1FFWB

Chey-binding domain of chea in complex with chey with a bound imido diphosphate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
ARRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Further insights into the mechanism of function of the response regulator CheY from crystallographic studies of the CheY--CheA(124--257) complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1ffwB00
1FWPA 1FFGB 1A0OB 1FFSB 2LP4A 1FFWB 1EAYC
chains in the Genus database with same CATH superfamily
4OIXA 2H9ZA 2G2YA 1X9WA 3CULA 1U1PA 1K0VA 3KWMA 3NCQA 4LF7J 1ZOTA 1N48A 1RT7B 2Y0BB 5E3AA 1S49A 2ZH3A 3DOLB 1LW2A 3MAAA 2HGMA 2LQ5A 2UXDJ 3LALA 2EC0A 1WI8A 2IM2A 1HHQA 1WF1A 3KXDA 1S0VA 1P9YA 2HAIA 4K4TA 2EK1A 1IJFB 4BLGA 4NCAA 3MCSA 4G6VB 2OAUA 1F9HA 2ZZTA 3R5AA 1RT5A 2YBVA 1S6UA 2WBRA 3W2VB 2MLXA 1HIYA 5I3UB 3BM7A 3KK2B 3H4DA 2E1MC 5ETNA 4ZVHA 3T6JA 5DG7A 3EDQB 2LKZA 4GKKF 1FRHA 2K2PA 5B0BA 3R1HA 2HQFA 2WVDA 3OL7A 2D69A 2E7XA 1UPMB 3U02A 4C4WA 2NZ4A 4P71A 1U49A 2NLWA 3M4XA 1NSAA 2ZBPA 4C2MA 2DCLA 5A6WA 1ZTWA 1NK6A 1TL1A 2CKWA 2YQ1A 3PYEA 2FGOA 1FNOA 3TARA 3Q8RB 2BEFA 1JMTA 1SH0A 1TMJA 2BR0A 4LF4F 1C1BA 5IS2A 3DLJA 4IOBA 2W9AA 2JEGA 1VQ7S 1U2RA 1NM2A 2I2YA 2OPRA 1DAXA 1JJHA 4YB1P 3SV3A 3SSSA 3VAKA 1PC4A 2DHAA 2IM1A 2R7OA 4LR9A 5CCMA 5J2PB 1MWQA 2B9XA 3OTOJ 5L1KA 1RTHB 3M9MB 5RUBA 2RRNA 1RBAA 2APOA 4UUXA 5SUHA 4QQBA 3W8PA 1E6VA 3OBIA 3KUGA 2HLTA 3FGVA 3P96A 3C19A 3BO2A 5FJ4A 2PFFB 1XMBA 3VF0B 3W62A 1R8BA 2VH7A 2F9DA 5B0FA 2W7PA 3OR1A 1T03B 4IR9A 2P6SA 2NSCA 3DLGA 3JYTA 3C14A 3DGPA 2ZZNA 2VKRA 3E01A 4DDFA 2X7IA 4KRWA 3HMJG 5HMYA 3CD6S 2NXNA 1HQEB 1Q86T 3KYLA 2HBRB 4DFKA 4DV7F 2FVPA 1KS2A 3TEGA 2GQCA 2GVZA 2JOQA 3B4DA 3DOKA 3HHLD 1VC6A 1PC5A 3P5TL 4PRFA 4B3RF 3M8PA 3A4TA 3QQCD 1SC6A 4IG3A 4Y3CA 1Q81T 1SKWA 1H2TZ 1YBTA 2PO4A 4DV7J 4A8QA 3RRHA 3HZEA 4KJIA 1IR1A 4WE1A 5HMXA 4K4UA 2YWGA 2JFKA 2J0XA 3DHXA 3PIOQ 4IRKA 2BKPA 3W63A 4U8VA 2F9JA 3DRXA 5K14B 2ERRA 1IN0A 2YWFA 2X1AA 1XNRF 4Q44A 2ZITA 3CMES 5AXNA 5DDOC 3D6HB 1YRXA 1C4AA 3BF4A 4I2QB 3VTIA 5HVHA 4B9LA 4OMFG 2RB7A 1ZM2A 3FBEA 3B78A 4F67A 4A8KA 5HLFA 3MTJA 2ZDOA 4C11B 5DG9A 5I42B 2FHJD 4V1Ak 3KLFB 3NLCA 4O3PA 2ASDA 3D3BJ 1NKEA 1T3NA 4O3OA 3KK1B 4CLTA 3NGKA 3VVTA 4NLUA 1HHTP 1GXLA 4B9MA 4ELUA 2AJ4A 4TY8B 2IJNA 2JVOA 2YNIA 1YZ7A 4LIRA 3VVUA 4X64J 3PW2A 1TFWA 2QN6B 2IVFB 2B4PA 4KGZB 4PG7A 4HI1A 4DPOA 2UUBF 3OFFA 2RHSB 1RGVA 3MWBA 4OV1A 3CMQA 2Z30B 3VR1A 2RH3A 1YJUA 2F1FA 2Z2YB 3LF0A 4K2JA 4DCPB 4UT4A 2CQIA 2VOOA 3RTVA 1QVFR 3Q86A 4Y28C 4J9MA 3GZ7A 3HX9A 3ZTSA 5D0RA 4NMXA 1SJ4P 4ECZA 4ZK7M 3PXGa 2XZWA 2Q43A 2H48B 3BSAA 2KYXA 1HPZB 3LP1B 4FYXB 1D9AA 4NLWA 1X60A 4ZS6A 4DR5F 1PO6A 2Z0GA 5T7LA 4NLOA 4P72A 1LEOA 1OO0B 4OYPA 4RX6A 3CMAS 1LV5A 1TL7B 2HLUA 2NS1B 4ZPDA 1RTIA 4L72B 2CJAA 2LEPA 4FYWB 2LP4A 5AXLA 3LWMA 1VQ6S 2OEKA 2W4DA 3M1VA 4CH0S 4HEA9 2FLPA 4JI7J 1EQ0A 2VASA 2XI2A 4OYOA 2HSEB 3DYAA 1RT2A 3QFWA 3MMJA 4LRFA 2BYCA 4CO0A 1NDCA 1UEKA 2E1AA 4F0HA 1VK8A 4ZVGA 5A6PA 4ZN3A 3POTA 4UOHA 1NK0A 4O3SA 1HPZA 4ECYA 4LFBF 3FSIA 3UCUP 4B3SF 1FK9B 1FTRA 1JLCB 2XHWA 4QYRA 4JYAJ 4O4GA 1G6BA 2R2TA 2V69A 4AYBD 3K57A 2R3VA 2CJKA 1TP7A 2LQJA 3J7AN 2N3OA 4FS2A 2VFVA 2W25A 3AOCA 5H9EK 1R3NA 1YZ6A 2PMHA 1WF0A 2AJ2A 1OQ6A 1NDLA 4DEZA 4X65F 2ZE2A 3ZNJ1 3CCZA 3PFEA 5KFOA 2DRAA 1NAQA 2WSFC 3AOBA 3GFYA 2FJBB 4RJVA 1YRTA 3GU0A 1RE1B 4XDDA 1F2HA 3OL6A 3OTEA 3K5NA 3I0SB 2NUHA 2HFZA 2QZ8A 3LO3A 1FWLA 4PXBA 2ZDPA 4U8YA 4IR1A 2GJIA 4KO0B 2NREA 2DY1A 1GTEA 1BLUA 3D4JA 2IDLA 4ECUA 4A8XA 2XY6A 1HBOB 4J37A 4OYMA 2BM0A 1KWMA 3LPYA 5KT7A 2HQGA 1QAIA 2ZOMA 3NGSA 3NGDA 4C8LA 2GMLA 2VG6A 3CJ2A 4I4BA 3DLEB 2MXYA 3K5OA 3CCES 1IBMF 3ET6B 3KLGB 3W9HA 5F3ZA 2CA9A 1FJCA 4RU2A 3OTCA 3IAM9 1FCAA 3M2VA 1VQPS 1FERA 2IPOB 2IM3A 4ZPWR 1OYEA 4JUZA 1Q5YA 5LSOA 5MAOA 4LMZA 1S79A 2GO9A 2V2KA 2YKMB 4MKYA 1JX4A 4HI2A 3W1YC 1N5TA 1HWIA 3KDNA 4KT0C 3Q8SB 4C98A 4DL0C 1HBOA 1KBRA 1C0UA 1NB2A 4WKRA 4MYUA 2FHKA 3RUBL 4O44A 4HDGA 1KTQA 3TQEA 4MK8A 2DNNA 2YXLA 1DBDA 3CDEA 2GHVC 4FYVB 4RUBA 2AYBA 3LA0A 1URNA 3CWJA 4R5PA 1Y3JA 3TUJC 4QCLA 2GGPB 1WC4A 4C0HA 2YNHB 2YPZA 2XQCA 4LFCF 4QIGA 3BN4A 3EZ5A 2QSFA 3PKYA 2I9SA 1WSVA 3L09A 4I64A 5KT6A 3TAQA 1TV6A 5L8RC 2K3IA 2J0QD 1P1TA 1UJ4A 2CJBA 1TU0B 5FIIA 1EHWA 1Q0NA 1WTFA 2QO3A 3EGVA 2HRYA 4Y2AA 3VGVA 1VRTA 4F25A 3MMCB 1RLCL 2ZOFA 4FP9A 1RP5A 2CNLB 1ZA1B 2KJWA 4EI2A 2A6OA 4PWDA 3VAFA 4B9SA 4X4UA 1XIQA 4RLEA 3D0GE 1J5OB 2MGZB 3BQ0A 3R7NB 1HQUB 1FD2A 3GCWP 4C6AA 2YNHA 4DR1F 1GMUA 3Q8YA 4YN3B 4CLFA 3OVSA 3OR2B 4QWEA 1JIHA 4R5PB 1K8AT 1LOUA 2C2RA 3BSCA 1JLEA 1HL6A 2GHWA 2YWEA 3K8WA 4OI3A 1FE0A 5D3GB 1RWXB 2DT9A 4IH7A 4X4RA 1KOHA 1KLMA 5KT2A 1NCLA 2ZJQQ 2GV1A 4LBIA 2H4YB 2K7JA 4ZHRB 5D4OA 1IKVB 2ASLA 4X4TA 3PHTA 2N82B 2YKAA 3W7BA 4H4MB 3P3DA 4ZA1A 2H5EA 2RILA 2FHMA 3KLHA 3HO1A 2DVIA 4HYKA 1KRPA 4RU9A 1FWKA 1N5QA 1B70B 1QAXA 3MF5A 2ROPA 1Q1KA 4C48A 5I4MA 3IRWP 3PX6A 4MIAA 1WTBA 4B02A 2R7XA 1ROFA 4TLQA 3ZTQA 3TZYA 2CQBA 3DRPB 5KG6A 3M8YA 1S9EA 2ZUAA 3J81Y 4DV6J 5F0UA 1BGXT 1P8GA 3MPDA 4OHVA 4CO2A 1BUXA 4OZ3A 2JH3A 1Z1ZA 1HYSA 2ADBA 3UD4P 1LK5A 2W9BA 1GX6A 1FJEB 1HR0F 2HQ3A 1S1XB 3U27A 2JNJA 2CPFA 4ID5B 1HHSA 9RUBA 3T5KA 5KFEA 2N4CA 4Q8EA 2ATCB 2QLWA 5B0CA 1TKTB 1I3OB 3PTWA 2JEFA 1PIEA 3DM2B 1RDRA 2H54B 4FKXA 2HZVA 2FVQA 4HHUA 2Y8YA 1U1OA 2QT7A 1BC6A 4K5SA 1Q53A 1HI8A 1R8PA 2CADA 3SFUA 2UVVA 1X4GA 1Y11A 3RB0A 4WTOB 1WJ9A 1Y7PA 4NE9C 4OZ2A 2W7OA 3FZBA 4CLSA 2ZFHA 2LYVA 3QT8A 5D78A 3QZ7A 2WCXA 4CO3A 2WTFA 4WJBA 2X1BA 3CGIA 1NK7A 2DITA 3UCGA 4RNMA 1C4CA 1S6PA 1TKTA 3HXMA 2LEBA 4GKKJ 3MPVA 4BWMA 3CJ8A 4CO4A 4EU0A 2E1PA 1REVA 2EFGA 1UWAA 2LQ8A 2WBMA 1RT6A 3LP2A 4HACA 4KE5A 4OLOA 2DNKA 2RS2A 4TQRA 2OHDA 1VQSA 1SQEA 3MD1A 3BH6B 4KGXB 4DR4J 3Q8PB 3M8WA 1ZETA 4W4MA 4ILLA 2HHXA 3TZWA 4RUHA 1WHVA 3BZQA 2FHOB 2FPHX 3EXYA 1RA7A 4I6WA 3PNIA 1TELA 3AODA 5CD4A 3Q8VA 2QFJA 4MKVA 5B0GA 2GMHA 4IQXA 1FRKA 3TZXA 5T14A 1JLQB 5F8MA 1B0PA 2QE5A 2OI2A 1HNVA 4ZVFA 3S01A 5B08A 4LFAF 1U47A 4KFBB 4F4XA 1OSDA 1S0OA 3AJDA 3G82B 2RQCA 3IP0A 4Y6IA 2V6AA 1T9XA 1RAIB 1W2BR 1VQ4S 2V68A 4PABA 1UA0A 3W5YA 4YUDA 1G7CB 2BE2B 5EDWA 2ZVIA 4WXOA 2Z8QA 4F4ZA 5JVHQ 4W92B 1UAWA 2L48A 5L9NA 4QWAA 4OYWA 4K4WA 2ZH5A 3PO5A 5HQLA 2DEJA 2J76E 1ZAWA 2B5JB 2XULA 1S12A 3JSYA 3GFHA 5KFRA 2XBPA 4GVLA 3QIPB 3T5LA 2DB1A 4HKQA 4QR1A 1RI7A 1ZM4A 4JI4F 3EDRB 2BX6A 2VF3A 1VI7A 3ZTPA 1X7VA 2NSBA 1FRIA 3R1LA 4PWUA 1LKZA 1LNQA 1FKOB 3THPA 4B08A 3UQSA 9ATCB 1CEZA 2ASYA 2F4VF 3GJSB 2YNIB 4RWWA 5GMDA 1SIZA 4DPTA 2LECA 1LQ9A 2EFQA 2IM0A 3RW7A 3DLGB 3SCIE 2QRRA 4LRDA 1FDDA 2OTLS 3CDBA 2XTJP 3OXFA 3HJVA 2H65B 1JNZB 2L9DA 3AXKA 1UWBA 5C2GA 2DRDA 2HFOA 2ZHAA 2HIQA 1RU1A 1SV5A 5ETPA 2KFZA 2FQQB 3BEGB 1RTHA 1TKXA 4GVBA 2W24A 1SIWB 2Z2ZA 2D41A 3KLIA 4WFYA 2AJ1A 5T7LB 3AXMA 2W9CA 3S1TA 4J9QA 5HO4A 3BDPA 3UVJA 3MAAB 1N5SA 1FRJA 1XR7A 5D4LA 2J6TA 1RT1A 2CPZA 3JQKA 1VLYA 2ILZA 2R42A 1T3OA 2X51A 4E98A 1NO8A 5KFUA 3ENVA 3QGPA 2LLZA 4TU9A 3A3OB 2P9EA 2BE9B 3M30B 1RZMA 3W9JA 5LMUF 3BSOA 3UI3A 3LPEA 2MZ1A 4K8RA 4IH5A 3ICLA 4NLRA 1JLAB 1NU4A 1RSCA 1W2IA 4DG1A 2RKIA 3M8ZA 4RW7A 2KN4A 3R9LA 5ITHA 2D3O1 1SL0A 2DHHA 2ROEA 3HSDA 3KDOA 2ZH1A 3DNCA 1HD1A 1RT7A 4BCAA 2VOPA 1N32J 2HGNA 2C2MB 3RG6A 2HBZB 4FVCA 1MMDA 2Y1LB 2IMWP 2IA0A 3BGUA 3CCLS 1GMWD 4IYQA 1KQKA 1HBUB 2M8HA 3IBWA 1Y4ZB 4MJKA 2BV3A 2FZKB 2PA3A 4JB8B 4QU6A 3SI8A 2ZVSA 2YKNA 3M32B 2R7VA 3AD7C 4C3KA 2CVEA 3ITHB 3G82A 1EP4B 1RT3A 4PR6A 2VIHA 2DD8S 1AUDA 1KP6A 2FD2A 2OPQB 2KM8B 2O3DA 4R8UB 2DTJA 5D6GA 4DQSA 1J5EJ 1S1UA 2RF2B 4ANEA 2C3OA 2OELA 3LANA 3VWSA 2ZH8A 1BWEA 5HJYA 2YNGA 5J2MA 2P2CB 4EUVA 1NHKL 1U09A 4WP3A 1YSJA 3HKZD 3OFGA 3RR8A 2FLLA 1MG7A 1YJ7A 2QFIA 4YHHJ 4M5KA 2J8AA 1U4BA 3VHQA 4WFBQ 2V5HG 2W01A 3BH7B 1OQ3A 1IBCB 2YKPA 3M8QA 1CPZA 1JLEB 3HVWA 4V19J 4RWXA 5HLFB 2ZEJA 1R43A 4AXJA 4WU3A 4CH7A 1VRQC 2JZ5A 4WU2A 5BR8F 3UCZP 3TAPA 1X8DA 3H8YA 2J7UA 4CLYA 5K9FA 3H2LA 1YJWS 4P10A 4USJC 3CPWR 3MECA 1SQGA 2HHQA 4ZPBA 4TY8A 2XMUA 3MPUB 1UVIA 4OQJA 1VRUA 3FBCA 4PG5A 3J7A1 3KK3A 2KH9A 1AFIA 2VG7A 1T8EA 3PACA 2HFUA 3OL8A 1FJ7A 1S9EB 3FEZA 5EHHA 2JDJA 2F4FA 4CH1A 1G1XA 5EX3A 1CS4A 3MEGA 2CYYA 5IQQA 2GVZB 4ES2A 1FVSA 2OTJS 2DGVA 3W2WA 3R2DJ 3FBFA 5CQGA 3EGNA 2XGQA 5DLFA 3MAHA 4Y34A 2XMJA 3R7SB 2EXUA 1FA0A 4IFYB 4YHHF 1HI1A 1XBWA 3BGFA 2O5DA 1DJ0A 4ECRA 1RXOB 2W2MP 4H4OA 4ANCA 3MMCA 3RB6A 1ULRA 4DUYJ 4B3TF 1KKHA 5CYMB 2GHPA 1SC4B 3MEEA 4Q2LA 4I2QA 1FESA 1SXLA 1CVJA 4J9LA 4P7VA 3Q0AA 3P5BP 4ES3A 3GV5B 2HHSA 1RHJB 4ZN1A 1DTTA 1UVNA 3AAWB 1QTNB 1WDTA 4N7TA 1M5OC 1UVMA 2C22A 4O23A 5IT9Y 2AZ3A 3MCOA 2BW2A 2I6WA 4JP8A 4TY9A 4J90A 2UP1A 3K5MA 1FFWB 3DRRB 3RRGA 4NXNJ 1PG5B 2OJ3A 4KHPJ 1TUVA 2HHHF 3BDEA 2M52A 1U6FA 4NPOA 4DQQA 4PCQA 2CJQA 3SCLE 5DRKA 1Q16B 2WAQD 2Z57B 4FBUA 2B5JA 2RUSA 3PO4A 4M1KA 2MKYA 5D4NA 4ED7A 1CLFA 3V2UC 4X62J 2HAFA 3OQ2A 3FEYB 3MFIA 1PYOB 1SJ3P 2CQ0A 3BYPA 3HFKA 1P1LA 3QJLA 3EGZA 1PJ5A 4QYZK 2FB0A 1T9VA 3NKYA 2FDNA 4WZQA 1SUQA 1XERA 3DC2A 3QO9B 3J7YU 3QAUA 4DR3F 4LF2A 2JEJA 3PW7A 4I7FB 2CVIA 1BE4A 4F3OA 3FRZA 1N56A 3EYZA 1FFSB 4OJ3A 4F4YA 3I5AA 4PG6A 3JYTB 2DIUA 1O6XA 1NJIT 3MD3A 1S1TB 1T9TA 1X0PA 2HKEA 3W8GA 3AB4B 2NXCA 1U1MA 2BJ3A 4EBCA 1OPZA 2OPSA 3G8QA 3QPIA 1FDNA 4ZVPB 3VGTA 3WZ0A 5HL7Q 3OLBA 2J6UA 4B9UA 2CQ4A 1GH8A 1RTDB 3RAMA 1CC7A 1PKUA 3K59A 3L4BC 3P4UB 3S6EA 3TR5A 1N34F 1JLGA 2FC8A 3VAGA 3KLHB 1WSRA 4RUAA 2PE8A 2Z4PA 1HBNA 1VRUB 2AKWB 4A8MP 1F3FA 1WC0A 3DOMB 4U7UK 2XLJA 3ET6A 1HR0J 2GQQA 2J0SD 3MM6A 4FXVA 4QPTA 2V9KA 3JXOA 3D1OA 1U1QA 2UU9J 3KHRA 2NXUA 3JS9A 4IUFA 3E8OA 5GAEU 2AV5A 3GG0A 1X5OA 1GMWA 3MEDA 1TL3B 4QOTA 3T1YJ 1NKCA 1YBUA 4V19X 1RYRA 1U8SA 3T41A 2X3GA 4JV5J 2HS0A 4TYAA 4ZCKA 4ZP9A 1WEXA 4QW8A 1NHVA 3VAMA 4E0DA 2MQPA 5DZ7A 1RAOA 4HT7A 4YB5A 5E33A 1HBNB 2B4VA 4P52A 1L3SA 3SIPB 1HA1A 2CQ1A 3TX0A 4AFFA 5L1IA 3J81j 4KSEB 3PJXA 2KYZA 1CSJA 2A1BA 2OD6A 2IAJB 3M05A 2AZ1A 2HBQB 2QMWA 4ZVTB 3RYLA 4IO9Q 1FF2A 1H73A 2H5JB 5D4PA 