1FG2A

Crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Viral escape at the molecular level explained by quantitative T-cell receptor/peptide/MHC interactions and the crystal structure of a peptide/MHC complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 61
structure length 273
sequence length 273
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2000-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fg2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1fg2A01
2ED8A 3ZKNC 3VH8A 3H9ZA 3QUXB 3N1PC 2FL5A 1HDMB 2JB5H 3RZWA 1F6LL 5EOTA 4LDLB 3RGVA 4P4RB 4XWOC 3R1GL 1N6VA 4XNMB 3O6LL 4I1NB 5IHZB 5JLZA 4ZUSB 2Z92A 3VI3F 2OTWA 1ZHLA 1HHIB 1W2KT 3HI5L 4V1DA 1CLZH 1K8DA 5GGQH 3W11C 1E6JH 2FEEL 3DV4B 3TJEH 3BWAB 35C8H 3VG0L 2O61B 3QUXA 1J88A 1JHLL 1H0DB 4DFIA 1HDMA 1V7NH 3QFJA 4JANB 1DANU 3ARQA 1S5IL 2WAHA 4K2UL 1YJDL 4XMKH 4UB0L 3ZDYE 4XNUH 4PBVC 4DEPC 2H32A 4PRPB 4OZGA 1A9BB 4CVWA 1ZLUK 2FCBA 3H0TB 1KIUA 1CK0L 3LH2L 1L0XA 1N64H 5C2BL 3CMGA 1CGYA 4JKPL 4RMWA 1EVTC 4XB8A 5JMOC 2I27N 3JV6B 5CEYB 4FXKA 5L6YL 1OAXL 3F7VB 3GSRB 5JQ6H 4OTXL 1J05A 5ALCL 2A73A 2RGSA 3BWAA 3ARZA 2XWBA 4OZGF 2W9DL 4BQ6A 4ZPTA 1RJZB 1A6WL 3BPLC 3V52H 3GBML 4APQA 4OGAD 4ZTOL 4DOHE 4Y5VB 3D85D 1OP5K 2X4UB 2DIAA 1UM6H 2E9WA 3O2VH 3TZVC 5DMKB 4YHZL 5EIIB 1A8JH 2EDQA 3H0TA 4KJYB 1KTDA 4FRWA 4U1SB 4L4TD 3PV6A 4MAYB 2DWDB 3S5LB 4MAUH 3ET9F 4YHYB 3JV6A 3GSRA 1MHPL 3MLWH 5HXMA 3FB6B 2PCPB 2B5IC 2CLVB 2VYRE 4TSCH 1JGLL 1Y6MR 2BVPA 5D1QD 4LCCA 4EZMA 4HWBL 4JEGB 4RZCB 3U9UA 3VRLE 4Y5VA 4XCYA 1UH2A 2BNRA 3SKMB 5FYKH 3VGHA 1LK3L 2CR3A 5DC9B 5EIIA 5FUZL 1DSFH 3QUZB 2DWDA 3S5LA 4RGND 4UUJB 2DB8A 2AJSH 2R0LL 4BUGA 2AERT 3FB6A 5SX4I 2CLVA 4PJXE 1TQBC 4LPTA 2CUIA 3RNKB 1NCCH 5KSAC 2CDGA 1QFHA 3SBWC 4KV5F 1MUJA 4RZCA 5IT2H 1E6OH 2AABL 2LE9A 4PB0H 3GBNL 3LS4L 5L88H 2J5LB 2KUTA 1WTLA 4Y2DB 3ULUH 3FFCE 1PZ5A 4PLNC 1BBJB 2D9QB 3T2NL 3TIDB 2HKFL 4UUJA 3A6CH 3L7FB 3HLAA 4M6ML 2DQHH 2VLKE 2XTJB 4KTDH 4TOYL 1HCVA 3RNKA 3CFKA 3QUML 4FG6D 4M1GL 3HHRB 4YBQD 3BP5B 2Y36L 1UWXH 4MJIA 4JRXE 4E41D 3P40A 2EYRB 4GKZA 3CAFA 1OPGL 5D2LA 5F9JB 4ODHH 4QT5B 2V17L 3O4OB 4ZSOB 1BBJA 1Q1JL 4LMQI 3TIDA 1JZ6A 2AXFA 4QOKB 3HI1B 4PJBA 2OTUA 3IVKA 3D48R 3GSUB 4YHKH 4KPHH 5D2LF 5IVXE 1ZS8A 2HLAB 2FGWL 2Z8SA 3U0WL 2R56H 1S7RB 4LLDB 4LLAA 5GISH 1M7DB 1NBVL 3ES6B 1EX0A 1HHKB 5AWNL 5HPMB 1C5DA 4XI5C 4PJBF 5DQJA 3JV4A 3R06B 1T2XA 2NNAB 4FQLL 5T5NG 3RY6C 4H5SA 3T3PE 2X1XR 5C0DA 3T2QA 4LF3B 3DVFA 1I85C 1DVFD 3TGXA 1DQDH 4HPOL 3HI1A 3BE1H 1JBJA 1IGTA 3CFJB 5GSRB 2OR9H 3PDOA 3GSUA 1WBYB 4LLUB 4XAWH 3ETBF 4CVZA 3IKCA 3RWIB 2W0FA 3CXDL 2EEAA 2GIYA 2HLAA 1NCDH 3UC0H 5ISZE 1I1FB 4WCYL 2ZUQB 1S7RA 3CH8A 2CRMA 3SJVA 3RJQB 4GQ9H 1M7DA 5HPMA 4ZNEA 1T2QL 4AH2B 1MHHB 1X5ZA 2AXJA 3ARPA 4YGVB 3BIKB 3KJ4C 5JIHA 2X4OB 2YD3A 4LF3A 5F3BA 3BESR 2APFA 4AQOA 1WZLA 3NCMA 3MJ9L 3DYMA 5AZ2L 3CFJA 5GSRA 4X83A 4OJFH 2OXGA 3AROA 1MWAB 4U33A 1ZAGA 4WWID 3RWIA 1JZ7A 3TFKC 3BHBB 5I66B 1WEJL 4P9HC 5CZXD 1IM9B 5C0JB 1NC2B 5IBLC 1HNGA 3PQYD 3RAJH 3VFPB 1KOAA 4AH2A 4F7CB 5D70L 4YGVA 3O6KH 1QSVA 3RL1B 4BZ2H 2X4OA 2JIXD 3PJSB 4PTUB 5C0BB 4PRHE 3MNZA 4LKCB 5SX4H 3BRGC 1S7VB 3EW3B 4HHAB 3NPZB 4WHDA 4FN0A 1XH3A 3TM6A 1CDGA 1MWAA 3VWKC 4YR6B 2JCCE 5I66A 1RUPH 4OLVH 5CGYD 1NGXB 1IM9A 4BFIB 3A6BH 4JKWA 1IBGL 1A64A 1GL4B 1I9RL 3D2UD 1NC2A 5D93C 1NDGB 3VFPA 5GPRA 5HYQB 5DD3H 5EOQH 2ARJB 5J8OA 3PJSA 5DD1L 1VESA 4LKCA 1VB9A 4FQPA 4GAGH 2B0SH 3EFFA 4EN3C 1YY8A 5LBSH 1KULA 3BIBX 5K9QG 5LXGL 4LLVA 3O3BB 2WV3A 3EO0B 4XWGL 2R8SL 3HMXL 1KJ2H 2JJVA 4YR6A 3STLB 4GO6B 2X05A 1BVLA 4YEEA 3S6CA 2CGRH 5IBTL 4U0QB 5DJXB 1EZVX 4XPTL 4Y2OA 1NDGA 2DM4A 4OM0H 3FB7B 5HYQA 3N50A 3UROR 2DN7A 2ARJA 5TJWK 2R0ZL 5CSGA 1D5IL 2AEIT 1GYAA 4JLRB 2EC8A 4Y1AB 3KPLB 3QHZH 3O3BA 3EO0A 4W70A 4ZQKB 2J88L 4MDIB 4KDWA 2X4QB 1XF2A 5JR1H 4KY1H 5FDWB 2VDML 2M2DA 3T0EE 4C55A 1FNLA 2XPGB 1K4CA 2ZG1A 4W6WB 5DJXA 4RMUA 1U8NA 1MCCA 5JQHC 1Z6JT 3UYRH 1Q9OB 3OG6B 4JLRA 4GRWH 4Y1AA 4OZIB 2X4RB 1DBJL 3DX7A 2MFNA 4Z7VB 5H94B 4QWWC 4ZQKA 3RVWD 4LLMA 4HK0B 5DJYB 4BFEA 1W72B 2AI0L 1BAFH 1ADQL 1A7OH 2FR4A 3MX0A 2NCMA 2PW1B 3GKWL 4OD1H 4I3SL 2C4FU 2AJZA 5GQBA 3T1WA 4FFZL 3EJZC 4LAQH 3DVIA 4HIEB 3T4YB 1Y0LA 4JJHA 1Q9OA 5EG6C 1HN1A 4U2YA 3MUZ1 2P5WB 4OZIA 2E8ZA 2NY6C 4S2SA 1B4JH 5T1LB 4V2CB 1NLBH 5DLMH 4ZPVB 5H94A 4Z7VA 2PW2A 3T3ME 3LIZH 1SYVB 4HK0A 4K3JL 1FFRA 4GKNA 1T66C 4NQXB 1EGJL 1W72A 1HYSC 2APWA 4U6VH 1NAKL 3S34L 5CFHA 4U3XA 2IH3B 4OQTA 4OZIF 1BEYH 1S3KL 2PW1A 2Q3AA 2CLRB 2V9QA 2FHFA 3T4YA 4Z7VF 5J89A 2Z91A 1JTTA 3QDGA 4RA3A 2Q8BL 2W0KA 1GGYA 4I0PC 3ARGB 4OCYH 5GRUL 2ZUTA 4C83A 2P5WA 2NR6C 3BKCL 4FFVC 1Z3GH 4X4YB 1JHKL 2I60L 5A16B 3GSVB 3CD4A 3WS6A 3VRJB 3LEYL 1HH6B 4JM2C 1F90H 1NCAH 3VXSB 4NQXA 2DLFL 5F7YC 1I8LA 4HUWA 3S98A 1F58H 1YEFL 2NW3B 4OFIA 2YSSB 5I9QC 1HSBA 2GFBA 5I74C 4BZYA 2XXMB 4YHLL 3BWUC 4DGYH 5I30L 5HGHA 1A7RH 5JO5B 3MV7D 1A7NL 1OAUL 3OKOA 3ZHLA 5CJXA 2M26A 1A2YA 4DKEL 4H1LH 1DR9A 5E8PB 3SKJH 3MJGX 1TZGL 4C54A 4X4YA 1P4LB 5EUOE 4AY0A 3PWPE 3RNQA 5FYJD 3VXSA 2VDQL 