;  3ORY A;  3AEE B;  3RYT A;  3EW9 A;  4F2S A;  4F72 A;  2MUT A;  1Q5W B;  1MSW D;  4UAR A;  3UQB A;  3ALB A;  2JR5 A;  1SGG A;  2P6R A;  5C5J A;  5G2N A;  1WX8 A;  3SV3 A;  5DGA A;  3WK4 A;  1PUZ A;  3AN1 A;  1KM7 A;  5IP4 D;  1YT3 A;  4M8N A;  4FJZ A;  3APF A;  4GXI A;  2BF8 B;  4DQO C;  4EX7 A;  4KLG A;  1YZ7 A;  3URY A;  3VH3 B;  1ZQT A;  2UVR A;  3DBR I;  4C8M A;  5H2F U;  4F4Y A;  4RM9 A;  4ZYS A;  2DX5 B;  3NZS A;  3MHS D;  2MBO A;  2RMM A;  9ICB A;  3V6C B;  5ALI A;  4RQ3 A;  1XQQ A;  2AXT U;  2BQ3 A;  3EYZ A;  4G50 A;  3QAR A;  4PZN A;  2INN E;  2WXL A;  3SD5 A;  5HKH A;  1N5W A;  5GTH U;  2ZJA A;  3M8R A;  2VA8 A;  2LGS A;  5A0L A;  5J29 A;  2BGF A;  3FYH A;  1KTQ A;  2VAN A;  5ALQ A;  3JPN A;  3JPO A;  2O6V D;  2AGO A;  4M0W B;  3O13 A;  2YN4 A;  4C8N A;  3VCB A;  4IL6 U;  4WAA A;  1WMH B;  5ALU A;  4ACO A;  4NAM A;  1SSN A;  3V62 A;  3AE3 B;  1NI3 A;  3RH4 A;  4DHJ D;  1HTQ A;  4DL3 A;  2W3R A;  3RH6 A;  5KFM A;  2DLB A;  1R7S A;  3TJP A;  4F71 A;  7ICP A;  3P4Q B;  4TQ0 A;  1A5R A;  3VUY A;  4IS7 A;  3C29 A;  3IM1 A;  4KLO A;  1C4A A;  3ED5 A;  3RF9 A;  3ZD9 A;  1J7C A;  1EU4 A;  1VCB A;  3WIM A;  2HW3 A;  1ZD4 A;  5KFA A;  1I4H A;  4NL9 A;  1Y56 A;  2PVO D;  2GRI A;  2KNB A;  2GBK A;  2XBB C;  1KQQ A;  2WS3 B;  4FHK A;  2FCN A;  1NK9 A;  1DK3 A;  4DL7 A;  1BPY A;  5FP0 A;  2ZIX B;  1Z4N A;  5ALZ A;  5KG0 A;  4HK2 A;  3TKA A;  1YN4 A;  4KLI A;  8ICR A;  4O3S A;  2W3S A;  4DQQ A;  4P0P A;  1NYR A;  3NZU A;  2B6G A;  1RYS A;  4RGM A;  4YL8 A;  4BBN C;  4B0M A;  5J2K A;  4JQW C;  3VR8 B;  3T5J A;  1Z1B A;  1QLB B;  5HR7 A;  4Q44 A;  2R61 A;  8ICL A;  5AI8 A;  4OHJ A;  2WXG A;  3VQI A;  3MR5 A;  2V4R A;  1FMA D;  3OTQ A;  2Q4T A;  2RD0 A;  4YG2 A;  3CST A;  5AI9 A;  1I42 A;  1T5X D;  3RNE C;  2Y5C A;  3ZDD A;  3AUO A;  1N6Z A;  3AEA B;  2KVZ A;  3N7R C;  4R64 A;  2WLB A;  3Q8C A;  4II3 B;  4RQM A;  4KN7 A;  3WAN A;  1DRG A;  1TKD A;  1P7D A;  2ZTC A;  4I6N B;  1DOQ A;  3V7L A;  4RMA A;  5CJ7 A;  2V1Y A;  4KLM A;  2H3Z A;  3HM6 X;  1BPD A;  2PVG C;  2ZIV B;  4RQ0 A;  4MGY E;  4NQL B;  5CWR A;  4Y2X A;  4WJ3 B;  3N3K B;  3JPT A;  1U48 A;  1JRU A;  3AU2 A;  4F3O A;  1RQL A;  2FE9 A;  2K8C A;  2M0N A;  2Z7J A;  4DFM A;  4MFF A;  1MJD A;  1ARO P;  4K81 A;  4HCP B;  3ONS A;  4NXZ A;  2JXT A;  4YXD B;  2I1K A;  2MP2 A;  4RF0 A;  1WRD B;  4MJS B;  2WF6 A;  4P1B C;  4RNO A;  2KWD A;  1FIQ A;  3R2I A;  3V05 A;  2KN4 A;  3IXS A;  2AQ2 B;  2KJ9 A;  5KL8 B;  2KAJ A;  3SQI A;  2OOB B;  5E6N A;  5IA7 A;  1OEY A;  1WG8 A;  3I9V 1;  1O08 A;  4OVV A;  5AKX A;  1T8E A;  4AQ7 A;  2ZJ8 A;  2AGP A;  4F4Z A;  3N7P D;  4R63 A;  2AGQ A;  4Z6C A;  1TAU A;  3QA8 A;  3RI7 C;  1L3U A;  4HPL B;  4ARI A;  