2KFNA 2BKOA 3M8QB 3GIIA 2D9PA 2QL5B 3BBCA 5ETVA 1VJWA 3G71S 3NGUA 3I0RB 4K59A 5LSLA 2FY1A 3EE3A 2JSXA 5M2PA 3SV4A 3D0IE 5IV3A 2V8DA 3CJQA 3E51A 1TAUA 3H2UB 3X3UA 4JOUA 5B0AA 2E5IA 4ATNA 1IWAA 5JMNA 5DM6Q 3IXQA 1RJJA 4DF4A 1AZSA 2CQPA 2XO6A 5C25A 1ZPWX 2VPWB 1IBKJ 4EFAC 4F0KA 4FPRA 1RT4A 2J9DE 3IO1A 2Z58B 3CD5A 4ED8A 3D6FB 2CZ9A 1S4EA 5T41A 3VGSA 3M1VB 7AT1B 3IA0A 1KHVA 4OHXA 4C3MA 2Z2LA 4DUYF 1QJHA 2ZWOA 5EN1A 1TQLA 1WC1A 3HVAA 2DNOA 4DSJA 3TJ9A 2XS7A 2FLNA 4NLDA 2IY5B 3KK1A 4F2RA 1Y10A 2C3PA 2MMYA 5KT3A 1PGZA 4GKJF 3EVOA 1U26A 2AEFA 3PHEA 4CNYA 1LWCA 2MKKA 3CCUS 2ATLA 2W8KA 1YTYA 2LXFA 3V81B 1DY3A 5ADZA 3VCDA 1NJWA 2KFYA 4AD6A 3FC9A 3BSNA 3PY8A 2GC8A 4X84A 2XMWA 5HBMA 1WKLA 2V4JB 2VV5A 1IUJA 3CB4A 3WX4A 4DS5A 3RAXA 3TW0A 5KFVA 2B8QA 2OPPB 1B7YB 2JWNA 2KT2A 5KAKA 4DF8A 1R0AB 1M90T 2JEIA 4U67Q 3PRBA 2VG5B 3EVMA 3NCPA 5GAHI 3EPIA 3X1LB 2BJ1A 2IRXA 2BM1A 3CCTA 3OUYB 1FRMA 1SUQB 1W25A 3TYTA 3NS6A 2M88A 4BHQA 1NRKA 1S1WA 3GQCA 4DV5J 2DGWA 3V6KA 2XS2A 3CCMS 3HK2A 2MZRA 4MFBB 5G4DA 4Y2IA 1G4CA 4I69A 5A8WB 4ZVSB 1YITS 3FKBA 2BRLA 1MSWD 2WW8A 1CQMA 2PGCA 1TZ0A 4U7CA 2HHWA 4RW8B 1S0MA 4DR6J 1D8YA 1KEKA 2MQMA 1R0AA 4WFAQ 2HFVA 2AP6A 3F0NA 3QWPA 5E41A 1DRZA 4OX9J 2OPPA 1CS4B 2IFXA 4N56A 2UU9F 4J7CA 3G4SS 1J5EF 3PDNA 2VJVA 3I56S 2CZVC 1SC1B 1HNVB 2V94A 3DU6A 1RAGB 4ED3A 4G3IA 3BR8A 2FJEB 4JYAF 3QLHA 3B6BA 2O67A 2XSFA 4LSNB 5G0RB 1YJVA 2AJFE 1ACMB 3LAKA 3I82A 2Q1LA 5KFMA 1AW0A 3DGPB 4N8NA 4X4SA 3QFHA 2LU1A 4FXDA 3UR0A 5KG7A 2E5JA 1SVDA 4DV3F 1LW0A 4NLVA 2CG8A 2P5VA 4XPCA 4JI7F 2Y1IA 1ITPA 4KO0A 1RB0A 5EUHA 2EK6A 3MTKA 5KFBA 1DQ9A 2H4WB 1E6VB 5EWFA 3M9NB 2QYCA 2KXFA 2IVMA 2W2NP 3CO9A 2WSEC 3C16B 3QIDA 2ZH9A 3AHPA 1U8WA 2HNYB 2KDOA 3GR0A 4LF1A 2CWXA 4RNFA 1H6KX 2CNOB 3GPAA 2FVRA 3KK3B 3KLEB 4IDKB 3KFWX 5LMUJ 1P9QC 3FRYA 3QBCA 2RDJA 3H7HB 1RHKB 2WHOA 5KG3A 5FLXY 2AU0A 2XYHB 3HM9A 1GQEA 3THVA 2OMLA 4JI1J 1M1KT 5I3PA 1TL3A 3ULHA 2EKNA 4EYIB 2V4RA 2HURA 1TMMA 5CH7B 1URRA 3OFHA 4F36A 2PI5A 3JSMA 1YJRA 4K4VA 1OJ4A 2UUBJ 4X62F 4DHVA 3DI6B 3D3CJ 2NR0A 1A0OB 3IAS9 4LFAJ 4A47A 2ZBCA 4QIEA 4J9RA 5HP1A 3R5DA 4KKOA 3ILJA 3EZOA 5HJXA 1HWKA 4WK3A 4Y2KA 3BO4A 3FMWA 4GC7A 4QU7A 2B6AA 4QIWD 4ZKAA 3KJFB 5GAEI 4NASA 4PAAA 3A13A 1PAEX 2WOMA 3HJFA 2XSJA 2KVIA 4IH6A 2CRLA 4QR0A 4E8UA 3EPGA 4LSLB 3NNAA 2QA4S 2CPDA 3SDEA 4DL5A 4DPWA 1FNMA 3WDOA 3M32A 2G1HA 1NH7A 1JLCA 3DRSB 2VZ9A 2HHTA 4DR6F 2IRUA 3R27A 1VYAA 3QRQA 4DX5A 3NS7B 4KBIA 4UTGA 3TWZA 5L1LA 4ED1A 3W5XA 4Z37A 2A10A 2P6TA 2XMTA 1YX2A 5J2NA 2YNFB 5CAAA 1RUSA 4DS4A 1GEHA 4B9NA 3MM6B 2LQ9A 1JXEA 4K4YA 1H7WA 1QDUB 5DZ6A 2C28A 1UP1A 2I38A 2WB4A 1REGX 4FPIA 5CZXA 1V3SA 3DDKA 3AT1B 4P2MA 3OVBA 1WG1A 4OJGA 1XTZA 2B9WA 1EETA 1F0XA 2QL9B 3GP9A 4DV2J 1H38A 2IC3B 3DXBA 5J1PA 1HBMA 1HMVA 1NK8A 3ZC4A 2YX7A 3I32A 1NEEA 2PEHA 1V9OA 1FX2A 3LTOA 3M6VA 2Y1RI 1WHWA 2E66A 3CE8A 3H90A 3QT7A 3TVKA 3A8EA 4X66F 2BZ2A 3FSXA 2EWHA 2LEAA 2Y3YA 4B9VA 1ZZFA 5A8WA 1QUPA 2YWHA 1TKZB 3TEHB 4ZIWA 5IWAF 1RHRB 4H54A 5FLXU 3PW5A 1CC8A 4UOFA 3TANA 3SCKE 4CLWA 5F41A 2XMKA 4O3RA 3QZ8A 3AH6A 2XMAA 3TA2A 4KV8A 3QT5A 2QA4G 1EAYC 3HFVA 2A6MA 4C7QA 5KFWA 4TN2A 3GB0A 1SPBP 3HHKA 4NYPA 3CJKB 4UY85 2R2UA 4GKJJ 1UA1A 1LW2B 3H25A 5KFHA 2EG2A 3VGUA 5GMKa 4H4OB 3P45B 3CCQS 2JC0A 1F9EB 4G1PA 4C97A 1SL1A 5BXIA 3MAQA 4DSLA 2J5AA 2MQOA 3TVZA 3OSNA 2ZWPA 4ILRA 1SQFA 1VMBA 4BS2A 1M5VC 2UXCJ 3O5TB 2I0XA 4M5DB 1RLDA 5KG5A 2AWZA 3BREA 4YDDB 3KJNB 1HWJA 2CQCA 3VALA 4K4XA 3S7RA 5L39A 1MWZA 2DCUB 5ETLA 2BQRA 3EXCX 4MIBA 1G3OA 3LP0A 2VODA 4LF9F 1QUVA 4I68A 3OUYA 1H74A 1T95A 2PFDA 3NBPB 1VFJA 1FKOA 1RHUB 1H2UX 2HQCA 3N79A 4DZDA 4CWBA 4XK8C 1M1HA 3VAJA 1Q8BA 3GJQB 4JI3F 4FF1A 2KB2A 3OPKA 2DY9A 2DNRA 1C1BB 5HQ8A 3MDFA 3RBDA 3NOGA 4PKDB 5KFTA 2XY7A 2ZC3A 3FMBA 4I0WA 1Q7YT 3J7ZT 1T9YA 1BQXA 2GQ2A 3AD8C 4UQTA 4I56A 6FD1A 3WIUA 2ZHBA 1MN9A 2KI2A 4JI6J 1S48A 1U0SA 1JKHA 3G86A 3BR9A 1FRLA 4LT6A 4JI5J 3LP0B 1JB0C 2FTRA 1K1QA 4DR4F 3C8YA 1AROP 2KU7A 3GFXA 5JUMA 2VDIA 4MKAA 1KONA 1YGYA 4ITSA 4YB6A 2OLWA 3W5ZA 4CYUA 3W3SA 1FEHA 3HHLB 2XB2D 5AE1A 4ED0A 1BQMA 4IOAQ 1HNWJ 4OHWA 2NZCA 3LAMA 3SQGB 1NZ8A 2VPYB 1GTHA 2WVCA 3CJ3A 3SEOA 1VIOA 4AXIA 3IN5A 1K1SA 2PD1A 1M5SA 1ZAVA 3EUNA 3G2XA 3RZAA 4M63A 3I96A 5KT4A 2YQ0A 2R2RA 5F9LA 4I2PA 2GZOA 4L74A 3SXLA 1GXTA 1LWEA 3KG4A 4J9OA 2J6SA 1XWLA 3NY0A 2VC0A 4DMZA 1V5IB 3LP1A 5LJ3Y 5U47A 2KZZA 1KR4A 1N88A 2RVJA 4R0EA 2IVYA 5CCLA 1RHQB 3DN9A 4KQZA 4K50A 2ZJRQ 3MMBA 2DNLA 3A8IA 2BOPA 2DRBA 1FXLA 2HVHA 5D8HB 1ZM3A 3FFIA 2B9EA 2RRBA 1IKXB 2QA1A 2QIFA 2FJXA 4X65J 1RISA 1NPPA 2FJWA 4B3OB 3MURP 1U0HB 2DNHA 1Q7LB 2IJFA 2KHCA 2WZ1A 1N6QA 1SL2A 2MPUA 4USIA 1RWKB 5GADI 2XLIA 4UUWA 2HWIA 2L3MA 2QMUB 1ZYQA 4LVOP 1AUSL 1R8AA 3K7RA 5ETRA 2XM3A 3MOJB 4USUA 4CZCA 4PQAA 4W98A 5KG4A 1EETB 2L41A 5HROA 3PJ9A 3DU5A 5L1JA 3CO0P 3JTOA 1U1LA 4C0BA 1HNZF 2PEBA 3ITHA 1JJ2R 4MK9A 3A1YG 3AB2B 3ZO7A 4LF8J 3I5CA 4F8RA 3JQJA 1M5KC 1R31A 1S6QB 2AF6A 2VL1A 3K5LA 3CUNA 4J9SA 1UVKA 1X4AA 3GLJA 3KLEA 4KB7A 5BYQA 4DV3J 4OJ1A 2A2CA 2N4DA 3O6QA 2OMOA 3A3NB 3L7UA 1UFLA 1VDHA 3KMSA 3MUVP 3V6DB 4RNHA 1OIAA 2HK3A 3WBZA 3ZFVA 2WVBA 1CJTB 2V2ZA 1DARA 4CQ1A 4KGMA 2XCAA 4LUBA 4JV2A 2HNZA 2XNRA 4LJMA 1PSDA 1D9FA 1HNXF 3N6MA 3PIPQ 4DSKA 3NBPA 1U48A 3MGJA 3DM2A 3UNGC 2OP5A 5DS7A 1VQKS 1SB6A 2HQDA 1I1GA 3F56A 2NXEA 2NPFA 4PQUA 3JQMA 2D3OR 2MZSA 1CJVB 5GAGI 1FXDA 3NMRA 1AXQA 2HVDA 2RSQA 2YX4A 2C2NA 4LSNA 5G0RA 1XEZA 2AX1A 1RA6A 5CYQB 4OX9F 2VFTA 1Y3KA 3AQOA 3H40A 4DR2F 2MB0B 1A6LA 2RQ4A 4CP5A 5KFKA 4J91A 3JTNA 1QM9A 2JLEA 3TUIC 4DPXA 4NXMJ 3LW5C 1TK5A 1OSCA 2AYGA 3CD7A 3V4IB 1R8HA 2POKA 3D2WA 4A8YA 4AL6A 4QBUA 4IG3B 4ED5A 2CPHA 3HHNB 2RDIA 3GFZA 2YH0A 5CYJA 4YR2A 4Y2MA 3EMTA 2HNDB 2XWYA 4HVZA 5D0EA 5B0EA 1H3DA 3WX8A 3KLVA 1X5PA 2HHVA 4RR5A 1LWFB 4ID8A 2MYFA 1B0VA 3ZZUA 5KFZA 4OYAA 4WTYA 4QW9A 1C0TA 4DI6A 3KHHA 2B43A 1XMOJ 3QSIA 5KFLA 2LCWA 2DISA 1R6YA 3I0SA 4F0MA 2L9WA 2KM8C 2WW4A 3GILA 2G0CA 2IYGA 4L73A 1LWXA 3GSIA 3T1AA 4TQSA 4DR1J 5HI7A 5I3QA 1KQFB 2OFHX 1HARA 2CWKA 3NCRA 1A7GE 4OYBA 5IC4B 1MMLA 2BACA 4ZLPA 4JI5F 2AJ0A 3AD9C 4N5SA 4FF4A 2W1BA 1SCJB 2VG7B 2B7CB 2EFVA 3DLEA 5D15A 2ASJA 3CCJS 4WK1A 4P74A 1NSKL 3J81U 1S72S 2HVIA 1JLFB 2GJ2A 3ISNC 2ZM6J 1R7IA 3ILIA 5LSRA 1VBYA 4KGVB 2K8GA 2WRMA 5HBMB 3QGIA 2RHQB 4OFZA 3D9BA 3T3FA 2AGPA 1LK7A 3C46A 3P8BB 1TAQA 2CPJA 1UZDA 2DXEA 2IBOA 1QD1A 2JFDA 2V2QA 3C6TB 2E29A 3KK2A 2X1FA 2CJYB 2AYMA 1RK8A 2R8HA 1X9SA 4EZ6A 3DRSA 1Y5NB 2QLFB 3MEKA 5GADU 2PC6A 1VGYA 4DUZJ 2V34A 1M0SA 4USHA 2V0NA 1F5AA 3GV8B 4DV4F 2C2EA 4IO1A 4D3HA 1S97A 2R8IA 1VC0A 3M8RA 4ZITA 1RT2B 2NXJA 3NP5A 3HHLC 2ACMA 4MK7A 5DG8A 1Z2ZA 5DJBA 3RB4A 4LF4J 3L9ZA 4RW9A 2DNMA 2HK2A 2OPRB 3OXGA 3M2RB 4K2XA 4NLYA 2W9BB 4EBEA 5A8RB 2QL7B 1XJWB 4JI1F 3GIMA 1ZZNA 2GIQA 4WFNQ 1H98A 4KYZA 5BYRA 3D1QA 2EFOA 2GA7A 3M7VA 2QV6A 2XC9A 2VJUA 3MM8B 1AFJA 1D3WA 5KG1A 3J80Y 2FJAB 3SQGA 2RMLA 5KFPA 2V63A 3T1YF 1YK9A 4ZJOA 4A8FA 4DFJA 1NXIA 4LF6J 2CXEA 3RBEA 3IWLA 1O0PA 3D0HE 4L6V3 2QA2A 1PCAA 3E3XA 3GG1A 3QWUA 3H5SA 4ZVQB 3G6VA 2HGLA 4CCHA 1L3TA 4DQPA 1FTCA 2KRRA 2QLXA 1YRUA 3GMGA 3MMAA 2VD3A 4M5JA 1DTQB 3A12A 2BANB 4OX7A 4PEOA 1H2VZ 1MN7A 2VBYA 1S5ZA 4XPEA 4KV8B 1FVQA 2QYGA 1W26A 2OKQA 4N8OA 3THTA 3IM8A 2CIMA 4MT1A 1RWOB 2VQFJ 4UZCA 4DR3J 3IC1A 5JVGQ 2UXBJ 4WFZA 2DNGA 2HG4A 4HHHA 4A46A 1Q95G 1Y5LB 5D0HA 3I6PA 1N0UA 3HSJA 1R0CB 3MECB 2BABA 5K14A 1IKXA 1J2VA 4HACB 1S1TA 1SJ1A 3QJJA 1T02A 1FKPA 1U1KA 3PYDA 2DO4A 4BWJA 4B3TJ 3MZIA 4KHMA 1VC5A 4X4OA 1EARA 5KFSA 1L3KA 4NZ7A 2M2BA 5FDLA 3HVRA 4CM2A 3T1HJ 2BANA 3H0PA 1ZH5A 3FSYA 3DFEA 2KVQE 2R8GA 4GVBB 4Q2MA 4USKA 5I42A 4O4RA 2LXIA 1IKVA 4LREA 2Q6BA 2HFNA 2KZMA 1SC3B 4URSA 3OR1B 1T03A 3C66A 1VJQA 2DBBA 1X31C 1YWXA 2LU2A 3FFIB 1BQNB 2ACYA 3IWXA 3LH2S 1VRTB 4KAIA 5H1SV 5GAHU 1NJXA 1Q8LA 3HSZA 3KKFA 3HVTB 3NS5A 4DSIA 2DH9A 1O8BA 2PMZD 2MGZA 3V4MA 3M30A 1S9GB 1BY9A 5A76A 5HAOA 1E6YB 4NLGA 3SZ2A 4UZBA 2C3MA 2FIUA 1WEYA 1M5HA 4Q0BB 3NGRA 1QAYA 4GRSA 1RTJB 1WC6A 2KO1A 4QWBA 3PRVA 3M9OB 2A3JA 4EBDA 3VQTA 1FJGJ 2QC3A 1K0TA 5KFYA 3UDLA 3HPOA 1C1CA 4P2SA 2MJNA 4NLSA 2ILYA 5KFAA 3LGNA 2CPIA 2HHPA 3MR7A 4CO5A 3HVTA 3I55S 3R8YA 2ZH6A 5M2UA 2VHGA 1S9FA 1D09B 4WP8A 4RO0A 3J7Z5 2W9CB 4OYZA 5IM0A 1TKZA 2QG9B 2G2OA 3CDUA 2UUTA 3TAMB 4DQIA 2XWXA 2DR5A 1MMNA 3TJAA 1CJKA 1SKSA 2XYPB 3EZUA 1H72C 2OUGA 5SZTA 3F41A 3PYFA 1WOSA 3L7OA 3NNCA 4W90B 1UFKA 2FVCA 1NZAA 3FUYA 4YOEA 1TTHB 2BQUA 3KLIB 5HQMA 2GJFA 5F9NA 1IBLJ 3ZZYA 8RUCA 2UZAA 2PA8D 3QSYB 1S1WB 3PZPA 2RDDA 1IBKF 4K7QA 4B3MJ 3FCVA 1U45A 4IQMA 5CYMA 5IM0B 1VCTA 4C3LA 3KJVB 1B64A 3ZZOA 1FNXH 3HT3A 3CVKA 1KFSA 1GMVA 4ECTA 3NAIA 4PYDA 1DTTB 1HFEL 3CIMA 4PG4A 1MROB 1OS5A 3P49B 2HZCA 1QY7A 2GIFA 5KTQA 2F5GA 3VAIA 3NG8A 3DMJA 1H0HB 1NUEA 4M5LA 3FCWA 2DHSA 1WKKA 3Q89A 3Q8UA 5F8HA 3Q24A 4XDCA 1L5UA 1EKSA 1KTVA 4IOCQ 1WC3A 1GFWB 3BV8A 3ZZTA 3LGMA 2ZM6F 2LFVA 2C3UA 2MKJA 3I9ZA 1KQGB 5ETSA 2AHOB 3W60A 2GVDA 5MLCV 2BJ7A 1JXLA 3ILOA 5DQIA 3N01A 1RTIB 3CCSS 4LIWA 5FD1A 4YFUA 3TX8A 4DSFA 1IR0A 4DL6A 3ADAC 4PXCA 1U1RA 4BC7A 3RBXA 3ENQA 2F3JA 2DNQA 1YDLA 2AYEA 5KOWA 2MQ8A 2B8PA 5L38A 5E2QA 2GFFA 5DQGA 2Q6CA 5K5MA 2WVEA 2AGOA 2FJDB 3CT9A 4NEZA 1P6TA 4QJVA 1VISA 2COLA 3BGOP 3D6MB 5IFMA 2O01C 2E7WA 1K9MT 2MSSA 5E3PA 3KNAA 1RACB 2V67A 1TL1B 1MLAA 4KFBA 1EB0A 1REVB 4YEAA 4EO6A 1ZAXA 3HZGA 3U1MA 4A48A 2O66A 3PYGA 3GJTB 1B7FA 2BJ9A 4ZP6A 1XN9A 2KXNB 5J2MB 2HQIA 1YJTA 4XTTA 2BUNA 2PT0A 4M5NA 1NSPA 5LXRA 2HZAA 1T0TV 1FKPB 4IFVB 1JLBB 4ZLJA 3EX7B 1NLKL 1DTQA 3OTBA 4NLXA 4R25A 3R5GA 5KFJA 4DV1F 3MM7B 2VICA 2ZD1B 4EEYA 4OYIA 4HTJA 3CNQP 3BJYA 2EFNA 1RAJA 5E3QA 4LFCJ 2F4VJ 2MDAA 1S7IA 2HWHA 4CTAB 5C5JA 3AQPA 4KR0B 7FDRA 4A8OA 5EGYA 4DR2J 2B0GA 1FRXA 2DNPA 4FNHA 4Q5VA 4B17A 2YY3A 3FZ2A 1FX4A 1X4DA 2JX2A 3Q2SC 3R5JB 1RTZA 4UW2A 5KFIA 4PWDB 2NYIA 4RPFA 1DQAA 3IRXB 2XY5A 4NA1A 4WPAA 2ZZMA 4RW9B 1HD0A 2BKNA 3CF5Q 4FNIA 4O0NA 3NGTA 1Q8KA 4LSLA 4RW6B 5J1EA 1KHWA 2ZKTA 5IT0A 2MZQA 