1FGSA

Folylpolyglutamate synthetase from lactobacillus casei
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
425
structure length
393
Chain Sequence
MNYTETVAYIHSFPRLAGDHRRILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLQQQQADFNVTEFEFITALAYWYFRQRQVDVAVIEVGDSTNVITPVVSVLTEVALDTITAIAKHKAGIIKRGIPVVTGNLVPDAAAVVAAKVATTGSQWLRFDRDFSVPKAKLHGWGQRFTYEDQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGYAAMADRLTAAFSTVYLVPVPGTPRGRLKDSWQEALAASLNDVPDQPIVITGSLYLASAVRQTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural homologies with ATP- and folate-binding enzymes in the crystal structure of folylpolyglutamate synthetase.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Synthetase
molecule keywords FOLYLPOLYGLUTAMATE SYNTHETASE
total genus 123
structure length 393
sequence length 425
ec nomenclature ec 6.3.2.17: Tetrahydrofolate synthase.
pdb deposition date 1998-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02875 Mur_ligase_C Mur ligase family, glutamate ligase domain
A PF08245 Mur_ligase_M Mur ligase middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.10 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase Mur-like, catalytic domain 1fgsA01
3.90.190.20 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Mur ligase, C-terminal domain 1fgsA02
2GCAA 3QCZA 2Y68A 3PYZA 1J6UA 4CVLA 3NRSA 1FGSA 2Y67A 2UAGA 2WJPA 2AM1A 4BUBA 1GQYA 3EAGA 1E8CA 5A5EA 1UAGA 4C12A 2VORA 1EEHA 1W7KA 2UUOA 2Y1OA 3UAGA 5A5FA 1W78A 3ZM5A 4ZIYA 2AM2A 3MVNA 4HV4A 4CVMA 2JFGA 2X5OA 3N2AA 1GQQA 2GC6A 4QF5A 4CVKA 2GC5A 1JBWA 1E0DA 3LK7A 4QDIA 2F00A 2JFFA 2Y66A 2GCBA 3ZM6A 1P3DA 2WTZA 2XJAA 4BUCA 2VOSA 3HN7A 4C13A 2JFHA 2XPCA 4UAGA 1O5ZA 1GG4A 2VTEA 1JBVA 3ZL8A 2UUPA 1P31A 2VTDA
chains in the Genus database with same CATH superfamily
3AWGA 5K9WA 3IE7A 2F6VA 4AZ1A 2CM3A 1YHJA 1YTNA 2I6BA 1YPTA 3H74A 1PTVA 5COJA 2MBCA 4R0SA 2FH7A 2CM7A 3UAGA 3RQ5A 2CNEA 4XCKA 3RS9A 2ZN7A 4MBBA 2AM2A 3RZ2A 2B07A 2NT7A 1V19A 1JBWA 4Z6BA 2J17A 4OHEA 4WOHA 2PQ5A 1T48A 3NBWA 3ZM6A 1P3DA 1XRIA 4XF7A 1BZHA 3O4SA 1RK2A 5TRWA 2M3VA 4RH5A 5BYDA 3PYZA 3OMHA 3BF5A 4C5LA 2ESBA 4E8ZA 2R0BA 5BYCA 2B4SA 4JNBA 5KA7A 1UAGA 1YZ4A 2OUDA 1U24A 2B4UA 3ZM2A 3F9BA 5K9VA 