2KVC A;  1MG4 A;  2INC C;  5JZE B;  4DSI A;  4FBU A;  2Z59 B;  4FBT A;  3MC1 A;  2YLM A;  4IOI E;  4O3R A;  1HJP A;  4ED6 A;  2DNF A;  2XK5 A;  2KE7 A;  2G08 A;  2DUY A;  4B6W A;  3SFD B;  3SAF A;  1C79 A;  4EZL A;  5KFO A;  2Y1J A;  5DPR A;  2ONQ A;  1WSP A;  5C23 A;  2W8K A;  4P7I A;  2K22 A;  1IGC A;  2Y5P A;  5TR5 A;  2DYM A;  2KVR A;  3RFZ B;  1KJT A;  1UGM A;  4C4R A;  4PGX A;  7ICL A;  1CK1 A;  3MR2 A;  8ICO A;  2AX5 A;  3VVW B;  2BS4 B;  1DXS A;  2LUE A;  1Q3U A;  2KOX A;  4IC7 B;  4DSJ A;  2KTR B;  5AM1 A;  4C56 C;  3ZO5 B;  4EBC A;  4DL2 A;  2WF8 A;  3H8J A;  5F9L A;  5CRX A;  2L0F A;  4F2R A;  1ZP0 B;  4EFO A;  5J0X A;  4M8M A;  1V1P B;  1GUA B;  3U7Z A;  5DB7 A;  4E71 A;  7ICV A;  5HHH A;  2C7H A;  4XDD A;  1MC8 A;  4KTQ A;  2Z8L A;  2YB1 A;  4R66 A;  3GIM A;  4RGT A;  4QJF B;  4I2C A;  4JPS A;  2RLT A;  2CU1 A;  1ZQV A;  2I6X A;  5ALJ A;  3PZP A;  4DXA B;  4NM2 A;  1BNP A;  2C5L C;  4BXO B;  5KG3 A;  2W54 A;  2EZY A;  3W5V B;  2NTS A;  5J8Y A;  5KTQ A;  3G6V A;  3A4R A;  4PL1 A;  4O3Q A;  5AKE A;  4RU9 A;  1SL0 A;  2DF4 B;  2DHZ A;  1S97 A;  2EAO A;  2LM1 A;  3RTV A;  1BPZ A;  4C8L A;  9ICV A;  2L52 A;  4OW0 A;  4AJW A;  3V61 A;  2W7P A;  4O3O A;  4CNQ A;  1M4V A;  4F91 B;  1Q1O A;  8ICM A;  5AZG A;  4C4V B;  2YB4 A;  3GE3 C;  1NKC A;  3ICX A;  3RB0 A;  5DQI A;  2JV3 A;  1SV0 A;  4YWG G;  4P6V F;  4IRD A;  4QZG A;  2GOW A;  3RBD A;  2JEG A;  1Z5S B;  5KFW A;  1TK8 A;  3BQ0 A;  3PX4 A;  4AWJ A;  9ICW A;  1L4Z B;  4RT2 A;  5EWG A;  2HJ8 A;  2R8I A;  5CP2 A;  4NLG A;  1HEZ E;  1UZX B;  1ZQW A;  3IG5 A;  4ECQ A;  1UBQ A;  3QAQ A;  5IOI A;  1SWW A;  2K89 A;  5DKW A;  1PGA A;  4MM3 A;  1ZXH A;  2NRW A;  3NG0 A;  1MPE A;  2LGD A;  4JV2 A;  4ED1 A;  4N9F 4;  1FD6 A;  4DQP A;  1J7A A;  4IWO A;  1BGX T;  5T8I A;  1ZUD 2;  2IA6 A;  2ASL A;  3NRW A;  2D3B A;  3WKD A;  1B22 A;  1D8L A;  1S5L U;  4YXJ A;  1V2Y A;  1XU4 A;  4I2F A;  3ZJT A;  2Y0S C;  4FJY A;  4F5Q A;  4UBB A;  2GLS A;  4O1N A;  1UEL A;  2K8B B;  1WJ6 A;  3GIJ A;  1QSY A;  3TAC B;  4C80 A;  1FEH A;  4FZM A;  1MG8 A;  3RT3 B;  3TEX A;  1RRB A;  2IO3 B;  2WWZ A;  2YVC A;  2HI0 A;  1MN8 A;  3KUZ A;  2WF5 A;  3KZX A;  3M6K A;  2NO4 A;  3UXN A;  4G3I A;  4E3C A;  2LJ5 A;  4KVG B;  2WDR B;  3UM9 A;  1XCQ L;  5KT2 A;  5KFR A;  5KHQ A;  2HBM A;  3BZC A;  3BQ1 A;  2Y1I A;  4I6P A;  5KFB A;  2KHV A;  7ICQ A;  1D9D A;  1T6B X;  4TV3 A;  1G6J A;  2MSN A;  4DFJ A;  1QSL A;  1NDD A;  1WXM A;  4EOY A;  2LI6 A;  5KFU A;  8ICF A;  1ZGU B;  4OJL A;  1KBU A;  3D2N A;  4KX5 A;  4NPN A;  2LHD A;  4JMU A;  4DOC A;  2F77 X;  2CRX A;  4O3P A;  5CHV C;  4I2D A;  1ZPS A;  4G3X B;  4EBD A;  1L7M A;  3A9J A;  3RFA A;  1L7P A;  1O03 A;  4YTM B;  1AYF