4ED6A 3K0JA 2C3YA 3GIJA 2DR7A 4LF9J 1OY9A 5AXMA 3C16A 1MU2A 4CT9A 4F26A 5C42A 2ZBQA 2B4OA 1TR0A 2DEIA 2J9DA 2OPQA 3FJ2A 4JV0A 4ZHRA 2EPIA 3TP2A 1WI6A 3IR6B 3N6LA 3S8SA 1UVJA 2GAGC 4NXNF 2EBEA 2AX0A 2DPJA 4KHPF 2XCPA 2VBXA 2YNGB 4U9RA 3D6TB 3SBMA 3R7BB 3CCVS 3RAQA 1VHFA 4HDHA 1DZ5A 2CQGA 2F7VA 3OT9A 1FO1A 5EX0A 5J1EB 3G96A 1XMOF 5CABA 2BQ3A 5A2QU 3Q83A 1JLFA 1AA1B 3R5BA 4ELVA 2ZJPQ 1B99A 2AGQA 1TKXB 4CDIA 2FJVA 3OSPA 2E5GA 1KFDA 2WONB 2YKNB 3DLHA 1VLOA 4R0JA 4OI1A 3DRRA 4CO1A 2R7UA 4ES1A 2HVZA 4MIWA 2MQLA 4Q8FA 5KOXA 5HROB 5E3CA 3ZZPA 5F8NA 2BJ8A 3ZZZA 2VFUA 1YIJS 2FVSA 2V9WA 3IWNC 1V6HA 3ENWA 4UF4A 2FGCA 4U95A 3GR1A 4ZP8A 1U0HA 6FDRA 5IT4A 4P6QA 5DDPC 1N6QB 1N32F 4TKTA 4QZVB 1KC8T 4YP3A 2N3LA 1UWBB 4NYOA 4DL4A 1NKBA 2M8DB 1UFWA 3CJ0A 4C11A 3WC2A 4NCBA 5KFDA 4TLRA 2OFGX 3C15B 1B0TA 3MM5A 3G8SA 2RKIB 1S6OA 2KT3A 2BRKA 2QLJB 3NXZA 4RW7B 1T9WA 4WCEQ 2ZH4A 1XC9A 2QEXS 1RCXB 3GYNA 3MPYA 4B9TA 2YWWA 3CJKA 2LQBA 2FZGB 5IXUA 1PYSB 3UVJB 2AJQA 4WP9A 5KFQA 4FDFA 1VQLS 3HD1A 4EYHB 1R0BG 4NRTA 4AL5A 2V4JA 4ZPAA 4DLEA 1Q4RA 1Y0HA 1UCNA 2V8HA 4Y2CA 3KLGA 1OYDA 2B3TB 2XNQA 5IZHA 1N54B 2E9TA 1V3RA 2GS8A 3MM5B 3GWCA 3PJWA 2IRYA 3AOAA 3CDAA 2DGSA 4OLPA 4C8MA 4DCJB 1R89A 2ZKUA 3VV2B 2AIRB 5J2PA 1K73T 4C8KA 4K0KJ 2VA3A 1X0FA 3T5HA 2AD9A 2U1AA 2YKMA 2XGPA 2R7WA 3HI9A 3ZZ0A 3BN7A 1FDBA 4F50A 4FBTA 2FZCB 2C2KB 2YQ3A 1TVRB 3M6WA 2XI3A 2ADCA 1FKAF 2J8SA 4IKAA 2HMIB 4F2SA 3KHLA 4G65A 2G1DA 2AQ4A 5CYQA 1Y5IB 3U1NA 3O8WA 3IG1B 2MZJA 1N36F 2DO0A 1JLBA 1MROA 2Z56B 2IIHA 1D8ZA 3J7YI 2K7KA 4DV1J 2F8MA 1NBEB 3MEDB 3QATA 1HKAA 1KVKA 1X4FA 3AA8A 2MLZA 5D0GA 5F3TA 3TI0A 4DR7J 4ERDA 2BXJA 2L9NA 1S1VB 4FZVA 3OL9A 2CAJA 5A0YB 5IQ6A 2HYIB 2DHXA 1U25A 1RT3B 1RT6B 2KT5A 1SJRA 4NZ0A 2HWTA 2OD4A 3D54A 5HP1B 3MXHP 1F3VA 4IFYA 4NCGA 5AT1B 3DXSX 3FBBA 2Y8WA 1HNIB 2V8VA 1XNRJ 4C8ZA 2RJZA 4CLLA 3IMQJ 4L76A 2VUGA 3N6NA 1RKIA 4YY3J 2M5YA 4Z7YA 3MCNA 3MMAB 3V81A 1F6TA 4X4PA 2K1RB 2XLKA 3K8VA 3SDEB 4ZJQA 4RUCA 1RYSA 3I0RA 4BDPA 1UETA 4DQRA 1HWLA 1VQYA 1X4CA 3BPDA 1XK8A 4BBYA 2VBWA 2VDHA 4OX8A 4AL7A 4DL7A 1Q8IA 1MU2B 3QRRA 2B4UA 2E5HA 1C2PA 4WYWA 3MFHA 2IYIA 2JJ4D 3MM8A 4URQU 5C25B 3OVAA 4DV5F 2Y1JA 1VQ9S 2OO4A 2J0WA 3DLLQ 3DOLA 3GCXP 1TUWA 1WEZA 4DCOB 3H4BA 4M95A 2NCKL 1Y9OA 3IRXA 4Q45A 1IBMJ 1KVIA 1QE1B 2QTWA 1NMEB 3BPSP 4X66J 4DZ6A 1SJQA 4DU8A 2A2DA 2EC2A 1LW0B 4LVNP 4JBCA 1SBRA 4YDXA 4RNOA 2C2DA 1N8RT 2K1RA 3NNHA 2CDQA 1WOPA 2AEJA 4OZ1A 4RW4A 2H51B 4NA2A 1HMVB 1HBMB 2B9YA 4H4KC 4CTAA 3K89A 3NAHA 2CNNB 4K5RA 2Z2MA 3HHLA 4NEYA 1UTAA 3QLHB 4H4MA 3QGGA 3B54A 1OPIA 4DX8H 3BQ1A 4CI0B 3BQ2A 2RS8A 4CM0A 3W9IA 1F2GA 5IOLA 3E2EA 2NPIA 1QE1A 3JTPA 5K8MA 2YKQA 4LBPA 4MYTA 1HBUA 4FF2A 4ETXA 1SH2A 2JVRA 1SJFA 2DXFA 4ZCMA 3DMJB 4TU7A 5M2RA 3WQPA 1X5TA 4DFPA 4DL3A 1TK0A 3UDCA 2VQEF 1JWWA 3BKTA 3UDVA 1U1NA 1GNKA 2O1PA 4S0MA 5KFFA 4KIAA 2DH8A 4C8YA 1TL4A 1KNZA 1RT1B 2OEMA 1D9DA 3C2PA 4LFBJ 2LMIA 4I1TA 1S99A 4CNZA 2KTQA 4LSZB 3CIZA 2R7TA 4O3QA 4NWBA 2UUCJ 1F9FA 1IM6A 4N47A 1S7HA 4DOZA 4ECWA 1FJGF 5HANA 3VZHA 3HD2A 1R6VA 4RW8A 4ZJLA 1VBKA 4ZPVR 4HH0A 4EMDA 2OSRA 2UV8A 3OJSA 3OR2A 1RCOB 1P27B 2EBGA 4HTIA 4KH0B 4P9SA 4F04B 4YS2A 3V6JA 3PV8A 2HBYB 1VQ8S 1NDPA 3BB5A 4F4KA 2IC3A 2WB1D 2KRBA 1FI4A 3PRDA 1KLMB 1OY8A 2XZDB 4NI2B 3SMZA 1NK5A 2W8LA 1IKWA 1CULB 4I67A 1DFDA 2CJXB 2D1CA 3O44A 4C8NA 2AEMA 2BA9A 2V50A 3ZNUA 4LF8F 1H7XA 3MHYA 3ONQA 2P9CA 2M9KA 2J9CA 2Q66A 3OTDA 1NB7A 2DGOA 1HNIA 4USVA 5LM7E 2JHEA 1S4FA 1IQZA 3UN2A 2P9GA 2M3DA 2YKOA 4I6YA 3UDEA 3M2UA 3K58A 2MKIA 3TJ8A 4MKBA 1KN6A 4HR2A 5LMNJ 2HFSA 1B4SA 4OZNA 4MAKA 5J2QA 2GMJA 2LA6A 3WIVA 3IGVA 3JSRA 1IKWB 1CULA 2ZOGA 1N4LA 1QSYA 1D0EA 3PCOB 1K47A 4NI2A 1JJ4A 2UVRA 4QIFA 4MH8A 1FD8A 3F44A 3GE9A 3HULA 4PQUB 1CJUB 3MM9A 1KVJA 2KG0A 3BGLA 1ZBTA 1KDNA 3WHIA 1RADB 3H59A 1S1UB 2F40A 1IR2A 1C1CB 1U2FA 3CJSA 4J5OA 4XAKA 3HCXA 3L7PA 1YI2S 1M1GA 3H2VE 4Z7CA 3I87A 4ICLB 1RAAB 3M2UB 5F8LA 5KG2A 1UW9A 3HT0A 3IFEA 3CXCR 2W4CA 5HK4A 5AE2A 1N5YB 3BKFA 1TFYA 1GXUA 4RW6A 3QT6A 3DI6A 1YQHA 3MOZA 3UPFA 4URGA 4DV6F 2P8IA 4OX6A 5HVFA 2MKCA 2BE2A 5LMNF 3D68A 2XHCA 2W2QP 3ETMA 1QAJA 5C2CA 4RKUC 5DDRC 4DX7A 3SSRA 3DLKB 2VKZG 5HMZA 2UV8G 5H9FJ 4CLZA 1O5JA 4EWTA 3PM9A 3HDSA 3I5BA 4GO5X 5LOQA 2RRAA 3MCMA 2VONA 1OY6A 4DV0J 3OW2R 5KFNA 1U24A 2C42A 2XSJB 3O1LA 3KUEA 4J9UE 3FEXB 3DGVA 4OI4A 2VBZA 4ECVA 1D1UA 4ZPCA 2MY7A 4CRJA 4RW4B 2ABYA 3RBZA 4X64F 5GAGU 3DHWC 3D28A 4DXLA 3UD3P 1U7LA 3BS9A 5EWGA 4KTQA 2VG5A 2PDAA 3MR3A 1TL7A 1A9NB 2HHHJ 1TVRA 2HMIA 3RR7A 3CSKA 4UOGA 1FFGB 2UXCF 4F3QA 4ER8A 1XNQF 3O2IA 4P75A 1VBZA 2IBKA 1NPKA 3UD5A 2PMWA 5AXKA 2RNEA 1TK8A 2CJ9A 2HRTA 1T94A 3L95X 2NYHA 4YB7A 1S76D 1RWNB 3IM9A 1T7PA 2W2OP 3NWRA 4XO0A 1GK8A 3TNVA 1IQTA 1S1VA 5C42B 1NHUA 4TYBA 5D77A 3ZXWA 2UUWA 2HNYA 4J9VA 3Q2TC 2DPIA 1EKRA 2RF2A 2RQMA 1WDDA 2ZUGA 3BGRA 3H5UA 1RHMB 1WORA 5H9EJ 2LDYA 2RQKA 4B3OA 4B3RJ 4QYZJ 4YMEA 5DGBA 3C14B 3OHBA 3HKWA 1NJZA 4FF3A 3GV7B 5THWA 3K5PA 1VBXA 1N33J 4ZIVA 4X4QA 5A8KB 3V5RA 1JQGA 3CJRA 5AJ3F 1XNQJ 3KG1A 5A8RA 1KSPA 3V6DA 1JLAA 1LFWA 4TXSA 3M2RA 4I6AA 1GAOA 2VC1A 3AA9A 1S6PB 5GMEA 3NRBA 4P2XA 8AT1B 1NDKA 3UFCX 4CLKA 4I7FA 3DOKB 5HSPA 1T9UA 1PJ6A 5EWEA 2CG4A 4DV2F 3UE2A 3EJMA 3BBFA 5F8GA 4YR3A 4LQ3A 4DJBA 4WE1B 5CZVA 5IV4A 3R6LB 2HRUA 1OMSA 4OI0A 3MUMP 4ALZA 3DCAA 3T9NA 3EWGA 4ED2A 2UUAJ 4J9KA 1IKYA 4NLPA 1PYTA 5B7WA 2V8PA 2H5IB 4FN5A 4WIQA 2XO7A 1SKRA 3UNYA 4CIOA 3GYGA 3U1LA 5K8OA 1FEEA 4C0OC 3ENAA 3TA0A 4ZLLA 2MQQA 4RZRA 4RBTA 4NXMF 2IDEA 3B82A 1S77D 1S1XA 3LUYA 3KLFA 2GNKA 5AE3A 4WKYA 3IBCB 3TUPA 2OIHA 1UMJA 4NRUA 4DV0F 3SFGA 2YWKA 4NZ6A 4WF9Q 1RWPB 2UXDF 1X4HA 4L3KA 3MMBB 4WWSA 1F5BA 1RBOB 3MM9B 2BDPA 3UO0A 4OI6A 3W61A 4KY3A 1X9MA 1KQSR 1SI9A 2RUGA 5DGAA 5ETQA 4N76A 2QSWA 3QIPA 2M4MA 1ZM9A 2PSZA 1IKYB 2GGPA 4RBVA 1HQEA 5ETKA 3M2VB 3ISND 1UPPA 1O51A 1OWXA 5LXYA 1X4BA 4MTPA 4PXDA 4WBFA 1DHMA 4NYZA 1IWGA 2H1YA 5CA5A 2GX8A 2JLFA 2VQFF 4DLGA 1JJCB 2VPXB 3D5MA 2XEXA 3M8PB 3MR6A 3N5BA 5D3GA 3NEKA 4GMKA 2E44A 5E5NA 2G0IA 5E3RA 3RJMB 5KG0A 3TZZA 1BQMB 1XR5A 1VK3A 2CQ3A 3D66A 1N36J 3T6BA 1LWFA 1N0VC 2G2ZA 1CJVA 1IJEB 2ROGA 4QIVA 3UN3A 3VZIA 1J5OA 4X2BA 1W7WA 3OLAA 1KD1T 3CD0A 3JB9k 1RWVB 3GIRA 2DXDA 1UZHA 3DLBA 3QGHA 3PR4A 1WF2A 1VQOS 4K4ZA 2A18A 3HHDA 5GVQA 1K44A 3TVYA 2F8EX 1FT8A 4G1IA 3FNNA 3V4IA 3HP6A 1E6YA 4PPZA 3GYXB 4NA3A 4TVAB 1VS3A 3OXLA 2LXUA 4LRBA 4J9PA 3CEDA 3GONA 5L46A 2RIJA 1V3ZA 3UN5A 3M6UA 4O3NA 4ID5A 1GT8A 2HW3A 2C2OB 2XG8A 2CZ4A 2YVSA 1Q79A 3JAMY 1I94F 4ENOA 2HEKA 3FK4A 4KC5A 1WC5A 3UR3C 3ZTRA 2DR8A 4IG0B 4LQ9A 2X1GA 4DV4J 3DRYA 3EVWA 3GJRB 4JV1A 1RT4B 2VB6A 2R8KA 5J1NA 2G4BA 4HT5A 1FE4A 1WD6A 2FHJA 3SQOP 4KPYA 4OZLA 5ETOA 2PIIA 2WOMB 3DDNA 2EW9A 2YTCA 3MEGB 3G87A 3CC2S 1CJKB 1MW7A 2QX0A 1YVFA 3IR5B 4HHJA 2BE7D 3B8HA 3PEJA 4HLBA 4U96A 3LGHA 3ZTOA 3BO3A 3C3LA 2ZNYA 3W65A 1NJYA 3RW6A 5HN0A 4M5MA 4CYUB 1RAFB 1HI0P 3AY0A 4ECXA 2N7CA 1RWWB 1S6QA 4IG0A 4KPCA 4ZDNA 4GC6A 5IC6B 1PILA 2DGUA 2BMBA 4DWIA 4X4NA 1EQMA 2VG6B 5LL6d 4J9NA 2ZBIA 4OZ0A 3N0VA 2YNFA 2KG1A 2DR9A 3QRPA 3OV7A 1XR6A 3MEEB 1LXJA 3TRGA 2ZHOA 3DRPA 3PVXA 2GIRA 1TUGB 4TU8A 4Y65A 2UVWA 4PUOA 1BMQB 1WHXA 3KOAA 4DPUA 5K8PA 3PX0A 2VA2A 1HYSB 2DGQA 1XQIA 2YX1A 3QO9A 2FUG9 2HNZB 1B3TA 4LR8A 1WOOA 4ZVEA 4ZCLA 1R27B 2J7KA 2DH7A 2DIVA 1HW8A 3IR7B 3UW1A 2J7WA 2RD5C 2FY8A 3DKDA 2KXHA 2MJUA 2R2SA 4JI3J 5HMWA 3CC7S 4UQGA 1VOMA 1BQNA 2CFXA 3W64A 1ZPVA 3K2YA 4AQYJ 4P7TA 4LF7F 1C0UB 1HW9A 1NH8A 3IG1A 5C7PA 3BKUA 5HVGA 4YQWA 1F60B 2JLGA 4P73A 4D3GA 2MEWA 2WVFA 3E01B 5CHCB 4ZVRB 1Y00A 5BR8J 4USMA 3IS9A 3ILLA 3OTOF 5CXTA 4KHRA 4I2PB 3AJ2A 5DO2A 2UUCF 3MPWA 4PZVA 3A8KA 2N7YA 1FWPA 1N33F 3WC0A 1CJUA 2M7SA 2W2PP 2GO8A 3A8JA 3ZZRA 3PW0A 4NCGB 3PFOA 5JXSA 1IBLF 2B7BB 4DN0A 2KKHA 4XIUA 3H20A 4DX6A 2G9OA 2E1CA 4YY3F 3O3LA 1RBLA 3G9CA 2L08A 2XMVA 1YG0A 1NSQA 8ATCB 3JAMU 4OYXA 4ECSA 2VPZB 3IGNA 2QGFB 4M8LA 5ETMA 7FD1A 2MSTA 2OEJA 2Q79A 4FXWA 4JI0F 3AFGA 3J80U 3KHGA 3VAHA 1PJ7A 5IWAJ 2OH2A 1RAHB 2JL9A 2I1RA 4DBQA 2UVUA 2EG1A 4RNNA 1LWEB 4ZVUB 3W2WB 4DPYA 1EP4A 2R7SA 3CW2C 3IBFB 3KJQB 4LF5J 4WZMA 2MHEA 1FDAA 1U6BA 1T05B 1WWHA 4USWA 4NMLA 3G6XA 1IM4A 4N41A 4CLUA 2CPXA 3KJVA 1QSLA 3I4PA 1BWVA 2BW7A 2RAQA 1F5CA 3OHAA 3CC4S 4ZLNA 3QJPA 2A0FB 3KTQA 1PAUB 4H4KA 1JK9B 1WHYA 5E7OB 1HNZJ 5FDLB 1Z4UA 1SV5B 1VQMS 3LWLA 3EM1A 4HL9A 4JI8F 1VHIA 3FQLA 3RGIA 3SSQA 5DDQC 1YJ9S 3HFZB 1CQNA 2RT3A 2HIYA 4JV5F 1JNRB 2MY8A 3C15A 1ELOA 1UEUA 2BJEA 2F63A 1RKJA 4O4GB 4CLPA 1PBAA 1I5OB 4DG1B 3Q22A 4F4AA 3NOCA 4EO8A 4LRCA 2F65A 1PBUA 3NWGA 3R97A 4ZCIA 2NQPA 4NLQA 3EICA 2ZNZA 4N77A 1LXNA 1C0TB 1R8CA 4NOHA 4PWWA 2KHDA 1RT5B 2QJ3A 4OZ5A 3W2VA 4QPXA 5I3UA 4FYDA 4EZ9A 1WACA 3CJ4A 4C9DA 4OHYA 3W66A 1NK9A 4Q0BA 1CJTA 4P2FA 1UW4A 1J27A 2EFPA 2GCFA 4DL2A 1QSSA 1LWCB 3ISZA 1FK9A 1EJ7L 3GTYX 4AE5A 4QWCA 3RB3A 1JXVA 1U6ZA 4CT8A 4JI4J 2MLYA 1L3UA 4Z2XA 3QYYA 4WYLA 5J2NB 3G8TA 1UVLA 2ALYB 1VIXA 1VR6A 5E0OA 4Q43A 4DSEA 2X3DA 4AT1B 3LP2B 3C6UB 2RU9A 3DYAB 3H5YA 2ZH7A 1L3VA 2QMXA 5A8KA 1EX8A 4QR2A 2Q3PA 4MMOA 4UY8T 3IS9B 4L75A 4ZP7A 4UOCA 2K06A 1N5VA 1HLWA 1JLQA 5L9XA 5B09A 4LRAA 4L3NA 4PXEA 1DQ8A 4LF6F 1HQ2A 1F1BB 3D1HA 1YJNS 5H9FK 3JSBA 2RE1A 2E1RA 2DK2A 4M5GA 3M8SA 1RTDA 1NPRA 2CPYA 3CCWA 1T05A 4R8UA 4OV6A 3PKMA 4FKYA 1DLOB 4OI2A 3CDWA 4ZVOB 3EGWB 3DLKA 3TQ1A 2BBEA 2HNDA 2J9EA 2U2FA 3CJTA 3FQKA 3HLUA 5DETA 3R2CJ 1BXNA 1VQ5S 2LVWA 1BD6A 2EEYA 2R7QA 2G0JA 3A3PB 3H98A 2R7RA 3N4WA 1UEVA 1Q82T 3I9V9 5A2QY 1YKWA 2EKYA 4EGLA 1EZZB 3POTB 4EK2A 1ZS6A 1HWUA 1MWYA 1S59A 2IJRA 4PPDA 3PR5B 1WG4A 4ED4A 4LF5F 4DUZF 3T9ZA 3OJUA 3QNWB 1BHNA 5KFXA 4WFXA 1SKUB 4PYAA 1XMQJ 1ICEB 2DGXA 3FVYA 4O44B 2G13A 4KKOB 3BGRB 2EVZA 4IFVA 3TOQA 2DR6A 1U02A 1YLXA 2IAJA 2LA4A 4GO7X 1DURA 1RU2A 2B51A 3B4MA 2B6AB 2AW0A 2XS5A 1IVZA 1X5SA 4IRCA 2ZD1A 3OFEA 4FS1A 4LBHA 3RU0A 2MHNA 1CBKA 3AJ1A 3N28A 4USTA 5A0YA 5BJRA 2HHUA 3HSGA 1Q5VA 2CQHA 3R6GB 5IT9U 3T1HF 3Q8QB 2DHGA 2F8HA 4JI2F 3CJ5A 