3D3VB 3QULB 1KT2A 1RU9H 4KVNL 5ID0B 3CX5J 1ZGLB 3X11A 3BT2H 4K7PY 4QNPE 2QQNH 2VTFA 5MEQA 4JFDD 2MQCA 1UB5B 3HC0B 3N9GH 1OTUD 4JVWA 1BJMA 3OAUL 3BH9B 4FQ2L 3VWJC 4NQEE 1P4LA 5IESL 4EVNA 4M1CD 2AAVA 2WWKO 1YEDB 4KUCD 1G7IB 3LQMA 3QFDB 2QJDA 3TO4C 3QULA 2C5DC 1MJ7H 5K59E 1AP2A 5ID0A 5T1DL 3ZE1E 5FUCC 5CHNA 2IQ9H 4C57C 1X4ZA 4JHAL 4DOHB 4YAQB 1UB5A 3GSOA 5D8JL 5E9DD 2XNAB 5D9SA 5E6IC 3B2VL 4UTAL 4MD5B 3MBEB 2HWZL 3IFPA 5D71L 4WO4C 4EDXA 4GLRH 2R9HD 2N56A 1G7IA 4J3OC 1LEKB 3O0RL 1JVKA 3V0VB 3QFDA 3WFCL 3STBA 1ORSA 3ZDYF 5F71A 4WWKB 3RGVD 5DWUH 5FGRA 1PSKL 1G9MC 3MUJA 5AUMB 1YPZB 2XKSA 3RIFK 1WZKA 1ZTXH 4JREB 5IMKB 3NFSL 2VQ1B 2BVQB 4XH2B 4ZODA 4HWBA 2XNAA 1DLHB 4AMKL 3TESA 1TJGH 2Q87A 4V1DD 1QPPA 4MD5A 3I50H 5E8NB 1PX3A 5KS9B 2K7PA 4HGKC 3QI9C 3I75B 4MYWB 3QUXD 3V0VA 1J86A 1YEJL 1QRNB 3P77B 3IDJA 1CD9B 1DCLA 3QFJD 4JFFB 1J1PL 1HH9B 4WWKA 1LILA 3GIVB 4PJXB 1BF8A 3ULSB 5IMKA 5B8CC 4G6AD 2HKHH 3TJHA 4ZTPH 2V2XB 2BVQA 3RHWF 1QFPA 1RULH 5JUEL 4M6NL 2A9NL 1SEQH 1CBVL 1DLHA 4FP8H 5E0QA 2DTML 4OCSL 2PUQT 3MGTA 3MYJA 43CAB 5IBUG 1ED3B 5CP7B 4P9MH 3I75A 1BZ9B 3UTQB 3DBXB 1AQDB 4LLWB 3ZT6A 3P77A 2PR4H 4WRLA 4XBGB 1KXVC 3VRLF 3NIGE 3IS1X 1MREH 3RQ3A 3GIVA 3KPRE 4PJXA 3CVHH 5BJTB 4YE4H 5A3IC 3ZTJH 2ZPKH 4E0RA 2AK1H 4XNQA 1RURH 2BHZA 3VFNA 5JNYB 1I7TB 2A6JB 2AP2A 3OZ9H 1AXTL 3PGDA 1FZKB 4N90E 3K2UL 43CAA 3FFCA 4PJXF 1ED3A 3RU8H 5CP7A 2A1WL 2BC4B 4MX7B 3V7AG 4FTVE 4POZC 3Q1SL 4P46C 2HVKA 4LEOB 2VB5A 4KUZL 4QKXB 4KI5C 2VLKA 1IAII 4UNVA 4HAGA 1HINL 1OP3H 3SQOL 2XTLA 4PJAE 3JWDL 3X3FH 3NCBB 4OFYA 5F6IC 2P43B 5A2LH 1I7TA 3WUWG 4JRXA 1CGTA 2A6JA 1UM5H 4M61B 2R4RH 4MAYD 3NN8A 3PNWB 3BEWB 1MPAL 1TCRB 1WCQA 5HDQH 4LSSL 5BMFH 3U30C 2LU3A 1QFOA 3NA4A 5DVMA 4RRPG 1S7WA 4WGVB 5E94B 4KJWC 3MRGB 4URTB 5IVXA 1JPGA 1NAMB 3UTTE 5JW4Q 4RGMC 5L2KE 3Q6GH 4ZS7L 5ISZB 4PS4H 4DZBB 5IOPA 2IPTL 2X44D 4DEPB 5ID1B 3V4PL 2PTUA 5GS0L 5IB3A 1MCEA 2AEWA 1PFCA 3K8LA 2DQJL 3BEWA 3WFHA 2KZWA 5I6XC 2YPVH 2VE6B 2HFTA 4MNQE 4LVHC 5IVXF 3OR7B 3MTRA 1I3GL 1C08B 4Z0BH 3WCYA 1FNHA 4P99A 3MRGA 4QRRB 1UWXK 4N9GB 5EO9A 4MJID 1ES0B 3BPLB 3BRFA 3MJ9A 2Z4QB 3H8NA 3T3PF 1TCMA 5ISZA 2FH8A 4Q74A 1P5VA 3EDKA 1GZQB 1U8PA 4Y2DD 3TZVB 3VD4A 5GGTL 2OL3L 1DQQB 1GVIA 4G3YL 1NANI 2ERJC 4WI4A 3ARRA 5TDNB 3WNOA 2CXGA 2VE6A 2A9MH 3OR7A 4PRHB 2IGFL 2GI7A 4FQCH 2XTJD 2NY7H 3FN3A 4C58B 2IG2H 3MFFA 3GMQB 4U1LA 1UXSB 4N9GA 1ZGLP 1A9EB 3HAEA 4OIAA 5IMOB 2UVEA 1ES0A 3NBNA 5DRNB 3ULVC 5CKAA 4Q9CA 2DD8L 3OKNB 4K9EC 4OCWH 4P3DB 2P8LA 4KZDL 2D7PA 4WUKL 1U3ZA 3WIFB 4ELKB 5CEZL 2H32H 1IGCH 5F7DA 5ITBL 1QP1A 3O2WL 2EZ0D 1HYRC 4PRHA 3IFOA 1JP5A 2ZKHH 2GJZB 2D31B 2EYTA 3FB5B 1G6RL 1RUAL 1WT5C 1TQBB 1UXSA 3DETC 1VSCA 2JCCA 1CTOA 3N0PB 1I1RA 3C8HA 4EDWH 3WIFA 4LU5L 4F33B 5J3HD 3V4VH 2E7LC 3WIIL 1DQTA 4OUUB 4NKQB 4FABH 1KFAL 4HBCH 5HHVL 2JCCF 4X7TB 5KSBE 4N0YH 2GJZA 1FFNA 3UJJH 1IAIH 2D31A 2VDNH 4FZ8H 4MHHI 3B9DA 5KSUB 3HMWL 5C0RH 3CLFH 1K4DB 4DQOH 3K2MC 5I1JL 1JI1A 1S9XB 3MRHB 5ANME 4EOWH 3SKOB 1D9KA 5INCB 4TUOB 2HJKB 1MCWW 4M1DL 1ND0A 4ENED 5MERA 4NNXA 4UNUA 3H9SE 5IK3B 5LCVL 3MREB 1QUNA 4ZO6A 4KI5E 4D9LL 2MKLC 1IM9D 1K6QH 4H20H 2UYLB 3WNLA 3D69A 4JKKA 4QRPE 1Z0NA 4ZYKB 2IAMC 1NC2D 4AEIH 4CUCA 3OTTA 1KIQB 4HWZB 3T0EA 4FQJL 4HIXL 2WSKA 1CR9L 3I3DA 4OV6F 1KIRA 1UG9A 4TUOA 1DFBH 3MOBL 1G0YR 1ADQA 4YBLC 3TN0C 1J0IA 2VXSL 3IKKA 5IK3A 5C09E 2VL5B 3MREA 2EC9T 2CO6B 2B4CL 2GAZB 4MVBC 1NGWB 2K9UA 1KXTB 2W65B 2R0WH 3E6FB 5GRVL 1MLCA 1JN6A 4HWZA 4HEME 4WFED 3ZLQC 3ZMRA 3FRUA 3LHPL 3WEXA 1EGJA 1NANH 3QCUH 4PBXA 1C1EH 4HGWB 4MDJA 3MODL 3BPOC 2RFXB 4LARL 3KJ4B 2OR8A 2XZZA 3F6LA 2C3HA 1CGUA 2CK0H 1P4BL 1J0KA 5IFHH 1PG7L 1OSPL 2NYYD 2GAZA 3PWLB 1NCNA 4WTZG 1NGWA 3QQ9C 3LAFA 3OBAA 2W65A 1PG7W 3CX2A 3E6FA 2JJTC 1I1YB 3I02B 1FBIH 3GGWB 2VXVH 3X14A 3KPMA 3GSNL 1N5AA 4LGPB 1HILB 5ABDE 2IANE 4HGWA 2YUWA 4RGOH 3NAAH 2RFXA 1GC1L 4Y1AD 5EBWA 1TQCC 3T3MF 3QEHA 2FIKA 5I2IB 2F8OA 5IEHB 4DVBA 2ADFL 4XMLH 2APTA 5I8EB 5EUOB 3FB8B 2JK5B 1GIGL 5D2NE 1YMME 2EECA 4KKLD 1S9YA 1PLGL 3BP6B 3JTTA 3VWKB 5L0QC 3F6IA 4NHUE 1QFWL 5IMLB 1HHGA 2DKUA 1I1YA 2VISB 1XR9B 4JHBA 4P57B 2EKSB 3GGWA 1M7IA 3RGHA 5D93B 3QCVH 2YD6A 1KENL 4DN3H 3GI8H 4F57L 4BQ8A 3K4AA 3LQZB 4HFWA 3UTPD 5I2IA 3C6SB 3GB7A 3P4NB 1TXKA 4EN3B 4RNRA 3AS2A 5EUOA 3MRNA 1XT5A 2JK5A 2H6PB 1YYLL 3HI6H 3PWPA 4LBEB 3BP6A 2A2QT 3FTGB 5H2BA 3PWNB 1S78C 1NGZB 2Y06L 4P57A 2EKSA 4FZEH 4OLYH 1WC7B 1MFBH 3GI9H 5E5MA 2BVYA 5F6HI 3O3EA 4ZS6C 3DI3B 3SEPA 3MLTB 2WWKT 3QUKB 4IIQA 3O9WC 5EUOF 4KMTH 2P5WD 3UBXG 3LVEA 3LRGA 3M1BB 3O41B 3PP4L 3L3JB 3GHBL 1N4XL 1RIUH 3HR5B 5T1LD 4GUPB 4NQSA 3C6SA 1WAAE 2VR5A 4I18A 1AJ7L 1TZIB 3P4NA 4NQEA 1C8PA 4H0IA 2Y72A 4KJQD 3OKDB 5JPMB 4LBEA 3UJIH 5IJVA 1EHNA 3DWTA 1UJ3C 4QNPF 3P0GB 4X7FC 3U7AA 4K8RC 4UDTB 3PWNA 1NGZA 4NKOB 1MWAH 1WC7A 4L3EE 1NGQL 1QSEE 5TGBB 4U1HA 3QUKA 1G7PA 2BNQE 2J4WH 2Z0BA 3M1BA 3MRJA 4C56E 2DQIL 1JCKA 1G0DA 3HR5A 2XQBH 3J7HA 4JKLA 4GUPA 2EIZB 4YIQB 1J5OH 4MD0A 4XPAL 3ZO0A 5K59F 4XC1H 5D7JC 5IW6B 3VXSD 3HA0A 3ZE1F 4MQSB 3OKDA 3HN3A 3U2SA 2P7TB 3D0LB 