A;  2PFQ A;  4M9N A;  4RNM A;  2GWS A;  1ZQY A;  9ICN A;  2IMW P;  1GC7 A;  2PFO A;  1WIA A;  4ITK A;  3F5E A;  3CMM B;  1JXE A;  5L95 C;  3TEZ A;  1JN3 A;  2LHT A;  1T94 A;  2A1J A;  3WA0 A;  2I2Y A;  3AU5 A;  2E8P A;  1RLF A;  1I4P A;  1GG3 A;  1BVS A;  4UB8 U;  2QSD A;  2IGH A;  4KN4 A;  3AED B;  2N9K A;  5MPO A;  4J03 A;  4MGI E;  1ZQO A;  1JUD A;  4HRO A;  3C8Y A;  3OJ4 B;  1N61 A;  3ZNH B;  4MEY A;  4HKZ E;  2N1V A;  3QU4 A;  3A1Q A;  4K4I A;  2MH7 A;  3HX0 A;  1NVI D;  3K9O B;  1J7B A;  3V60 A;  1KF6 B;  1P1A A;  2WXR A;  5KAF U;  1LM8 B;  2CXY A;  4CQN A;  4QZD A;  2PXI A;  1UWX A;  1Q46 A;  1U9L A;  2QB0 A;  2JZP A;  3H7P A;  4UDU C;  3R7Q A;  2FPK A;  4C00 A;  4LJO B;  2KDE B;  1WXV A;  1ZXI A;  1A70 A;  2KFJ A;  4CF3 A;  4B9U A;  1RQN A;  2FE8 A;  4C7Z A;  4TUS A;  4PK1 A;  2W9B B;  5ALE A;  4O5C A;  1HXY D;  1P7E A;  2QDF A;  5C1Z A;  4RPZ A;  1QOF A;  2N0S B;  3TI0 A;  5D7G A;  4GOC A;  4KIT B;  4QZE A;  2VA3 A;  1V81 A;  2FLN A;  1YJ1 A;  5IIN A;  4JUZ A;  4NLK A;  1TS5 A;  3SEB A;  1SZP A;  3PHW B;  1JX4 A;  4I2G A;  2MBH A;  4BFR A;  2DGZ A;  2DYB A;  5AKG A;  2UVV A;  1BPB A;  3Q8F A;  1I4R A;  4XWW A;  3D2S A;  2ZCC A;  1SJE D;  3BWU D;  2E8M A;  4WIP A;  3EA6 A;  1F5S A;  5AIC A;  4YMM A;  7ICS A;  2UVW A;  2Q5W D;  4F4K A;  1QTM A;  4DBG A;  5J17 A;  4M47 A;  2K6Q A;  2IY0 B;  2MWS B;  5L83 A;  2BPG A;  5KFI A;  1UUP A;  1TBE A;  1L6N A;  2QIL A;  5GXG B;  4OVU A;  4QWE A;  7ICG A;  4OO1 J;  4PS3 A;  4M0A A;  3OG5 A;  2BVC A;  4M01 A;  2KQ7 A;  4P0Q A;  4NM1 A;  3LWL A;  4LNN A;  3RD2 A;  4RUC A;  2REX A;  2ZNV C;  5J0P A;  3RZW C;  3BS5 A;  3K1R B;  1Q0W B;  1F2R I;  1TYG B;  1E10 A;  2CS4 A;  3ZXV A;  1JRO A;  4RFB A;  2BKE A;  2ALZ A;  1SE9 A;  2K4P A;  3P4P B;  2LUM A;  4E74 A;  2HDE A;  4EX6 A;  4JWS C;  2QAR A;  3NHE B;  3M6Z A;  5L1M A;  1ZW7 A;  5IAA C;  3DQV A;  1DOY A;  4W9L A;  2M0A A;  2FDR A;  3E56 A;  4BVU C;  2MRP A;  1TFR A;  4Q8F A;  1ZQK A;  2JZ3 B;  1SXD A;  4BJQ A;  4DO9 A;  1TK5 A;  4U6P A;  2KX0 A;  1OEY J;  4QWC A;  2FID A;  4DHZ E;  2HHS A;  2ZVN A;  5J0R A;  1JWB D;  2IBI B;  3HM3 A;  4OVZ A;  2W9M A;  2DZM A;  3GZN B;  1Y8R C;  3H7I A;  1HTO A;  2MLB A;  4UB6 U;  4RQ7 A;  4URK A;  1KLU D;  3DHG C;  3OJ3 A;  2RRD A;  2G0A A;  4F93 B;  3J81 j;  4R3D A;  3AQE A;  1SL1 A;  1TAQ A;  5AZH A;  2HD5 B;  2CKH B;  4QZB A;  4DL6 A;  1KTK A;  4IR9 A;  2G3Q B;  2LMC A;  1F2R C;  1LQB A;  2ZEQ A;  4KLJ A;  3IRU A;  1J2M A;  3Q8S B;  3I28 A;  4XQ8 A;  4RT3 A;  4RQ6 A;  1VRA B;  1XLQ A;  2YML A;  4WWN A;  3P42 A;  1D8Y A;  2LYA A;  4DK5 A;  3CF6 E;  5LXH A;  3NVY A;  2ON8 A;  1S77 D;  1BPE A;  4OD0 A;  1C20 A;  4KIK B;  3I5J C;  4KMO B;  3JSV B;  5ALH A;  