1FQ1A 1I9TA 1OETA 2PI7A 3MVNA 3HICA 2CNHA 3V0IA 3NL2A 3N2AA 2I5BA 2F71A 5K22A 2XTBA 1X24A 2H4VA 3A5JA 4I8NA 1OEUA 2F00A 3KZHA 4S1MA 2DDMA 1T49A 5KA0A 1OHDA 2HC2A 3BRHA 3O3LA 1G1FA 4RI4A 3DZVA 2PSZA 4OHDA 3V0FA 3MBJA 1RFUA 1TD2A 3IKHA 4JMJA 5C40A 1VI9A 2WJPA 2AM1A 3QCGA 1BZJA 3Q1YA 1E8CA 4KYRA 2NV5A 3RQHA 5KACA 1EEHA 2I6MA 4NX8A 3ZV2A 2IMGA 1NO6A 1V3AA 2A8BA 2QDCA 4H1OA 4K8TA 2B49A 2QDPA 4OHIA 2YDUA 3IBQA 4B8SA 2VOSA 4KADA 4C13A 2I4HA 4JKUA 1G7FA 3D44A 3RO1A 1P15A 1PA1A 1ZCKA 4LCAA 1EKQA 1QXKA 3LOOA 1JF7A 4YR8B 1VHRA 2NTAA 2Q05A 3PZSA 4X8FA 1SUGA 2BV5A 4C5MA 4HJPA 2Y1OA 1PA9A 4R0TA 3GO6A 2DCNA 4K9IA 4ZIYA 1PTTA 2HC1A 4KANA 4E8YA 4UBEA 1BZCA 4WTYA 3I7ZA 1GC5A 2GC6A 3QCHA 1ZC0A 5K24A 2GC5A 4PVGA 2FV7A 4K93A 3H49A 4S1IB 2H04A 2F6WA 5KAAA 1EKKA 4KI9A 4Y14A 1JBVA 4HV4A 1GWZA 4JMKA 4N09A 4LBGA 1ONZA 3CM3A 2HW1A 3RY7A 3V0GA 4BJOA 3RT9A 2FJMA 1G1GA 4C12A 3HJ6A 4DU5A 3D42A 3HYOA 2FJNA 2UUOA 2GJTA 1UA4A 2F70A 1NWEA 3FHYA 2CM8A 1TZ6A 1G1HA 3S3FA 2X5OA 3QCMA 2H4GA 3D1OA 3NC9A 3RSFA 3B1OA 2NZ6A 5CM5A 2I4EA 3QKPA 1E0DA 4QBWA 3KEUA 3QCEA 4RKKA 2WTZA 5BYEA 2I6IA 1LHRA 2QCTA 4GFUA 1NL9A 2C49A 1TZ3A 1XM2A 2Y67A 2AZRA 4YAAA 2QBSA 4J51A 2ABQA 1YGJA 1LQFA 3B7OA 2VEXA 2VEWA 4HRFA 3RQ2A 3F41A 4K9CA 2HNQA 1JXHA 4GE5A 2F6YA 1I57A 3B1QA 2V78A 1PTYA 2NLKA 1G7GA 4B8RA 3AWFA 3V0DA 3LK7A 2F6TA 5J8RA 5KA3A 1ZCLA 2RBCA 1ECVA 3QCJA 5KA9A 3AWEA 4S0GA 3N1CA 2VTDA 2RF6A 2OZ5A 5GTJA 2JGVA 4WU2A 3QCCA 2F6ZA 2I1YA 2PT0A 2QBPA 4RDDA 3S4EA 5CGEA 3BLTA 5K25A 3RTGA 3ZM0A 1GQTA 5C3ZA 1Q6MA 5F11A 2VEUA 4K8KA 3RRJA 2P4DA 3QCKA 2R3EA 3F81A 1A5YA 3S3KA 1G4US 4E3AA 2A3KA 4OHHA 4E69A 4KALA 2ZMMA 3CQDA 2OC3A 1ZZWA 3NBVA 2BIJA 2I3UA 3EU0A 1YGKA 3UQDA 1C84A 3LJSA 1EENA 3ZL8A 2CMCA 1OEMX 3RGQA 3O5XA 2Y68A 1YGUA 2GWOA 5KA1A 2AX3A 4XF6A 2VARA 2Y2FA 1V1SA 2ABSA 5C41A 4BUBA 3NMEA 4U7XA 2JG1A 2I6PA 3BM8A 4JKSA 2VORA 1RFTA 4YWRA 5A5FA 4NNDA 2YXUA 3BLUA 3UQEA 4GM6A 4QUNA 2OOQA 1LARA 1PTUA 4RI5A 1OEOX 3QCNA 4ERCA 2I75A 3IN1A 2GCBA 3B3LA 2F02A 2NWHA 2QHPA 2BZLA 5BUGA 1LIOA 2E0TA 3RU3A 1Q6SA 3UMOA 2CMBA 3NL6A 3V0JA 3PS5A 5BX1A 4PYHA 1WRMA 4QBEA 3ZS7A 2H4KA 3GBUA 5I6VA 4JJPA 5KADA 4HJQA 1C88A 2I4GA 2QBQA 2A9YA 2AB8A 3HPDA 4C5JA 5KA2A 3RREA 1FPZA 1QZ0A 4O1GA 2AWDA 2VEYA 5KABA 1RKAA 1C85A 