1FG5N

Crystal structure of bovine alpha-1,3-galactosyltransferase catalytic domain.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
277
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Bovine alpha1,3-galactosyltransferase catalytic domain structure and its relationship with ABO histo-blood group and glycosphingolipid glycosyltransferases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 75
structure length 277
sequence length 277
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2000-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1fg5N00
1FXOA 4IRQA 5C3AA 2XMHA 4D48A 2FY7A 1VH3A 2OEFA 2GGOA 2WAWA 5AJOA 2D0JA 2AH9A 3T7OA 1ZCVA 3OKRA 1H7FA 5IFYA 3KIAA 3RSBA 1GWVA 1TVYA 3V8ZA 4AAWA 5I1FA 2UX8A 1MP5A 3I0KA 4EE5A 1LL2A 3K8EA 4J18A 3SX7A 4Y62A 2E8BA 3U0YA 2ZU9A 3CKJA 4FCEA 2D7IA 2V0IA 1VM8A 3D5NA 1H7HA 3V91A 4HO5A 4NAKA 4BMAA 1NWGB 1WT1A 1G2VA 3OH1A 3V0PA 4IRPA 2VSHA 2VXLA 1JYKA 2CU2A 4KPZA 4KC4A 5FU8A 1NMMB 5FTSA 1HM9A 1R7UA 1JVGA 1O7QA 1ON6A 4KNRA 1FGXA 1FOAA 4FRQA 5C4DA 1VGUA 2YQJA 4HCQA 2XWMA 2JCOA 4MNDA 3U0XA 5C4BA 1MC3A 4EE3A 5CMFX 4G3QA 3U2TA 3SXAA 4G3PA 1O0RA 4DDZA 1FR8A 3NGWA 1WT0A 1ZDFA 2W0WA 1ZJ1A 2APCA 2V0LA 4Y7TA 2VSIA 4ECMA 4FQWA 5IDTA 4CVHA 5C4CA 5CMIA 4FREA 3U2XA 2Y4JA 4B3UA 1ZIZA 1S4PA 5CQPA 1ZI3A 4M2AA 2P73A 1FRWA 3F1YA 4B4MA 2BO6A 1G23A 3CGXA 2P6WA 4LW6A 3R3IA 2QKXA 1O23B 5FUHA 4JD0A 3U2WA 3D8VA 1QGQA 4CJCA 4AC3A 4B4GA 5CQLX 1NKHB 1NQIB 2FYCB 2FFVA 2PGYA 2JCLA 3V90A 1IINA 1VPAA 4D11A 1PZYB 4HO0A 5DDTA 1H5TA 4JISA 3SX8A 1VGZA 1H5TB 1H7LA 1H5RA 2PGVA 1G93A 5CQOA 1ZJ0A 2OI5A 1H5RB 1YP3A 2X5SA 4Y7VA 3BRKX 1FGGA 1H5SC 1XHBA 1R7YA 2V0HA 3FOQA 1HM8A 1YROB 3ST8A 5C4EA 4M28A 4FRLA 4B2XA 1WT2A 1G8OA 2ICYA 1R7TA 2GGQA 1ZCTA 1ZI1A 4HO8A 1GX0A 1ZDGA 5CQMX 2XMEA 1W55A 3I0LA 1R7XA 2RJ6A 2WGZA 2Y7AA 4ASYA 2Y6PA 5CMGX 3R2WA 2PX7A 2NXVA 4FRMA 2RJ9A 5C48A 4L41C 5JQQA 4KRVA 4KXOA 3JUKA 1G1LA 3EE5A 3SX3A 3Q7UA 3TQDA 3I0HA 4ARWA 3IOHA 1TW1A 2OI7A 3V0OA 2RIYA 2WVLA 4KPXA 3USRA 3CKNA 2JCKA 5DDVA 2VFZA 3Q4SA 3IOJA 4B42A 4P00A 1LL3A 1FWYA 1JVDA 3OH2A 4FRDA 3POLA 3OH3A 2Y4LA 3CKQA 2YQHA 1FG5N 3SXEA 2X65A 4KC2A 5FTVA 1ZI4A 4GBPA 5C8RA 4EEOA 2YC5A 4HG6A 1LZ7A 3E25A 4Y63A 1FXJA 1NHEB 2RJ5A 2YC3A 1SS9A 3LW6A 5C49A 3SXGA 5AJPA 1QGSA 3N9WA 1TZFA 1LL0A 1GQ9A 2Z87A 4YS8A 1ZJ2A 2A8UA 2X60A 1VZXA 3CKVA 3HL3A 4Y7FA 1QG8A 2V0JA 3FWWA 4HO3A 3SXCA 3I0IX 1ZHJA 1H7TA 1H5SB 3I0EA 1S4OA 3TZTA 1G95A 2VS4A 3DK5A 4KQLA 2QH5A 3IOIA 1EYRA 2AM3A 3PKPA 2QGIA 1HJLA 2MZBA 4FRHA 5CMJA 2Z86A 2XWLA 3ZLLA 2FYBA 3DUVA 1Z90A 2AECA 4P02A 2JCJA 5C1HA 2WEEA 1GQCA 2YESA 1EZIA 5L6VA 1H4CA 3CKOA 3K8DA 3I0CA 1E5KA 1OMXA 3ZGFA 4EEAA 3JUJA 1VICA 1PZTA 2FFUA 2AGDA 3RMWA 2FYDB 2RJ1A 5FYEA 5C4FA 1R81A 2I5KA 3V0QA 4UEGA 2WVKA 5C36A 3PNNA 1IIMA 1LZIA 4EE4A 4Y64A 2I7BA 2Q4JA 5EJZA 4EEGA 1QWJA 3CU0A 1GX4A 4Y7UA 2VXMA 4E1KA 2WVMA 3D98A 1H4EA 4HO2A 1V84A 4D0ZA 2VS3A 2E3DA 4Y6NA 5L6SA 4EVWA 5C3DA 1MP4A 1LZJA 3I0FA 5IDSA 1INJA 5EJ1A 4ASJA 4CJ8A 1I52A 2OEGA 3GUEA 4EEMA 3V0NA 1H7GA 1FO8A 2O1FA 4G3SA 3SXDA 2Y4KA 2YQSA 3I0GA 2ICXA 3OAMA 1V83A 2P72A 2WE9A 4Y6UA 2A8WA 2DPWA 1VGTA 1LVWA 3V0MA 1R80A 5FU0A 2VD4A 3O3PA 5HS2A 2AE7A 4LW3A 1JV1A 1VGWA 1NF5B 2RIXA 4D0TA 4Y9XA 2RJ8A 1ON8A 4CJBA 2RITA 3SX5A 3V8YA 5EIYA 1H3MA 3U2UA 4DE7A 2BO4A 1WSZA 2VS5A 2OI6A 1INIA 3F1CA 1HV9A 1O7OA 4D11C 3SXBA 4K6RA 3I0DA 3ZF8A 4G87A 3BCVA 1G9RA 5C3BA 4NALA 5FV9A 3OH4A 1TW5A 5CMHA 4Y7GA 4KT7A 4AYLA 4R7PA 1YP4A 1GA8A 1G97A 1H4DA 5C1LA 4B5BA 4FRPA 1FZWA 3E26A 3I0JA 3ZLKA 1H5SA 2X5ZA 3QVBA 1FO9A 