3RWDB 2X5PA 1XGPB 3NABH 5DHYB 1EXUB 4G43B 2DL9A 1AIFB 2MOVA 3LEVL 4NKOA 1G9NH 4X9GA 4OFVA 2BNUA 4P49A 1OTSD 4HBQA 3IAGC 4LSQL 4NKMB 2BDNL 2FATH 2FEEI 3Q6FA 2NY6B 3JV0A 4YIQA 5I0ZA 1H3PL 1KCSH 1GH7A 2IH1B 3CX5K 3U6RA 5CBAA 3VU2A 2DBLH 2HT2C 2P7TA 4OCXH 4NPYA 3RWDA 4NFDA 1XGPA 5DHYA 5KSVB 1AIFA 3SE3A 5I1IL 3WSQH 1FC2D 3DUUA 4G5ZH 4G80B 4IOIB 4MA8L 3O8XA 3OXRB 3KPRB 1P6AB 2J2ZA 4O58L 4HLZH 2PF6A 1MCRA 2CJUH 1BWMA 4NBYB 4I0PB 3BD5A 3BEVB 1NC4B 3T1FB 4FFWC 2HTLC 3V5KB 2R23A 1MF2L 1XGUB 2DJ4A 5DQDH 3HZMA 1LO0H 3RI5F 1S7TA 2IH1A 3DRQA 3P4OA 1MQ8A 4ZO9A 1A7PL 4EI5C 2MTPA 2BFVH 4FTVB 5KSVA 3SCMC 5CILL 4F3FB 4G80A 1ZA6A 5DFTA 4D0BB 4GSDH 2B1HL 3KPRA 5F6HJ 1OM3H 1T6VN 5I9QB 1FRGH 5I74B 4PJAB 2BSED 4YGAB 4XZUA 3SGJC 4PJEE 4A6YL 2AJUL 1NC4A 3DGGA 3V5KA 4LRNL 4IM8A 1XGUA 4HKZA 3NIGF 4O9HH 1DQLL 5DD0L 1KJ3H 2HFGL 3MV8B 4WWKD 3UZQA 4FTVA 1Z2KA 3FO2B 4S10A 2NXZD 2PYEE 1WFUA 2LVCA 3R0NA 1BQSA 1B0WA 3TJHD 1W72H 4D0BA 1FIGH 2B20A 3TA3C 2Q86B 1R3HA 5D1ZA 3UTTB 4IRZH 4TTGA 4OQTH 5L2KB 3PXJA 3EHBC 3S9DB 5E00B 1CQKA 3HE6C 2D7OA 5C92A 4TUKH 3VWJB 1EFXB 3WXWH 2OL3B 3FN0H 1U2HA 1EBPA 4KHTL 4PJAF 4ZMAT 4AEFA 1I9JH 4R0LA 3TO4B 4HUXB 1SBSL 4KKBD 4NOBA 2AS5M 4FMFA 5E1HB 3C5ZA 5HGBA 2PO6C 4KK6C 1DTUA 2WUBH 3WUZA 3UTTA 3RVXD 5C0IA 4I13B 5T3ZL 5JW5B 1RZ8B 1UACH 4PRDA 5E6IB 3FFCD 3VWJA 5F93C 3DNKA 2XZQL 1INQB 2VDRL 4WO4B 5GGTA 2OL3A 4G7VL 3SDYH 3SKNB 4MNQA 3O6LH 2VLKD 5I73C 4HV8A 2CIKB 3FRPG 4NN6C 3PWUA 4UQ2B 4OLZH 5EZIH 3MQIA 4OFYD 3HI5H 4Z5RA 4JRXD 32C2B 5A2FA 2FNBA 5AEAA 2HRPL 3VG0H 4P2RE 5JW5A 4YHPA 1JHLH 2OJZL 4TVPE 4AENB 2RR3A 5E70A 3QI9B 4K2UH 1S5IH 1YJDH 2ZCKL 4UB0H 3ZKND 5F7NC 5A43C 4CJ1A 1ORQB 3NVQA 2XKNB 1CK0H 3UPCA 3H7BB 4XWOD 1T1ZB 2LV4A 4JKPH 4YEFA 5B8CB 1W0VA 5L6YH 32C2A 3OB8A 1T7YA 4OTXH 5ALCH 1NJ9B 3W2DL 1MCLA 3CZJA 4OLUL 3NPSC 3BZDA 4O5LL 3L1OH 1AY1L 1A6WH 3GBMH 4N8PA 4EUPA 3GMOA 4ZTOH 1KTRL 3L6FB 3QI9A 1EMTL 4IOFC 1QQDA 2E5EA 4ZD3L 1LK2A 5KSBB 4YHZH 3HB3C 5JA8B 5FGBC 2J1KA 1U3HA 1I1CA 3TCLB 4XB7A 5ISZD 5GSVA 5GIRA 4JPWL 5B8CA 4LSRL 1HI6B 1O7VA 4JGJA 3NTCL 1MHPH 3IJYB 4NM8L 3K81A 2APBA 5IROA 3G5VB 5ANMB 1MFEL 2C9AA 5F7HA 3REVB 3H9YA 1WJ3A 4HWBH 4D8PB 2E27L 2EIDA 5DRXB 3LS5L 3H9SB 1H3VA 3W5NA 3QIUC 1HKFA 1LK3H 3I6GB 4P46B 4RBPH 5IHUL 2ADJB 3IU3A 1FAIH 4TUJA 3QIBB 4QRPB 3ALWA 3MC0A 1HI6A 3OKYA 5F6IB 1NUDA 2R0LH 3IJYA 3TYFB 1QFUH 5F1IA 3BUYA 3SDDA 2VXUL 1HHJA 2GTZA 4F58H 5HGGS 5KSBF 4NCDA 1RZJL 4DN4L 1MCWM 4PRHD 3DGCR 5FO8A 4D8PA 4R2GC 3TH2T 4KAQH 5DRXA 4Z77B 1M71A 3MO1A 2AABH 3U30B 3H9SA 4NBXB 5EC1B 3GBNH 3BO8A 2AW2A 5C09B 4P46A 2ADJA 2ZZUT 5J1AB 4LDOB 4HAFA 4MQXC 3T2NH 3TCXA 2Z9TA 3QIBA 4QRPA 5DMGD 4RGMB 2HKFH 3QEUB 3TYFA 4OF3A 4AG4H 3EDJA 3UTZB 4D9QE 2YD4A 2FZ3B 4TOYH 2LU4A 1BMGA 4IJ3B 4KI5F 5I6XB 4NCC1 3W5MA 3WJJC 4LVHB 2Y36H 3B9KA 2VITB 3EYFB 4ZO8A 5EC1A 5MEPB 5C09A 1P5UA 4M00A 1OPGH 1P2CB 2EC9U 4WW2A 1CG9B 2ICCA 5J1AA 4OGZA 5HYJA 1P7KB 3VG9C 3QEUA 3MLRL 5IB5A 1BHGA 3LD8B 3M17B 2BVUA 4XP9L 3UTZA 2FZ3A 2DQUL 1UA6L 2GSIB 5LG1A 2ERJB 1CYGA 1MH5A 2FGWH 3U0WH 3P9MA 3GJEA 5EORL 2HN7B 3QO1B 1NBVH 4GAFB 1YN7B 5C07E 1E4WH 3H3KA 1P2CA 4Q9QL 4FQLH 1A22B 3T0ED 1QHOA 5D2NB 1WWAX 4LKXA 1P1ZB 3E3QC 4XAKE 4NHUB 2HJFA 1NFDE 1BPVA 3QWQB 4HPOH 5IM7A 1OY3B 5HD8D 1HKLL 4W6YB 2GUOA 1E4XL 2GSIA 2IANA 3VRIB 5KVGL 4WCYH 2DWEB 2HFEB 2HN7A 5BVJB 5D6DC 1F2QA 2YRPA 1N6QL 4LSTL 3AC0A 3EYQC 3QNZB 3X3GH 1QR4A 3NACL 4AIZA 5D2NA 1YMMA 1B4RA 3B4NA 1R3KB 4NHUA 1A6AB 4XI5D 2FD6L 3G6DL 5JIPA 3MJ9H 1QFWM 1IARB 5AZ2H 4LSPL 4PLJC 1A3RL 5J1TC 1MNUL 5DF0A 1WVZA 3ILPB 4Y5YC 4I77L 4KDTA 2Q76A 1WEJH 4X99A 2P44B 1D5BB 4AZ8A 2DWEA 5FK9B 1N0XL 2AEPL 3ARBA 1A4KA 1S7SB 3JTCA 4CKVX 1CE1L 2Z31C 5C9JB 3B5HA 5D70H 4AM0B 2W92A 3BSZL 1OAQL 5L2JB 3HAEH 1ZOXA 4CVXB 5D6CB 3NCJL 5CLTA 1IGYB 1QSEB 5FM8A 1RUQL 2FRGP 2BNQB 3ILPA 5JHDA 2DDQH 3LKNA 2D03L 4C56B 1WAAA 5TQ0L 1D3CA 4ZFOB 2RAMA 5DZOA 1MHEA 3U7WL 3DSNA 5C9JA 3TFKD 4Z78A 5C6TL 4PGBA 3DROA 2IAMB 5IBLD 5I71C 1BIIA 5LXGH 4CVXA 5D6CA 1WAAF 5A2KH 4L3EA 3MZTA 4GKOA 2R8SH 2Y9RT 3UP1A 1BX2B 5D4QA 4GW4B 1RSFA 3FO0L 2JE8A 1HXMA 3EIFA 1YY9C 3MRKA 1WQVT 5E4IA 1RMFL 4PJDE 3ZYOA 4C56A 5HYIA 5IBTH 3VGFA 2JKXA 2F19L 3Q3GB 3PWPD 4ZFOA 3V5DA 4XPTH 4NT6B 3VWKD 3BZ4B 4P5MB 2R0ZH 1D5IH 3EDDA 4IMKA 3OR6A 4JY4B 1M7XA 1KJVA 3WLBA 1UH4A 2J88H 1F3DJ 3N1FC 3QHTC 2X2YA 3BPOB 5GGUB 2VDMH 4EN3D 4NQED 4NRXB 2EICA 2WIIB 5D5MA 1CD1B 3WE6B 3ZT5A 2R1WA 3QUYC 3X13B 4BKLB 3WHXA 5LGJB 4NT6A 3RIAF 1CCZA 1IGJB 4RMSA 3D25A 4KGJA 1MLBB 1FN4B 1GZPB 4KJPC 4X80L 5DYOA 1A1NB 2YC1A 4KU1A 4NKIL 1DBJH 1KGCE 1IEHA 1T4KA 1F3DH 5F1OB 1IC5L 4FMKA 3SPVB 5LQBL 2AI0H 3L3HA 1TQCB 3KG5A 5IB2B 4NQCB 1KLGB 1A6TB 3G5ZA 1ADQH 4HIJB 4NRXA 3WE6A 4OKVB 3GKWH 4I3SH 3X13A 4BKLA 4FFZH 5FYJU 5CAYB 1IGJA 1KJMB 2IMNA 3IU4L 5E99L 2E6PA 3KYOB 3IF1A 2CRZA 4R6UA 1MLBA 5L0QB 2IQAB 2PYEB 1T0PB 4CADA 4WEMB 1T0NB 3TO2A 3QXVA 5EO0B 3SPVA 3A0OA 4PRIA 1F3JA 1EGJH 1NBYB 1BREA 3S34H 4PJEA 4HIJA 5HGAB 4BQCA 4OKVA 4QWWD 2Q1EA 2ORBL 2I26N 2FJGA 3QXDB 4ONOA 5TH2B 3OMZA 3BW9A 1KJMA 2ZCHL 5FEBA 2HP4A 2Q8BH 1GGTA 5D7LE 