3R3TA 4OZJA 5CD4H 2D3UA 4RBUA 2CQDA 2DNZA 3QMQA 2YH1A 1CG2A 1UJ5A 2CDRB 1YHQS 5LT5A 2CNKB 1SH3A 1N52B 2MKHA 4A8WA 2HS4A 3DOMA 3PW4A 4JI8J 2MZTA 4A4JA 6AT1B 3V6HA 4YR0A 4ICLA 4F02A 2E5LJ 2HVEA 1KLNA 1NNDA 4AQYF 2DNYA 2OPSB 3KMQA 3NMAA 4ILMA 2UXBF 1YBAA 3TAMA 2IMOA 1TV6B 2IHR1 2SXLA 1JKHB 4O0IA 2E9RX 1N5YA 1TL5A 3C6TA 3I4HX 2OGUA 4NLTA 1AYEA 5LJ5Y 3D67A 2VQEJ 3CCRS 1ZA2B 2Y0SD 1QVGR 2E5LF 1VQNS 2KL8A 2GW8A 2FYXA 1S10A 1RWMB 5AJ3J 5K20B 2V4QA 1FHTA 4WIIA 5B0DA 1UJ6A 1WNEA 1IXKA 2KJVA 4G1QA 4DFMA 4M94A 3TO8A 3LOUA 2WSCC 2K3KA 3QAEA 1S57A 4IDKA 5BYSA 3C6UA 4DR5J 1NK4A 4JI0J 1WG5A 2DYAA 3GSDA 2FC9A 2B56A 3N5FA 3US5A 4JI2J 2H3EB 1WELA 2BVZA 3MUTP 3P6YC 4ELTA 4AUKA 3ETOA 3T5JA 5F0WA 4E2FB 2VFSA 3FDSA 2D7SA 4ANDA 4LR7A 1RTJA 1RWUA 2E7VA 1UL3A 4KGKA 2GAHC 4NX9A 4PG8A 2GVDB 4G1QB 5DQHA 3G6YA 3PX4A 2XZTB 2IA6A 5JJBA 4MFBA 2Y9HA 5K8NA 4F7VA 3K17A 3NL0A 4ETZA 3T19A 2FLOA 4OL8A 3PG9A 2PI4A 4HH1A 2ZE2B 1HQUA 2CPEA 1AB8A 4RL1A 4BC9A 1QLNA 1APSA 2DGTA 2DKOB 1I6JA 2JRSA 1FXRA 2AMCB 4FYYB 1I51B 2R9LA 4FVMA 4DR7F 1I94J 2OSQA 5KFGA 1Z2LA 3F73A 5J2QB 2AT1B 2WONA 4WXWA 1WKJA 5DM7Q 3BBBA 4C8OA 4M5HA 5DLGA 2CUYA 3RRKA 5KFCA 4OJHA 3N9UC 1RAEB 3KNGA 3GIKA 2C2ZB 2M0GB 2I8EA 2V2VA 2V8GA 3UWTA 1AZSB 2PN6A 4F3MA 2EI5A 4ECQA 4A8SA 1QTMA 3D7SB 2LDIA 2HS3A 1AT1B 4QWDA 4F4WA 4TNOA 3SCJE 3PEHA 4Y0FA 3LQVA 1N34J 4K0KF 2HPUA 2MTLA 4Q7AA 4DN9A 4X4VA 3HHEA 3OD2A 4DU7A 3MM7A 3CTRA 3TUZC 2XMMA 1X4EA 1RABB 3BYRA 1EIYB 4M5IA 2MQNA 5HATA 3VQSA 2VFRA 1JLGB 1UKUA 2I5JA 2R4FA 3U7JA 5F8IA 2MKSA 4NL5A 5ETTA 2RU3A 5C24A 2ZBRA 4DUTA 3G6ES 2JC1A 3ELHA 1ZTTA 3I31A 3MI7X 2XYGB 3Q23A 1LFPA 4KH1B 1RQ0A 1S9GA 2BJDA 2M70A 2D9OA 3FCHA 4PUOB 1GX5A 2W4PA 1KOOA 3JSMB 2VU5A 4IRDA 1T11A 3MR2A 4K4SA 1S0NA 2NUUG 2CQ2A 5F8JA 1WUUA 2D3ZA 1Q78A 2C1EB 2I5JB 2WK4A 3R5CA 1HNWF 4ZOSA 4B3MF 1G2EA 4ZMMA 3H42A 3H5XA 4Y00A 5KT5A 4U7UD 1DLOA 2ZC4A 2ALZA 2R8JA 2YPYA 2W7AA 5C24B 3SYZA 3TA1A 3KG0A 3HF5A 4OHZA 3DDIA 2E9ZA 2BOAA 2D74B 1TKDA 2UUAF 3L3CA 4JI6F 1MNEA 2ZH2A 3MR5A 3M6XA 1M5PC 4M5DA 1HNXJ 4ZPTR 1U2CA 2QLBB 3KUHA 2DJWA 4U6PA 1XMQF 4B3SJ 1V5VA
chains in the Genus database with same CATH topology
1FWPA 1FFGB 1A0OB 1FFSB 2LP4A 1FFWB 1EAYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWP A;  1FFG B;  1A0O B;  1FFS B;  2LP4 A;  1FFW B;  1EAY C; 
#chains in the Genus database with same CATH topology
 4OIX A;  2H9Z A;  2G2Y A;  1X9W A;  3CUL A;  1U1P A;  1K0V A;  3KWM A;  3NCQ A;  4LF7 J;  1ZOT A;  1N48 A;  1RT7 B;  2Y0B B;  5E3A A;  1S49 A;  2ZH3 A;  3DOL B;  1LW2 A;  3MAA A;  2HGM A;  2LQ5 A;  2UXD J;  3LAL A;  2EC0 A;  1WI8 A;  2IM2 A;  1HHQ A;  1WF1 A;  3KXD A;  1S0V A;  1P9Y A;  2HAI A;  4K4T A;  2EK1 A;  1IJF B;  4BLG A;  4NCA A;  3MCS A;  4G6V B;  2OAU A;  1F9H A;  2ZZT A;  3R5A A;  1RT5 A;  2YBV A;  1S6U A;  2WBR A;  3W2V B;  2MLX A;  1HIY A;  5I3U B;  3BM7 A;  3KK2 B;  3H4D A;  2E1M C;  5ETN A;  4ZVH A;  3T6J A;  5DG7 A;  3EDQ B;  2LKZ A;  4GKK F;  1FRH A;  2K2P A;  5B0B A;  3R1H A;  2HQF A;  2WVD A;  3OL7 A;  2D69 A;  2E7X A;  1UPM B;  3U02 A;  4C4W A;  2NZ4 A;  4P71 A;  1U49 A;  2NLW A;  3M4X A;  1NSA A;  2ZBP A;  4C2M A;  2DCL A;  5A6W A;  1ZTW A;  1NK6 A;  1TL1 A;  2CKW A;  2YQ1 A;  3PYE A;  2FGO A;  1FNO A;  3TAR A;  3Q8R B;  2BEF A;  1JMT A;  1SH0 A;  1TMJ A;  2BR0 A;  4LF4 F;  1C1B A;  5IS2 A;  3DLJ A;  4IOB A;  2W9A A;  2JEG A;  1VQ7 S;  1U2R A;  1NM2 A;  2I2Y A;  2OPR A;  1DAX A;  1JJH A;  4YB1 P;  3SV3 A;  3SSS A;  3VAK A;  1PC4 A;  2DHA A;  2IM1 A;  2R7O A;  4LR9 A;  5CCM A;  5J2P B;  1MWQ A;  2B9X A;  3OTO J;  5L1K A;  1RTH B;  3M9M B;  5RUB A;  2RRN A;  1RBA A;  2APO A;  4UUX A;  5SUH A;  4QQB A;  3W8P A;  1E6V A;  3OBI A;  3KUG A;  2HLT A;  3FGV A;  3P96 A;  3C19 A;  3BO2 A;  5FJ4 A;  2PFF B;  1XMB A;  3VF0 B;  3W62 A;  1R8B A;  2VH7 A;  2F9D A;  5B0F A;  2W7P A;  3OR1 A;  1T03 B;  4IR9 A;  2P6S A;  2NSC A;  3DLG A;  3JYT A;  3C14 A;  3DGP A;  2ZZN A;  2VKR A;  3E01 A;  4DDF A;  2X7I A;  4KRW A;  3HMJ G;  5HMY A;  3CD6 S;  2NXN A;  1HQE B;  1Q86 T;  3KYL A;  2HBR B;  4DFK A;  4DV7 F;  2FVP A;  1KS2 A;  3TEG A;  2GQC A;  2GVZ A;  2JOQ A;  3B4D A;  3DOK A;  3HHL D;  1VC6 A;  1PC5 A;  3P5T L;  4PRF A;  4B3R F;  3M8P A;  3A4T A;  3QQC D;  1SC6 A;  4IG3 A;  4Y3C A;  1Q81 T;  1SKW A;  1H2T Z;  1YBT A;  2PO4 A;  4DV7 J;  4A8Q A;  3RRH A;  3HZE A;  4KJI A;  1IR1 A;  4WE1 A;  5HMX A;  4K4U A;  2YWG A;  2JFK A;  2J0X A;  3DHX A;  3PIO Q;  4IRK A;  2BKP A;  3W63 A;  4U8V A;  2F9J A;  3DRX A;  5K14 B;  2ERR A;  1IN0 A;  2YWF A;  2X1A A;  1XNR F;  4Q44 A;  2ZIT A;  3CME S;  5AXN A;  5DDO C;  3D6H B;  1YRX A;  1C4A A;  3BF4 A;  4I2Q B;  3VTI A;  5HVH A;  4B9L A;  4OMF G;  2RB7 A;  1ZM2 A;  3FBE A;  3B78 A;  4F67 A;  4A8K A;  5HLF A;  3MTJ A;  2ZDO A;  4C11 B;  5DG9 A;  5I42 B;  2FHJ D;  4V1A k;  3KLF B;  3NLC A;  4O3P A;  2ASD A;  3D3B J;  1NKE A;  1T3N A;  4O3O A;  3KK1 B;  4CLT A;  3NGK A;  3VVT A;  4NLU A;  1HHT P;  1GXL A;  4B9M A;  4ELU A;  2AJ4 A;  4TY8 B;  2IJN A;  2JVO A;  2YNI A;  1YZ7 A;  4LIR A;  3VVU A;  4X64 J;  3PW2 A;  1TFW A;  2QN6 B;  2IVF B;  2B4P A;  4KGZ B;  4PG7 A;  4HI1 A;  4DPO A;  2UUB F;  3OFF A;  2RHS B;  1RGV A;  3MWB A;  4OV1 A;  3CMQ A;  2Z30 B;  3VR1 A;  2RH3 A;  1YJU A;  2F1F A;  2Z2Y B;  3LF0 A;  4K2J A;  4DCP B;  4UT4 A;  2CQI A;  2VOO A;  3RTV A;  1QVF R;  3Q86 A;  4Y28 C;  4J9M A;  3GZ7 A;  3HX9 A;  3ZTS A;  5D0R A;  4NMX A;  1SJ4 P;  4ECZ A;  4ZK7 M;  3PXG a;  2XZW A;  2Q43 A;  2H48 B;  3BSA A;  2KYX A;  1HPZ B;  3LP1 B;  4FYX B;  1D9A A;  4NLW A;  1X60 A;  4ZS6 A;  4DR5 F;  1PO6 A;  2Z0G A;  5T7L A;  4NLO A;  4P72 A;  1LEO A;  1OO0 B;  4OYP A;  4RX6 A;  3CMA S;  1LV5 A;  1TL7 B;  2HLU A;  2NS1 B;  4ZPD A;  1RTI A;  4L72 B;  2CJA A;  2LEP A;  4FYW B;  2LP4 A;  5AXL A;  3LWM A;  1VQ6 S;  2OEK A;  2W4D A;  3M1V A;  4CH0 S;  4HEA 9;  2FLP A;  4JI7 J;  1EQ0 A;  2VAS A;  2XI2 A;  4OYO A;  2HSE B;  3DYA A;  1RT2 A;  3QFW A;  3MMJ A;  4LRF A;  2BYC A;  4CO0 A;  1NDC A;  1UEK A;  2E1A A;  4F0H A;  1VK8 A;  4ZVG A;  5A6P A;  4ZN3 A;  3POT A;  4UOH A;  1NK0 A;  4O3S A;  1HPZ A;  4ECY A;  4LFB F;  3FSI A;  3UCU P;  4B3S F;  1FK9 B;  1FTR A;  1JLC B;  2XHW A;  4QYR A;  4JYA J;  4O4G A;  1G6B A;  2R2T A;  2V69 A;  4AYB D;  3K57 A;  2R3V A;  2CJK A;  1TP7 A;  2LQJ A;  3J7A N;  2N3O A;  4FS2 A;  2VFV A;  2W25 A;  3AOC A;  5H9E K;  1R3N A;  1YZ6 A;  2PMH A;  1WF0 A;  2AJ2 A;  1OQ6 A;  1NDL A;  4DEZ A;  4X65 F;  2ZE2 A;  3ZNJ 1;  3CCZ A;  3PFE A;  5KFO A;  2DRA A;  1NAQ A;  2WSF C;  3AOB A;  3GFY A;  2FJB B;  4RJV A;  1YRT A;  3GU0 A;  1RE1 B;  4XDD A;  1F2H A;  3OL6 A;  3OTE A;  3K5N A;  3I0S B;  2NUH A;  2HFZ A;  2QZ8 A;  3LO3 A;  1FWL A;  4PXB A;  2ZDP A;  4U8Y A;  4IR1 A;  2GJI A;  4KO0 B;  2NRE A;  2DY1 A;  1GTE A;  1BLU A;  3D4J A;  2IDL A;  4ECU A;  4A8X A;  2XY6 A;  1HBO B;  4J37 A;  4OYM A;  2BM0 A;  1KWM A;  3LPY A;  5KT7 A;  2HQG A;  1QAI A;  2ZOM A;  3NGS A;  3NGD A;  4C8L A;  2GML A;  2VG6 A;  3CJ2 A;  4I4B A;  3DLE B;  2MXY A;  3K5O A;  3CCE S;  1IBM F;  3ET6 B;  3KLG B;  3W9H A;  5F3Z A;  2CA9 A;  1FJC A;  4RU2 A;  3OTC A;  3IAM 9;  1FCA A;  3M2V A;  1VQP S;  1FER A;  2IPO B;  2IM3 A;  4ZPW R;  1OYE A;  4JUZ A;  1Q5Y A;  5LSO A;  5MAO A;  4LMZ A;  1S79 A;  2GO9 A;  2V2K A;  2YKM B;  4MKY A;  1JX4 A;  4HI2 A;  3W1Y C;  1N5T A;  1HWI A;  3KDN A;  4KT0 C;  3Q8S B;  4C98 A;  4DL0 C;  1HBO A;  1KBR A;  1C0U A;  1NB2 A;  4WKR A;  4MYU A;  2FHK A;  3RUB L;  4O44 A;  4HDG A;  1KTQ A;  3TQE A;  4MK8 A;  2DNN A;  2YXL A;  1DBD A;  3CDE A;  2GHV C;  4FYV B;  4RUB A;  2AYB A;  3LA0 A;  1URN A;  3CWJ A;  4R5P A;  1Y3J A;  3TUJ C;  4QCL A;  2GGP B;  1WC4 A;  4C0H A;  2YNH B;  2YPZ A;  2XQC A;  4LFC F;  4QIG A;  3BN4 A;  3EZ5 A;  2QSF A;  3PKY A;  2I9S A;  1WSV A;  3L09 A;  4I64 A;  5KT6 A;  3TAQ A;  1TV6 A;  5L8R C;  2K3I A;  2J0Q D;  1P1T A;  1UJ4 A;  2CJB A;  1TU0 B;  5FII A;  1EHW A;  1Q0N A;  1WTF A;  2QO3 A;  3EGV A;  2HRY A;  4Y2A A;  3VGV A;  1VRT A;  4F25 A;  3MMC B;  1RLC L;  2ZOF A;  4FP9 A;  1RP5 A;  2CNL B;  1ZA1 B;  2KJW A;  4EI2 A;  2A6O A;  4PWD A;  3VAF A;  4B9S A;  4X4U A;  1XIQ A;  4RLE A;  3D0G E;  1J5O B;  2MGZ B;  3BQ0 A;  3R7N B;  1HQU B;  1FD2 A;  3GCW P;  4C6A A;  2YNH A;  4DR1 F;  1GMU A;  3Q8Y A;  4YN3 B;  4CLF A;  3OVS A;  3OR2 B;  4QWE A;  1JIH A;  4R5P B;  1K8A T;  1LOU A;  2C2R A;  3BSC A;  1JLE A;  1HL6 A;  2GHW A;  2YWE A;  3K8W A;  4OI3 A;  1FE0 A;  5D3G B;  1RWX B;  2DT9 A;  4IH7 A;  4X4R A;  1KOH A;  1KLM A;  5KT2 A;  1NCL A;  2ZJQ Q;  2GV1 A;  4LBI A;  2H4Y B;  2K7J A;  4ZHR B;  5D4O A;  1IKV B;  2ASL A;  4X4T A;  3PHT A;  2N82 B;  2YKA A;  3W7B A;  4H4M B;  3P3D A;  4ZA1 A;  2H5E A;  2RIL A;  2FHM A;  3KLH A;  3HO1 A;  2DVI A;  4HYK A;  1KRP A;  4RU9 A;  1FWK A;  1N5Q A;  1B70 B;  1QAX A;  3MF5 A;  2ROP A;  1Q1K A;  4C48 A;  5I4M A;  3IRW P;  3PX6 A;  4MIA A;  1WTB A;  4B02 A;  2R7X A;  1ROF A;  4TLQ A;  3ZTQ A;  3TZY A;  2CQB A;  3DRP B;  5KG6 A;  3M8Y A;  1S9E A;  2ZUA A;  3J81 Y;  4DV6 J;  5F0U A;  1BGX T;  1P8G A;  3MPD A;  4OHV A;  4CO2 A;  1BUX A;  4OZ3 A;  2JH3 A;  1Z1Z A;  1HYS A;  2ADB A;  3UD4 P;  1LK5 A;  2W9B A;  1GX6 A;  1FJE B;  1HR0 F;  2HQ3 A;  1S1X B;  3U27 A;  2JNJ A;  2CPF A;  4ID5 B;  1HHS A;  9RUB A;  3T5K A;  5KFE A;  2N4C A;  4Q8E A;  2ATC B;  2QLW A;  5B0C A;  1TKT B;  1I3O B;  3PTW A;  2JEF A;  1PIE A;  3DM2 B;  1RDR A;  2H54 B;  4FKX A;  2HZV A;  2FVQ A;  4HHU A;  2Y8Y A;  1U1O A;  2QT7 A;  1BC6 A;  4K5S A;  1Q53 A;  1HI8 A;  1R8P A;  2CAD A;  3SFU A;  2UVV A;  1X4G A;  1Y11 A;  3RB0 A;  4WTO B;  1WJ9 A;  1Y7P A;  4NE9 C;  4OZ2 A;  2W7O A;  3FZB A;  4CLS A;  2ZFH A;  2LYV A;  3QT8 A;  5D78 A;  3QZ7 A;  2WCX A;  4CO3 A;  2WTF A;  4WJB A;  2X1B A;  3CGI A;  1NK7 A;  2DIT A;  3UCG A;  4RNM A;  1C4C A;  