4FCUA 2O1GA 1JV3A 5BXCA 2V0KA 1HJJA 1G3LA 1R7VA 4B4BA 2YCMA 1OQMB 3SPTA 1YP2A 1FR9A 2W0VA 2D7RA 3T7MA 1MP3A 3Q80A 5C1GA 5AJNA 1K4VA 2RIZA 3USQA 5J49A 1WT3A 1R82A 4KNXA 3U2VA 2AM4A 1HM0A 2AM5A 3JTJA 3V0LA 4M4KA 3PKQA 2RJ4A 4XWIA 1VZUA 4M2BA 1S4NA 2PA4A 1JYLA 1ZI5A 4FROA 2AESA 1W77A 4FRAA 3OH0A 2RJ7A 4BQHA 2BO7A 1VZTA 1OMZA 1H5SD 2YQCA 1ZCUA 1ZJOA 5CQNX 2ZU8A 1LZ0A 2FYAA 1KWSA 1WVCA 4ZDQA 4HOCA 4NANA 5C47A 5C38A 4MYBA 1ZJ3A 2ZU7A 1G0RA 1W57A 2Y4MA 3OGZA 1GWWA 3OC9A 4HO9A 4FRBA 4B2WA 2O1HA 3T7NA 2I5EA 4KC1A 4NAIA 4HO4A 3ZGGA 2XWNA 3DJ4A 4HO6A 1XZ6A 1H7EA 4DECA 1ZCYA 3RMVA 2RJ0A 4AYJA 1V82A 2BO8A 4C2SA 1H7QA 1VH1A 1ZJPA
chains in the Genus database with same CATH superfamily
1FXOA 4IRQA 5C3AA 2XMHA 4D48A 2FY7A 1VH3A 2OEFA 2GGOA 2WAWA 5AJOA 2D0JA 2AH9A 3T7OA 1ZCVA 3OKRA 1H7FA 5IFYA 3KIAA 3RSBA 1GWVA 1TVYA 3V8ZA 4AAWA 5I1FA 2UX8A 1MP5A 3I0KA 4EE5A 1LL2A 3K8EA 4J18A 3SX7A 4Y62A 2E8BA 3U0YA 2ZU9A 3CKJA 4FCEA 2D7IA 2V0IA 1VM8A 3D5NA 1H7HA 3V91A 4HO5A 4O6NA 4NAKA 4BMAA 1NWGB 1WT1A 1G2VA 3OH1A 3V0PA 4IRPA 2VSHA 2VXLA 1JYKA 2CU2A 4KPZA 4KC4A 5FU8A 1NMMB 5FTSA 1HM9A 1R7UA 1JVGA 1O7QA 1ON6A 4KNRA 1FGXA 1FOAA 4FRQA 5C4DA 1VGUA 2YQJA 4HCQA 2XWMA 4FIYA 2JCOA 4MNDA 3U0XA 5C4BA 1MC3A 4EE3A 5CMFX 4G3QA 3U2TA 3SXAA 4G3PA 1O0RA 4DDZA 1FR8A 3NGWA 1WT0A 1ZDFA 2W0WA 1ZJ1A 2APCA 2V0LA 4Y7TA 2VSIA 4ECMA 4FQWA 5IDTA 4CVHA 5C4CA 5CMIA 4FREA 3U2XA 2Y4JA 4B3UA 1ZIZA 2C0NA 1S4PA 5CQPA 1ZI3A 4M2AA 2P73A 1FRWA 3F1YA 4B4MA 2BO6A 1G23A 3CGXA 2P6WA 4LW6A 3R3IA 2QKXA 5D92A 1O23B 5FUHA 4JD0A 3U2WA 3D8VA 1QGQA 4CJCA 4AC3A 4B4GA 5CQLX 1NKHB 1NQIB 2FYCB 2FFVA 2PGYA 2JCLA 3V90A 1IINA 1VPAA 4D11A 1PZYB 4HO0A 5DDTA 1H5TA 4JISA 3SX8A 1VGZA 1H5TB 1H7LA 1H5RA 2PGVA 1G93A 5CQOA 1ZJ0A 2OI5A 1H5RB 1YP3A 2X5SA 4Y7VA 3BRKX 1FGGA 1H5SC 1XHBA 1R7YA 2V0HA 3FOQA 1HM8A 4Q7CA 1YROB 3ST8A 5C4EA 4M28A 4FRLA 4B2XA 1WT2A 1G8OA 2ICYA 1R7TA 2GGQA 1ZCTA 1ZI1A 4HO8A 1GX0A 1ZDGA 5CQMX 2XMEA 1W55A 3I0LA 1R7XA 2RJ6A 2WGZA 2Y7AA 4ASYA 2Y6PA 5CMGX 3R2WA 2PX7A 2NXVA 4FRMA 2RJ9A 5C48A 4L41C 5JQQA 4KRVA 4KXOA 3JUKA 1G1LA 3EE5A 3SX3A 3Q7UA 3TQDA 3I0HA 4ARWA 3IOHA 1TW1A 2OI7A 3V0OA 2RIYA 2WVLA 4KPXA 3USRA 3CKNA 2JCKA 5DDVA 2VFZA 3Q4SA 3IOJA 4B42A 4P00A 1LL3A 1FWYA 1JVDA 3OH2A 4FRDA 3POLA 3OH3A 2Y4LA 3CKQA 2YQHA 1FG5N 3SXEA 2X65A 4KC2A 5FTVA 1ZI4A 4GBPA 5C8RA 4EEOA 2YC5A 4HG6A 1LZ7A 3E25A 4Y63A 1FXJA 1NHEB 2RJ5A 2YC3A 1SS9A 3LW6A 5C49A 3SXGA 5AJPA 1QGSA 3N9WA 1TZFA 1LL0A 1GQ9A 2Z87A 4YS8A 1ZJ2A 2A8UA 2X60A 1VZXA 3CKVA 3HL3A 4Y7FA 1QG8A 2V0JA 3FWWA 4HO3A 3SXCA 3I0IX 1ZHJA 1H7TA 1H5SB 3I0EA 1S4OA 3TZTA 1G95A 2VS4A 3DK5A 4KQLA 2QH5A 3IOIA 1EYRA 2AM3A 3PKPA 2QGIA 1HJLA 2MZBA 4FRHA 5CMJA 2Z86A 2XWLA 3ZLLA 2FYBA 3DUVA 1Z90A 2AECA 4P02A 2JCJA 5C1HA 2WEEA 1GQCA 2YESA 1EZIA 5L6VA 1H4CA 3CKOA 3K8DA 3I0CA 1E5KA 1OMXA 3ZGFA 4EEAA 3JUJA 1VICA 1PZTA 2FFUA 2AGDA 3RMWA 2FYDB 2RJ1A 5FYEA 5C4FA 1R81A 2I5KA 3V0QA 4UEGA 2WVKA 5C36A 3PNNA 1IIMA 1LZIA 4EE4A 4Y64A 2I7BA 2Q4JA 5EJZA 4EEGA 1QWJA 3CU0A 1GX4A 4Y7UA 2VXMA 4E1KA 2WVMA 3D98A 1H4EA 4HO2A 1V84A 4D0ZA 2VS3A 2E3DA 4Y6NA 5L6SA 4EVWA 5C3DA 1MP4A 1LZJA 3I0FA 5IDSA 1INJA 5EJ1A 4ASJA 4CJ8A 1I52A 2OEGA 3GUEA 4EEMA 3V0NA 1H7GA 1FO8A 2O1FA 4G3SA 3SXDA 4FIXA 2Y4KA 2YQSA 3I0GA 2ICXA 3OAMA 1V83A 2P72A 2WE9A 4Y6UA 2A8WA 2DPWA 1VGTA 1LVWA 3V0MA 1R80A 5FU0A 2VD4A 3O3PA 5HS2A 2AE7A 4LW3A 1JV1A 1VGWA 1NF5B 2RIXA 4D0TA 4Y9XA 2RJ8A 1ON8A 4CJBA 2RITA 3SX5A 3V8YA 5EIYA 1H3MA 3U2UA 4DE7A 2BO4A 1WSZA 2VS5A 2OI6A 1INIA 3F1CA 1HV9A 4O6MA 1O7OA 4D11C 3SXBA 4K6RA 3I0DA 3ZF8A 4G87A 