5GRUH 3O8XD 3ORJA 1JGVH 1NEZB 2LABA 4QHKI 2IQAA 2I24N 2PYEA 1JHKH 4PJEF 2I60H 3AS3A 4LQ1A 3I6KB 3KAAA 1Q9LA 3U4EB 4QTHB 2A0LC 3O9WB 3OAZH 4GBXA 2NY6D 2DLFH 1NBYA 1B0RA 4PGCB 2AKRB 4XX1G 5HGAA 1YEFH 1XFPA 5EFIB 1QLRB 4H25B 5TH2A 3QXDA 4YHLH 1T66D 2NTSP 4GKSA 1LP9B 1C12A 4UBDC 5I30H 4NKDB 1A14L 4BYHA 1OAUH 3OJDB 5J6HA 1UJ3B 4N1EA 4DKEH 3KPRD 1FVEA 2E8YA 2ARWA 1FL5B 4QF1B 1TZGH 4PYHA 4X6DE 4LLYA 4DAGL 3UZEA 3LDBC 3U4EA 5DJZB 4QTHA 4I0PD 5F88B 1V8HA 1NKRA 1NC4D 2VDQH 5IGXL 2NR6D 4KVNH 4FFVD 4LCWB 4N90D 4HK3N 1UADC 4Z6AT 1SM3L 1YEKL 2R2EB 1BECA 3T0XA 1Q8MA 1QLRA 5D7JB 3U4BH 2F54E 4FTVD 4NKDA 1CGSH 2BSTA 4XRCA 2QHRL 3OJDA 4JZNA 5I16B 1RZGB 3GNML 3OAUH 1AGBA 3DYOA 3KR3L 4FQ1L 1FL5A 5D1ZD 1YNLL 1ZT4B 3ZHKA 2G60L 3I2CL 3F7YB 4X9IA 5DJZA 5F88A 3T0DA 1BWWA 4XP4L 2HA1A 3DRTA 4P2RA 1LEIB 1XF3B 2KBGA 5T1DH 2R2EA 4RWHA 3RP1A 5D7JA 4BH8A 1YC8A 4JHAH 4J3XA 1T03L 5C70A 1DN2A 5D8JH 3B2VH 4OCRL 4MNGE 3C6LB 4HXAL 3UTTD 2HWZH 1ZT4A 5D71H 5L2KD 4DCQA 1PGRB 4F7MB 3UO1H 4J3WA 3JSSA 4MXVE 3W9DB 1ITBB 1R24B 3K80A 3O0RH 4I8DA 4U1MB 4M93B 1PBYA 2P47B 3VWJD 3WFCH 1EFXD 2UUDK 1LEIA 1XF3A 1PSKH 5DGQA 4JG1L 4MNQD 1R3LB 1VEOA 4J12A 3NFSH 4LK4A 4ZUUA 5IG7B 2R2HA 1NBZA 3S3PA 2PNDA 5ALBL 1R5VA 1RZKL 4NO3B 4MJ6B 3F12B 2OJEA 2YA1A 4Q6YA 4M7ZC 3S4SG 5KW9L 4QHKJ 3SCMB 4HF5L 4KROB 4HXBH 3TVMA 3V79C 4ODSL 3C6LA 3GEWB 4F7MA 1U3JA 5E6ID 1R24A 2DYPA 1YEJH 4HPYH 4QRUA 4U1KA 1MCDA 2XG4A 1J1PH 4HWNA 4LFHD 4WO4D 5FA3A 3PWVA 3H42L 1FZMB 3BZFB 5EU7C 5FYKE 3SDXE 5IG7A 4M6NH 5JUEH 2A9NH 1FIEA 1TITA 2DKMA 2JB6A 4WEUD 2VN4A 2DTMH 3L3GA 2EE6A 5HHPB 4CBPA 1R5IB 2IEPA 4DK6A 1LO3L 3AXLA 3FCTA 1J1XL 4Z7UA 3TA3B 3TNMB 4AYFA 4U6YA 2A83B 3GMRB 1FNAA 5IFAL 1A4JA 3QG6B 2VL4A 2D7NA 1BJ1J 3HE6B 4FFYL 4G8IB 4PJHE 3QI9D 1CD8A 3T09A 3WO4C 1YEGH 4L4JA 2KPNA 5IP4A 3KPNA 3BZFA 4JDTL 2C1OB 4DGVL 5C08A 1U3HD 4TNWF 3ZDZE 4DUWA 5KBNC 1AXTH 4MSWB 4YBQC 5I1HH 2PO6B 3K2UH 2FJHA 1R5IA 5JDSB 4JM4L 3ALPA 5DUML 3TNMA 2A1WH 3WMSA 1U58A 3F65A 5GXBB 2A83A 4LQFL 2BRRL 3Q1SH 4WDIB 1BJ1H 2OZ4L 2A6IB 4KUZH 4GJTB 1AD9B 4G8IA 5IWLC 3DUHA 4MA7L 1HINH 2F9BT 4JO3L 5DD5L 3SQOH 4RMQA 2EDNA 1ZVSA 5HY9B 1QBLH 1X5HA 1AHWB 3JWDH 4RBPK 2G75B 4I48B 4KHXL 3TBYB 4IRJC 4YPGB 3VXRE 1TVBB 1D6VL 1OGTA 5I73B 2H26A 5DTFB 4NN6B 4MSWA 5C07B 1HSAA 4HJJL 1MIML 1MPAH 2PO6A 1PG7X 3KS0J 4JFYB 3B3IA 3MRDB 4FXLA 3QNXB 5HYSA 4P59H 2H2SC 2CUHA 4QRSB 5INDA 2ICEB 1S9KC 1AD9A 5CIPB 3DUSA 2MQ3A 4NUJB 1I8KA 5HY9A 1NGYA 3H9SD 1U92B 3VCLB 4POZD 1AHWA 2G75A 4ZS7H 4I48A 3RA7L 3IDYC 2IPTH 4P46D 4YPGA 1TVBA 4KI5D 5EBGA 2DQDL 5C07A 2XKUA 3KS0H 3T2OA 3QIBD 2DQJH 2YR3A 4QRPD 5TDOA 4IS6B 4YHIB 4K94L 3TP4A 5T1KB 5B38B 2YUZA 1WIUA 3BXNB 4KRMB 5F1KC 1I3GH 3QNXA 1NFDA 3P4LA 4HS8H 4LHUB 4JQVC 2P24B 4JVUA 2UZYB 1AD0A 3NPSB 1KCVH 2Z35A 2FSEA 2O93L 2NZIA 1U92A 3VCLA 2XA3A 4ONGL 5EU3A 2F53E 5C09D 4RDQF 4KJWD 2LTQC 1NFDF 5GGTH 2OL3H 4XXCC 5CZXC 1CWVA 4G3YH 5ETUB 5T5FL 2NZ9C 1GSMA 2BVTA 3INUL 4JE4B 5T1KA 1FLTX 1H5BA 3BP4A 3BXNA 3S8WA 2IGFH 2EDFA 5T1MA 1TJHL 3V5HB 4LHUA 1G0XA 5ESQB 4JQIL 4CDHA 2HAZA 3HRZB 3BDBA 2W9EH 3C08L 3TBSB 1LQVA 4U1GC 5DD6A 1K85A 3L5IA 4XCCL 1ZEAL 2DD8H 4TNVK 4KZDH 3JVGA 3QIUB 5I76B 1QVOB 5CGYC 4DW2H 1EUUA 5ETUA 4G6FB 3P4MA 3CSGA 3O2WH 5F3HB 5FKAB 4CW1A 3N06B 2ESVE 1F4YL 5ESQA 1OGAE 2VIRB 2IAND 1EJOL 4M48L 1RUAH 5SWZE 3HRZA 3K8KA 3S36L 1JF1A 3E1F1 4RAHA 1RVFL 1YEEL 3G6JE 5EU7E 2ZG3A 1B2WL 4PJDB 4F15C 1QFWI 4EUPH 2BY3A 1Q9WA 2OYPA 3O6FA 4OCNC 4LU5H 5EN2B 2H9GB 5F89B 5HHOA 1YMMD 5EOCL 5C0GB 5ICZA 1MCFA 1QKZL 1RIHH 3MUY1 2E7BA 3WIIH 5FCUL 5DSCB 2ITDA 1KFAH 5HHVH 2FO1A 3GSXB 3PHQA 1U6AL 2VIRA 1UWEL 3MLZL 4IRSC 1P9MC 1AGFA 4X4XB 3GMPB 1GGCL 3VGDA 3HMWH 4JRWA 4PR5B 4ZO7A 43C9B 5DK3A 5I1JH 4HC1L 4PJDA 4XGZB 2V7HA 1T7XA 2NY5C 5EN2A 5F89A 3DETD 2SEBB 3GMMA 5C0GA 1NDMB 3L3OB 4TULL 3V6FB 3IS0X 4M1DH 3BYTA 3X17A 4YXKL 4WHYG 5C0AE 3VFVB 4PGEB 4BELD 4IHOB 5DSCA 4J3UA 2VXTL 3KLHC 2VDPL 3GSXA 4PJDF 5LCVH 4PP8C 2V5SA 3JWNC 3PABB 4KVCL 4D9LH 4X4XA 1JTOA 3D0VA 4PG2A 4BH7B 1UGNA 1DBAL 3LPGA 1SJHB 1RK0A 4FQJH 3P0YH 1T1YA 4HIXH 1CR9H 1ZA3A 5HDOA 4ZUTB 2SEBA 4UINH 4PRBA 1L9NA 1QSZA 3VFVA 1FGNH 3BH8A 4H8WL 4L3ED 1CF8L 5E2VL 1QSED 3CFDB 5F1SA 3IXAA 2BNQD 3VXME 4CMHC 4M3KB 5D1XA 5BW7A 4K23H 4NNYA 4C56D 2R0KL 3PWJA 3TF7C 1KELL 5BO1H 5FB8B 1EUTA 3MZGB 1NMCC 2ENSA 3LHPH 3HNSL 1BVKB 3B9VA 3LKPA 4ZUTA 1BGXL 2R2CA 2EH8L 3MODH 3LN4B 1XF4B 2X4PB 4OF8A 2VZVA 5C3LD 5JORA 1GXEA 5L8JB 1H8NA 1RZ7L 5D7LB 2W60B 1P53A 1P4BH 2MMXA 4WJ5B 3JXAA 4Z95L 1PG7H 3CFDA 1OSPH 4XBPB 4HKBB 2QSCL 2QSTA 1RJLB 2IPUG 1H3GA 4Y8AA 5CINH 4Y5YB 3DHJA 1MCPL 1NCBH 2YK1L 5FB8A 3QO0A 3QQ4B 3HZVB 2Y25A 4ONHB 1GC1H 1XF4A 4G9FE 3HFML 4MCYB 4Z7NE 1IRAY 3ARUA 1SY6L 2W60A 2ADFH 3FZUC 4FQIL 3JWOC 1HIML 4K55A 4XBPA 1E0OB 2CQVA 4X6DB 3EJYD 1WIOA 2H3NB 3QJFA 1GIGH 1NKOA 2R29H 3JTSB 3L3KA 1PLGH 4XP6H 1QFWH 4BFGA 4JG0L 4P2QE 5DQ9B 3QQ4A 3HZVA 2VZ1A 4LPUA 2CUMA 1FFOA 5JA9A 3OHXB 1OAKL 4Y4KC 1KENH 2BOBB 4ONHA 4E9LA 2VLJB 1KCLA 4F57H 4U6XA 1CFTA 1D5XB 2IADB 1N59B 5I71B 1OTUC 4U4BA 4X6DA 4NZTL 5KVDL 3SHSA 4YNYB 