1S6P A;  1TKT A;  3HXM A;  2LEB A;  4GKK J;  3MPV A;  4BWM A;  3CJ8 A;  4CO4 A;  4EU0 A;  2E1P A;  1REV A;  2EFG A;  1UWA A;  2LQ8 A;  2WBM A;  1RT6 A;  3LP2 A;  4HAC A;  4KE5 A;  4OLO A;  2DNK A;  2RS2 A;  4TQR A;  2OHD A;  1VQS A;  1SQE A;  3MD1 A;  3BH6 B;  4KGX B;  4DR4 J;  3Q8P B;  3M8W A;  1ZET A;  4W4M A;  4ILL A;  2HHX A;  3TZW A;  4RUH A;  1WHV A;  3BZQ A;  2FHO B;  2FPH X;  3EXY A;  1RA7 A;  4I6W A;  3PNI A;  1TEL A;  3AOD A;  5CD4 A;  3Q8V A;  2QFJ A;  4MKV A;  5B0G A;  2GMH A;  4IQX A;  1FRK A;  3TZX A;  5T14 A;  1JLQ B;  5F8M A;  1B0P A;  2QE5 A;  2OI2 A;  1HNV A;  4ZVF A;  3S01 A;  5B08 A;  4LFA F;  1U47 A;  4KFB B;  4F4X A;  1OSD A;  1S0O A;  3AJD A;  3G82 B;  2RQC A;  3IP0 A;  4Y6I A;  2V6A A;  1T9X A;  1RAI B;  1W2B R;  1VQ4 S;  2V68 A;  4PAB A;  1UA0 A;  3W5Y A;  4YUD A;  1G7C B;  2BE2 B;  5EDW A;  2ZVI A;  4WXO A;  2Z8Q A;  4F4Z A;  5JVH Q;  4W92 B;  1UAW A;  2L48 A;  5L9N A;  4QWA A;  4OYW A;  4K4W A;  2ZH5 A;  3PO5 A;  5HQL A;  2DEJ A;  2J76 E;  1ZAW A;  2B5J B;  2XUL A;  1S12 A;  3JSY A;  3GFH A;  5KFR A;  2XBP A;  4GVL A;  3QIP B;  3T5L A;  2DB1 A;  4HKQ A;  4QR1 A;  1RI7 A;  1ZM4 A;  4JI4 F;  3EDR B;  2BX6 A;  2VF3 A;  1VI7 A;  3ZTP A;  1X7V A;  2NSB A;  1FRI A;  3R1L A;  4PWU A;  1LKZ A;  1LNQ A;  1FKO B;  3THP A;  4B08 A;  3UQS A;  9ATC B;  1CEZ A;  2ASY A;  2F4V F;  3GJS B;  2YNI B;  4RWW A;  5GMD A;  1SIZ A;  4DPT A;  2LEC A;  1LQ9 A;  2EFQ A;  2IM0 A;  3RW7 A;  3DLG B;  3SCI E;  2QRR A;  4LRD A;  1FDD A;  2OTL S;  3CDB A;  2XTJ P;  3OXF A;  3HJV A;  2H65 B;  1JNZ B;  2L9D A;  3AXK A;  1UWB A;  5C2G A;  2DRD A;  2HFO A;  2ZHA A;  2HIQ A;  1RU1 A;  1SV5 A;  5ETP A;  2KFZ A;  2FQQ B;  3BEG B;  1RTH A;  1TKX A;  4GVB A;  2W24 A;  1SIW B;  2Z2Z A;  2D41 A;  3KLI A;  4WFY A;  2AJ1 A;  5T7L B;  3AXM A;  2W9C A;  3S1T A;  4J9Q A;  5HO4 A;  3BDP A;  3UVJ A;  3MAA B;  1N5S A;  1FRJ A;  1XR7 A;  5D4L A;  2J6T A;  1RT1 A;  2CPZ A;  3JQK A;  1VLY A;  2ILZ A;  2R42 A;  1T3O A;  2X51 A;  4E98 A;  1NO8 A;  5KFU A;  3ENV A;  3QGP A;  2LLZ A;  4TU9 A;  3A3O B;  2P9E A;  2BE9 B;  3M30 B;  1RZM A;  3W9J A;  5LMU F;  3BSO A;  3UI3 A;  3LPE A;  2MZ1 A;  4K8R A;  4IH5 A;  3ICL A;  4NLR A;  1JLA B;  1NU4 A;  1RSC A;  1W2I A;  4DG1 A;  2RKI A;  3M8Z A;  4RW7 A;  2KN4 A;  3R9L A;  5ITH A;  2D3O 1;  1SL0 A;  2DHH A;  2ROE A;  3HSD A;  3KDO A;  2ZH1 A;  3DNC A;  1HD1 A;  1RT7 A;  4BCA A;  2VOP A;  1N32 J;  2HGN A;  2C2M B;  3RG6 A;  2HBZ B;  4FVC A;  1MMD A;  2Y1L B;  2IMW P;  2IA0 A;  3BGU A;  3CCL S;  1GMW D;  4IYQ A;  1KQK A;  1HBU B;  2M8H A;  3IBW A;  1Y4Z B;  4MJK A;  2BV3 A;  2FZK B;  2PA3 A;  4JB8 B;  4QU6 A;  3SI8 A;  2ZVS A;  2YKN A;  3M32 B;  2R7V A;  3AD7 C;  4C3K A;  2CVE A;  3ITH B;  3G82 A;  1EP4 B;  1RT3 A;  4PR6 A;  2VIH A;  2DD8 S;  1AUD A;  1KP6 A;  2FD2 A;  2OPQ B;  2KM8 B;  2O3D A;  4R8U B;  2DTJ A;  5D6G A;  4DQS A;  1J5E J;  1S1U A;  2RF2 B;  4ANE A;  2C3O A;  2OEL A;  3LAN A;  3VWS A;  2ZH8 A;  1BWE A;  5HJY A;  2YNG A;  5J2M A;  2P2C B;  4EUV A;  1NHK L;  1U09 A;  4WP3 A;  1YSJ A;  3HKZ D;  3OFG A;  3RR8 A;  2FLL A;  1MG7 A;  1YJ7 A;  2QFI A;  4YHH J;  4M5K A;  2J8A A;  1U4B A;  3VHQ A;  4WFB Q;  2V5H G;  2W01 A;  3BH7 B;  1OQ3 A;  1IBC B;  2YKP A;  3M8Q A;  1CPZ A;  1JLE B;  3HVW A;  4V19 J;  4RWX A;  5HLF B;  2ZEJ A;  1R43 A;  4AXJ A;  4WU3 A;  4CH7 A;  1VRQ C;  2JZ5 A;  4WU2 A;  5BR8 F;  3UCZ P;  3TAP A;  1X8D A;  3H8Y A;  2J7U A;  4CLY A;  5K9F A;  3H2L A;  1YJW S;  4P10 A;  4USJ C;  3CPW R;  3MEC A;  1SQG A;  2HHQ A;  4ZPB A;  4TY8 A;  2XMU A;  3MPU B;  1UVI A;  4OQJ A;  1VRU A;  3FBC A;  4PG5 A;  3J7A 1;  3KK3 A;  2KH9 A;  1AFI A;  2VG7 A;  1T8E A;  3PAC A;  2HFU A;  3OL8 A;  1FJ7 A;  1S9E B;  3FEZ A;  5EHH A;  2JDJ A;  2F4F A;  4CH1 A;  1G1X A;  5EX3 A;  1CS4 A;  3MEG A;  2CYY A;  5IQQ A;  2GVZ B;  4ES2 A;  1FVS A;  2OTJ S;  2DGV A;  3W2W A;  3R2D J;  3FBF A;  5CQG A;  3EGN A;  2XGQ A;  5DLF A;  3MAH A;  4Y34 A;  2XMJ A;  3R7S B;  2EXU A;  1FA0 A;  4IFY B;  4YHH F;  1HI1 A;  1XBW A;  3BGF A;  2O5D A;  1DJ0 A;  4ECR A;  1RXO B;  2W2M P;  4H4O A;  4ANC A;  3MMC A;  3RB6 A;  1ULR A;  4DUY J;  4B3T F;  1KKH A;  5CYM B;  2GHP A;  1SC4 B;  3MEE A;  4Q2L A;  4I2Q A;  1FES A;  1SXL A;  1CVJ A;  4J9L A;  4P7V A;  3Q0A A;  3P5B P;  4ES3 A;  3GV5 B;  2HHS A;  1RHJ B;  4ZN1 A;  1DTT A;  1UVN A;  3AAW B;  1QTN B;  1WDT A;  4N7T A;  1M5O C;  1UVM A;  2C22 A;  4O23 A;  5IT9 Y;  2AZ3 A;  3MCO A;  2BW2 A;  2I6W A;  4JP8 A;  4TY9 A;  4J90 A;  2UP1 A;  3K5M A;  1FFW B;  3DRR B;  3RRG A;  4NXN J;  1PG5 B;  2OJ3 A;  4KHP J;  1TUV A;  2HHH F;  3BDE A;  2M52 A;  1U6F A;  4NPO A;  4DQQ A;  4PCQ A;  2CJQ A;  3SCL E;  5DRK A;  1Q16 B;  2WAQ D;  2Z57 B;  4FBU A;  2B5J A;  2RUS A;  3PO4 A;  4M1K A;  2MKY A;  5D4N A;  4ED7 A;  1CLF A;  3V2U C;  4X62 J;  2HAF A;  3OQ2 A;  3FEY B;  3MFI A;  1PYO B;  1SJ3 P;  2CQ0 A;  3BYP A;  3HFK A;  1P1L A;  3QJL A;  3EGZ A;  1PJ5 A;  4QYZ K;  2FB0 A;  1T9V A;  3NKY A;  2FDN A;  4WZQ A;  1SUQ A;  1XER A;  3DC2 A;  3QO9 B;  3J7Y U;  3QAU A;  4DR3 F;  4LF2 A;  2JEJ A;  3PW7 A;  4I7F B;  2CVI A;  1BE4 A;  4F3O A;  3FRZ A;  1N56 A;  3EYZ A;  1FFS B;  4OJ3 A;  4F4Y A;  3I5A A;  4PG6 A;  3JYT B;  2DIU A;  1O6X A;  1NJI T;  3MD3 A;  1S1T B;  1T9T A;  1X0P A;  2HKE A;  3W8G A;  3AB4 B;  2NXC A;  1U1M A;  2BJ3 A;  4EBC A;  1OPZ A;  2OPS A;  3G8Q A;  3QPI A;  1FDN A;  4ZVP B;  3VGT A;  3WZ0 A;  5HL7 Q;  3OLB A;  2J6U A;  4B9U A;  2CQ4 A;  1GH8 A;  1RTD B;  3RAM A;  1CC7 A;  1PKU A;  3K59 A;  3L4B C;  3P4U B;  3S6E A;  3TR5 A;  1N34 F;  1JLG A;  2FC8 A;  3VAG A;  3KLH B;  1WSR A;  4RUA A;  2PE8 A;  2Z4P A;  1HBN A;  1VRU B;  2AKW B;  4A8M P;  1F3F A;  1WC0 A;  3DOM B;  4U7U K;  2XLJ A;  3ET6 A;  1HR0 J;  2GQQ A;  2J0S D;  3MM6 A;  4FXV A;  4QPT A;  2V9K A;  3JXO A;  3D1O A;  1U1Q A;  2UU9 J;  3KHR A;  2NXU A;  3JS9 A;  4IUF A;  3E8O A;  5GAE U;  2AV5 A;  3GG0 A;  1X5O A;  1GMW A;  3MED A;  1TL3 B;  4QOT A;  3T1Y J;  1NKC A;  1YBU A;  4V19 X;  1RYR A;  1U8S A;  3T41 A;  2X3G A;  4JV5 J;  2HS0 A;  4TYA A;  4ZCK A;  4ZP9 A;  1WEX A;  4QW8 A;  1NHV A;  3VAM A;  4E0D A;  2MQP A;  5DZ7 A;  1RAO A;  4HT7 A;  4YB5 A;  5E33 A;  1HBN B;  2B4V A;  4P52 A;  1L3S A;  3SIP B;  1HA1 A;  2CQ1 A;  3TX0 A;  4AFF A;  5L1I A;  3J81 j;  4KSE B;  3PJX A;  2KYZ A;  1CSJ A;  2A1B A;  2OD6 A;  2IAJ B;  3M05 A;  2AZ1 A;  2HBQ B;  2QMW A;  4ZVT B;  3RYL A;  4IO9 Q;  1FF2 A;  1H73 A;  2H5J B;  5D4P A;  2KFN A;  2BKO A;  3M8Q B;  3GII A;  2D9P A;  2QL5 B;  3BBC A;  5ETV A;  1VJW A;  3G71 S;  3NGU A;  3I0R B;  4K59 A;  5LSL A;  2FY1 A;  3EE3 A;  2JSX A;  5M2P A;  3SV4 A;  3D0I E;  5IV3 A;  2V8D A;  3CJQ A;  3E51 A;  1TAU A;  3H2U B;  3X3U A;  4JOU A;  5B0A A;  2E5I A;  4ATN A;  1IWA A;  5JMN A;  5DM6 Q;  3IXQ A;  1RJJ A;  4DF4 A;  1AZS A;  2CQP A;  2XO6 A;  5C25 A;  1ZPW X;  2VPW B;  1IBK J;  4EFA C;  4F0K A;  4FPR A;  1RT4 A;  2J9D E;  3IO1 A;  2Z58 B;  3CD5 A;  4ED8 A;  3D6F B;  2CZ9 A;  1S4E A;  5T41 A;  3VGS A;  3M1V B;  7AT1 B;  3IA0 A;  1KHV A;  4OHX A;  4C3M A;  2Z2L A;  4DUY F;  1QJH A;  2ZWO A;  5EN1 A;  1TQL A;  1WC1 A;  3HVA A;  2DNO A;  4DSJ A;  3TJ9 A;  2XS7 A;  2FLN A;  4NLD A;  2IY5 B;  3KK1 A;  4F2R A;  1Y10 A;  2C3P A;  2MMY A;  5KT3 A;  1PGZ A;  4GKJ F;  3EVO A;  1U26 A;  2AEF A;  3PHE A;  4CNY A;  1LWC A;  2MKK A;  3CCU S;  2ATL A;  2W8K A;  1YTY A;  2LXF A;  3V81 B;  1DY3 A;  5ADZ A;  3VCD A;  1NJW A;  2KFY A;  4AD6 A;  3FC9 A;  3BSN A;  3PY8 A;  2GC8 A;  4X84 A;  2XMW A;  5HBM A;  1WKL A;  2V4J B;  2VV5 A;  1IUJ A;  3CB4 A;  3WX4 A;  4DS5 A;  3RAX A;  3TW0 A;  5KFV A;  2B8Q A;  2OPP B;  1B7Y B;  2JWN A;  2KT2 A;  5KAK A;  4DF8 A;  1R0A B;  1M90 T;  2JEI A;  4U67 Q;  3PRB A;  2VG5 B;  3EVM A;  3NCP A;  5GAH I;  3EPI A;  3X1L B;  2BJ1 A;  2IRX A;  2BM1 A;  3CCT A;  3OUY B;  1FRM A;  1SUQ B;  1W25 A;  3TYT A;  3NS6 A;  2M88 A;  4BHQ A;  1NRK A;  1S1W A;  3GQC A;  4DV5 J;  2DGW A;  3V6K A;  2XS2 A;  3CCM S;  3HK2 A;  2MZR A;  4MFB B;  5G4D A;  4Y2I A;  1G4C A;  4I69 A;  5A8W B;  4ZVS B;  1YIT S;  3FKB A;  2BRL A;  1MSW D;  2WW8 A;  1CQM A;  2PGC A;  1TZ0 A;  4U7C A;  2HHW A;  4RW8 B;  1S0M A;  4DR6 J;  1D8Y A;  1KEK A;  2MQM A;  1R0A A;  4WFA Q;  2HFV A;  2AP6 A;  3F0N A;  3QWP A;  5E41 A;  1DRZ A;  4OX9 J;  2OPP A;  1CS4 B;  2IFX A;  4N56 A;  2UU9 F;  4J7C A;  3G4S S;  1J5E F;  3PDN A;  2VJV A;  3I56 S;  2CZV C;  1SC1 B;  1HNV B;  2V94 A;  3DU6 A;  1RAG B;  4ED3 A;  4G3I A;  3BR8 A;  2FJE B;  4JYA F;  3QLH A;  3B6B A;  2O67 A;  2XSF A;  4LSN B;  5G0R B;  1YJV A;  2AJF E;  1ACM B;  3LAK A;  3I82 A;  2Q1L A;  5KFM A;  1AW0 A;  3DGP B;  4N8N A;  4X4S A;  3QFH A;  2LU1 A;  4FXD A;  3UR0 A;  5KG7 A;  2E5J A;  1SVD A;  4DV3 F;  1LW0 A;  4NLV A;  2CG8 A;  2P5V A;  4XPC A;  4JI7 F;  2Y1I A;  1ITP A;  4KO0 A;  1RB0 A;  5EUH A;  2EK6 A;  3MTK A;  5KFB A;  1DQ9 A;  2H4W B;  1E6V B;  5EWF A;  3M9N B;  2QYC A;  2KXF A;  2IVM A;  2W2N P;  3CO9 A;  2WSE C;  3C16 B;  3QID A;  2ZH9 A;  3AHP A;  1U8W A;  2HNY B;  2KDO A;  3GR0 A;  4LF1 A;  2CWX A;  4RNF A;  1H6K X;  2CNO B;  3GPA A;  2FVR A;  3KK3 B;  3KLE B;  4IDK B;  3KFW X;  5LMU J;  1P9Q C;  3FRY A;  3QBC A;  2RDJ A;  3H7H B;  1RHK B;  2WHO A;  5KG3 A;  5FLX Y;  2AU0 A;  2XYH B;  3HM9 A;  1GQE A;  3THV A;  2OML A;  4JI1 J;  1M1K T;  5I3P A;  1TL3 A;  3ULH A;  2EKN A;  4EYI B;  2V4R A;  2HUR A;  1TMM A;  5CH7 B;  1URR A;  3OFH A;  4F36 A;  2PI5 A;  3JSM A;  1YJR A;  4K4V A;  1OJ4 A;  2UUB J;  4X62 F;  4DHV A;  3DI6 B;  3D3C J;  2NR0 A;  1A0O B;  3IAS 9;  4LFA J;  4A47 A;  2ZBC A;  4QIE A;  4J9R A;  5HP1 A;  3R5D A;  4KKO A;  3ILJ A;  3EZO A;  5HJX A;  1HWK A;  4WK3 A;  4Y2K A;  3BO4 A;  3FMW A;  4GC7 A;  4QU7 A;  2B6A A;  4QIW D;  4ZKA A;  3KJF B;  5GAE I;  4NAS A;  4PAA