3BCVA 1G9RA 5C3BA 4NALA 5FV9A 3OH4A 1TW5A 5CMHA 4Y7GA 4KT7A 4AYLA 4R7PA 1YP4A 1GA8A 1G97A 2J0BA 1H4DA 5C1LA 4B5BA 4FRPA 1FZWA 3E26A 3I0JA 3ZLKA 1H5SA 2X5ZA 3QVBA 1FO9A 4FCUA 2O1GA 1JV3A 5BXCA 2V0KA 1HJJA 1G3LA 1R7VA 4B4BA 2J0AA 2YCMA 1OQMB 3SPTA 1YP2A 1FR9A 2W0VA 2VK9A 2D7RA 3T7MA 1MP3A 3Q80A 5C1GA 5AJNA 1K4VA 2RIZA 3USQA 5J49A 1WT3A 1R82A 4KNXA 3U2VA 2AM4A 1HM0A 2AM5A 3JTJA 3V0LA 4M4KA 3PKQA 2RJ4A 4XWIA 4MIXA 1VZUA 5D91A 4M2BA 1S4NA 2PA4A 1JYLA 1ZI5A 4FROA 2AESA 1W77A 4FRAA 3OH0A 2RJ7A 4BQHA 2BO7A 1VZTA 1OMZA 1H5SD 2YQCA 1ZCUA 1ZJOA 5CQNX 2ZU8A 1LZ0A 2FYAA 1KWSA 1WVCA 4ZDQA 4HOCA 4NANA 5C47A 5C38A 4MYBA 1ZJ3A 2ZU7A 1G0RA 1W57A 2Y4MA 3OGZA 1GWWA 3OC9A 4HO9A 4FRBA 4B2WA 2O1HA 3T7NA 2I5EA 4KC1A 4NAIA 4HO4A 3ZGGA 2XWNA 3DJ4A 4HO6A 1XZ6A 1H7EA 4DECA 1ZCYA 3RMVA 2RJ0A 4AYJA 1V82A 2BO8A 4C2SA 1H7QA 1VH1A 1ZJPA
chains in the Genus database with same CATH topology
1FXOA 4IRQA 5C3AA 2XMHA 4D48A 2FY7A 1VH3A 2OEFA 2GGOA 2WAWA 5AJOA 2D0JA 2AH9A 3T7OA 1ZCVA 3OKRA 1H7FA 5IFYA 3KIAA 3RSBA 1GWVA 1TVYA 3V8ZA 4AAWA 5I1FA 2UX8A 1MP5A 3I0KA 4EE5A 1LL2A 3K8EA 4J18A 3SX7A 4Y62A 2E8BA 3U0YA 2ZU9A 3CKJA 4FCEA 2D7IA 2V0IA 1VM8A 3D5NA 1H7HA 3V91A 4HO5A 4O6NA 4NAKA 4BMAA 1NWGB 1WT1A 1G2VA 3OH1A 3V0PA 4IRPA 2VSHA 2VXLA 1JYKA 2CU2A 4KPZA 4KC4A 5FU8A 1NMMB 5FTSA 1HM9A 1R7UA 1JVGA 1O7QA 1ON6A 4KNRA 1FGXA 1FOAA 4FRQA 5C4DA 1VGUA 2YQJA 4HCQA 2XWMA 4FIYA 2JCOA 4MNDA 3U0XA 5C4BA 1MC3A 4EE3A 5CMFX 4G3QA 3U2TA 3SXAA 4G3PA 1O0RA 4DDZA 1FR8A 3NGWA 1WT0A 1ZDFA 2W0WA 1ZJ1A 2APCA 2V0LA 4Y7TA 2VSIA 4ECMA 4FQWA 5IDTA 4CVHA 5C4CA 5CMIA 4FREA 3U2XA 2Y4JA 4B3UA 1ZIZA 2C0NA 1S4PA 5CQPA 1ZI3A 4M2AA 2P73A 1FRWA 3F1YA 4B4MA 2BO6A 1G23A 3CGXA 2P6WA 4LW6A 3R3IA 2QKXA 5D92A 1O23B 5FUHA 4JD0A 3U2WA 3D8VA 1QGQA 4CJCA 4AC3A 4B4GA 5CQLX 1NKHB 1NQIB 2FYCB 2FFVA 2PGYA 2JCLA 3V90A 1IINA 1VPAA 4D11A 1PZYB 4HO0A 5DDTA 1H5TA 4JISA 3SX8A 1VGZA 1H5TB 1H7LA 1H5RA 2PGVA 1G93A 5CQOA 1ZJ0A 2OI5A 1H5RB 1YP3A 2X5SA 4Y7VA 3BRKX 1FGGA 1H5SC 1XHBA 1R7YA 2V0HA 3FOQA 1HM8A 4Q7CA 1YROB 3ST8A 5C4EA 4M28A 4FRLA 4B2XA 1WT2A 1G8OA 2ICYA 1R7TA 2GGQA 1ZCTA 1ZI1A 4HO8A 1GX0A 1ZDGA 5CQMX 2XMEA 1W55A 3I0LA 1R7XA 2RJ6A 2WGZA 2Y7AA 4ASYA 2Y6PA 5CMGX 3R2WA 2PX7A 2NXVA 4FRMA 2RJ9A 5C48A 4L41C 5JQQA 4KRVA 4KXOA 3JUKA 1G1LA 3EE5A 3SX3A 3Q7UA 3TQDA 3I0HA 4ARWA 3IOHA 1TW1A 2OI7A 3V0OA 2RIYA 2WVLA 4KPXA 3USRA 3CKNA 2JCKA 5DDVA 2VFZA 3Q4SA 3IOJA 4B42A 4P00A 1LL3A 1FWYA 1JVDA 3OH2A 4FRDA 3POLA 3OH3A 2Y4LA 3CKQA 2YQHA 1FG5N 3SXEA 2X65A 4KC2A 5FTVA 1ZI4A 4GBPA 5C8RA 4EEOA 2YC5A 4HG6A 1LZ7A 3E25A 4Y63A 1FXJA 1NHEB 2RJ5A 2YC3A 1SS9A 3LW6A 5C49A 3SXGA 5AJPA 1QGSA 3N9WA 1TZFA 1LL0A 1GQ9A 2Z87A 4YS8A 1ZJ2A 2A8UA 2X60A 1VZXA 3CKVA 3HL3A 4Y7FA 1QG8A 2V0JA 3FWWA 4HO3A 3SXCA 3I0IX 1ZHJA 1H7TA 1H5SB 3I0EA 1S4OA 3TZTA 1G95A 2VS4A 3DK5A 4KQLA 2QH5A 3IOIA 1EYRA 2AM3A 3PKPA 2QGIA 1HJLA 2MZBA 4FRHA 5CMJA 2Z86A 2XWLA 3ZLLA 2FYBA 3DUVA 1Z90A 2AECA 4P02A 2JCJA 5C1HA 2WEEA 1GQCA 2YESA 1EZIA 5L6VA 1H4CA 3CKOA 3K8DA 3I0CA 1E5KA 1OMXA 3ZGFA 4EEAA 3JUJA 1VICA 1PZTA 2FFUA 2AGDA 3RMWA 2FYDB 2RJ1A 5FYEA 5C4FA 1R81A 2I5KA 3V0QA 4UEGA 2WVKA 5C36A 3PNNA 1IIMA 1LZIA 4EE4A 4Y64A 2I7BA 2Q4JA 5EJZA 4EEGA 1QWJA 3CU0A 1GX4A 4Y7UA 2VXMA 4E1KA 2WVMA 3D98A 1H4EA 4HO2A 1V84A 4D0ZA 2VS3A 2E3DA 4Y6NA 5L6SA 4EVWA 5C3DA 1MP4A 1LZJA 3I0FA 5IDSA 1INJA 5EJ1A 4ASJA 4CJ8A 1I52A 2OEGA 3GUEA 4EEMA 3V0NA 1H7GA 1FO8A 2O1FA 4G3SA 3SXDA 4FIXA 2Y4KA 2YQSA 3I0GA 2ICXA 3OAMA 1V83A 2P72A 2WE9A 4Y6UA 2A8WA 2DPWA 1VGTA 1LVWA 3V0MA 1R80A 5FU0A 2VD4A 3O3PA 5HS2A 2AE7A 4LW3A 1JV1A 