3VI4E 2MJWA 3JTSA 1U8JB 1M4KA 4HSQA 5FGCE 1PAMA 4M1CC 2HFFA 2Y06H 3T0BA 3D1MC 2HJLA 4KK8D 1MAMH 5BS0E 5DXWA 4YDJA 3HTLX 4X6DF 2F54A 4X5LA 3WLWC 3QDAA 4Z8FL 1DQML 3PP4H 1LE5B 2PYED 1M1SA 3GHBH 1N4XH 5FXCH 4BUHA 1AJ7H 2F5BL 3OAZK 4MNGB 5MHSE 2PYFB 4YQXL 1X6LA 2DIBA 4HEPG 5TPWL 1V3LA 4X7EC 2F5AL 1LNUB 1U8JA 2LVEA 3RIFF 4Z76A 1CQYA 2XN9B 1J12A 3I9GL 4X6FA 3RWGA 2R9HC 2GITB 3SY0B 1NGQH 1X5XA 3QUYB 4HCRL 1DBML 3RDTC 3RGVC 5DK0A 5M94B 2ARJQ 3TIEB 4XCNA 4NM4L 5C0CA 2YD1A 1S78D 1LE5A 1U42A 2DQIH 5FYLE 5C8JB 4FA8A 1WWCA 3UTSE 1CLYL 4XPAH 4ZNCD 4ZS6D 2N1KA 4MNGA 3RPKA 5C0NC 1O0VA 3MRIB 3O9WD 4X6CE 4N9OB 1I8IB 1I9EA 1LNUA 5DUBB 4X8JA 4ESKA 3FT3A 3LEVH 5C6PB 3JBG7 2GITA 2AJYH 3QUYA 4NZRL 2FX9L 5J6GB 4MWFB 1HOCA 5FM5M 3DSFH 3TIEA 2QV2A 3SDXB 4CN4A 5KG9B 4LSQH 3KYMB 2BDNH 2N7BA 1FO0L 5CJ5A 4MXVF 4R4ND 5BXFB 1KTKE 1A1OB 1LDPL 3I3EA 1H3PH 2R15A 3VFTB 5JIIA 1BZ7B 1NFKA 1JTPA 4P2RD 1MJUL 3KLDA 5I1IH 4M8VA 2FX8L 5D7JD 4TVPD 4MA8H 4YFEA 1DLFL 2VKXA 4PJHB 2OP4L 2ADIB 4BFBD 1EVUA 4O58H 4HQQL 4APQC 4MXQA 2ZUXA 5J6GA 1U8OB 1KACB 3SDXA 1EJ6A 4EBQH 4TPRH 1JYWA 3P73B 4ETQB 1A1OA 1MF2H 1DEDA 2X4NA 2Y7QB 3VFTA 5B3NA 1BZ7A 1A7PH 1OF2A 4YH6A 2P8MA 2NTFB 3SDXF 1FZOB 4HWEL 4R3SB 5CILH 1S9VB 2PTTB 3MRCB 4PJHA 2B1HH 4Y4HB 1S5HB 4LCCC 2HT2D 1XCTA 4K3EH 3O45A 3LKRB 5HVHC 2EE3A 4PRAB 3TVMD 4RMVA 4R4FL 3VXRB 4Y5VC 3C6LD 2AJUH 4LRNH 1T20B 3B9AA 5CLWA 1DQLH 2ZSVA 5DD0H 4PJHF 2X89A 3LDBB 5I1KL 2HFGH 4JJ5B 4K71C 3PIQB 5HJ3B 2VZTA 2F8VA 3VD3A 4YHYC 4LRIC 4FFWD 2HTLD 2NTFA 4PRNA 4WI8A 3MRLB 2JJWA 4MD4A 1HWHB 3TBWB 5GRYA 3ZDZF 5CD5D 1ACYL 4Y4HA 2VH5L 3P0VL 4JB9L 3T8XA 1BOYA 4ODTL 2NY2D 4B7IA 3SCMD 4KROD 4PRAA 2RB8A 3VXRA 4NP4L 3OXSB 3CJJA 1I3RB 1WK0A 1T20A 2IBBA 2J8OA 4OZHE 4JJ5A 4KHTH 5HJ3A 1MI5A 4KQ3L 2DQGL 1SBSH 3MRLA 4X0KB 2DM7A 3ZE0E 4I2XE 4P5KA 1CGVA 4F7EB 1NUNB 3BI9X 1NSNL 1RZIA 2BP3A 2R4SL 3F7RA 5T3ZH 5IVNA 2F53B 1BBDL 3TA3D 1CL7L 3LKOA 1OWRM 3GFUA 2XZQH 3HZKB 4WFHE 2VDRH 4NQTA 4PJCA 4G7VH 3QWOB 2MKWA 5D72L 2C26A 5J06A 3HE6D 4D9QD 3O3AA 1MFDL 4X0KA 3LZFH 4PJIE 4F37F 2FYYB 3O3DA 1VFAB 1FG9C 5JOPE 1MCBA 4LDEB 1KN4L 1F11B 3W0WE 3EYSH 1SVZA 1BZQK 1LD9B 2F53A 2HRPH 3DURB 1B9ZA 1CICC 2PO6D 4KK6D 4M7ZB 5CEXA 4QHMA 4L8BB 1CZ8H 4U1JB 1XIWA 2OJZH 2CKNA 3HZKA 4PTTA 4UQ3B 1OP5H 3KLAA 2ZCKH 3RL2B 1RZFL 1E4JA 2VAAB 2Z93B 1A3QA 3K0WA 2XACC 1OSZA 1OGAB 1X5IA 3CFCL 3FQWB 3V95A 5ENWA 1CDCA 5SWZB 2FYYA 4U1IB 5K33A 3BISA 3GJFB 4OZFA 3G6JB 2GK0A 1RI8A 5C07D 4W68A 3W2DH 4Z7WB 4Y0GA 1CXLA 4TVPH 4MCZB 3FT4B 4OLUH 1JV5B 4U1JA 4O5LH 2AV7A 3H6JA 5B39G 2GYSA 4XAKD 2HYMA 2IPKB 4UQ3A 3U46B 1EMTH 3S96B 1E4XI 3A67L 4ZD3H 4WY7L 5J3HC 3RL2A 3U48A 1A5FH 2ESVA 1R3IL 2Z93A 1JL8A 2CMRH 3DJ9A 4L3AA 5GRJL 3FQWA 4U7MA 1IQDB 1KJ2B 3WO4B 5SWZA 3GJFA 4I4WB 1JRHL 2YD8A 3WKMH 4LSRH 5ITFB 3NTCH 1DBKL 4NM8H 3RWFB 1MCKA 1VADA 3FT4A 5IF0B 2XA8L 2BVOB 1MFEH 4HC1A 4I3RL 5J11C 4I3GA 5JW4R 5F9WC 5T1KD 3VD5A 3FQRB 4E41B 5TDPB 4Q9BA 2E27H 2IPKA 4LHUD 3U46A 5C0AB 3LS5H 1C5CL 1YNTA 3TLRA 4W81A 4MB3A 3DO7B 3NCYS 2YN3A 3G6JF 3OJ2C 4OF6A 4JPVH 4Z7WF 4M8QB 1IQDA 3ROLB 1OW0A 1DQJB 2B2XL 2OBGA 4IOFD 2EO1A 4I4WA 5H8DA 3KPQA 3IFLL 5BQ7B 4WI3A 4IRJB 4LLQB 3K8MA 2VXUH 3MRBB 5ACZB 4HS6A 2BNRE 3KXFE 3X12A 2CIIB 1K3ZA 1RZJH 3NFPB 1Y6KR 5E2WL 3Q2CA 2GT9B 2AJ3A 4DN4H 3FQRA 1D5ZB 4KK5D 1F4XL 4GRWB 2V2WB 5K9JL 2P1YA 2OMBA 5C0AA 3MNVB 1KBGH 3DO7A 1YEHL 2GY5A 3NOIA 1JZ8A 5FM4A 5C7XL 5AAMA 4M8QA 4XCFL 3VXMB 1I1AC 1G9NC 4RSVA 1MCHA 3O6FD 3IDYB 5ESAA 3CSPA 4IRJA 4KXZI 4G6FD 5ACZA 3KNBB 2CIIA 4LVEA 3NFPA 3BRDA 4OI7A 4HZAA 1D5ZA 2B39A 2MWCA 3TWCL 4D0CB 5IEKA 3D18B 1ITCA 2V2WA 2OR7A 4X6BB 3JUYA 3MNVA 1TTFA 3WYRA 4H88H 5K9KB 1TTGA 3CMOL 2FHCA 2QADC 3IRZA 5I8KL 3WDHA 1G7LB 3W39B 5EZJB 3VXMA 4WU5B 2ZG2A 2J8HA 5HHNB 1AE6L 2NYYC 2VDKH 3EDEA 4MS8A 4FXGB 3MLRH 1BOGB 1RQ5A 1YNKL 1AGEB 4CN1A 5CJOL 2LTQB 1EEZB 4XP9H 3NCCB 2DQUH 1UA6H 2CXKA 2FBOJ 3DLQR 3R8QA 4R90L 5IB1B 4G9FB 3MJ8B 5EORH 5CBEA 5EUKB 3VXSE 5K9KA 1XGRA 2ITCB 2CR6A 4JQVA 4XVJL 3VFWB 4YDLC 2JELL 1FZJB 3W39A 4Q9QH 5EZJA 1SY6A 1X5JA 1KPRA 5FOBB 4U1GB 4XVTL 4UT6H 4QTIL 3NZ8B 4P2QB 5DT1L 1KYOJ 3WNPA 3DV6B 4YDIL 4XXCA 1HKLH 5F1NB 1LO2L 1S7UB 1E4XH 5E2TL 3D2UB 5KVGH 4H1LB 4G9FA 3MJ8A 4L3CB 4YDVA 3RZCA 4G6ML 6CGTA 5EUKA 1P7QB 1KGCD 1TENA 1QR1B 5DRZB 5D1XD 1N6QH 4LSTH 5GRVK 2VLME 2YWYA 1FZJA 5GS3A 4S0UC 5FOBA 4XCEA 4F8TA 1ZVHA 2VLRE 1RHHB 4S0SD 4Z7NF 4F15B 3SJVE 2FD6H 2NY1C 3G6DH 3DV6A 4HDIB 4LSPH 1CFNB 1A3RH 2E9BA 5BS0B 1MNUH 2OI9A 3TPUE 4L8CB 3MLPA 1S7UA 2O5XL 1TZHA 4I77H 2BMKB 3QSKB 2XZCL 3E6HB 1YDPB 4L3CA 1N0XH 4PREA 2AEPH 4KQ4L 5CUSL 3OKMA 4BQBA 1UH3A 5LJYH 1T1WB 4IRSB 3V6BR 4CU8A 1MOEA 1IGML 4GG8B 2I9TA 4NO0B 3CCHB 3QNYB 1LWRA 1L7TL 3BSZH 4UZGA 1OAQH 1I8LC 1QO3B 3EYQD 3H3PL 3NCJH 4HDIA 1RY7B 3CDGB 1A7BA 5BS0A 1ZWIA 5D7LD 1RUQH 4WW1B 3VI4F 4RDQG 1FYTA 2D03H 3DARA 4G8EA 4NO2B 3VW3L 1YDPA 4HCRA 3UTSB 3DVGB 4ALAL 5TQ0H 1FYHB 2OSLB 4PLJD 5D7IB 3WNMA 1IVLA 2EDBA 1L0QA 5C6TH 1P9MA 4U3CA 3H9HB 2QQLL 1U8IB 4GG8A 5F9OL 4N0CA 1PEWA 4JFOB 1BFVL 5E6YA 4KXZH 3S97C 2XZAL 3V8OA 4RA0C 5E08H 4PD4J 