4LZD A;  4HJK A;  4EZ9 A;  1URJ A;  4JWM A;  3TAD A;  3L0W B;  1LKY A;  3MAB A;  1ZQB A;  1QZE A;  3PTF C;  1TKY A;  2UU7 A;  3HHM A;  3HVD A;  4S17 A;  3L10 B;  4NLN A;  1WZ3 A;  3AU4 A;  5GTI U;  1ZYQ A;  4ANV A;  2N9L A;  4B9N A;  1KDH A;  9ICS A;  1PYW D;  1ZET A;  1SE2 A;  1IBX B;  1PVR A;  5KG7 A;  4MEX A;  5AKH A;  3H4D A;  3NGD A;  5J2D A;  5C3J B;  1P98 A;  5AKZ A;  3QU2 A;  3MC9 A;  3AU6 A;  4I2I A;  2IHM A;  3RNA C;  2VJ5 A;  5E6O A;  4JWN A;  1KFS A;  4N59 A;  1WM2 A;  2BWE S;  1XSL A;  2C7N B;  4QZA A;  4PT5 A;  2WX0 A;  9ICP A;  4LCD E;  3BQ2 A;  2BCQ A;  1Z4O A;  3HJE A;  1SE4 A;  3PZ7 A;  4ECX A;  1D4B A;  5ALN A;  2KHW B;  3JPS A;  4BX9 C;  5KL1 B;  2KFN A;  2NPT B;  2QIE B;  4KLH A;  5D4B A;  2BQR A;  3N1X C;  5E79 U;  3A0B U;  2JRI B;  3VAW A;  4AJY B;  3AEF B;  2QC8 A;  5CB1 A;  1B0X A;  1ZDX A;  5HML A;  2F1H A;  1L8O A;  1BML C;  1VZ7 A;  1BUI C;  4YD1 A;  1L7O A;  3TMP B;  4IDI A;  2LXA A;  3P4R B;  5KFN A;  1ZQG A;  8ICS A;  3SAG A;  1E8Z A;  4IUM B;  4F50 A;  5AM4 A;  5B66 U;  1N56 A;  4DFK A;  1SF0 A;  5CR0 A;  4RUA A;  4PYZ A;  3PO4 A;  2ZTD A;  1IV8 A;  4CF5 A;  2BB6 A;  1RYJ A;  1WJN A;  1X2I A;  3GE8 C;  3PVL A;  5KG4 A;  2VKQ A;  5AHX A;  1K50 A;  1F77 A;  4AUQ C;  3LJ3 A;  3L08 A;  4GIB A;  4NL9 C;  1WE6 A;  4DQI A;  1YN3 A;  2LXC A;  4BKG A;  2WAQ F;  3QU5 A;  4CYE A;  1NI2 A;  4O0I A;  3C23 A;  3OAW A;  4A8X C;  1STE A;  2NVU I;  2ZIW B;  2KX3 A;  2TSS A;  1UA0 A;  4PS8 A;  3DVN U;  4CO7 A;  5BO4 B;  4O5K A;  3AMZ A;  3D6J A;  4IM0 A;  1TK0 A;  1L2N A;  2B21 A;  4IQW A;  3RAQ A;  1E8Y A;  3W9C B;  1GB4 A;  2IOF A;  1TTN A;  3ZNZ B;  5AEK B;  4A90 A;  4EBE A;  5D49 A;  2W43 A;  3DVG X;  2KIW A;  2DL0 A;  1Z3E B;  2FJ6 A;  4H2A A;  3KUC B;  5DDM A;  4ED0 A;  2XID A;  1ZQZ A;  5D3I B;  3ZQ4 A;  4UB1 A;  1L3V A;  3C5G A;  1QQ7 A;  3HRD D;  4UBC A;  4LDT D;  1S0M A;  4G9B A;  5AKL A;  3JPQ A;  4DDI D;  5KFF A;  1NZB A;  3RRG A;  3IAS 1;  5HR6 A;  5JHB A;  1FO4 A;  4YTN B;  2KYW A;  4DWF A;  3EC8 A;  2N4F A;  4BDP A;  1JRP A;  1C78 A;  4JIO U;  2G5H B;  2QMT A;  3ETR A;  2D3D A;  2WB1 C;  4EEW A;  1FRR A;  4A3P A;  5IN7 A;  5III A;  3MGV A;  1WY8 A;  3LDA A;  5AI5 A;  1OFF A;  1XEE A;  4UAW A;  3GU3 A;  3T5L A;  3PML A;  4M04 A;  3LXF A;  4XC2 A;  2CN1 A;  3RNB C;  1QQR A;  4I28 A;  4JLC A;  2EDU A;  4RCO A;  5D6J B;  1SIJ A;  5DGB A;  2LBO A;  3AE9 B;  4DDG D;  3DBR B;  2LFI A;  7ICN A;  5BYS A;  5D2M B;  2V4Q A;  2OJW A;  4QZ9 A;  4W9J A;  4EEN A;  3IFW B;  2EAM A;  2XY7 A;  1VR9 A;  2W9A A;  2QB1 A;  2FUH B;  2GBN A;  1OQY A;  1MFW A;  2GI9 A;  1UBI A;  5T14 A;  4Z6D A;  3ZJV A;  1Z00 A;  2E3T A;  2XCA A;  4DFP A;  4LVS A;  5BMH A;  2JVC A;  2MW5 A;  3LB8 