1VGWA 1NF5B 2RIXA 4D0TA 4Y9XA 2RJ8A 1ON8A 4CJBA 2RITA 3SX5A 3V8YA 5EIYA 1H3MA 3U2UA 4DE7A 2BO4A 1WSZA 2VS5A 2OI6A 1INIA 3F1CA 1HV9A 4O6MA 1O7OA 4D11C 3SXBA 4K6RA 3I0DA 3ZF8A 4G87A 3BCVA 1G9RA 5C3BA 4NALA 5FV9A 3OH4A 1TW5A 5CMHA 4Y7GA 4KT7A 4AYLA 4R7PA 1YP4A 1GA8A 1G97A 2J0BA 1H4DA 5C1LA 4B5BA 4FRPA 1FZWA 3E26A 3I0JA 3ZLKA 1H5SA 2X5ZA 3QVBA 1FO9A 4FCUA 2O1GA 1JV3A 5BXCA 2V0KA 1HJJA 1G3LA 1R7VA 4B4BA 2J0AA 2YCMA 1OQMB 3SPTA 1YP2A 1FR9A 2W0VA 2VK9A 2D7RA 3T7MA 1MP3A 3Q80A 5C1GA 5AJNA 1K4VA 2RIZA 3USQA 5J49A 1WT3A 1R82A 4KNXA 3U2VA 2AM4A 1HM0A 2AM5A 3JTJA 3V0LA 4M4KA 3PKQA 2RJ4A 4XWIA 4MIXA 1VZUA 5D91A 4M2BA 1S4NA 2PA4A 1JYLA 1ZI5A 4FROA 2AESA 1W77A 4FRAA 3OH0A 2RJ7A 4BQHA 2BO7A 1VZTA 1OMZA 1H5SD 2YQCA 1ZCUA 1ZJOA 5CQNX 2ZU8A 1LZ0A 2FYAA 1KWSA 1WVCA 4ZDQA 4HOCA 4NANA 5C47A 5C38A 4MYBA 1ZJ3A 2ZU7A 1G0RA 1W57A 2Y4MA 3OGZA 1GWWA 3OC9A 4HO9A 4FRBA 4B2WA 2O1HA 3T7NA 2I5EA 4KC1A 4NAIA 4HO4A 3ZGGA 2XWNA 3DJ4A 4HO6A 1XZ6A 1H7EA 4DECA 1ZCYA 3RMVA 2RJ0A 4AYJA 1V82A 2BO8A 4C2SA 1H7QA 1VH1A 1ZJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXO A;  4IRQ A;  5C3A A;  2XMH A;  4D48 A;  2FY7 A;  1VH3 A;  2OEF A;  2GGO A;  2WAW A;  5AJO A;  2D0J A;  2AH9 A;  3T7O A;  1ZCV A;  3OKR A;  1H7F A;  5IFY A;  3KIA A;  3RSB A;  1GWV A;  1TVY A;  3V8Z A;  4AAW A;  5I1F A;  2UX8 A;  1MP5 A;  3I0K A;  4EE5 A;  1LL2 A;  3K8E A;  4J18 A;  3SX7 A;  4Y62 A;  2E8B A;  3U0Y A;  2ZU9 A;  3CKJ A;  4FCE A;  2D7I A;  2V0I A;  1VM8 A;  3D5N A;  1H7H A;  3V91 A;  4HO5 A;  4NAK A;  4BMA A;  1NWG B;  1WT1 A;  1G2V A;  3OH1 A;  3V0P A;  4IRP A;  2VSH A;  2VXL A;  1JYK A;  2CU2 A;  4KPZ A;  4KC4 A;  5FU8 A;  1NMM B;  5FTS A;  1HM9 A;  1R7U A;  1JVG A;  1O7Q A;  1ON6 A;  4KNR A;  1FGX A;  1FOA A;  4FRQ A;  5C4D A;  1VGU A;  2YQJ A;  4HCQ A;  2XWM A;  2JCO A;  4MND A;  3U0X A;  5C4B A;  1MC3 A;  4EE3 A;  5CMF X;  4G3Q A;  3U2T A;  3SXA A;  4G3P A;  1O0R A;  4DDZ A;  1FR8 A;  3NGW A;  1WT0 A;  1ZDF A;  2W0W A;  1ZJ1 A;  2APC A;  2V0L A;  4Y7T A;  2VSI A;  4ECM A;  4FQW A;  5IDT A;  4CVH A;  5C4C A;  5CMI A;  4FRE A;  3U2X A;  2Y4J A;  4B3U A;  1ZIZ A;  1S4P A;  5CQP A;  1ZI3 A;  4M2A A;  2P73 A;  1FRW A;  3F1Y A;  4B4M A;  2BO6 A;  1G23 A;  3CGX A;  2P6W A;  4LW6 A;  3R3I A;  2QKX A;  1O23 B;  5FUH A;  4JD0 A;  3U2W A;  3D8V A;  1QGQ A;  4CJC A;  4AC3 A;  4B4G A;  5CQL X;  1NKH B;  1NQI B;  2FYC B;  2FFV A;  2PGY A;  2JCL A;  3V90 A;  1IIN A;  1VPA A;  4D11 A;  1PZY B;  4HO0 A;  5DDT A;  1H5T A;  4JIS A;  3SX8 A;  1VGZ A;  1H5T B;  1H7L A;  1H5R A;  2PGV A;  1G93 A;  5CQO A;  1ZJ0 A;  2OI5 A;  1H5R B;  1YP3 A;  2X5S A;  4Y7V A;  3BRK X;  1FGG A;  1H5S C;  1XHB A;  1R7Y A;  2V0H A;  3FOQ A;  1HM8 A;  1YRO B;  3ST8 A;  5C4E A;  4M28 A;  4FRL A;  4B2X A;  1WT2 A;  1G8O A;  2ICY A;  1R7T A;  2GGQ A;  1ZCT A;  1ZI1 A;  4HO8 A;  1GX0 A;  1ZDG A;  5CQM X;  2XME A;  1W55 A;  3I0L A;  1R7X A;  2RJ6 A;  2WGZ A;  2Y7A A;  4ASY A;  2Y6P A;  5CMG X;  3R2W A;  2PX7 A;  2NXV A;  4FRM A;  2RJ9 A;  5C48 A;  4L41 C;  5JQQ A;  4KRV A;  4KXO A;  3JUK A;  1G1L A;  3EE5 A;  3SX3 A;  3Q7U A;  3TQD A;  3I0H A;  4ARW A;  3IOH A;  1TW1 A;  2OI7 A;  3V0O A;  2RIY A;  2WVL A;  4KPX A;  3USR A;  3CKN A;  2JCK A;  5DDV A;  2VFZ A;  3Q4S A;  3IOJ A;  4B42 A;  4P00 A;  1LL3 A;  1FWY A;  1JVD A;  3OH2 A;  4FRD A;  3POL A;  3OH3 A;  2Y4L A;  3CKQ A;  2YQH A;  1FG5 N;  3SXE A;  2X65 A;  4KC2 A;  5FTV A;  1ZI4 A;  4GBP A;  5C8R A;  4EEO A;  2YC5 A;  4HG6 A;  1LZ7 A;  3E25 A;  4Y63 A;  1FXJ A;  