4JDZB 1GGIH 5FA4B 3SDAB 5B38G 1RMFH 4NN7C 2JF1A 2R1XA 3UTSA 1HQRA 1TNMA 3DVGA 2F19H 1EO7A 3B6SA 2OSLA 1YJDC 4ZOEA 1FO0A 2W38A 4X6CA 4CMHB 1IGIL 2QEJA 3BDYL 4OT1L 1FLRL 4E5XB 2DQFB 1Q38A 1NMCB 3U1SH 3AU1B 4JZOB 1HE7A 2F54D 5D7IF 2DKSA 2F58L 4X6CF 4X98B 3SDAA 5EWIL 4JN2B 3T0WA 1EHLH 1IEBB 2IFGA 3PF2A 1UVQB 3KHQA 3KWWB 4KWUA 8FABB 4PY7A 4ODBD 4WV1A 3TF7A 1KEGH 4X80H 4E5XA 2DQFA 4YUEH 1KC5L 3CVHB 3B43A 4NKIH 4QXUL 1KB5L 1HEZB 3AU1A 4JZOA 4QXTB 5C0EB 4I5BA 1W0WB 1TETL 3FONA 5LQBH 4LSUL 4X98A 4MB4A 5F7KC 5BVPH 2MCG1 3ZHDA 3MV7B 3M45A 3MRQB 5ERWB 1UVQA 2YRLA 3IU4H 2PETA 4KKAC 2EDEA 5ESVB 1VFMA 1YUHB 4UU9A 1U91B 4RWYH 3QUYD 3PGCA 5J13C 4RIRA 1UYWL 1HEZA 2QQKL 4WWKC 4K7FB 4QXTA 1HQ4B 3MACL 2NXZC 4Y4KB 4KJPD 1IAKB 1R6VA 3TJHC 4LNVA 1LE9B 4BSWB 3ZL4L 4UDUB 4JFDB 3UPRA 2UVFA 2ORBH 2YKLH 4K3DH 5T3XE 1HHHB 2JJUA 2ZCHH 1T80A 2CKBB 4YBHA 5IHBA 4TQEL 2CDFA 4OZHB 1MJJB 5ESVA 1YUHA 1R5WB 5GGRB 5I19L 3V7MA 4MXQD 1RK1A 4K7FA 4Q2ZB 3BN9C 5FYKD 1ZVYA 4KKNA 5GS1A 4DZ8A 4FQHA 2A77L 3BP7B 1LE9A 3QDGE 4Z0XA 1JWMB 5IVZA 5LVEA 4BSWA 4D3CL 1QEWB 4GAJH 4UDUA 2XY2A 4U31A 2DQCL 3HUJE 4R4BB 4TVSa 4JFHE 1A14H 2CKBA 3G9AB 4OZHA 2ZUUA 3QZWB 4DGIL 5DEFB 4ERSL 1JNHB 3V4UL 1R5WA 3UZVB 3VH8B 4PJIB 2G2RB 1VCAA 4KDVA 2WBJA 4DAGH 4GAYB 4I2XA 4Q2ZA 2FL5B 5DZNA 1CLZL 3W0WB 3RDTB 3ESUF 5EOTB 3RGVB 4DVRL 5IGXH 3TJEL 4OZHF 2RHEA 35C8L 4NQUA 1YEKH 2X89D 1XR8A 5JLZB 2Z92B 4CNIB 4DFHA 2EDOA 4CVUA 1AGDA 4U6HB 3ZE0F 1ZHLB 4P5TB 4V1DB 2QHRH 2YPLA 3K1KC 1MFCH 4UIMA 5DEFA 4Y4HD 2YS4A 3MLUL 5DURB 3GNMH 1QLFA 2A74A 3LSOA 2UWEA 3KR3H 4PJIA 3WNKA 1XZ0A 2G2RA 1YNLH 4GAYA 1MCJA 4UBDD 5J7CC 2G60H 4M6OL 3I2CH 4R7NA 3QFJB 3VXRD 4M9PA 3S37L 3W0WA 3RDTA 3TYGL 5JQ6L 4LNRB 3SKUD 5CWSA 5EU6E 4HT1H 3U9PL 2EDYA 5B21A 4B0MM 2LAAA 2H32B 1RJYA 4OZGB 4DWHA 1AR1C 4BSVB 2AVGA 2X4TA 3GSQB 4CNIA 1U8LB 4PJIF 1R0AL 1TMCA 4L4VA 1QLEL 3VXTB 4U6HA 1KIPA 4P5TA 2IFFH 1T03H 2EE9A 4FXKB 4OCRH 1FNGA 3MLSH 1J05B 2A73B 2EDDA 1J0YA 4YZFE 4HXAH 4QHUB 2XWBB 1BQUA 4ZPTB 4MA3B 5I75C 4WI7A 4APQB 1N7ML 4LNRA 2HTKD 4OBSA 3ARDA 4BSVA 1L4IA 4JG1H 1A7QL 3GSQA 1U8LA 1KTDB 3NCEB 3VXTA 1GPOH 3MRRA 5F21B 3PV6B 4LIQE 5ALBH 1RZKH 1RFDL 5BRZE 1ZLSL 5KW9H 4OFKA 3EGSB 1J0ZA 4HF5H 3IDGA 4ODSH 1IKNA 4JCLA 4QHUA 4N8VG 3LN9A 2BVPB 4LCCB 1BIHA 5SWSA 4MA3A 3S3JA 2F53D 5EU5A 5HVHB 3U9UB 4XCYB 2BNRB 2W9LA 4LIQL 1B6DA 1NCCL 1UKTA 3H42H 4YDKL 3TT3L 2EE2A 4K71B 4MQ7B 4GW5A 3OG4B 5TF0A 5KAQF 1KPUB 1AXSA 1CLOL 1J0JA 3EGSA 1U95A 3KYKL 3P9WB 3ULUL 1LO3H 3QA3A 1FGVH 1F4AA 2CDGB 5MI0C 1MUJB 5T33L 3A6CL 3D39E 5DMGC 3ESVF 4FFYH 3KXFA 1J11A 1U93A 4KTDL 2LAGB 5GZNC 1XCQB 2FHBA 2ESVD 1PZ5B 3GBLA 4JDTH 2B8OT 1OGAD 4MQ7A 4DGVH 4LRIA 5SWZD 1KPUA 2OXHA 3HLAB 3RUGE 4PJ7E 4JM4H 4EKXA 1QHPA 3OKLA 3U7YL 2AXHA 2GSGB 1TNNA 3CFKB 4LQFH 4MXWL 3LOWA 1JI2A 4MJIB 3DX9B 4G42B 3IFNL 1D9KC 3MRFA 4JO3H 5DD5H 2CRIA 5FHAL 4GKZB 5D2LB 5IFJA 1XCQA 5IKCB 2R56L 3QRFM 1UENA 4BM7A 4GXVL 4KHXH 1WF5A 4Y19E 1D6VH 3AAZA 5E7BA 4MMXC 2OK0L 2AXFB 3B8YA 4PJBB 2D0GA 3B8SA 2OTUB 4HJJH 5I1CL 3IVKB 4N0UA 4ZUWB 2BOCB 1WZ1L 2GSGA 4PJ9A 1ZS8B 5A1AA 4L9LA 1GGUA 3F5WA 4IOSD 3T0EC 1CICB 3BE1L 1AQKL 1IGFL 1SQ2N 1OD7A 4G6KL 3DX9A 3MV01 4G42A 1MY5A 1C5DB 5C0AD 1X7QA 5DQJB 4C4KO 2DMBA 3JV4B 5HD8C 3KPSA 3CUPA 4H5SB 5C0DB 3RA7H 5IKCA 1II4E 4OGXL 4JCMA 4TNWK 5IVOA 3WFEH 2X1OA 1HXYB 3K4ZA 3EOAA 2O5YH 2R1YA 1IGTB 1I9IL 1JZ3A 3PDOB 1OLZA 2P46B 2VERN 3IKCB 2BOCA 4IRJD 5E7FA 2W0FB 4ZUWA 4CVZB 1CVRA 3SJVB 2ZOKB 1CICA 5FFLA 4JRYE 4JN1H 2H2SD 4OB5L 1MCQA 5CGMA 4H26A 1KLUA 5F3BB 5KJRL 3LRHA 3M8OL 3VXMD 1HXYA 2WM0A 4MS8D 3O6KL 3AS1A 3INUH 1PEZA 3CK0L 1TJHH 2VLRA 1JGDA 3L5XL 1BQHA 4N5UA 4JQIH 2ZOKA 1I8MA 5J11B 3C08H 5F9WB 3P9LB 4YX2L 3TPUA 1CT8A 4MJ2A 4XCCH 5SV3A 2L4OA 3MNZB 1JF5A 5SX5H 2P45B 3AMLA 4NSKA 4OKDA 4ISVB 1LVEA 2QR0B 4P4KC 1XH3B 5F8QC 3Q48A 1CDUA 1F4YH 4F9LA 2NZ9D 4OZFH 1EJOH 4M48H 3P11L 4G9FD 1I7RA 1F2XK 5GGSY 4BZ1H 4L9DA 3RZCD 3P9LA 4X9BA 5GJTL 1RVFH 1YEEH 1JF6A 1FH5L 5FF6A 1QACA 3P30L 4LHJB 4KKCD 3EFFB 1YY8B 1KYOK 1QKZH 2XXCB 4LLVB 4ISVA 1I1AB 2QR0A 4P2QD 2Y5EA 4HIIA 1UWGL 3MYZA 4IDJL 4D9RE 1XGQA 4ACPA 1BVLB 3GJFH 1U6AH 3BAEL 4JAMA 4PV8B 1UWEH 4QHNB 3MXWL 3MLZH 5EBMA 4WUUE 4NWUL 1GGCH 4MA1C 1KB5B 1P7QD 4IIQC 2F15A 3AREA 4HC1H 3KLSA 2QADB 4I18C 4M4PA 4OZ4B 3FT2B 4TULH 5FCSH 1MRCL 3ARXA 1I1AA 1SMAA 5J1SC 2X1WL 1F6AB 1XF2B 4YWGL 2C3GA 2VXTH 4N8CL 2VDPH 4BK5A 1T0MB 5BS0D 3G9VA 1K4CB 2APXA 4PV8A 4KVCH 4QHNA 1U8NB 4HGMA 1KB5A 1JPSH 5TE6H 1PVHA 4AL8L 5MHSD 3V9FA 1A7OL 4IRSD 2DMKA 1CS6A 2YRZA 4OZ4A 3FT2A 3DX7B 3MGOB 3MGAA 4N0CD 4NO0D 4U05A 4YDLB 3GSWA 5I15L 5I18L 4ZFZA 4N5EA 1DN0A 4LLMB 1F6AA 3DXAE 4H8WH 3IXTB 1CF8H 2J8UA 2X6MA 2FEDC 1T0MA 5E2VH 4LPXA 5E03A 4U1NB 2FR4B 4XHJD 2MNUA 4O2CA 1KCRH 2FBJL 2AJZB 2R0KH 1QTYT 5FYLD 2G9HA 5I1LA 3UTSD 1KELH 3KLHD 1Y0LB 1N0LA 1ZE3C 1B88A 5F9AC 1BEYL 3IGAB 3W82A 2ADGA 4S2SB 3BJ91 1A1MB 4RFNC 2EH8H 3MGOA 5BV7L 3KJ6H 2PW2B 4PD4K 1NMAL 1RZ7H 4GKNB 5EIVA 3IXTA 2EEBA 4Z95H 3SE3C 2NY1B 4U1NA 5C2UB 1J87A 4F7PA 3O8XC 1X3DA 2QSCH 3SDAD 2BXZA 4K7PL 5J12C 1TJIL 2Z91B 4PB9H 