2PKNA 3RQ6A 1JLNA 1L2LA 3O4UA 4GE2A 4YL5A 4D3PA 4R30A 3GO7A 3W4SA 4UAGA 1JXIA 3RRFA 1Q6TA 3RQQA 2GCAA 1ESQA 3QCZA 5EHPA 3SR9A 1J6UA 3EB1A 3GXGA 1FGSA 3ZM1A 5HDEA 2HXPA 3NM1A 4E8WA 3M4UA 1W7KA 4TVVA 4XDAA 1GFYA 3RQXA 3IH0A 1DGMA 3LKIA 1C86A 1YWFA 3CWEA 3SMEA 4QUMA 2GP0A 3B1NA 1KAVA 3RTAA 4D3RA 2WGPA 4S1IA 3QCBA 2XJAA 2A9ZA 3HN7A 4O1LA 2HY3A 5LXQB 2XPCA 5K23A 3V0EA 2J16B 2UUPA 2SHPA 1RKDA 3NL5A 3RPHA 1V1AA 4C5NA 4DGPA 3K5WA 4E84A 4EOHA 1Q6JA 4WJMA 4GE6A 3IQ0A 2B3OA 2I3RA 3NC2A 1LIKA 3I80A 4PVVA 3PL2A 3KTNA 3NCAA 4GS0A 2CFVA 3S4OA 1Q6NA 1WAXA 1LIIA 1YN9A 2AA0A 1PH0A 2CNIA 3RTEA 2I6OA 4DGXA 4CVMA 4S1HA 2C4EA 2HB1A 4QF5A 5F0ZA 3ZM3A 4CVKA 4QDIA 3DRWA 3MOZA 4BUCA 4QAHA 1RPMA 3OTXA 2QDMA 2P6XA 1LIJA 3H2XA 3NL3A 5KA8A 2QEPA 4ZRTA 3Q92A 1TYYA 3F99A 3RT7A 4QAPA 1ONYA 2I42A 1GQYA 2QBRA 1FPRA 3D1HA 2CNGA 2CMAA 3LHXA 3S3EA 3B1RA 3RTBA 4EBUA 1YFOA 3F9AA 1OEVA 4ZN5A 2PKFA 1NZ7A 4JBCA 4ZI4A 1YGRA 1WYEA 4K8PA 4GRYA 1D5RA 2I6JA 3GXHA 3MBHA 5M43A 2BGEA 1J4XA 4D3QA 2AJRA 3I3YA 4KAHA 1RXDA 3JULA 3KD6A 3OLRA 3ZMQA 1P31A 4C5KA 4GRZA 2B4PA 1PYNA 2QCJA 3QCDA 3UQ9A 3EWMA 1U2XA 1PXHA 2AHSA 1UB0A 1ESJA 4NWFA 3QKQA 5KA4A 1XBOA 2AJPA 1WCHA 2Y96A 1NWLA 2I6AA 1KYHA 1RKSA 3NM3A 3RPZA 1W78A 5B6AA 4RH9A 5MMZB 3QCFA 4GWFA 4IKCA 1KAKA 3D1QA 2JFGA 2R3BA 1C83A 3V0HA 2Q5RA 4LC4A 1XXPA 3O4TA 2Y66A 2HVLA 3MMJA 2HNPA 2VTEA 1MKPA 2PKMA 2H03A 4K8CA 4RHGA 3QA2A 4N08A 2I5XA 4BPCA 4EUMA 1OHEA 4KYQA 1M3GA 1AAXA 2G59A 1L8GA 1OESA 3ZM5A 2B4OA 2G6ZA 2HLZA 1C87A 3FHXA 4LBXA 1EEOA 2QCVA 4ICZA 3MOWA 2JG5A 1GQQA 2F7KA 1L8KA 2C7SA 1Q1MA 1YTSA 3RGOA 5IBSA 2JFFA 4KBEA 3VASA 2CJZA 5BZZA 3BGKA 1VK4A 1RFVA 2H02A 3EMUA 2J16A 4Y2EA 3RTCA 1Q6PA 1I9SA 4OHLA 3RQ8A 4CVLA 3UQ6A 1C3QA 3RM5A 3LJ8A 5TQIA 3U96A 2UAGA 1G4WR 2HQQA 3QAIA 3VAQA 1U26A 2NT2A 3K9EA 1T4JA 3A5KA 5AWXA 3QCLA 5A5EA 2JJDA 2DDOA 2Q47A 3S3HA 3N0AA 4B04A 5EYNA 3UMPA 2PBNA 2CM2A 2DDWA 2PKKA 1OHCA 1NNYA 1V1BA 3EZZA 4NYHA 2C46A 1R6HA 1LYVA 1O5ZA 4WU3A 3I36A 4EN4A 3D9CA 3RSQA 1YTWA 2CNFA 5BZXA 4NWGA 1BX4A 5EY7A 3EAXA 3RU2A 3NRSA 1XXVA 3RRBA 5BYFA 3EAGA 2VEVA 5IBMA 5CGAA 2F46A 5EHRA 3RSGA 3QCIA 2HCMA 2F6FA 4GFVA 3UBOA 3B1PA 2AFBA 2PA5A 2BGDA 1LHPA 3ZMPA 3RTDA 4H34A 5C3YA 3RSSA 4DC3A 1U25A 2YXTA 2DXPA 1GG4A 1VM7A 3RO4A 3RS8A 2JFHA