1NHE B;  2RJ5 A;  2YC3 A;  1SS9 A;  3LW6 A;  5C49 A;  3SXG A;  5AJP A;  1QGS A;  3N9W A;  1TZF A;  1LL0 A;  1GQ9 A;  2Z87 A;  4YS8 A;  1ZJ2 A;  2A8U A;  2X60 A;  1VZX A;  3CKV A;  3HL3 A;  4Y7F A;  1QG8 A;  2V0J A;  3FWW A;  4HO3 A;  3SXC A;  3I0I X;  1ZHJ A;  1H7T A;  1H5S B;  3I0E A;  1S4O A;  3TZT A;  1G95 A;  2VS4 A;  3DK5 A;  4KQL A;  2QH5 A;  3IOI A;  1EYR A;  2AM3 A;  3PKP A;  2QGI A;  1HJL A;  2MZB A;  4FRH A;  5CMJ A;  2Z86 A;  2XWL A;  3ZLL A;  2FYB A;  3DUV A;  1Z90 A;  2AEC A;  4P02 A;  2JCJ A;  5C1H A;  2WEE A;  1GQC A;  2YES A;  1EZI A;  5L6V A;  1H4C A;  3CKO A;  3K8D A;  3I0C A;  1E5K A;  1OMX A;  3ZGF A;  4EEA A;  3JUJ A;  1VIC A;  1PZT A;  2FFU A;  2AGD A;  3RMW A;  2FYD B;  2RJ1 A;  5FYE A;  5C4F A;  1R81 A;  2I5K A;  3V0Q A;  4UEG A;  2WVK A;  5C36 A;  3PNN A;  1IIM A;  1LZI A;  4EE4 A;  4Y64 A;  2I7B A;  2Q4J A;  5EJZ A;  4EEG A;  1QWJ A;  3CU0 A;  1GX4 A;  4Y7U A;  2VXM A;  4E1K A;  2WVM A;  3D98 A;  1H4E A;  4HO2 A;  1V84 A;  4D0Z A;  2VS3 A;  2E3D A;  4Y6N A;  5L6S A;  4EVW A;  5C3D A;  1MP4 A;  1LZJ A;  3I0F A;  5IDS A;  1INJ A;  5EJ1 A;  4ASJ A;  4CJ8 A;  1I52 A;  2OEG A;  3GUE A;  4EEM A;  3V0N A;  1H7G A;  1FO8 A;  2O1F A;  4G3S A;  3SXD A;  2Y4K A;  2YQS A;  3I0G A;  2ICX A;  3OAM A;  1V83 A;  2P72 A;  2WE9 A;  4Y6U A;  2A8W A;  2DPW A;  1VGT A;  1LVW A;  3V0M A;  1R80 A;  5FU0 A;  2VD4 A;  3O3P A;  5HS2 A;  2AE7 A;  4LW3 A;  1JV1 A;  1VGW A;  1NF5 B;  2RIX A;  4D0T A;  4Y9X A;  2RJ8 A;  1ON8 A;  4CJB A;  2RIT A;  3SX5 A;  3V8Y A;  5EIY A;  1H3M A;  3U2U A;  4DE7 A;  2BO4 A;  1WSZ A;  2VS5 A;  2OI6 A;  1INI A;  3F1C A;  1HV9 A;  1O7O A;  4D11 C;  3SXB A;  4K6R A;  3I0D A;  3ZF8 A;  4G87 A;  3BCV A;  1G9R A;  5C3B A;  4NAL A;  5FV9 A;  3OH4 A;  1TW5 A;  5CMH A;  4Y7G A;  4KT7 A;  4AYL A;  4R7P A;  1YP4 A;  1GA8 A;  1G97 A;  1H4D A;  5C1L A;  4B5B A;  4FRP A;  1FZW A;  3E26 A;  3I0J A;  3ZLK A;  1H5S A;  2X5Z A;  3QVB A;  1FO9 A;  4FCU A;  2O1G A;  1JV3 A;  5BXC A;  2V0K A;  1HJJ A;  1G3L A;  1R7V A;  4B4B A;  2YCM A;  1OQM B;  3SPT A;  1YP2 A;  1FR9 A;  2W0V A;  2D7R A;  3T7M A;  1MP3 A;  3Q80 A;  5C1G A;  5AJN A;  1K4V A;  2RIZ A;  3USQ A;  5J49 A;  1WT3 A;  1R82 A;  4KNX A;  3U2V A;  2AM4 A;  1HM0 A;  2AM5 A;  3JTJ A;  3V0L A;  4M4K A;  3PKQ A;  2RJ4 A;  4XWI A;  1VZU A;  4M2B A;  1S4N A;  2PA4 A;  1JYL A;  1ZI5 A;  4FRO A;  2AES A;  1W77 A;  4FRA A;  3OH0 A;  2RJ7 A;  4BQH A;  2BO7 A;  1VZT A;  1OMZ A;  1H5S D;  2YQC A;  1ZCU A;  1ZJO A;  5CQN X;  2ZU8 A;  1LZ0 A;  2FYA A;  1KWS A;  1WVC A;  4ZDQ A;  4HOC A;  4NAN A;  5C47 A;  5C38 A;  4MYB A;  1ZJ3 A;  2ZU7 A;  1G0R A;  1W57 A;  2Y4M A;  3OGZ A;  1GWW A;  3OC9 A;  4HO9 A;  4FRB A;  4B2W A;  2O1H A;  3T7N A;  2I5E A;  4KC1 A;  4NAI A;  4HO4 A;  3ZGG A;  2XWN A;  3DJ4 A;  4HO6 A;  1XZ6 A;  1H7E A;  4DEC A;  1ZCY A;  3RMV A;  2RJ0 A;  4AYJ A;  1V82 A;  2BO8 A;  4C2S A;  1H7Q A;  1VH1 A;  1ZJP A; 
#chains in the Genus database with same CATH topology