C;  1KRP A;  2L83 A;  2YMP A;  3ZD8 A;  2NRZ A;  5ALK A;  7ICU A;  1BXT A;  2SEB D;  3N7S C;  2UWQ A;  2KC1 A;  2FLL A;  4B9L A;  2AU0 A;  4YT0 B;  1MHX A;  3VHT C;  3CNH A;  5J2F A;  1NYQ A;  1MA7 A;  2AL3 A;  1XLP A;  2IGG A;  3ZVV A;  4I29 A;  3QZ8 A;  1LO5 D;  4ZRQ A;  1R4N B;  3WAL A;  3NUH B;  1R4N I;  3T5H A;  3QIJ A;  5J0O A;  4EUT A;  3PX6 A;  5KFY A;  5HMM A;  3PSI A;  1E8W A;  1NK0 A;  2V9H A;  2N7D A;  4OCZ A;  1NK4 A;  1ZQD A;  1UA1 A;  3E58 A;  1IIP A;  2H88 B;  5DG8 A;  3ZUN A;  3PW0 A;  1YZ6 A;  4FZN A;  1WJ4 A;  5CA7 A;  1Q3V A;  5AM3 A;  7ICJ A;  3GFK B;  5HHD G;  5KFJ A;  2BZF A;  2AQ0 A;  2ISP A;  5CHF A;  4Y2V A;  2K60 A;  3H1U A;  1HZ5 A;  3SV4 A;  3K1Z A;  1BT0 A;  1RDF A;  3V6H A;  9ICX A;  4XUS A;  1DK2 A;  4DF4 A;  2PMZ C;  1X66 A;  1L7Y A;  4XE0 A;  1L3T A;  2KAC A;  3QUB A;  2O2V A;  5JHA A;  4R8U B;  4M6W B;  4C8O A;  4EYH B;  2J4X A;  3WAO A;  5ALG A;  1QH9 A;  5J0Y A;  1F9J A;  5BYR A;  2C22 A;  2B76 B;  3ZTC A;  1FNW A;  4KSL C;  4W9F A;  2L05 A;  1H8C A;  3N1Z C;  4RM8 A;  4QWD A;  4KX6 B;  5KT6 A;  2NYV A;  3T79 A;  1FXT B;  5AKK A;  1JCK B;  1S0V A;  2PPH A;  2WF7 A;  2ZPY A;  5EWE A;  2EAP A;  1EF5 A;  1TZO A;  2ZW0 A;  3JYU A;  3PZD A;  4DS5 A;  3T3F A;  3JVZ X;  4KX3 A;  2IJ0 A;  5L1I A;  4NWI A;  1ZQM A;  1FCC C;  4CCH A;  1QF6 A;  3KBB A;  4JV0 A;  1MI0 A;  1WXQ A;  1GAQ B;  5AKI A;  4OJ5 A;  1XC9 A;  2KT7 A;  2AQ1 B;  1GC6 A;  3MGH A;  2RP5 A;  5IIL A;  2BCR A;  1F0M A;  3UPQ A;  2I9G A;  5KG1 A;  1T0R C;  2WXN A;  3RR7 A;  5J8Y C;  4B9S A;  4HDO A;  3HIZ A;  2ZG6 A;  2JT4 B;  2ACZ B;  3EFU A;  3DBL I;  2M8S A;  4ECR A;  2LRW A;  1TGZ B;  5AK6 A;  4ED2 A;  3EEC A;  5B5E U;  1CQV A;  4YSX B;  2VZK B;  1S76 D;  1AW7 A;  3UXP A;  4QZ8 A;  3BDP A;  1CZP A;  3DEE A;  2JEF A;  4YVZ A;  2WDT B;  4QIW C;  4ED7 A;  1XO3 A;  3BVG A;  2KC2 A;  1SV0 C;  4KDI C;  1ET9 A;  2PI4 A;  5G5H A;  4A9A A;  1K1S A;  1EM7 A;  4F1S A;  1PK1 B;  4BBN F;  4F5P A;  4FZL A;  3FM9 A;  5DB8 A;  1U49 A;  1P0R A;  4J9R A;  2D07 B;  3L13 A;  4RQ4 A;  1ZE3 D;  3U2S C;  2KG5 A;  4QWA A;  4GXJ A;  2MBQ A;  5KG6 A;  5J0Q A;  3IDW A;  1A76 A;  2L5Y A;  1TKG A;  5LXI B;  3A0H U;  2BDP A;  1S0O A;  3KHL A;  3JPR A;  3RJG A;  2WDV B;  2ZPN A;  4FXC A;  2MJD A;  1JXL A;  3Q3O C;  2ODG A;  3HT3 A;  2WXP A;  3I3T B;  1Q8K A;  1RXV A;  3IT6 B;  4DSF A;  2ZXH A;  4YFK A;  4BAX A;  3A4S C;  2LJI A;  1C4C A;  2N9X A;  4PGQ A;  4DSL A;  2L1A A;  1VJ5 A;  4ECV A;  5KNI A;  3PNC A;  5CHG A;  2RQ5 A;  4J9K A;  1U45 A;  5J0T A;  2RDJ A;  3CW2 C;  5DB6 A;  1E7V A;  1XXG A;  2G1E A;  2JZB B;  2JYE A;  4NZL B;  1DYQ A;  4MGK E;  3BJY A;  2W9C B;  4Q8E A;  2RSU A;  5ALY A;  5DQH A;  2R8K A;  3SEI A;  