A;  3A13 A;  1PAE X;  2WOM A;  3HJF A;  2XSJ A;  2KVI A;  4IH6 A;  2CRL A;  4QR0 A;  4E8U A;  3EPG A;  4LSL B;  3NNA A;  2QA4 S;  2CPD A;  3SDE A;  4DL5 A;  4DPW A;  1FNM A;  3WDO A;  3M32 A;  2G1H A;  1NH7 A;  1JLC A;  3DRS B;  2VZ9 A;  2HHT A;  4DR6 F;  2IRU A;  3R27 A;  1VYA A;  3QRQ A;  4DX5 A;  3NS7 B;  4KBI A;  4UTG A;  3TWZ A;  5L1L A;  4ED1 A;  3W5X A;  4Z37 A;  2A10 A;  2P6T A;  2XMT A;  1YX2 A;  5J2N A;  2YNF B;  5CAA A;  1RUS A;  4DS4 A;  1GEH A;  4B9N A;  3MM6 B;  2LQ9 A;  1JXE A;  4K4Y A;  1H7W A;  1QDU B;  5DZ6 A;  2C28 A;  1UP1 A;  2I38 A;  2WB4 A;  1REG X;  4FPI A;  5CZX A;  1V3S A;  3DDK A;  3AT1 B;  4P2M A;  3OVB A;  1WG1 A;  4OJG A;  1XTZ A;  2B9W A;  1EET A;  1F0X A;  2QL9 B;  3GP9 A;  4DV2 J;  1H38 A;  2IC3 B;  3DXB A;  5J1P A;  1HBM A;  1HMV A;  1NK8 A;  3ZC4 A;  2YX7 A;  3I32 A;  1NEE A;  2PEH A;  1V9O A;  1FX2 A;  3LTO A;  3M6V A;  2Y1R I;  1WHW A;  2E66 A;  3CE8 A;  3H90 A;  3QT7 A;  3TVK A;  3A8E A;  4X66 F;  2BZ2 A;  3FSX A;  2EWH A;  2LEA A;  2Y3Y A;  4B9V A;  1ZZF A;  5A8W A;  1QUP A;  2YWH A;  1TKZ B;  3TEH B;  4ZIW A;  5IWA F;  1RHR B;  4H54 A;  5FLX U;  3PW5 A;  1CC8 A;  4UOF A;  3TAN A;  3SCK E;  4CLW A;  5F41 A;  2XMK A;  4O3R A;  3QZ8 A;  3AH6 A;  2XMA A;  3TA2 A;  4KV8 A;  3QT5 A;  2QA4 G;  1EAY C;  3HFV A;  2A6M A;  4C7Q A;  5KFW A;  4TN2 A;  3GB0 A;  1SPB P;  3HHK A;  4NYP A;  3CJK B;  4UY8 5;  2R2U A;  4GKJ J;  1UA1 A;  1LW2 B;  3H25 A;  5KFH A;  2EG2 A;  3VGU A;  5GMK a;  4H4O B;  3P45 B;  3CCQ S;  2JC0 A;  1F9E B;  4G1P A;  4C97 A;  1SL1 A;  5BXI A;  3MAQ A;  4DSL A;  2J5A A;  2MQO A;  3TVZ A;  3OSN A;  2ZWP A;  4ILR A;  1SQF A;  1VMB A;  4BS2 A;  1M5V C;  2UXC J;  3O5T B;  2I0X A;  4M5D B;  1RLD A;  5KG5 A;  2AWZ A;  3BRE A;  4YDD B;  3KJN B;  1HWJ A;  2CQC A;  3VAL A;  4K4X A;  3S7R A;  5L39 A;  1MWZ A;  2DCU B;  5ETL A;  2BQR A;  3EXC X;  4MIB A;  1G3O A;  3LP0 A;  2VOD A;  4LF9 F;  1QUV A;  4I68 A;  3OUY A;  1H74 A;  1T95 A;  2PFD A;  3NBP B;  1VFJ A;  1FKO A;  1RHU B;  1H2U X;  2HQC A;  3N79 A;  4DZD A;  4CWB A;  4XK8 C;  1M1H A;  3VAJ A;  1Q8B A;  3GJQ B;  4JI3 F;  4FF1 A;  2KB2 A;  3OPK A;  2DY9 A;  2DNR A;  1C1B B;  5HQ8 A;  3MDF A;  3RBD A;  3NOG A;  4PKD B;  5KFT A;  2XY7 A;  2ZC3 A;  3FMB A;  4I0W A;  1Q7Y T;  3J7Z T;  1T9Y A;  1BQX A;  2GQ2 A;  3AD8 C;  4UQT A;  4I56 A;  6FD1 A;  3WIU A;  2ZHB A;  1MN9 A;  2KI2 A;  4JI6 J;  1S48 A;  1U0S A;  1JKH A;  3G86 A;  3BR9 A;  1FRL A;  4LT6 A;  4JI5 J;  3LP0 B;  1JB0 C;  2FTR A;  1K1Q A;  4DR4 F;  3C8Y A;  1ARO P;  2KU7 A;  3GFX A;  5JUM A;  2VDI A;  4MKA A;  1KON A;  1YGY A;  4ITS A;  4YB6 A;  2OLW A;  3W5Z A;  4CYU A;  3W3S A;  1FEH A;  3HHL B;  2XB2 D;  5AE1 A;  4ED0 A;  1BQM A;  4IOA Q;  1HNW J;  4OHW A;  2NZC A;  3LAM A;  3SQG B;  1NZ8 A;  2VPY B;  1GTH A;  2WVC A;  3CJ3 A;  3SEO A;  1VIO A;  4AXI A;  3IN5 A;  1K1S A;  2PD1 A;  1M5S A;  1ZAV A;  3EUN A;  3G2X A;  3RZA A;  4M63 A;  3I96 A;  5KT4 A;  2YQ0 A;  2R2R A;  5F9L A;  4I2P A;  2GZO A;  4L74 A;  3SXL A;  1GXT A;  1LWE A;  3KG4 A;  4J9O A;  2J6S A;  1XWL A;  3NY0 A;  2VC0 A;  4DMZ A;  1V5I B;  3LP1 A;  5LJ3 Y;  5U47 A;  2KZZ A;  1KR4 A;  1N88 A;  2RVJ A;  4R0E A;  2IVY A;  5CCL A;  1RHQ B;  3DN9 A;  4KQZ A;  4K50 A;  2ZJR Q;  3MMB A;  2DNL A;  3A8I A;  2BOP A;  2DRB A;  1FXL A;  2HVH A;  5D8H B;  1ZM3 A;  3FFI A;  2B9E A;  2RRB A;  1IKX B;  2QA1 A;  2QIF A;  2FJX A;  4X65 J;  1RIS A;  1NPP A;  2FJW A;  4B3O B;  3MUR P;  1U0H B;  2DNH A;  1Q7L B;  2IJF A;  2KHC A;  2WZ1 A;  1N6Q A;  1SL2 A;  2MPU A;  4USI A;  1RWK B;  5GAD I;  2XLI A;  4UUW A;  2HWI A;  2L3M A;  2QMU B;  1ZYQ A;  4LVO P;  1AUS L;  1R8A A;  3K7R A;  5ETR A;  2XM3 A;  3MOJ B;  4USU A;  4CZC A;  4PQA A;  4W98 A;  5KG4 A;  1EET B;  2L41 A;  5HRO A;  3PJ9 A;  3DU5 A;  5L1J A;  3CO0 P;  3JTO A;  1U1L A;  4C0B A;  1HNZ F;  2PEB A;  3ITH A;  1JJ2 R;  4MK9 A;  3A1Y G;  3AB2 B;  3ZO7 A;  4LF8 J;  3I5C A;  4F8R A;  3JQJ A;  1M5K C;  1R31 A;  1S6Q B;  2AF6 A;  2VL1 A;  3K5L A;  3CUN A;  4J9S A;  1UVK A;  1X4A A;  3GLJ A;  3KLE A;  4KB7 A;  5BYQ A;  4DV3 J;  4OJ1 A;  2A2C A;  2N4D A;  3O6Q A;  2OMO A;  3A3N B;  3L7U A;  1UFL A;  1VDH A;  3KMS A;  3MUV P;  3V6D B;  4RNH A;  1OIA A;  2HK3 A;  3WBZ A;  3ZFV A;  2WVB A;  1CJT B;  2V2Z A;  1DAR A;  4CQ1 A;  4KGM A;  2XCA A;  4LUB A;  4JV2 A;  2HNZ A;  2XNR A;  4LJM A;  1PSD A;  1D9F A;  1HNX F;  3N6M A;  3PIP Q;  4DSK A;  3NBP A;  1U48 A;  3MGJ A;  3DM2 A;  3UNG C;  2OP5 A;  5DS7 A;  1VQK S;  1SB6 A;  2HQD A;  1I1G A;  3F56 A;  2NXE A;  2NPF A;  4PQU A;  3JQM A;  2D3O R;  2MZS A;  1CJV B;  5GAG I;  1FXD A;  3NMR A;  1AXQ A;  2HVD A;  2RSQ A;  2YX4 A;  2C2N A;  4LSN A;  5G0R A;  1XEZ A;  2AX1 A;  1RA6 A;  5CYQ B;  4OX9 F;  2VFT A;  1Y3K A;  3AQO A;  3H40 A;  4DR2 F;  2MB0 B;  1A6L A;  2RQ4 A;  4CP5 A;  5KFK A;  4J91 A;  3JTN A;  1QM9 A;  2JLE A;  3TUI C;  4DPX A;  4NXM J;  3LW5 C;  1TK5 A;  1OSC A;  2AYG A;  3CD7 A;  3V4I B;  1R8H A;  2POK A;  3D2W A;  4A8Y A;  4AL6 A;  4QBU A;  4IG3 B;  4ED5 A;  2CPH A;  3HHN B;  2RDI A;  3GFZ A;  2YH0 A;  5CYJ A;  4YR2 A;  4Y2M A;  3EMT A;  2HND B;  2XWY A;  4HVZ A;  5D0E A;  5B0E A;  1H3D A;  3WX8 A;  3KLV A;  1X5P A;  2HHV A;  4RR5 A;  1LWF B;  4ID8 A;  2MYF A;  1B0V A;  3ZZU A;  5KFZ A;  4OYA A;  4WTY A;  4QW9 A;  1C0T A;  4DI6 A;  3KHH A;  2B43 A;  1XMO J;  3QSI A;  5KFL A;  2LCW A;  2DIS A;  1R6Y A;  3I0S A;  4F0M A;  2L9W A;  2KM8 C;  2WW4 A;  3GIL A;  2G0C A;  2IYG A;  4L73 A;  1LWX A;  3GSI A;  3T1A A;  4TQS A;  4DR1 J;  5HI7 A;  5I3Q A;  1KQF B;  2OFH X;  1HAR A;  2CWK A;  3NCR A;  1A7G E;  4OYB A;  5IC4 B;  1MML A;  2BAC A;  4ZLP A;  4JI5 F;  2AJ0 A;  3AD9 C;  4N5S A;  4FF4 A;  2W1B A;  1SCJ B;  2VG7 B;  2B7C B;  2EFV A;  3DLE A;  5D15 A;  2ASJ A;  3CCJ S;  4WK1 A;  4P74 A;  1NSK L;  3J81 U;  1S72 S;  2HVI A;  1JLF B;  2GJ2 A;  3ISN C;  2ZM6 J;  1R7I A;  3ILI A;  5LSR A;  1VBY A;  4KGV B;  2K8G A;  2WRM A;  5HBM B;  3QGI A;  2RHQ B;  4OFZ A;  3D9B A;  3T3F A;  2AGP A;  1LK7 A;  3C46 A;  3P8B B;  1TAQ A;  2CPJ A;  1UZD A;  2DXE A;  2IBO A;  1QD1 A;  2JFD A;  2V2Q A;  3C6T B;  2E29 A;  3KK2 A;  2X1F A;  2CJY B;  2AYM A;  1RK8 A;  2R8H A;  1X9S A;  4EZ6 A;  3DRS A;  1Y5N B;  2QLF B;  3MEK A;  5GAD U;  2PC6 A;  1VGY A;  4DUZ J;  2V34 A;  1M0S A;  4USH A;  2V0N A;  1F5A A;  3GV8 B;  4DV4 F;  2C2E A;  4IO1 A;  4D3H A;  1S97 A;  2R8I A;  1VC0 A;  3M8R A;  4ZIT A;  1RT2 B;  2NXJ A;  3NP5 A;  3HHL C;  2ACM A;  4MK7 A;  5DG8 A;  1Z2Z A;  5DJB A;  3RB4 A;  4LF4 J;  3L9Z A;  4RW9 A;  2DNM A;  2HK2 A;  2OPR B;  3OXG A;  3M2R B;  4K2X A;  4NLY A;  2W9B B;  4EBE A;  5A8R B;  2QL7 B;  1XJW B;  4JI1 F;  3GIM A;  1ZZN A;  2GIQ A;  4WFN Q;  1H98 A;  4KYZ A;  5BYR A;  3D1Q A;  2EFO A;  2GA7 A;  3M7V A;  2QV6 A;  2XC9 A;  2VJU A;  3MM8 B;  1AFJ A;  1D3W A;  5KG1 A;  3J80 Y;  2FJA B;  3SQG A;  2RML A;  5KFP A;  2V63 A;  3T1Y F;  1YK9 A;  4ZJO A;  4A8F A;  4DFJ A;  1NXI A;  4LF6 J;  2CXE A;  3RBE A;  3IWL A;  1O0P A;  3D0H E;  4L6V 3;  2QA2 A;  1PCA A;  3E3X A;  3GG1 A;  3QWU A;  3H5S A;  4ZVQ B;  3G6V A;  2HGL A;  4CCH A;  1L3T A;  4DQP A;  1FTC A;  2KRR A;  2QLX A;  1YRU A;  3GMG A;  3MMA A;  2VD3 A;  4M5J A;  1DTQ B;  3A12 A;  2BAN B;  4OX7 A;  4PEO A;  1H2V Z;  1MN7 A;  2VBY A;  1S5Z A;  4XPE A;  4KV8 B;  1FVQ A;  2QYG A;  1W26 A;  2OKQ A;  4N8O A;  3THT A;  3IM8 A;  2CIM A;  4MT1 A;  1RWO B;  2VQF J;  4UZC A;  4DR3 J;  3IC1 A;  5JVG Q;  2UXB J;  4WFZ A;  2DNG A;  2HG4 A;  4HHH A;  4A46 A;  1Q95 G;  1Y5L B;  5D0H A;  3I6P A;  1N0U A;  3HSJ A;  1R0C B;  3MEC B;  2BAB A;  5K14 A;  1IKX A;  1J2V A;  4HAC B;  1S1T A;  1SJ1 A;  3QJJ A;  1T02 A;  1FKP A;  1U1K A;  3PYD A;  2DO4 A;  4BWJ A;  4B3T J;  3MZI A;  4KHM A;  1VC5 A;  4X4O A;  1EAR A;  5KFS A;  1L3K A;  4NZ7 A;  2M2B A;  5FDL A;  3HVR A;  4CM2 A;  3T1H J;  2BAN A;  3H0P A;  1ZH5 A;  3FSY A;  3DFE A;  2KVQ E;  2R8G A;  4GVB B;  4Q2M A;  4USK A;  5I42 A;  4O4R A;  2LXI A;  1IKV A;  4LRE A;  2Q6B A;  2HFN A;  2KZM A;  1SC3 B;  4URS A;  3OR1 B;  1T03 A;  3C66 A;  1VJQ A;  2DBB A;  1X31 C;  1YWX A;  2LU2 A;  3FFI B;  1BQN B;  2ACY A;  3IWX A;  3LH2 S;  1VRT B;  4KAI A;  5H1S V;  5GAH U;  1NJX A;  1Q8L A;  3HSZ A;  3KKF A;  3HVT B;  3NS5 A;  4DSI A;  2DH9 A;  1O8B A;  2PMZ D;  2MGZ A;  3V4M A;  3M30 A;  1S9G B;  1BY9 A;  5A76 A;  5HAO A;  1E6Y B;  4NLG A;  3SZ2 A;  4UZB A;  2C3M A;  2FIU A;  1WEY A;  1M5H A;  4Q0B B;  3NGR A;  1QAY A;  4GRS A;  1RTJ B;  1WC6 A;  2KO1 A;  4QWB A;  3PRV A;  3M9O B;  2A3J A;  4EBD A;  3VQT A;  1FJG J;  2QC3 A;  1K0T A;  5KFY A;  3UDL A;  3HPO A;  1C1C A;  4P2S A;  2MJN A;  4NLS A;  2ILY A;  5KFA A;  3LGN A;  2CPI A;  2HHP A;  3MR7 A;  4CO5 A;  3HVT A;  3I55 S;  3R8Y A;  2ZH6 A;  5M2U A;  2VHG A;  1S9F A;  1D09 B;  4WP8 A;  4RO0 A;  3J7Z 5;  2W9C B;  4OYZ A;  5IM0 A;  1TKZ A;  2QG9 B;  2G2O A;  3CDU A;  2UUT A;  3TAM B;  4DQI A;  2XWX A;  2DR5 A;  1MMN A;  3TJA A;  1CJK A;  1SKS A;  2XYP B;  3EZU A;  1H72 C;  2OUG A;  5SZT A;  3F41 A;  3PYF A;  1WOS A;  3L7O A;  3NNC A;  4W90 B;  1UFK A;  2FVC A;  1NZA A;  3FUY A;  4YOE A;  1TTH B;  2BQU A;  3KLI B;  5HQM A;  2GJF A;  5F9N A;  1IBL J;  3ZZY A;  8RUC A;  2UZA A;  2PA8 D;  3QSY B;  1S1W B;  3PZP A;  2RDD A;  1IBK F;  4K7Q A;  4B3M J;  3FCV A;  1U45 A;  4IQM A;  5CYM A;  5IM0 B;  1VCT A;  4C3L A;  3KJV B;  1B64 A;  3ZZO A;  1FNX H;  3HT3 A;  3CVK A;  1KFS A;  1GMV A;  4ECT A;  3NAI A;  4PYD A;  1DTT B;  1HFE L;  3CIM A;  4PG4 A;  1MRO B;  1OS5 A;  3P49 B;  2HZC A;  1QY7 A;  2GIF A;  5KTQ A;  2F5G A;  3VAI A;  3NG8 A;  3DMJ A;  1H0H B;  1NUE A;  4M5L A;  3FCW A;  2DHS A;  1WKK A;  3Q89 A;  3Q8U A;  5F8H A;  3Q24 A;  4XDC A;  1L5U A;  1EKS A;  1KTV A;  4IOC Q;  1WC3 A;  1GFW B;  3BV8 A;  3ZZT A;  3LGM A;  2ZM6 F;  2LFV