 1FXO A;  4IRQ A;  5C3A A;  2XMH A;  4D48 A;  2FY7 A;  1VH3 A;  2OEF A;  2GGO A;  2WAW A;  5AJO A;  2D0J A;  2AH9 A;  3T7O A;  1ZCV A;  3OKR A;  1H7F A;  5IFY A;  3KIA A;  3RSB A;  1GWV A;  1TVY A;  3V8Z A;  4AAW A;  5I1F A;  2UX8 A;  1MP5 A;  3I0K A;  4EE5 A;  1LL2 A;  3K8E A;  4J18 A;  3SX7 A;  4Y62 A;  2E8B A;  3U0Y A;  2ZU9 A;  3CKJ A;  4FCE A;  2D7I A;  2V0I A;  1VM8 A;  3D5N A;  1H7H A;  3V91 A;  4HO5 A;  4O6N A;  4NAK A;  4BMA A;  1NWG B;  1WT1 A;  1G2V A;  3OH1 A;  3V0P A;  4IRP A;  2VSH A;  2VXL A;  1JYK A;  2CU2 A;  4KPZ A;  4KC4 A;  5FU8 A;  1NMM B;  5FTS A;  1HM9 A;  1R7U A;  1JVG A;  1O7Q A;  1ON6 A;  4KNR A;  1FGX A;  1FOA A;  4FRQ A;  5C4D A;  1VGU A;  2YQJ A;  4HCQ A;  2XWM A;  4FIY A;  2JCO A;  4MND A;  3U0X A;  5C4B A;  1MC3 A;  4EE3 A;  5CMF X;  4G3Q A;  3U2T A;  3SXA A;  4G3P A;  1O0R A;  4DDZ A;  1FR8 A;  3NGW A;  1WT0 A;  1ZDF A;  2W0W A;  1ZJ1 A;  2APC A;  2V0L A;  4Y7T A;  2VSI A;  4ECM A;  4FQW A;  5IDT A;  4CVH A;  5C4C A;  5CMI A;  4FRE A;  3U2X A;  2Y4J A;  4B3U A;  1ZIZ A;  2C0N A;  1S4P A;  5CQP A;  1ZI3 A;  4M2A A;  2P73 A;  1FRW A;  3F1Y A;  4B4M A;  2BO6 A;  1G23 A;  3CGX A;  2P6W A;  4LW6 A;  3R3I A;  2QKX A;  5D92 A;  1O23 B;  5FUH A;  4JD0 A;  3U2W A;  3D8V A;  1QGQ A;  4CJC A;  4AC3 A;  4B4G A;  5CQL X;  1NKH B;  1NQI B;  2FYC B;  2FFV A;  2PGY A;  2JCL A;  3V90 A;  1IIN A;  1VPA A;  4D11 A;  1PZY B;  4HO0 A;  5DDT A;  1H5T A;  4JIS A;  3SX8 A;  1VGZ A;  1H5T B;  1H7L A;  1H5R A;  2PGV A;  1G93 A;  5CQO A;  1ZJ0 A;  2OI5 A;  1H5R B;  1YP3 A;  2X5S A;  4Y7V A;  3BRK X;  1FGG A;  1H5S C;  1XHB A;  1R7Y A;  2V0H A;  3FOQ A;  1HM8 A;  4Q7C A;  1YRO B;  3ST8 A;  5C4E A;  4M28 A;  4FRL A;  4B2X A;  1WT2 A;  1G8O A;  2ICY A;  1R7T A;  2GGQ A;  1ZCT A;  1ZI1 A;  4HO8 A;  1GX0 A;  1ZDG A;  5CQM X;  2XME A;  1W55 A;  3I0L A;  1R7X A;  2RJ6 A;  2WGZ A;  2Y7A A;  4ASY A;  2Y6P A;  5CMG X;  3R2W A;  2PX7 A;  2NXV A;  4FRM A;  2RJ9 A;  5C48 A;  4L41 C;  5JQQ A;  4KRV A;  4KXO A;  3JUK A;  1G1L A;  3EE5 A;  3SX3 A;  3Q7U A;  3TQD A;  3I0H A;  4ARW A;  3IOH A;  1TW1 A;  2OI7 A;  3V0O A;  2RIY A;  2WVL A;  4KPX A;  3USR A;  3CKN A;  2JCK A;  5DDV A;  2VFZ A;  3Q4S A;  3IOJ A;  4B42 A;  4P00 A;  1LL3 A;  1FWY A;  1JVD A;  3OH2 A;  4FRD A;  3POL A;  3OH3 A;  2Y4L A;  3CKQ A;  2YQH A;  1FG5 N;  3SXE A;  2X65 A;  4KC2 A;  5FTV A;  1ZI4 A;  4GBP A;  5C8R A;  4EEO A;  2YC5 A;  4HG6 A;  1LZ7 A;  3E25 A;  4Y63 A;  1FXJ A;  1NHE B;  2RJ5 A;  2YC3 A;  1SS9 A;  3LW6 A;  5C49 A;  3SXG A;  5AJP A;  1QGS A;  3N9W A;  1TZF A;  1LL0 A;  1GQ9 A;  2Z87 A;  4YS8 A;  1ZJ2 A;  2A8U A;  2X60 A;  1VZX A;  3CKV A;  3HL3 A;  4Y7F A;  1QG8 A;  2V0J A;  3FWW A;  4HO3 A;  3SXC A;  3I0I X;  1ZHJ A;  1H7T A;  1H5S B;  3I0E A;  1S4O A;  3TZT A;  1G95 A;  2VS4 A;  3DK5 A;  4KQL A;  2QH5 A;  3IOI A;  1EYR A;  2AM3 A;  3PKP A;  2QGI A;  1HJL A;  2MZB A;  4FRH A;  5CMJ A;  2Z86 A;  2XWL A;  3ZLL A;  2FYB A;  3DUV A;  1Z90 A;  2AEC A;  4P02 A;  2JCJ A;  5C1H A;  2WEE A;  1GQC A;  2YES A;  1EZI A;  5L6V A;  1H4C A;  3CKO A;  3K8D A;  3I0C A;  1E5K A;  1OMX A;  3ZGF A;  4EEA A;  3JUJ A;  1VIC A;  1PZT A;  2FFU A;  2AGD A;  3RMW A;  2FYD B;  2RJ1 A;  5FYE A;  5C4F A;  1R81 A;  2I5K A;  3V0Q A;  4UEG A;  2WVK A;  5C36 A;  3PNN A;  1IIM A;  1LZI A;  4EE4 A;  4Y64 A;  2I7B A;  2Q4J A;  5EJZ A;  4EEG A;  1QWJ A;  3CU0 A;  1GX4 A;  4Y7U A;  2VXM A;  4E1K A;  2WVM A;  3D98 A;  1H4E A;  4HO2 A;  1V84 A;  4D0Z A;  2VS3 A;  2E3D A;  4Y6N A;  5L6S A;  4EVW A;  5C3D A;  1MP4 A;  1LZJ A;  3I0F A;  5IDS A;  1INJ A;  5EJ1 A;  4ASJ A;  4CJ8 A;  1I52 A;  2OEG A;  3GUE A;  4EEM A;  3V0N A;  1H7G A;  1FO8 A;  2O1F A;  4G3S A;  3SXD A;  4FIX A;  2Y4K A;  2YQS A;  3I0G A;  2ICX A;  3OAM A;  1V83 A;  2P72 A;  2WE9 A;  4Y6U A;  2A8W A;  2DPW A;  1VGT A;  1LVW A;  3V0M A;  1R80 A;  5FU0 A;  2VD4 A;  3O3P A;  5HS2 A;  2AE7 A;  4LW3 A;  1JV1 A;  1VGW A;  1NF5 B;  2RIX A;  4D0T A;  4Y9X A;  2RJ8 A;  1ON8 A;  4CJB A;  2RIT A;  3SX5 A;  3V8Y A;  5EIY A;  