3A9J B;  4JL9 A;  4B6J A;  5GMV A;  4FA6 A;  8ICY A;  2LRU A;  4P4M A;  2C60 A;  4HDQ A;  5EE9 A;  8ICW A;  4TSS A;  1S9F A;  1KEJ A;  2PIA A;  3QX1 A;  2AYO B;  5JU5 A;  2N1W A;  8ICE A;  2DQN B;  2HJ1 A;  3AH7 A;  2BB5 A;  1T3Q A;  3TL5 A;  4MSM B;  3DVG Y;  4I27 A;  3PHX B;  3MDC A;  4M2Y A;  8ICK A;  4DFD A;  5KFT A;  3PSE B;  4LNI A;  1ZKH A;  5D94 A;  3F53 A;  2BCV A;  2P35 A;  1IM4 A;  2KD1 A;  4DXF A;  1WM3 A;  2F2A B;  3PV8 A;  5TZV A;  4FHJ A;  1UHU A;  3AE6 B;  3BVZ A;  2FLP A;  1KFY B;  3ZLZ A;  3WKA A;  3H8M A;  4P16 A;  1V9J A;  3VC8 A;  2RDH A;  5KFQ A;  4ARC A;  3FDS A;  2QB0 B;  9ICG A;  2F76 X;  2XN9 C;  5LNK 1;  3PRZ A;  2LM4 A;  5FK9 C;  1VLB A;  1D9F A;  3Q3J A;  1SGH A;  5KFD A;  4XX5 A;  3TEW A;  4DLG A;  3PSF A;  1E6E B;  1UH6 A;  2LEK A;  2IOF K;  4KSK C;  1WRI A;  3H8W A;  1SKW A;  4KV2 A;  3DHH C;  5HFY A;  4EZ6 A;  4ICV A;  2J0K A;  1X6I A;  1FRD A;  2KKC A;  4MH8 A;  3ZNG C;  2QLT A;  1NEN B;  2E5S A;  3U4E G;  1WMH A;  2VJ4 A;  3FIL B;  9ICU A;  1PQS A;  2PI5 A;  3ISB A;  4EEK A;  3SHQ A;  3QXG A;  4YR3 A;  2ZUB A;  4AP4 C;  3PRP B;  2IBK A;  4YSZ B;  1B43 A;  4AYB C;  3C2K A;  2BDU A;  1MQ3 A;  2O6V B; 
#chains in the Genus database with same CATH homology
 2BW2 A;  2W82 A;  4RGN A;  3E9S A;  1OQR A;  3Q8F A;  1I4R A;  1TKE A;  2K5P A;  4XWW A;  2I38 A;  1SJE D;  2AQ3 B;  3BWU D;  5TSS A;  4WIP A;  3EA6 A;  4MM3 B;  3CWI A;  2IDY A;  2WXM A;  1N63 A;  2ZW1 A;  3AE8 B;  2Q5W D;  3AB5 A;  4WH4 A;  4B0E A;  2CJN A;  3AM9 A;  1FXI A;  2MEK A;  3BYT B;  3NVW A;  3AE5 B;  1UUP A;  2WXK A;  1ENF A;  2J42 A;  2BTE A;  1VZ6 A;  2QIL A;  1MHH E;  1HQR D;  5GXG B;  1V8C A;  1TY0 A;  2SAK A;  2WP9 B;  1PFD A;  2DWQ A;  1RFK A;  2BBC A;  2JYT A;  1E7P B;  1SJH D;  4AS1 A;  3B2G A;  3W2D A;  1C76 A;  1NEK B;  1N62 A;  1D6E C;  1F2R I;  1TYG B;  1E10 A;  1D5M C;  2GB1 A;  3W5U B;  1JRO A;  4RFB A;  4OZB A;  1YJJ A;  1YNT E;  2WXH A;  1RM6 C;  3P4P B;  2LUM A;  2HDE A;  3SR6 A;  1SE3 A;  2WXF A;  4US8 A;  4JWS C;  4XDC A;  2BT6 A;  4REZ A;  1DOY A;  1AWD A;  2M0A A;  2G9H D;  3E56 A;  3R2T A;  1C4P A;  2PMV A;  1JWB D;  4OVZ A;  2L32 A;  2PTL A;  1XF5 L;  4WUR A;  1GPX A;  3AEE B;  1KLU D;  3U52 E;  2HTM E;  4R3D A;  4YSY B;  3Q8B A;  2LMC A;  3VRA B;  1KTK A;  1F2R C;  1L6U A;  3AN1 A;  1WGK A;  1XCT L;  2OED A;  4RGO S;  3NRZ A;  1VRA B;  1XLQ A;  3P42 A;  3VRB B;  4DQO C;  3NVY A;  2ON8 A;  3URY A;  2NTT A;  2WXQ A;  1D5Z C;  3BZD B;  2E6X A;  4ZYS A;  1D5X C;  3P63 A;  4KGT A;  3V3X A;  2RMM A;  3W1S A;  4TQ1 A;  1TKY A;  2LHE A;  3HVD A;  1DOI A;  2QEJ C;  3KQ4 A;  1YJI A;  3EGR A;  2INN E;  2N9L A;  1C77 A;  2WXL A;  3OWE B;  3MHZ A;  1N5W A;  1SE2 A;  1PYW D;  1IBX