A;  2C3U A;  2MKJ A;  3I9Z A;  1KQG B;  5ETS A;  2AHO B;  3W60 A;  2GVD A;  5MLC V;  2BJ7 A;  1JXL A;  3ILO A;  5DQI A;  3N01 A;  1RTI B;  3CCS S;  4LIW A;  5FD1 A;  4YFU A;  3TX8 A;  4DSF A;  1IR0 A;  4DL6 A;  3ADA C;  4PXC A;  1U1R A;  4BC7 A;  3RBX A;  3ENQ A;  2F3J A;  2DNQ A;  1YDL A;  2AYE A;  5KOW A;  2MQ8 A;  2B8P A;  5L38 A;  5E2Q A;  2GFF A;  5DQG A;  2Q6C A;  5K5M A;  2WVE A;  2AGO A;  2FJD B;  3CT9 A;  4NEZ A;  1P6T A;  4QJV A;  1VIS A;  2COL A;  3BGO P;  3D6M B;  5IFM A;  2O01 C;  2E7W A;  1K9M T;  2MSS A;  5E3P A;  3KNA A;  1RAC B;  2V67 A;  1TL1 B;  1MLA A;  4KFB A;  1EB0 A;  1REV B;  4YEA A;  4EO6 A;  1ZAX A;  3HZG A;  3U1M A;  4A48 A;  2O66 A;  3PYG A;  3GJT B;  1B7F A;  2BJ9 A;  4ZP6 A;  1XN9 A;  2KXN B;  5J2M B;  2HQI A;  1YJT A;  4XTT A;  2BUN A;  2PT0 A;  4M5N A;  1NSP A;  5LXR A;  2HZA A;  1T0T V;  1FKP B;  4IFV B;  1JLB B;  4ZLJ A;  3EX7 B;  1NLK L;  1DTQ A;  3OTB A;  4NLX A;  4R25 A;  3R5G A;  5KFJ A;  4DV1 F;  3MM7 B;  2VIC A;  2ZD1 B;  4EEY A;  4OYI A;  4HTJ A;  3CNQ P;  3BJY A;  2EFN A;  1RAJ A;  5E3Q A;  4LFC J;  2F4V J;  2MDA A;  1S7I A;  2HWH A;  4CTA B;  5C5J A;  3AQP A;  4KR0 B;  7FDR A;  4A8O A;  5EGY A;  4DR2 J;  2B0G A;  1FRX A;  2DNP A;  4FNH A;  4Q5V A;  4B17 A;  2YY3 A;  3FZ2 A;  1FX4 A;  1X4D A;  2JX2 A;  3Q2S C;  3R5J B;  1RTZ A;  4UW2 A;  5KFI A;  4PWD B;  2NYI A;  4RPF A;  1DQA A;  3IRX B;  2XY5 A;  4NA1 A;  4WPA A;  2ZZM A;  4RW9 B;  1HD0 A;  2BKN A;  3CF5 Q;  4FNI A;  4O0N A;  3NGT A;  1Q8K A;  4LSL A;  4RW6 B;  5J1E A;  1KHW A;  2ZKT A;  5IT0 A;  2MZQ A;  4ED6 A;  3K0J A;  2C3Y A;  3GIJ A;  2DR7 A;  4LF9 J;  1OY9 A;  5AXM A;  3C16 A;  1MU2 A;  4CT9 A;  4F26 A;  5C42 A;  2ZBQ A;  2B4O A;  1TR0 A;  2DEI A;  2J9D A;  2OPQ A;  3FJ2 A;  4JV0 A;  4ZHR A;  2EPI A;  3TP2 A;  1WI6 A;  3IR6 B;  3N6L A;  3S8S A;  1UVJ A;  2GAG C;  4NXN F;  2EBE A;  2AX0 A;  2DPJ A;  4KHP F;  2XCP A;  2VBX A;  2YNG B;  4U9R A;  3D6T B;  3SBM A;  3R7B B;  3CCV S;  3RAQ A;  1VHF A;  4HDH A;  1DZ5 A;  2CQG A;  2F7V A;  3OT9 A;  1FO1 A;  5EX0 A;  5J1E B;  3G96 A;  1XMO F;  5CAB A;  2BQ3 A;  5A2Q U;  3Q83 A;  1JLF A;  1AA1 B;  3R5B A;  4ELV A;  2ZJP Q;  1B99 A;  2AGQ A;  1TKX B;  4CDI A;  2FJV A;  3OSP A;  2E5G A;  1KFD A;  2WON B;  2YKN B;  3DLH A;  1VLO A;  4R0J A;  4OI1 A;  3DRR A;  4CO1 A;  2R7U A;  4ES1 A;  2HVZ A;  4MIW A;  2MQL A;  4Q8F A;  5KOX A;  5HRO B;  5E3C A;  3ZZP A;  5F8N A;  2BJ8 A;  3ZZZ A;  2VFU A;  1YIJ S;  2FVS A;  2V9W A;  3IWN C;  1V6H A;  3ENW A;  4UF4 A;  2FGC A;  4U95 A;  3GR1 A;  4ZP8 A;  1U0H A;  6FDR A;  5IT4 A;  4P6Q A;  5DDP C;  1N6Q B;  1N32 F;  4TKT A;  4QZV B;  1KC8 T;  4YP3 A;  2N3L A;  1UWB B;  4NYO A;  4DL4 A;  1NKB A;  2M8D B;  1UFW A;  3CJ0 A;  4C11 A;  3WC2 A;  4NCB A;  5KFD A;  4TLR A;  2OFG X;  3C15 B;  1B0T A;  3MM5 A;  3G8S A;  2RKI B;  1S6O A;  2KT3 A;  2BRK A;  2QLJ B;  3NXZ A;  4RW7 B;  1T9W A;  4WCE Q;  2ZH4 A;  1XC9 A;  2QEX S;  1RCX B;  3GYN A;  3MPY A;  4B9T A;  2YWW A;  3CJK A;  2LQB A;  2FZG B;  5IXU A;  1PYS B;  3UVJ B;  2AJQ A;  4WP9 A;  5KFQ A;  4FDF A;  1VQL S;  3HD1 A;  4EYH B;  1R0B G;  4NRT A;  4AL5 A;  2V4J A;  4ZPA A;  4DLE A;  1Q4R A;  1Y0H A;  1UCN A;  2V8H A;  4Y2C A;  3KLG A;  1OYD A;  2B3T B;  2XNQ A;  5IZH A;  1N54 B;  2E9T A;  1V3R A;  2GS8 A;  3MM5 B;  3GWC A;  3PJW A;  2IRY A;  3AOA A;  3CDA A;  2DGS A;  4OLP A;  4C8M A;  4DCJ B;  1R89 A;  2ZKU A;  3VV2 B;  2AIR B;  5J2P A;  1K73 T;  4C8K A;  4K0K J;  2VA3 A;  1X0F A;  3T5H A;  2AD9 A;  2U1A A;  2YKM A;  2XGP A;  2R7W A;  3HI9 A;  3ZZ0 A;  3BN7 A;  1FDB A;  4F50 A;  4FBT A;  2FZC B;  2C2K B;  2YQ3 A;  1TVR B;  3M6W A;  2XI3 A;  2ADC A;  1FKA F;  2J8S A;  4IKA A;  2HMI B;  4F2S A;  3KHL A;  4G65 A;  2G1D A;  2AQ4 A;  5CYQ A;  1Y5I B;  3U1N A;  3O8W A;  3IG1 B;  2MZJ A;  1N36 F;  2DO0 A;  1JLB A;  1MRO A;  2Z56 B;  2IIH A;  1D8Z A;  3J7Y I;  2K7K A;  4DV1 J;  2F8M A;  1NBE B;  3MED B;  3QAT A;  1HKA A;  1KVK A;  1X4F A;  3AA8 A;  2MLZ A;  5D0G A;  5F3T A;  3TI0 A;  4DR7 J;  4ERD A;  2BXJ A;  2L9N A;  1S1V B;  4FZV A;  3OL9 A;  2CAJ A;  5A0Y B;  5IQ6 A;  2HYI B;  2DHX A;  1U25 A;  1RT3 B;  1RT6 B;  2KT5 A;  1SJR A;  4NZ0 A;  2HWT A;  2OD4 A;  3D54 A;  5HP1 B;  3MXH P;  1F3V A;  4IFY A;  4NCG A;  5AT1 B;  3DXS X;  3FBB A;  2Y8W A;  1HNI B;  2V8V A;  1XNR J;  4C8Z A;  2RJZ A;  4CLL A;  3IMQ J;  4L76 A;  2VUG A;  3N6N A;  1RKI A;  4YY3 J;  2M5Y A;  4Z7Y A;  3MCN A;  3MMA B;  3V81 A;  1F6T A;  4X4P A;  2K1R B;  2XLK A;  3K8V A;  3SDE B;  4ZJQ A;  4RUC A;  1RYS A;  3I0R A;  4BDP A;  1UET A;  4DQR A;  1HWL A;  1VQY A;  1X4C A;  3BPD A;  1XK8 A;  4BBY A;  2VBW A;  2VDH A;  4OX8 A;  4AL7 A;  4DL7 A;  1Q8I A;  1MU2 B;  3QRR A;  2B4U A;  2E5H A;  1C2P A;  4WYW A;  3MFH A;  2IYI A;  2JJ4 D;  3MM8 A;  4URQ U;  5C25 B;  3OVA A;  4DV5 F;  2Y1J A;  1VQ9 S;  2OO4 A;  2J0W A;  3DLL Q;  3DOL A;  3GCX P;  1TUW A;  1WEZ A;  4DCO B;  3H4B A;  4M95 A;  2NCK L;  1Y9O A;  3IRX A;  4Q45 A;  1IBM J;  1KVI A;  1QE1 B;  2QTW A;  1NME B;  3BPS P;  4X66 J;  4DZ6 A;  1SJQ A;  4DU8 A;  2A2D A;  2EC2 A;  1LW0 B;  4LVN P;  4JBC A;  1SBR A;  4YDX A;  4RNO A;  2C2D A;  1N8R T;  2K1R A;  3NNH A;  2CDQ A;  1WOP A;  2AEJ A;  4OZ1 A;  4RW4 A;  2H51 B;  4NA2 A;  1HMV B;  1HBM B;  2B9Y A;  4H4K C;  4CTA A;  3K89 A;  3NAH A;  2CNN B;  4K5R A;  2Z2M A;  3HHL A;  4NEY A;  1UTA A;  3QLH B;  4H4M A;  3QGG A;  3B54 A;  1OPI A;  4DX8 H;  3BQ1 A;  4CI0 B;  3BQ2 A;  2RS8 A;  4CM0 A;  3W9I A;  1F2G A;  5IOL A;  3E2E A;  2NPI A;  1QE1 A;  3JTP A;  5K8M A;  2YKQ A;  4LBP A;  4MYT A;  1HBU A;  4FF2 A;  4ETX A;  1SH2 A;  2JVR A;  1SJF A;  2DXF A;  4ZCM A;  3DMJ B;  4TU7 A;  5M2R A;  3WQP A;  1X5T A;  4DFP A;  4DL3 A;  1TK0 A;  3UDC A;  2VQE F;  1JWW A;  3BKT A;  3UDV A;  1U1N A;  1GNK A;  2O1P A;  4S0M A;  5KFF A;  4KIA A;  2DH8 A;  4C8Y A;  1TL4 A;  1KNZ A;  1RT1 B;  2OEM A;  1D9D A;  3C2P A;  4LFB J;  2LMI A;  4I1T A;  1S99 A;  4CNZ A;  2KTQ A;  4LSZ B;  3CIZ A;  2R7T A;  4O3Q A;  4NWB A;  2UUC J;  1F9F A;  1IM6 A;  4N47 A;  1S7H A;  4DOZ A;  4ECW A;  1FJG F;  5HAN A;  3VZH A;  3HD2 A;  1R6V A;  4RW8 A;  4ZJL A;  1VBK A;  4ZPV R;  4HH0 A;  4EMD A;  2OSR A;  2UV8 A;  3OJS A;  3OR2 A;  1RCO B;  1P27 B;  2EBG A;  4HTI A;  4KH0 B;  4P9S A;  4F04 B;  4YS2 A;  3V6J A;  3PV8 A;  2HBY B;  1VQ8 S;  1NDP A;  3BB5 A;  4F4K A;  2IC3 A;  2WB1 D;  2KRB A;  1FI4 A;  3PRD A;  1KLM B;  1OY8 A;  2XZD B;  4NI2 B;  3SMZ A;  1NK5 A;  2W8L A;  1IKW A;  1CUL B;  4I67 A;  1DFD A;  2CJX B;  2D1C A;  3O44 A;  4C8N A;  2AEM A;  2BA9 A;  2V50 A;  3ZNU A;  4LF8 F;  1H7X A;  3MHY A;  3ONQ A;  2P9C A;  2M9K A;  2J9C A;  2Q66 A;  3OTD A;  1NB7 A;  2DGO A;  1HNI A;  4USV A;  5LM7 E;  2JHE A;  1S4F A;  1IQZ A;  3UN2 A;  2P9G A;  2M3D A;  2YKO A;  4I6Y A;  3UDE A;  3M2U A;  3K58 A;  2MKI A;  3TJ8 A;  4MKB A;  1KN6 A;  4HR2 A;  5LMN J;  2HFS A;  1B4S A;  4OZN A;  4MAK A;  5J2Q A;  2GMJ A;  2LA6 A;  3WIV A;  3IGV A;  3JSR A;  1IKW B;  1CUL A;  2ZOG A;  1N4L A;  1QSY A;  1D0E A;  3PCO B;  1K47 A;  4NI2 A;  1JJ4 A;  2UVR A;  4QIF A;  4MH8 A;  1FD8 A;  3F44 A;  3GE9 A;  3HUL A;  4PQU B;  1CJU B;  3MM9 A;  1KVJ A;  2KG0 A;  3BGL A;  1ZBT A;  1KDN A;  3WHI A;  1RAD B;  3H59 A;  1S1U B;  2F40 A;  1IR2 A;  1C1C B;  1U2F A;  3CJS A;  4J5O A;  4XAK A;  3HCX A;  3L7P A;  1YI2 S;  1M1G A;  3H2V E;  4Z7C A;  3I87 A;  4ICL B;  1RAA B;  3M2U B;  5F8L A;  5KG2 A;  1UW9 A;  3HT0 A;  3IFE A;  3CXC R;  2W4C A;  5HK4 A;  5AE2 A;  1N5Y B;  3BKF A;  1TFY A;  1GXU A;  4RW6 A;  3QT6 A;  3DI6 A;  1YQH A;  3MOZ A;  3UPF A;  4URG A;  4DV6 F;  2P8I A;  4OX6 A;  5HVF A;  2MKC A;  2BE2 A;  5LMN F;  3D68 A;  2XHC A;  2W2Q P;  3ETM A;  1QAJ A;  5C2C A;  4RKU C;  5DDR C;  4DX7 A;  3SSR A;  3DLK B;  2VKZ G;  5HMZ A;  2UV8 G;  5H9F J;  4CLZ A;  1O5J A;  4EWT A;  3PM9 A;  3HDS A;  3I5B A;  4GO5 X;  5LOQ A;  2RRA A;  3MCM A;  2VON A;  1OY6 A;  4DV0 J;  3OW2 R;  5KFN A;  1U24 A;  2C42 A;  2XSJ B;  3O1L A;  3KUE A;  4J9U E;  3FEX B;  3DGV A;  4OI4 A;  2VBZ A;  4ECV A;  1D1U A;  4ZPC A;  2MY7 A;  4CRJ A;  4RW4 B;  2ABY A;  3RBZ A;  4X64 F;  5GAG U;  3DHW C;  3D28 A;  4DXL A;  3UD3 P;  1U7L A;  3BS9 A;  5EWG A;  4KTQ A;  2VG5 A;  2PDA A;  3MR3 A;  1TL7 A;  1A9N B;  2HHH J;  1TVR A;  2HMI A;  3RR7 A;  3CSK A;  4UOG A;  1FFG B;  2UXC F;  4F3Q A;  4ER8 A;  1XNQ F;  3O2I A;  4P75 A;  1VBZ A;  2IBK A;  1NPK A;  3UD5 A;  2PMW A;  5AXK A;  2RNE A;  1TK8 A;  2CJ9 A;  2HRT A;  1T94 A;  3L95 X;  2NYH A;  4YB7 A;  1S76 D;  1RWN B;  3IM9 A;  1T7P A;  2W2O P;  3NWR A;  4XO0 A;  1GK8 A;  3TNV A;  1IQT A;  1S1V A;  5C42 B;  1NHU A;  4TYB A;  5D77 A;  3ZXW A;  2UUW A;  2HNY A;  4J9V A;  3Q2T C;  2DPI A;  1EKR A;  2RF2 A;  2RQM A;  1WDD A;  2ZUG A;  3BGR A;  3H5U A;  1RHM B;  1WOR A;  5H9E J;  2LDY A;  2RQK A;  4B3O A;  4B3R J;  4QYZ J;  4YME A;  5DGB A;  3C14 B;  3OHB A;  3HKW A;  1NJZ A;  4FF3 A;  3GV7 B;  5THW A;  3K5P A;  1VBX A;  1N33 J;  4ZIV A;  4X4Q A;  5A8K B;  3V5R A;  1JQG A;  3CJR A;  5AJ3 F;  1XNQ J;  3KG1 A;  5A8R A;  1KSP A;  3V6D A;  1JLA A;  1LFW A;  4TXS A;  3M2R A;  4I6A A;  1GAO A;  2VC1 A;  3AA9 A;  1S6P B;  5GME A;  3NRB A;  4P2X A;  8AT1 B;  1NDK A;  3UFC X;  4CLK A;  4I7F A;  3DOK B;  5HSP A;  1T9U A;  1PJ6 A;  5EWE A;  2CG4 A;  4DV2 F;  3UE2 A;  3EJM A;  3BBF A;  5F8G A;  4YR3 A;  4LQ3 A;  4DJB A;  4WE1 B;  5CZV A;  5IV4 A;  3R6L B;  2HRU A;  1OMS A;  4OI0 A;  3MUM P;  4ALZ A;  3DCA A;  3T9N A;  3EWG A;  4ED2 A;  2UUA J;  4J9K A;  1IKY A;  4NLP A;  1PYT A;  5B7W A;  2V8P A;  2H5I B;  4FN5 A;  4WIQ A;  2XO7 A;  1SKR A;  3UNY A;  4CIO A;  3GYG A;  3U1L A;  5K8O A;  1FEE A;  4C0O C;  3ENA A;  3TA0 A;  4ZLL A;  2MQQ A;  4RZR A;  4RBT A;  4NXM F;  2IDE A;  3B82 A;  1S77 D;  1S1X A;  3LUY A;  3KLF A;  2GNK A;  5AE3 