1H3M A;  3U2U A;  4DE7 A;  2BO4 A;  1WSZ A;  2VS5 A;  2OI6 A;  1INI A;  3F1C A;  1HV9 A;  4O6M A;  1O7O A;  4D11 C;  3SXB A;  4K6R A;  3I0D A;  3ZF8 A;  4G87 A;  3BCV A;  1G9R A;  5C3B A;  4NAL A;  5FV9 A;  3OH4 A;  1TW5 A;  5CMH A;  4Y7G A;  4KT7 A;  4AYL A;  4R7P A;  1YP4 A;  1GA8 A;  1G97 A;  2J0B A;  1H4D A;  5C1L A;  4B5B A;  4FRP A;  1FZW A;  3E26 A;  3I0J A;  3ZLK A;  1H5S A;  2X5Z A;  3QVB A;  1FO9 A;  4FCU A;  2O1G A;  1JV3 A;  5BXC A;  2V0K A;  1HJJ A;  1G3L A;  1R7V A;  4B4B A;  2J0A A;  2YCM A;  1OQM B;  3SPT A;  1YP2 A;  1FR9 A;  2W0V A;  2VK9 A;  2D7R A;  3T7M A;  1MP3 A;  3Q80 A;  5C1G A;  5AJN A;  1K4V A;  2RIZ A;  3USQ A;  5J49 A;  1WT3 A;  1R82 A;  4KNX A;  3U2V A;  2AM4 A;  1HM0 A;  2AM5 A;  3JTJ A;  3V0L A;  4M4K A;  3PKQ A;  2RJ4 A;  4XWI A;  4MIX A;  1VZU A;  5D91 A;  4M2B A;  1S4N A;  2PA4 A;  1JYL A;  1ZI5 A;  4FRO A;  2AES A;  1W77 A;  4FRA A;  3OH0 A;  2RJ7 A;  4BQH A;  2BO7 A;  1VZT A;  1OMZ A;  1H5S D;  2YQC A;  1ZCU A;  1ZJO A;  5CQN X;  2ZU8 A;  1LZ0 A;  2FYA A;  1KWS A;  1WVC A;  4ZDQ A;  4HOC A;  4NAN A;  5C47 A;  5C38 A;  4MYB A;  1ZJ3 A;  2ZU7 A;  1G0R A;  1W57 A;  2Y4M A;  3OGZ A;  1GWW A;  3OC9 A;  4HO9 A;  4FRB A;  4B2W A;  2O1H A;  3T7N A;  2I5E A;  4KC1 A;  4NAI A;  4HO4 A;  3ZGG A;  2XWN A;  3DJ4 A;  4HO6 A;  1XZ6 A;  1H7E A;  4DEC A;  1ZCY A;  3RMV A;  2RJ0 A;  4AYJ A;  1V82 A;  2BO8 A;  4C2S A;  1H7Q A;  1VH1 A;  1ZJP A; 
#chains in the Genus database with same CATH homology
 1FXO A;  4IRQ A;  5C3A A;  2XMH A;  4D48 A;  2FY7 A;  1VH3 A;  2OEF A;  2GGO A;  2WAW A;  5AJO A;  2D0J A;  2AH9 A;  3T7O A;  1ZCV A;  3OKR A;  1H7F A;  5IFY A;  3KIA A;  3RSB A;  1GWV A;  1TVY A;  3V8Z A;  4AAW A;  5I1F A;  2UX8 A;  1MP5 A;  3I0K A;  4EE5 A;  1LL2 A;  3K8E A;  4J18 A;  3SX7 A;  4Y62 A;  2E8B A;  3U0Y A;  2ZU9 A;  3CKJ A;  4FCE A;  2D7I A;  2V0I A;  1VM8 A;  3D5N A;  1H7H A;  3V91 A;  4HO5 A;  4O6N A;  4NAK A;  4BMA A;  1NWG B;  1WT1 A;  1G2V A;  3OH1 A;  3V0P A;  4IRP A;  2VSH A;  2VXL A;  1JYK A;  2CU2 A;  4KPZ A;  4KC4 A;  5FU8 A;  1NMM B;  5FTS A;  1HM9 A;  1R7U A;  1JVG A;  1O7Q A;  1ON6 A;  4KNR A;  1FGX A;  1FOA A;  4FRQ A;  5C4D A;  1VGU A;  2YQJ A;  4HCQ A;  2XWM A;  4FIY A;  2JCO A;  4MND A;  3U0X A;  5C4B A;  1MC3 A;  4EE3 A;  5CMF X;  4G3Q A;  3U2T A;  3SXA A;  4G3P A;  1O0R A;  4DDZ A;  1FR8 A;  3NGW A;  1WT0 A;  1ZDF A;  2W0W A;  1ZJ1 A;  2APC A;  2V0L A;  4Y7T A;  2VSI A;  4ECM A;  4FQW A;  5IDT A;  4CVH A;  5C4C A;  5CMI A;  4FRE A;  3U2X A;  2Y4J A;  4B3U A;  1ZIZ A;  2C0N A;  1S4P A;  5CQP A;  1ZI3 A;  4M2A A;  2P73 A;  1FRW A;  3F1Y A;  4B4M A;  2BO6 A;  1G23 A;  3CGX A;  2P6W A;  4LW6 A;  3R3I A;  2QKX A;  5D92 A;  1O23 B;  5FUH A;  4JD0 A;  3U2W A;  3D8V A;  1QGQ A;  4CJC A;  4AC3 A;  4B4G A;  5CQL X;  1NKH B;  1NQI B;  2FYC B;  2FFV A;  2PGY A;  2JCL A;  3V90 A;  1IIN A;  1VPA A;  4D11 A;  1PZY B;  4HO0 A;  5DDT A;  1H5T A;  4JIS A;  3SX8 A;  1VGZ A;  1H5T B;  1H7L A;  1H5R A;  2PGV A;  1G93 A;  5CQO A;  1ZJ0 A;  2OI5 A;  1H5R B;  1YP3 A;  2X5S A;  4Y7V A;  3BRK X;  1FGG A;  1H5S C;  1XHB A;  1R7Y A;  2V0H A;  3FOQ A;  1HM8 A;  4Q7C A;  1YRO B;  3ST8 A;  5C4E A;  4M28 A;  4FRL A;  4B2X A;  1WT2 A;  1G8O A;  2ICY A;  1R7T A;  2GGQ A;  1ZCT A;  1ZI1 A;  4HO8 A;  1GX0 A;  1ZDG A;  5CQM X;  2XME A;  1W55 A;  3I0L A;  1R7X A;  2RJ6 A;  2WGZ A;  2Y7A A;  4ASY A;  2Y6P A;  5CMG X;  3R2W A;  2PX7 A;  2NXV A;  4FRM A;  2RJ9 A;  5C48 A;  4L41 C;  5JQQ A;  4KRV A;  4KXO A;  