B;  4L2Y A;  1EWC A;  5C3J B;  3AEG B;  3AE1 B;  1IUE A;  1QIL A;  3O13 A;  3R8B A;  3I57 A;  1FFU A;  1UWM A;  2RDG A;  4MAC A;  3AEC B;  4N59 A;  1TS4 A;  2JU6 X;  4NAM A;  4LLG M;  2V0G A;  1SSN A;  2NMQ A;  4ZOH C;  4PT5 A;  1YN5 A;  3AE3 B;  1NI3 A;  2JSV X;  2W3R A;  2DLB A;  4LTU A;  1R7S A;  4M0W A;  1SE4 A;  3PZ7 A;  1D4B A;  3P4Q B;  4TQ0 A;  2QIE B;  2JQR B;  3BYY B;  3PZ8 A;  3GP7 A;  1HZ6 A;  1B9R A;  1C4A A;  1J7C A;  1EU4 A;  5FR3 A;  3AEF B;  1OQQ A;  1GOZ A;  1ZDX A;  3P1M A;  1I4H A;  1L4D B;  3GB1 A;  1BML C;  1Y56 A;  1VZ7 A;  2KQ4 X;  1BUI C;  3FAH A;  2PVO D;  3CIR B;  2GRI A;  1FXA A;  2H89 B;  4IDI A;  3P4R B;  2WS3 B;  1V1P A;  1QOB A;  1K53 A;  2V3N A;  3KWV A;  3BK2 A;  2PLP A;  1ESF A;  1YN4 A;  2PKO A;  1JW9 D;  1SF0 A;  2V4I B;  3KWL A;  1VJK A;  2W3S A;  1FNV A;  3T3O A;  4US9 A;  2BB6 A;  1RYJ A;  1NYR A;  1FFV A;  4RGM A;  1PUT A;  1FNU A;  4B0M A;  4EE2 A;  5E6J A;  3VR8 B;  1I4X A;  1K50 A;  1F77 A;  1QLB B;  2J53 A;  2R61 A;  4WQM A;  3BVM A;  1YN3 A;  4OHJ A;  1YQ4 B;  2WXG A;  3VQI A;  4NJC A;  1FMA D;  3HUI A;  1T5X D;  4A8X C;  2Y5C A;  3L4P A;  1STE A;  3AEA B;  2WLB A;  3Q8C A;  4HJG E;  1WYG A;  4XWT A;  2YEP B;  2TSS A;  2IPK D;  3AMZ A;  2RPV A;  1L0Y B;  2PVG C;  1XLN A;  5EE0 A;  1UGJ A;  3W9C B;  1GB4 A;  4A90 A;  4NAW B;  4H2A A;  5H8Y E;  4A6Q A;  2WXO A;  1E9M A;  3T3N A;  5D3I B;  3ZQ4 A;  1AN8 A;  3HRD D;  2JXT A;  4YXD B;  4RF0 A;  4GLS C;  1SB3 C;  5HG2 A;  3IAS 1;  2KWD A;  1FIQ A;  4RF1 A;  1FO4 A;  3R2I A;  3PO0 A;  4YTN B;  3V05 A;  2KN4 A;  3AEB B;  3IXS A;  2AQ2 B;  3VR9 B;  1QOG A;  1K52 A;  1JRP A;  1C78 A;  2KAJ A;  4RH6 A;  2QMT A;  3WCQ A;  3ETR A;  4IKG A;  1FRR A;  3I9V 1;  1MVK A;  4AQ7 A;  1OFF A;  1XEE A;  3EUB 2;  1YQ3 B;  2FBW B;  3LXF A;  2LGI A;  1DGJ A;  1QQR A;  4ARI A;  4RCO A;  1SIJ A;  3KLS X;  3AE9 B;  5BYS A;  1RWS A;  2LFI A;  4A55 A;  5I4D A;  4IOI E;  1VR9 A;  3MFG A;  5H92 C;  2GI9 A;  1YMH E;  1L6V A;  3ZJV A;  2E3T A;  5BMH A;  1SEB D;  3NVV A;  3LB8 C;  2L83 A;  3SFD B;  1P7F A;  2SEB D;  1BXT A;  4YT0 B;  1C79 A;  4C7Y A;  4L1B A;  1JQ4 A;  1JWM D;  1MHX A;  2N7J A;  1N5X A;  1NYQ A;  2EEL A;  1WSP A;  2ONQ A;  3ABV B;  1XLP A;  1UNS A;  2IGG A;  3B2F A;  3H8H A;  4HEA 1;  2K22 A;  1IGC A;  2Y5P A;  3MJ5 A;  1TS2 A;  1TJE A;  1LO5 D;  4ZRQ A;  1ET6 A;  2CU3 A;  2DYM A;  3MC0 B;  2JWU A;  4KKI A;  3NUH B;  1I4Q A;  4N6E B;  3RFZ B;  3IAM 1;  1CK1 A;  5BMG A;  1E0Z A;  1JWA D;  2ICI A;  4HRS A;  2AX5 A;  2YEP F;  4KGS A;  2K9X A;  1F0Z A;  2BS4 B;  2PW9 A;  1KLG D;  2H88 B;  5C2T B;  1V97 A;  1DOX A;  2WXJ A;  4C56 C;  3NS1 A;  1I7H A;  5HHD G;  1VZ8 A;  5EE1 A;  2X38 A;  1ZP0 B;  2WNM A;  1V1P B;  