2PXYB 2YK1H 1K8IA 3QDGB 2WWMC 3SE8L 5KOVC 1NGPL 2ZNXA 1DUZA 1UZ8A 2D7TH 4C83B 2GCYA 4QYOA 3IGAA 2H8PB 1A1MA 3HCVB 1T5XB 4PUBL 1A7RL 3HFMH 3BD4A 1QNZL 1CXIA 4PJ8C 5ILTH 1SY6H 4FQIH 1FNSL 1BD2E 4UT7L 2ENYA 4HUWB 4N8VA 4AT6A 3CU1A 2DQEL 3C09C 1TIUA 3V0WL 1WGOA 4U3HA 4NC0B 1HSBB 2GFBB 5TQ2L 2UZXB 4PY8I 1XF1A 1I7UA 5DJCB 5HGHB 4JG0H 2PXYA 1UM4L 3OKOB 3EYUL 1T22A 3O11A 3VFUB 1EAJA 3EKCA 1A2YB 1AGCB 3JWDC 3DTXB 2H8PA 3HUJA 1OAKH 2YA2A 3HCVA 3AGVA 1T5XA 3RNQB 4HMDA 2A6DB 2RCSL 4LSVL 4S1DD 1WIPA 1N5YL 1KT2B 3LPFA 1J10A 4NZTH 4WTWA 5KVDH 3X11B 3UJTH 1IE5A 1EHAA 3HUJF 4W4NA 5D1ZC 5DJCA 5MEQB 1A6UL 3FZUD 1MRDL 1H9VA 5EU6B 4NN7B 1QOKA 3VFUA 1ZHNB 1PDKA 2X70A 1AGCA 4HFUH 3DTXA 4MQTB 4QLRA 4ODWA 4G8GE 1MSPA 3Q5OA 2E7CA 5GS0C 4EVNB 4Z8FH 1DQMH 1CXFA 1F4HA 2A6DA 4R0LC 1INDL 4MJ5A 3BPCA 4YHNB 3EZJB 2F5BH 1RPQA 4Y4KD 1AP2B 3C5ZC 4PJFA 4YQXH 5TPWH 2F5AH 2E9JA 5CHNB 3EFDL 3C9NA 4X7CC 5JDJA 1OTTC 3BKML 3GSOB 5EU6A 4DTGL 1T2JA 3SDCC 4J8RA 5D9SB 1ZHNA 1E27A 3WDIA 4XPGH 4J3TA 2ZP0T 4HCRH 1DBMH 3IFPB 2NW2A 4JY6B 4XPBH 4DKDC 4EDXB 4NM4H 3V7AE 4GRLC 5CJQL 5BRZB 5K9OA 3QPQC 1XGTA 1CLYH 1PY4A 4YHNA 5JIKA 1ORSB 3CIQA 1CL7I 3WLWD 2VXQL 3SE9H 4M5ZL 4LEXH 4H1LG 2NY5H 4F7TB 2D7QA 5EDXA 2YD2A 4WFHD 3RWJA 5HI4D 4NZRH 1RJCA 1JNNL 5FYLH 4YZFF 1GGBH 4JY6A 2FDBP 3CC5A 3ERYA 1FO0H 5BRZA 4UMGA 2QSQA 1LDPH 5JOPD 5J13B 3IDJB 3W0WD 3RDTD 2IBZY 3PL6B 4LPYA 1LO5A 3ROOB 2NXZB 4P9ML 3IDIA 4PY8J 1MJUH 3C87A 3T0AA 5TFSL 4ZAKB 1YA5A 4F7TA 1K2DA 2FX8H 3MLXL 1MRFL 3D39B 5C0ND 1DLFH 1MREL 4P5TD 2OP4H 4JDVA 1Q94B 3KVQA 1L7IL 3MGTB 3MYJB 3MMEA 2AK1L 4WFFE 1VDGA 1RURL 1MIEL 2K1MA 5DURD 1LGVA 2VC2H 1V3KA 3PP3H 3SQBA 5I1AB 3LQAL 2XG5A 1U3HC 1SEBB 1UT9A 3PL6A 3A6OA 3M07A 3ROOA 1SBBA 5T5NF 1IC4L 2BK8A 4E0RB 3TBVB 2ICWI 4XNQB 4ZAKA 1A3LL 3VFNB 4HWEH 2Q8AL 3D39A 5IROC 3QUMB 3PGDB 1Q94A 4CU6A 4WHCA 1CLCA 3FFCB 5FYJL 3X3FL 1J9CT 4GFTB 1GAFL 1JRHI 4YHML 4HJGA 4ZUVA 1AO7E 1EZVY 2CDEB 3WS3A 5CSZB 5I1AA 2HVKB 4APQD 4JFEE 2VLKB 3RUGA 1SEBA 4PJ7A 5I1KH 1Z5LA 1JWSB 5DDHA 3TBVA 2C3VA 2D3VA 2I9LA 1CIUA 2D4FA 2FJFB 4NOFA 2YMXL 1CDYA 4JRXB 3SDDC 3QUMA 1ACYH 3QWRA 2VH5H 4P48A 4XPFL 2BHUA 3NN8B 5IHLB 3P0VH 4JB9H 5EO1B 4ODTH 3RUGF 1Z0MA 5J4MA 3JWOH 5GGSA 2E3VA 4UI2A 4Y19A 4NP4H 1F8TL 5JTWA 2CDEA 2AQ2A 4JFZL 4XVUD 5CSZA 1S7WB 4X7DC 2ZUWA 4C4KT 3OL2A 1T7ZA 5IVXB 1JWSA 1JPGB 5E1AB 3GKZA 2B4CC 3QIBC 4KQ3H 1U41A 3C2AL 2BNRD 3KXFD 1N8ZB 2DQGH 5IOPB 2FJFA 3D85A 5IB3B 3HS0B 4HH9B 5EO1A 3WFHB 2R4SH 2VABB 3WL9B 1BM3L 2DQTL 1BBDH 3B9KC 1SVCP 3ZTJG 2CKBH 3QDME 2CD0A 1CL7H 4ZFFA 4JFQA 3LV3B 3WDJA 3L5JA 4WW2C 5D1QA 5EO9B 3RX7A 5D72H 5I75B 5E1AA 1F45A 4G8FA 1N8ZA 4FQCL 4KRLB 1MFDH 4HIHA 4WNQA 1U8PB 4FNLL 5AG9A 4TNVF 2AGJL 2YBRB 3HS0A 4JRYA 5F44A 4HH9A 4IJ3C 4UILL 4O4YH 2VABA 4UIKL 3WL9A 3VXQA 2YA0A 1IMHC 1GC1C 3DPBA 4UV7H 3L3DA 2V9TA 3AS0A 3ARFB 4PJ9D 3LV3A 3MFFB 4U1LB 4GRMB 1SJEB 3HAEB 2WY3A 3W9EB 1RZFH 1ETZA 4PRPE 3GMNB 4CN6A 4GQPH 2N4IA 3LD8C 2P8LB 2WQ8A 3UCRA 2YBRA 1V3MA 4KTYA 5GRXG 2G5BA 5F7DB 3RTQB 3RKPA 3CFBA 1F4WH 4NC2B 5CEZE 3IFOB 3LMJL 3G5XB 2VO5A 1T7VA 1CTNA 2BVEA 2EYTB 2YEZB 3ARFA 4Z7QE 5DA0B 3RWHB 3QR2A 5CP3A 4GRMA 5D2NC 1SJEA 3A67H 1CICD 4WY7H 4KI1A 4FABL 3KPOA 5MI0B 2Y6SD 2JCCB 3W9EA 3MUGA 4MZ2A 3GMNA 4F37K 1VENA 2KL6A 1IAIL 2W59A 5E8EA 3DO3A 1MCSA 4RQQB 5C0RL 1JRHH 3CLFL 4MNHA 4YO0A 4KDTC 3RTQA 2KKQA 3F58H 3WO3B 1DBKH 3NA9L 3L7EB 3ARBC 2VLMD 4WHTB 3G5XA 2EDXA 2XA8H 3VH8G 4B53A 3MNWB 3QH3B 4I3RH 1FFNB 2YEZA 1JPST 2DM2A 2VLRD 4UOW1 3RWHA 3SJVD 1C5CH 1VGKA 5FHBL 3ZTNL 4XP5L 2X42A 4M03A 3HMXA 4WUUA 3RX8A 5IR1A 1D9KB 2B2XH 4RQQA 9CGTA 1K6QL 5AYQA 4PGDA 4ZXBC 5SX5K 4BA8A 1ND0B 5MERB 4AEIL 3IFLH 4NNXB 3L7EA 2L0DA 4NJAH 4WHTA 3MNWA 3QH3A 5E2WH 2CRYA 1DFBL 5CSBA 5K9JH 2DLEA 3D69B 4TRPL 1B3JA 1YQVL 1YEHH 3HE7C 5GS2D 2P5EE 3T0EB 3U79A 3V0AC 4JHZA 3C8KB 4JKMA 5TE4L 1KIRB 1UKQA 4HUVB 2R0WL 2X9XA 4WGWB 5IUSA 1URLA 5HVGB 3EBAA 5H37H 5EBLB 7CGTA 4ODUA 3QCUL 5IMMB 4Q6IC 4OM1L 3TWCH 1IEAA 3GJFK 3DXAA 5CGTA 1MLCB 4IMKC 3CMOH 1JN6B 3BGFC 5IFHL 4Y8DC 1PKOA 3FRUB 3WEXB 2C7UA 3C8KA 4ZSOE 3ARED 4S1SL 3LB6D 3PQYA 4HUVA 4MDJB 2UY7A 5B4MD 4QOKE 1YNKH 2JIXA 4OLXH 5EBLA 1I1AD 5AZEH 3MBXL 5IMMA 4R90H 5KZCB 3NAAL 5HYJE 5DI8A 4XNZB 1WFOA 1G7MB 5JXEA 2X40A 4WI5A 2YWZA 3X14B 2JELH 3KPMB 4J3VA 1N5AB 1K5NA 5DJ6A 4XVTH 1X5AA 3EJYC 5HI5C 4QTIH 2QADD 3S5LG 4DKFL 5EBWB 2QHLA 3QEHB 3LRSA 2FIKB 3CDCA 5DJAB 3SGDI 4OIIL 4DVBB 2VQTA 2HT3C 1LO2H 3QCVL 3L5HA 5E2TH 4OBRA 4P4KB 4HG4J 1T6WA 4DN3L 2VRAA 2J3SA 1ZLVH 1S9YB 4G6MH 1CE6A 4X4ME 3JTTB 3WN5C 3AY4A 1G7MA 5FKPA 1HHGB 1BD2A 4HUUA 2VSCA 1EO5A 2VN7A 1M7IB 1JGEA 4NRZA 4UOJA 3MXVL 3H3BC 3VXNB 1C7TA 1CIDA 4Q58C 4HH8A 2JJSA 3IJHB 1JNLL 1DEEA 5DJAA 2BJML 4HFWB 2GK2A 4OLYL 4JO2L 3GB7B 1MFBL 4JVPA 5ELIA 1GJIA 5IBUB 4RNRB 3FQNB 2HVJA 2O5XH 3MRNB 4KMTL 4P4KA 3PWPB 3CZFB 4KK8C 2XZCH 3ZE2E 2NX5E 5CUSH 4KQ4H 5FIEA 4M43L 5H2BB 2EYSB 4OCLC 3HNVH 5JHLH 1BFTA 5E5MB 1IGMH 4MA1B 3VXNA 3O3EB 4P0DA 1W8NA 3F7QA 4IIQB 5C0BE 1H8OA 1L7TH 3IJHA 4GBXC 3S37X 3WJLC 4NJ9H 1RD6A 5T3XD 3H3PH 1GOGA 4NQSB 4I18B 4CU7A 