A;  4WKY A;  3IBC B;  3TUP A;  2OIH A;  1UMJ A;  4NRU A;  4DV0 F;  3SFG A;  2YWK A;  4NZ6 A;  4WF9 Q;  1RWP B;  2UXD F;  1X4H A;  4L3K A;  3MMB B;  4WWS A;  1F5B A;  1RBO B;  3MM9 B;  2BDP A;  3UO0 A;  4OI6 A;  3W61 A;  4KY3 A;  1X9M A;  1KQS R;  1SI9 A;  2RUG A;  5DGA A;  5ETQ A;  4N76 A;  2QSW A;  3QIP A;  2M4M A;  1ZM9 A;  2PSZ A;  1IKY B;  2GGP A;  4RBV A;  1HQE A;  5ETK A;  3M2V B;  3ISN D;  1UPP A;  1O51 A;  1OWX A;  5LXY A;  1X4B A;  4MTP A;  4PXD A;  4WBF A;  1DHM A;  4NYZ A;  1IWG A;  2H1Y A;  5CA5 A;  2GX8 A;  2JLF A;  2VQF F;  4DLG A;  1JJC B;  2VPX B;  3D5M A;  2XEX A;  3M8P B;  3MR6 A;  3N5B A;  5D3G A;  3NEK A;  4GMK A;  2E44 A;  5E5N A;  2G0I A;  5E3R A;  3RJM B;  5KG0 A;  3TZZ A;  1BQM B;  1XR5 A;  1VK3 A;  2CQ3 A;  3D66 A;  1N36 J;  3T6B A;  1LWF A;  1N0V C;  2G2Z A;  1CJV A;  1IJE B;  2ROG A;  4QIV A;  3UN3 A;  3VZI A;  1J5O A;  4X2B A;  1W7W A;  3OLA A;  1KD1 T;  3CD0 A;  3JB9 k;  1RWV B;  3GIR A;  2DXD A;  1UZH A;  3DLB A;  3QGH A;  3PR4 A;  1WF2 A;  1VQO S;  4K4Z A;  2A18 A;  3HHD A;  5GVQ A;  1K44 A;  3TVY A;  2F8E X;  1FT8 A;  4G1I A;  3FNN A;  3V4I A;  3HP6 A;  1E6Y A;  4PPZ A;  3GYX B;  4NA3 A;  4TVA B;  1VS3 A;  3OXL A;  2LXU A;  4LRB A;  4J9P A;  3CED A;  3GON A;  5L46 A;  2RIJ A;  1V3Z A;  3UN5 A;  3M6U A;  4O3N A;  4ID5 A;  1GT8 A;  2HW3 A;  2C2O B;  2XG8 A;  2CZ4 A;  2YVS A;  1Q79 A;  3JAM Y;  1I94 F;  4ENO A;  2HEK A;  3FK4 A;  4KC5 A;  1WC5 A;  3UR3 C;  3ZTR A;  2DR8 A;  4IG0 B;  4LQ9 A;  2X1G A;  4DV4 J;  3DRY A;  3EVW A;  3GJR B;  4JV1 A;  1RT4 B;  2VB6 A;  2R8K A;  5J1N A;  2G4B A;  4HT5 A;  1FE4 A;  1WD6 A;  2FHJ A;  3SQO P;  4KPY A;  4OZL A;  5ETO A;  2PII A;  2WOM B;  3DDN A;  2EW9 A;  2YTC A;  3MEG B;  3G87 A;  3CC2 S;  1CJK B;  1MW7 A;  2QX0 A;  1YVF A;  3IR5 B;  4HHJ A;  2BE7 D;  3B8H A;  3PEJ A;  4HLB A;  4U96 A;  3LGH A;  3ZTO A;  3BO3 A;  3C3L A;  2ZNY A;  3W65 A;  1NJY A;  3RW6 A;  5HN0 A;  4M5M A;  4CYU B;  1RAF B;  1HI0 P;  3AY0 A;  4ECX A;  2N7C A;  1RWW B;  1S6Q A;  4IG0 A;  4KPC A;  4ZDN A;  4GC6 A;  5IC6 B;  1PIL A;  2DGU A;  2BMB A;  4DWI A;  4X4N A;  1EQM A;  2VG6 B;  5LL6 d;  4J9N A;  2ZBI A;  4OZ0 A;  3N0V A;  2YNF A;  2KG1 A;  2DR9 A;  3QRP A;  3OV7 A;  1XR6 A;  3MEE B;  1LXJ A;  3TRG A;  2ZHO A;  3DRP A;  3PVX A;  2GIR A;  1TUG B;  4TU8 A;  4Y65 A;  2UVW A;  4PUO A;  1BMQ B;  1WHX A;  3KOA A;  4DPU A;  5K8P A;  3PX0 A;  2VA2 A;  1HYS B;  2DGQ A;  1XQI A;  2YX1 A;  3QO9 A;  2FUG 9;  2HNZ B;  1B3T A;  4LR8 A;  1WOO A;  4ZVE A;  4ZCL A;  1R27 B;  2J7K A;  2DH7 A;  2DIV A;  1HW8 A;  3IR7 B;  3UW1 A;  2J7W A;  2RD5 C;  2FY8 A;  3DKD A;  2KXH A;  2MJU A;  2R2S A;  4JI3 J;  5HMW A;  3CC7 S;  4UQG A;  1VOM A;  1BQN A;  2CFX A;  3W64 A;  1ZPV A;  3K2Y A;  4AQY J;  4P7T A;  4LF7 F;  1C0U B;  1HW9 A;  1NH8 A;  3IG1 A;  5C7P A;  3BKU A;  5HVG A;  4YQW A;  1F60 B;  2JLG A;  4P73 A;  4D3G A;  2MEW A;  2WVF A;  3E01 B;  5CHC B;  4ZVR B;  1Y00 A;  5BR8 J;  4USM A;  3IS9 A;  3ILL A;  3OTO F;  5CXT A;  4KHR A;  4I2P B;  3AJ2 A;  5DO2 A;  2UUC F;  3MPW A;  4PZV A;  3A8K A;  2N7Y A;  1FWP A;  1N33 F;  3WC0 A;  1CJU A;  2M7S A;  2W2P P;  2GO8 A;  3A8J A;  3ZZR A;  3PW0 A;  4NCG B;  3PFO A;  5JXS A;  1IBL F;  2B7B B;  4DN0 A;  2KKH A;  4XIU A;  3H20 A;  4DX6 A;  2G9O A;  2E1C A;  4YY3 F;  3O3L A;  1RBL A;  3G9C A;  2L08 A;  2XMV A;  1YG0 A;  1NSQ A;  8ATC B;  3JAM U;  4OYX A;  4ECS A;  2VPZ B;  3IGN A;  2QGF B;  4M8L A;  5ETM A;  7FD1 A;  2MST A;  2OEJ A;  2Q79 A;  4FXW A;  4JI0 F;  3AFG A;  3J80 U;  3KHG A;  3VAH A;  1PJ7 A;  5IWA J;  2OH2 A;  1RAH B;  2JL9 A;  2I1R A;  4DBQ A;  2UVU A;  2EG1 A;  4RNN A;  1LWE B;  4ZVU B;  3W2W B;  4DPY A;  1EP4 A;  2R7S A;  3CW2 C;  3IBF B;  3KJQ B;  4LF5 J;  4WZM A;  2MHE A;  1FDA A;  1U6B A;  1T05 B;  1WWH A;  4USW A;  4NML A;  3G6X A;  1IM4 A;  4N41 A;  4CLU A;  2CPX A;  3KJV A;  1QSL A;  3I4P A;  1BWV A;  2BW7 A;  2RAQ A;  1F5C A;  3OHA A;  3CC4 S;  4ZLN A;  3QJP A;  2A0F B;  3KTQ A;  1PAU B;  4H4K A;  1JK9 B;  1WHY A;  5E7O B;  1HNZ J;  5FDL B;  1Z4U A;  1SV5 B;  1VQM S;  3LWL A;  3EM1 A;  4HL9 A;  4JI8 F;  1VHI A;  3FQL A;  3RGI A;  3SSQ A;  5DDQ C;  1YJ9 S;  3HFZ B;  1CQN A;  2RT3 A;  2HIY A;  4JV5 F;  1JNR B;  2MY8 A;  3C15 A;  1ELO A;  1UEU A;  2BJE A;  2F63 A;  1RKJ A;  4O4G B;  4CLP A;  1PBA A;  1I5O B;  4DG1 B;  3Q22 A;  4F4A A;  3NOC A;  4EO8 A;  4LRC A;  2F65 A;  1PBU A;  3NWG A;  3R97 A;  4ZCI A;  2NQP A;  4NLQ A;  3EIC A;  2ZNZ A;  4N77 A;  1LXN A;  1C0T B;  1R8C A;  4NOH A;  4PWW A;  2KHD A;  1RT5 B;  2QJ3 A;  4OZ5 A;  3W2V A;  4QPX A;  5I3U A;  4FYD A;  4EZ9 A;  1WAC A;  3CJ4 A;  4C9D A;  4OHY A;  3W66 A;  1NK9 A;  4Q0B A;  1CJT A;  4P2F A;  1UW4 A;  1J27 A;  2EFP A;  2GCF A;  4DL2 A;  1QSS A;  1LWC B;  3ISZ A;  1FK9 A;  1EJ7 L;  3GTY X;  4AE5 A;  4QWC A;  3RB3 A;  1JXV A;  1U6Z A;  4CT8 A;  4JI4 J;  2MLY A;  1L3U A;  4Z2X A;  3QYY A;  4WYL A;  5J2N B;  3G8T A;  1UVL A;  2ALY B;  1VIX A;  1VR6 A;  5E0O A;  4Q43 A;  4DSE A;  2X3D A;  4AT1 B;  3LP2 B;  3C6U B;  2RU9 A;  3DYA B;  3H5Y A;  2ZH7 A;  1L3V A;  2QMX A;  5A8K A;  1EX8 A;  4QR2 A;  2Q3P A;  4MMO A;  4UY8 T;  3IS9 B;  4L75 A;  4ZP7 A;  4UOC A;  2K06 A;  1N5V A;  1HLW A;  1JLQ A;  5L9X A;  5B09 A;  4LRA A;  4L3N A;  4PXE A;  1DQ8 A;  4LF6 F;  1HQ2 A;  1F1B B;  3D1H A;  1YJN S;  5H9F K;  3JSB A;  2RE1 A;  2E1R A;  2DK2 A;  4M5G A;  3M8S A;  1RTD A;  1NPR A;  2CPY A;  3CCW A;  1T05 A;  4R8U A;  4OV6 A;  3PKM A;  4FKY A;  1DLO B;  4OI2 A;  3CDW A;  4ZVO B;  3EGW B;  3DLK A;  3TQ1 A;  2BBE A;  2HND A;  2J9E A;  2U2F A;  3CJT A;  3FQK A;  3HLU A;  5DET A;  3R2C J;  1BXN A;  1VQ5 S;  2LVW A;  1BD6 A;  2EEY A;  2R7Q A;  2G0J A;  3A3P B;  3H98 A;  2R7R A;  3N4W A;  1UEV A;  1Q82 T;  3I9V 9;  5A2Q Y;  1YKW A;  2EKY A;  4EGL A;  1EZZ B;  3POT B;  4EK2 A;  1ZS6 A;  1HWU A;  1MWY A;  1S59 A;  2IJR A;  4PPD A;  3PR5 B;  1WG4 A;  4ED4 A;  4LF5 F;  4DUZ F;  3T9Z A;  3OJU A;  3QNW B;  1BHN A;  5KFX A;  4WFX A;  1SKU B;  4PYA A;  1XMQ J;  1ICE B;  2DGX A;  3FVY A;  4O44 B;  2G13 A;  4KKO B;  3BGR B;  2EVZ A;  4IFV A;  3TOQ A;  2DR6 A;  1U02 A;  1YLX A;  2IAJ A;  2LA4 A;  4GO7 X;  1DUR A;  1RU2 A;  2B51 A;  3B4M A;  2B6A B;  2AW0 A;  2XS5 A;  1IVZ A;  1X5S A;  4IRC A;  2ZD1 A;  3OFE A;  4FS1 A;  4LBH A;  3RU0 A;  2MHN A;  1CBK A;  3AJ1 A;  3N28 A;  4UST A;  5A0Y A;  5BJR A;  2HHU A;  3HSG A;  1Q5V A;  2CQH A;  3R6G B;  5IT9 U;  3T1H F;  3Q8Q B;  2DHG A;  2F8H A;  4JI2 F;  3CJ5 A;  3R3T A;  4OZJ A;  5CD4 H;  2D3U A;  4RBU A;  2CQD A;  2DNZ A;  3QMQ A;  2YH1 A;  1CG2 A;  1UJ5 A;  2CDR B;  1YHQ S;  5LT5 A;  2CNK B;  1SH3 A;  1N52 B;  2MKH A;  4A8W A;  2HS4 A;  3DOM A;  3PW4 A;  4JI8 J;  2MZT A;  4A4J A;  6AT1 B;  3V6H A;  4YR0 A;  4ICL A;  4F02 A;  2E5L J;  2HVE A;  1KLN A;  1NND A;  4AQY F;  2DNY A;  2OPS B;  3KMQ A;  3NMA A;  4ILM A;  2UXB F;  1YBA A;  3TAM A;  2IMO A;  1TV6 B;  2IHR 1;  2SXL A;  1JKH B;  4O0I A;  2E9R X;  1N5Y A;  1TL5 A;  3C6T A;  3I4H X;  2OGU A;  4NLT A;  1AYE A;  5LJ5 Y;  3D67 A;  2VQE J;  3CCR S;  1ZA2 B;  2Y0S D;  1QVG R;  2E5L F;  1VQN S;  2KL8 A;  2GW8 A;  2FYX A;  1S10 A;  1RWM B;  5AJ3 J;  5K20 B;  2V4Q A;  1FHT A;  4WII A;  5B0D A;  1UJ6 A;  1WNE A;  1IXK A;  2KJV A;  4G1Q A;  4DFM A;  4M94 A;  3TO8 A;  3LOU A;  2WSC C;  2K3K A;  3QAE A;  1S57 A;  4IDK A;  5BYS A;  3C6U A;  4DR5 J;  1NK4 A;  4JI0 J;  1WG5 A;  2DYA A;  3GSD A;  2FC9 A;  2B56 A;  3N5F A;  3US5 A;  4JI2 J;  2H3E B;  1WEL A;  2BVZ A;  3MUT P;  3P6Y C;  4ELT A;  4AUK A;  3ETO A;  3T5J A;  5F0W A;  4E2F B;  2VFS A;  3FDS A;  2D7S A;  4AND A;  4LR7 A;  1RTJ A;  1RWU A;  2E7V A;  1UL3 A;  4KGK A;  2GAH C;  4NX9 A;  4PG8 A;  2GVD B;  4G1Q B;  5DQH A;  3G6Y A;  3PX4 A;  2XZT B;  2IA6 A;  5JJB A;  4MFB A;  2Y9H A;  5K8N A;  4F7V A;  3K17 A;  3NL0 A;  4ETZ A;  3T19 A;  2FLO A;  4OL8 A;  3PG9 A;  2PI4 A;  4HH1 A;  2ZE2 B;  1HQU A;  2CPE A;  1AB8 A;  4RL1 A;  4BC9 A;  1QLN A;  1APS A;  2DGT A;  2DKO B;  1I6J A;  2JRS A;  1FXR A;  2AMC B;  4FYY B;  1I51 B;  2R9L A;  4FVM A;  4DR7 F;  1I94 J;  2OSQ A;  5KFG A;  1Z2L A;  3F73 A;  5J2Q B;  2AT1 B;  2WON A;  4WXW A;  1WKJ A;  5DM7 Q;  3BBB A;  4C8O A;  4M5H A;  5DLG A;  2CUY A;  3RRK A;  5KFC A;  4OJH A;  3N9U C;  1RAE B;  3KNG A;  3GIK A;  2C2Z B;  2M0G B;  2I8E A;  2V2V A;  2V8G A;  3UWT A;  1AZS B;  2PN6 A;  4F3M A;  2EI5 A;  4ECQ A;  4A8S A;  1QTM A;  3D7S B;  2LDI A;  2HS3 A;  1AT1 B;  4QWD A;  4F4W A;  4TNO A;  3SCJ E;  3PEH A;  4Y0F A;  3LQV A;  1N34 J;  4K0K F;  2HPU A;  2MTL A;  4Q7A A;  4DN9 A;  4X4V A;  3HHE A;  3OD2 A;  4DU7 A;  3MM7 A;  3CTR A;  3TUZ C;  2XMM A;  1X4E A;  1RAB B;  3BYR A;  1EIY B;  4M5I A;  2MQN A;  5HAT A;  3VQS A;  2VFR A;  1JLG B;  1UKU A;  2I5J A;  2R4F A;  3U7J A;  5F8I A;  2MKS A;  4NL5 A;  5ETT A;  2RU3 A;  5C24 A;  2ZBR A;  4DUT A;  3G6E S;  2JC1 A;  3ELH A;  1ZTT A;  3I31 A;  3MI7 X;  2XYG B;  3Q23 A;  1LFP A;  4KH1 B;  1RQ0 A;  1S9G A;  2BJD A;  2M70 A;  2D9O A;  3FCH A;  4PUO B;  1GX5 A;  2W4P A;  1KOO A;  3JSM B;  2VU5 A;  4IRD A;  1T11 A;  3MR2 A;  4K4S A;  1S0N A;  2NUU G;  2CQ2 A;  5F8J A;  1WUU A;  2D3Z A;  1Q78 A;  2C1E B;  2I5J B;  2WK4 A;  3R5C A;  1HNW F;  4ZOS A;  4B3M F;  1G2E A;  4ZMM A;  3H42 A;  3H5X A;  4Y00 A;  5KT5 A;  4U7U D;  1DLO A;  2ZC4 A;  2ALZ A;  2R8J A;  2YPY A;  2W7A A;  5C24 B;  3SYZ A;  3TA1 A;  3KG0 A;  3HF5 A;  4OHZ A;  3DDI A;  2E9Z A;  2BOA A;  2D74 B;  1TKD A;  2UUA F;  3L3C A;  4JI6 F;  1MNE A;  2ZH2 A;  3MR5 A;  3M6X A;  1M5P C;  4M5D A;  1HNX J;  4ZPT R;  1U2C A;  2QLB B;  3KUH A;  2DJW A;  4U6P A;  1XMQ F;  4B3S J;  1V5V A; 
#chains in the Genus database with same CATH homology
 1FWP A;  1FFG B;  1A0O B;  1FFS B;  2LP4 A;  1FFW B;  1EAY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...