2Y3A A;  1HZ5 A;  3U7Z A;  3HVZ A;  1QOA A;  4XE0 A;  3B9J A;  2KAC A;  4XDD A;  2Z8L A;  2D5G A;  5JXV A;  3ZGZ A;  5HI1 A;  2J4X A;  3NZ3 A;  4RGT A;  2M56 B;  2BS2 B;  2XNA C;  2W55 A;  1EU3 A;  4J3O D;  4JPS A;  5BYR A;  2B76 B;  3AE7 B;  1FNW A;  2V3P A;  2M19 A;  3SFE B;  2WU2 B;  2W54 A;  1SBB B;  2KDM A;  3DWG C;  4GDK B;  2NTS A;  2JX5 A;  4KX6 B;  3W5V B;  4DXG A;  2BYT A;  1JCK B;  1TZO A;  2ZW0 A;  1GB1 A;  2MJ3 A;  2IJ0 A;  4OW0 A;  4USA A;  2L52 A;  1FCC C;  3IT4 B;  1QF6 A;  1FM0 D;  1WWT A;  1M4V A;  1MI0 A;  1GAQ B;  1WXQ A;  5FKA C;  4D2K A;  4ZHO A;  3FIL A;  2AQ1 B;  1ROE A;  2J52 A;  2IGD A;  1K51 A;  4YWG G;  1TY2 A;  3P4S B;  4KKJ A;  4P6V F;  1FCL A;  4N58 A;  2WXN A;  4JX1 C;  2WU5 B;  2ACZ B;  1L4Z B;  1V1O A;  3NVZ A;  4HKQ A;  3ZJU A;  1HEZ E;  1CQV A;  4YSX B;  2VZK B;  1AW7 A;  4JWU C;  3FC4 A;  1CZP A;  5EE3 A;  3GS2 A;  1PGA A;  1ZXH A;  1MPE A;  1N60 A;  1XO3 A;  3BVG A;  1FD6 A;  1J7A A;  1ET9 A;  1L0X B;  5G5H A;  3TSS A;  4A9A A;  1EM7 A;  1I4G A;  5T8I A;  1ZUD 2;  2DYO A;  1ZE3 D;  3U2S C;  3TUO A;  3ZJT A;  1TKG A;  2BS3 B;  2INP E;  4O1N A;  2K0P A;  4WAF A;  1KRH A;  2WDV B;  4FXC A;  4L23 A;  4C80 A;  1FEH A;  3AE2 B;  2MJD A;  3BII D;  3TEX A;  2WXP A;  3AV8 A;  3IT6 B;  1JWS D;  1EWY C;  2LJI A;  1C4C A;  2L1A A;  2WDR B;  3DWM A;  3Q69 A;  1XCQ L;  2CJO A;  5G5G A;  3LYY A;  1XXG A;  2JYE A;  2G1E A;  3MP9 A;  3ZYY X;  1T6B X;  4NZL B;  1DYQ A;  3AE4 B;  4WWM A;  5BMI A;  4MT5 A;  1VDV A;  5EE9 A;  5AUK A;  4JE3 B;  1ZDV A;  4TSS A;  1ZOY B;  2PIA A;  1L0V B;  1Q10 A;  5BYQ A;  2LHD A;  2FUG 1;  1ZPS A;  1KH0 A;  4ZRP A;  2KMM A;  1HA5 A;  3AH7 A;  1L5P A;  4YTM B;  2BB5 A;  1T3Q A;  1AYF A;  3RPF C;  1PDX A;  1JWU D;  1TS3 A;  2K3U A;  2WXI A;  2QJL A;  4ITK A;  3TEZ A;  4OZC A;  2OHF A;  2WDQ B;  3N9Y C;  2I2Y A;  1B1Z A;  1PGX A;  4DXF A;  3J9C A;  1I4P A;  5D3D A;  3AE6 B;  3BVZ A;  1KFY B;  4OZA A;  2QSD A;  2WQY B;  2EKI A;  2IGH A;  3AED B;  4P16 A;  2N9K A;  2RDH A;  5MPO A;  4ARC A;  1SXT A;  2XN9 C;  5LNK 1;  4HRO A;  3C8Y A;  1N61 A;  5FK9 C;  1VLB A;  1IGD A;  4HKZ E;  1CJE A;  1IBX A;  3TEW A;  1E6E B;  2MH7 A;  1NVI D;  4TMA B;  1J7B A;  2LEK A;  1KF6 B;  4Q2J A;  1QT9 A;  1WRI A;  2WXR A;  1C9F A;  4CQN A;  1UWX A;  2JZP A;  1ACC A;  5HFY A;  4GDL B;  4UDU C;  1JAL A;  1FRD A;  1ZXI A;  4MH8 A;  1A70 A;  3Q8A A;  3UI3 A;  2FE8 A;  2VZK D;  4C7Z A;  1NEN B;  1PGB A;  3Q8E A;  1XLO A;  4LK0 M;  3U4E G;  3FIL B;  4RNA A;  1HXY D;  1P7E A;  2DBY A;  2MJE A;  4YTP B;  1QOF A;  2N0S B;  5AUI A;  4ZHP A;  5D7G A;  3TEY A;  3BK1 A;  4KGR A;  4YSZ B;  1QKZ A;  1TS5 A;  3SEB A;  1JML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...