1CN4A 3IDUA 1T89A 3FQNA 4NQEB 1JUFA 4G8GA 4HKXB 3CZFA 3WD5L 1EERB 5IJVB 3VW3H 3BZEB 2NY1D 2XQBL 2ATPA 2NY0B 2EXYD 4A2LA 2EYSA 2MPAH 2PXYD 3QDGD 2QQLH 4XP1L 4U1HB 5F9OH 3NABL 1G7PB 1BFVH 3PUCA 5JHDE 5AD0B 5GS2H 3MRJB 5CZVH 3B5GA 1CFVL 2J6EL 2IBGA 4JFHD 3UDWA 4MD0B 2X41A 5EU4A 1XGYL 4HKXA 4HWUA 4Y88A 3U2SB 3IDXH 1MCIA 3BZEA 2FATL 2ZUSA 1V7ML 1NH6A 1WCBA 1KCSL 1U3YA 4R4NC 3MOAL 4OSUL 2BNUB 3BDYH 2DBLL 1Z9LA 1WTGT 1YYML 1ROWA 1ODAA 3RWEA 1JGUH 4OT1H 1FLRH 3TH4T 4KTEL 5AD0A 4MHHG 3WUWA 3WSQL 5HSFA 2M1KA 3Q6FB 5E4EB 2YD9A 3B83A 2F58H 5DJ0A 4RFNB 4XBEH 3L5WA 4OFDA 4QGYA 3U6RB 5CBAB 4QRQB 1H3UA 1IFHL 5EWIH 3RWCA 1N26A 3QHFL 4NPYB 3HRPA 5FYKU 5GRWA 4RRPA 2EDHA 3DUUB 4P2YA 4OD2B 3CNKA 3O8XB 3RVTC 5J12B 5EU6D 4OF0A 4WI9A 4XNXL 1OWWA 2OMNA 2BFVL 1NCWL 3E2HA 1NBQA 3SGDH 1KTLA 2DJSA 3CFIC 1KB5H 1KG0A 5D5ME 4GSDL 2R23B 1TETH 3HZMB 4NRYB 1JYXA 1A02N 1S7TB 3DRQB 4QRQA 1Q9KA 3P4OB 1YEIH 3N1MC 2EXWC 3U0TA 1E4KA 4PJ8B 1AO7B 1Y18B 3C5SB 4V2BA 3WHE1 3MRMA 3TVMC 3C09B 4OD2A 3C6LC 4ELME 1ZA6B 5EIQA 1T1XB 5LGHL 3HPJB 4KH2A 4XZUB 1P84J 4M93C 1IQWL 2AXGA 1W72L 3BGAA 3DGGB 3FQXA 1AFVH 4HKZB 1HWGB 4NRYA 1INEH 5BRZD 4IRZL 5CD5C 1RZJC 2GTWB 4D94A 4ODVH 4PJ8A 1AO7A 1BFSA 1Y18A 3C5SA 2NY2C 5GZOD 5EA0L 4KROC 2WINA 4JFEA 3MLVL 3UAJC 3ZKSD 1WWBX 3PHSA 4CAGA 5D96C 1NL0L 1R3HB 4PRIE 5D1ZB 2RQ8A 1T1XA 4PGJA 3HPJA 2R2BB 4CRPA 2X9YA 5I19H 1P4IL 5E9DA 2ZCLL 4KK9C 3FOMB 1IM3A 1H3XA 4KKAD 3PP3K 4L1HA 4LP4A 1X5KA 5T3XH 1WICA 2GTWA 4MJ4A 1UACL 4D3CH 3SO5A 4R0LB 3VGAC 3PL6D 4LCIH 3QDMB 4P2CG 4HLZG 2DQCH 3C5ZB 4JHWL 1NLDL 5AYUL 5HGBB 3ZKMD 4ZAKD 3SDYL 1EV2E 3D39D 4DGIH 4ERSH 3V4UH 2R2BA 4HS3A 5C0IB 5CJBA 5IIEA 3SDCB 2RJMA 4PRDB 1J8KA 4OLZL 5EZIL 3FOMA 3BKYL 5T3ZE 5F7EL 5KTEH 4DVRH 3TV3L 3D3VE 3V6OA 4MNQB 4GRLB 1JK8B 4HV8B 3BN9D 4NNPH 3QDMA 3PWUB 5ACLA 2GY7B 3CXHJ 4P4RA 1LHZA 3QCTL 4XNMA 4Z5RB 1OT1A 5IHZA 2JTDA 2W91A 3MLUH 3IAQA 3QWRD 4ZUSA 3FFDB 4B5EA 1L0YA 3SDCA 4W4OA 4YHPB 2XQYG 1F6FB 1XAUA 2A6KB 1HHIA 1IZJA 4M6OH 2NY3C 4Y19D 3S37H 3TYGH 1JFQL 3IB4A 1AHWC 2UUDH 3DV4A 3R1GH 4R97C 4HJ0D 4GRLA 2V2TB 3U9PH 2O61A 1JK8A 1QG3A 4XVSL 1H0DA 3L1OL 1R0AH 3ALXA 2VQUA 3EJJX 1QLEH 2CSPA 4JANA 2YZ1A 1W0VB 2HMID 1G6RB 2YHGA 4PRPA 1A9BA 3WBDA 3FFDA 1OLLA 1IAMA 3VD7A 3DVNB 2A6KA 3WFDL 1MFNA 3ABZA 4RAUB 3K4DA 3TH3T 1N7MH 4EUPB 5CEYA 3GMOB 4NHCL 3F7VA 12E8L 4PDCE 4G7YL 3EYVB 1QQDB 2V2TA 2K7QA 2IC2A 1LK2B 4YXLL 4TTDD 1YPZE 1A7QH 4MZ3A 1RJZA 3LH2H 1U3HB 3LKQB 1Z9MA 5C2BH 5GSVB 5GIRB 4ZFGL 1JMZA 1H5BC 1RFDH 2X4UA 1ZLSH 5K9QI 1G6RA 1OAXH 2P49B 5DMKA 1AR1D 4BSJA 3P3YA 4JRYD 4KJYA 5KS9E 4M7KL 2YD7A 3DVNA 1HNFA 2W9DH 4U1SA 25C8L 1IAIM 4RAUA 4MAYA 1FAIL 4Q97A 4Z7QF 1VFBB 3AB0B 1QRNE 3EYVA 1QFUL 3U0PB 4JFFE 2Q3ZA 3QXUA 2PCPA 3TEUA 2GQHA 3JVGC 1MAJA 1OHQA 4F58L 3FL7A 4LIQH 4WTZA 3IU3B 3LKQA 4PYGA 4YDKH 3TT3H 4KAQL 1NEUA 4TUJB 5LAXB 3BN3B 5JZ7D 4KK5C 1FPTL 4EEEA 1J0HA 2OX5A 1CLOH 2P5EB 5GHWL 3SKMA 5F1IB 3BUYB 3SDDB 3KYKH 1HHJB 2GTZB 4F9PC 3QUZA 1JGLH 2VNCA 4NFCA 1VFBA 5FO8B 4L5FL 2J12B 4S1QL 1MEXL 5T33H 4AG4L 1M71B 3MO1B 3U0PA 3ARFD 1MVUB 3O6FC 1V3JA 3BO8B 5FUZH 2DTSA 3QEQE 2W07A 4Z7UE 4UTBL 1YMHB 5LAXA 1EPFA 4LPCA 2XWJB 2P5EA 3MA9L 4Y2DA 3RTQD 3U7YH 4JO4L 3UBXB 2XOTA 3ME0A 5DC0A 4M5YL 4MXWH 5DUPL 3AFLA 3NIDE 3L7FA 3B9KB 5C08E 3MROB 1MVUA 3IFNH 1J7VR 3LS4H 5FHAH 4GXUM 4D9RD 4WW2B 5HYJB 5CCKL 1YMHA 3BP5A 4GXVH 2AJVL 3LN5B 3SN6N 3HR6A 4FQXC 2OK0H 4WUUD 5IB5B 2XWJA 3ARVA 2EYRA 1E4WL 5GZND 5I1CH 4M6MH 5F9JA 4PLKC 4QT5A 4ZSOA 1VFOA 1WZ1H 4PG2C 3UBXA 4K7PX 3QXAB 3GSNB 1MH5B 3QUMH 3VXUE 3P9MB 1V05A 2BHYA 3GJEB 4M1GH 4QOKA 1TVDA 1AQKH 1IGFH 4G6KH 3C2SA 3MROA 4NN5B 1WITA 2UV3A 2V17H 1Q1JH 5DRWB 3E8UL 4OGXH 4LKXB 4LLDA 3ZKQD 1ULVA 3LN5A 2HJFB 2NMSA 3ES6A 1HHKA 4AK1A 1D9KD 3T04D 5IM7B 3R06A 1I9IH 2NNAA 3X3GL 5D1XC 1FCGA 1U2CA 4YC2B 5BW7C 1RUKL 2GUOB 2IANB 4WW2F 3QXAA 3GSNA 1X5LA 5DVNA 4LOUD 1NAML 3MSPA 4QRRE 4U0RC 5AWNH 1WBYA 4LLUA 1FDLL 3DXAD 4AIZB 1DP0A 3FO1B 5DRWA 1I1FA 1YMMB 4OB5H 2NX5B 4X4MA 3RJDA 3S7GA 1CI5A 5KJRH 3M8OH 1IAOB 1QYGL 4OQ1A 4MB5A 5C1MB 5DJDB 1MHHA 1ONQB 2IBZX 3BIKA 3CXDH 3CK0H 4YJZL 2Q76B 1NMBL 1UCBL 4X99B 3L5XH 5DO2C 3ARBB 1A4KB 4LCYB 1UXWB 2D2OA 1G6VK 4YX2H 1T2QH 5E95B 5JXED 3BHBA 2DDQL 3FO1A 2YN5A 2NX5A 5C0JA 3CU7A 5IJKA 1IAOA 3OKKB 2Y1VA 5DJDA 3VDBA 2MHAB 4U49A 4F7CA 1ONQA 2CK2A 4P3WA 3RL1A 4ZXBB 4ODXB 4PTUA 5C0BA 5JHDB 3LKNB 3ZE2F 3IAPA 3EUUA 4OAWB 4LCYA 1ZLVK 1UXWA 5KZCD 1S7VA 3P11H 4HHAA 1MHEB 3VXOB 1PW3A 3V8CA 1A47A 5GJTH 4Z78B 2J6EA 1FH5H 3DROB 1BD2D 4PGBB 1NGXA 4BFIA 3P30H 3HE7B 1JZ4A 4M7JL 5CP3H 4OLEA 3BPNC 1BIIB 1Z9OA 1A6ZB 3OKKA 2MHAA 4L3EB 5D7KE 4RISL 4ZXBA 1UWGH 2X9WA 4IDJH 4ODXA 2QBWA 1HXMB 1O7SA 3MRKB 3O4LE 4HG4K 4YK4C 4U7KA 1FC1A 3QIWB 1IBGH 3BAEH 4OAWA 3MXWH 3OX8B 1I9RH 4P4KD 3QPXL 3NIFE 5HHOE 4NWUH 3V5DB 4A2MA 2OCFD 4Q6IB 3VXOA 2H41A 3OWEA 1ZLWH 2FGZA 2LFGA 4GXUN 3STLA 2CPCA 2OS7A 5MENE 5DD1H 3HE7A 3BGFB 3OR6B 3QB7C 5HI3C 1MRCH 1KJVB 4HMEA 1A6ZA 3WLBB 3FB7A 3BFOA 4XWGH 3HMXH 4YWGH 4N8CH 3F7PC 2OTPA 4XX1E 2BY2A 3QIWA 3KPLA 4G8GD 5D5MB 3OX8A 4Q0XL 1QZ1A 2R1WB