3JUK A;  1G1L A;  3EE5 A;  3SX3 A;  3Q7U A;  3TQD A;  3I0H A;  4ARW A;  3IOH A;  1TW1 A;  2OI7 A;  3V0O A;  2RIY A;  2WVL A;  4KPX A;  3USR A;  3CKN A;  2JCK A;  5DDV A;  2VFZ A;  3Q4S A;  3IOJ A;  4B42 A;  4P00 A;  1LL3 A;  1FWY A;  1JVD A;  3OH2 A;  4FRD A;  3POL A;  3OH3 A;  2Y4L A;  3CKQ A;  2YQH A;  1FG5 N;  3SXE A;  2X65 A;  4KC2 A;  5FTV A;  1ZI4 A;  4GBP A;  5C8R A;  4EEO A;  2YC5 A;  4HG6 A;  1LZ7 A;  3E25 A;  4Y63 A;  1FXJ A;  1NHE B;  2RJ5 A;  2YC3 A;  1SS9 A;  3LW6 A;  5C49 A;  3SXG A;  5AJP A;  1QGS A;  3N9W A;  1TZF A;  1LL0 A;  1GQ9 A;  2Z87 A;  4YS8 A;  1ZJ2 A;  2A8U A;  2X60 A;  1VZX A;  3CKV A;  3HL3 A;  4Y7F A;  1QG8 A;  2V0J A;  3FWW A;  4HO3 A;  3SXC A;  3I0I X;  1ZHJ A;  1H7T A;  1H5S B;  3I0E A;  1S4O A;  3TZT A;  1G95 A;  2VS4 A;  3DK5 A;  4KQL A;  2QH5 A;  3IOI A;  1EYR A;  2AM3 A;  3PKP A;  2QGI A;  1HJL A;  2MZB A;  4FRH A;  5CMJ A;  2Z86 A;  2XWL A;  3ZLL A;  2FYB A;  3DUV A;  1Z90 A;  2AEC A;  4P02 A;  2JCJ A;  5C1H A;  2WEE A;  1GQC A;  2YES A;  1EZI A;  5L6V A;  1H4C A;  3CKO A;  3K8D A;  3I0C A;  1E5K A;  1OMX A;  3ZGF A;  4EEA A;  3JUJ A;  1VIC A;  1PZT A;  2FFU A;  2AGD A;  3RMW A;  2FYD B;  2RJ1 A;  5FYE A;  5C4F A;  1R81 A;  2I5K A;  3V0Q A;  4UEG A;  2WVK A;  5C36 A;  3PNN A;  1IIM A;  1LZI A;  4EE4 A;  4Y64 A;  2I7B A;  2Q4J A;  5EJZ A;  4EEG A;  1QWJ A;  3CU0 A;  1GX4 A;  4Y7U A;  2VXM A;  4E1K A;  2WVM A;  3D98 A;  1H4E A;  4HO2 A;  1V84 A;  4D0Z A;  2VS3 A;  2E3D A;  4Y6N A;  5L6S A;  4EVW A;  5C3D A;  1MP4 A;  1LZJ A;  3I0F A;  5IDS A;  1INJ A;  5EJ1 A;  4ASJ A;  4CJ8 A;  1I52 A;  2OEG A;  3GUE A;  4EEM A;  3V0N A;  1H7G A;  1FO8 A;  2O1F A;  4G3S A;  3SXD A;  4FIX A;  2Y4K A;  2YQS A;  3I0G A;  2ICX A;  3OAM A;  1V83 A;  2P72 A;  2WE9 A;  4Y6U A;  2A8W A;  2DPW A;  1VGT A;  1LVW A;  3V0M A;  1R80 A;  5FU0 A;  2VD4 A;  3O3P A;  5HS2 A;  2AE7 A;  4LW3 A;  1JV1 A;  1VGW A;  1NF5 B;  2RIX A;  4D0T A;  4Y9X A;  2RJ8 A;  1ON8 A;  4CJB A;  2RIT A;  3SX5 A;  3V8Y A;  5EIY A;  1H3M A;  3U2U A;  4DE7 A;  2BO4 A;  1WSZ A;  2VS5 A;  2OI6 A;  1INI A;  3F1C A;  1HV9 A;  4O6M A;  1O7O A;  4D11 C;  3SXB A;  4K6R A;  3I0D A;  3ZF8 A;  4G87 A;  3BCV A;  1G9R A;  5C3B A;  4NAL A;  5FV9 A;  3OH4 A;  1TW5 A;  5CMH A;  4Y7G A;  4KT7 A;  4AYL A;  4R7P A;  1YP4 A;  1GA8 A;  1G97 A;  2J0B A;  1H4D A;  5C1L A;  4B5B A;  4FRP A;  1FZW A;  3E26 A;  3I0J A;  3ZLK A;  1H5S A;  2X5Z A;  3QVB A;  1FO9 A;  4FCU A;  2O1G A;  1JV3 A;  5BXC A;  2V0K A;  1HJJ A;  1G3L A;  1R7V A;  4B4B A;  2J0A A;  2YCM A;  1OQM B;  3SPT A;  1YP2 A;  1FR9 A;  2W0V A;  2VK9 A;  2D7R A;  3T7M A;  1MP3 A;  3Q80 A;  5C1G A;  5AJN A;  1K4V A;  2RIZ A;  3USQ A;  5J49 A;  1WT3 A;  1R82 A;  4KNX A;  3U2V A;  2AM4 A;  1HM0 A;  2AM5 A;  3JTJ A;  3V0L A;  4M4K A;  3PKQ A;  2RJ4 A;  4XWI A;  4MIX A;  1VZU A;  5D91 A;  4M2B A;  1S4N A;  2PA4 A;  1JYL A;  1ZI5 A;  4FRO A;  2AES A;  1W77 A;  4FRA A;  3OH0 A;  2RJ7 A;  4BQH A;  2BO7 A;  1VZT A;  1OMZ A;  1H5S D;  2YQC A;  1ZCU A;  1ZJO A;  5CQN X;  2ZU8 A;  1LZ0 A;  2FYA A;  1KWS A;  1WVC A;  4ZDQ A;  4HOC A;  4NAN A;  5C47 A;  5C38 A;  4MYB A;  1ZJ3 A;  2ZU7 A;  1G0R A;  1W57 A;  2Y4M A;  3OGZ A;  1GWW A;  3OC9 A;  4HO9 A;  4FRB A;  4B2W A;  2O1H A;  3T7N A;  2I5E A;  4KC1 A;  4NAI A;  4HO4 A;  3ZGG A;  2XWN A;  3DJ4 A;  4HO6 A;  1XZ6 A;  1H7E A;  4DEC A;  1ZCY A;  3RMV A;  2RJ0 A;  4AYJ A;  1V82 A;  2BO8 A;  4C2S A;  1H7Q A;  1VH1 A;  1ZJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...