chains in the Genus database with same CATH topology
2GCAA 3QCZA 2Y68A 3PYZA 1J6UA 4CVLA 3NRSA 1FGSA 2Y67A 2UAGA 2WJPA 2AM1A 4BUBA 1GQYA 3EAGA 1E8CA 5A5EA 1UAGA 4C12A 2VORA 1EEHA 1W7KA 2UUOA 2Y1OA 3UAGA 5A5FA 1W78A 3ZM5A 4ZIYA 2AM2A 3MVNA 4HV4A 4CVMA 2JFGA 2X5OA 3N2AA 1GQQA 2GC6A 4QF5A 4CVKA 2GC5A 1JBWA 1E0DA 3LK7A 4QDIA 2F00A 2JFFA 2Y66A 2GCBA 3ZM6A 1P3DA 2WTZA 2XJAA 4BUCA 2VOSA 3HN7A 4C13A 2JFHA 2XPCA 4UAGA 1O5ZA 1GG4A 2VTEA 1JBVA 3ZL8A 2UUPA 1P31A 2VTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GCA A;  3QCZ A;  2Y68 A;  3PYZ A;  1J6U A;  4CVL A;  3NRS A;  1FGS A;  2Y67 A;  2UAG A;  2WJP A;  2AM1 A;  4BUB A;  1GQY A;  3EAG A;  1E8C A;  5A5E A;  1UAG A;  4C12 A;  2VOR A;  1EEH A;  1W7K A;  2UUO A;  2Y1O A;  3UAG A;  5A5F A;  1W78 A;  3ZM5 A;  4ZIY A;  2AM2 A;  3MVN A;  4HV4 A;  4CVM A;  2JFG A;  2X5O A;  3N2A A;  1GQQ A;  2GC6 A;  4QF5 A;  4CVK A;  2GC5 A;  1JBW A;  1E0D A;  3LK7 A;  4QDI A;  2F00 A;  2JFF A;  2Y66 A;  2GCB A;  3ZM6 A;  1P3D A;  2WTZ A;  2XJA A;  4BUC A;  2VOS A;  3HN7 A;  4C13 A;  2JFH A;  2XPC A;  4UAG A;  1O5Z A;  1GG4 A;  2VTE A;  1JBV A;  3ZL8 A;  2UUP A;  1P31 A;  2VTD A; 
#chains in the Genus database with same CATH topology
 3AWG A;  5K9W A;  3IE7 A;  2F6V A;  4AZ1 A;  2CM3 A;  1YHJ A;  1YTN A;  2I6B A;  1YPT A;  3H74 A;  1PTV A;  5COJ A;  2MBC A;  4R0S A;  2FH7 A;  2CM7 A;  3UAG A;  3RQ5 A;  2CNE A;  4XCK A;  3RS9 A;  2ZN7 A;  4MBB A;  2AM2 A;  3RZ2 A;  2B07 A;  2NT7 A;  1V19 A;  1JBW A;  4Z6B A;  2J17 A;  4OHE A;  4WOH A;  2PQ5 A;  1T48 A;  3NBW A;  3ZM6 A;  1P3D A;  1XRI A;  4XF7 A;  1BZH A;  3O4S A;  1RK2 A;  5TRW A;  2M3V A;  4RH5 A;  5BYD A;  3PYZ A;  3OMH A;  3BF5 A;  4C5L A;  2ESB A;  4E8Z A;  2R0B A;  5BYC A;  2B4S A;  4JNB A;  5KA7 A;  1UAG A;  1YZ4 A;  2OUD A;  1U24 A;  2B4U A;  3ZM2 A;  3F9B A;  5K9V A;  1FQ1 A;  1I9T A;  1OET A;  2PI7 A;  3MVN A;  3HIC A;  2CNH A;  3V0I A;  3NL2 A;  3N2A A;  2I5B A;  2F71 A;  5K22 A;  2XTB A;  1X24 A;  2H4V A;  3A5J A;  4I8N A;  1OEU A;  2F00 A;  3KZH A;  4S1M A;  2DDM A;  1T49 A;  5KA0 A;  1OHD A;  2HC2 A;  3BRH A;  3O3L A;  1G1F A;  4RI4 A;  3DZV A;  2PSZ A;  4OHD A;  3V0F A;  3MBJ A;  1RFU A;  1TD2 A;  3IKH A;  4JMJ A;  5C40 A;  1VI9 A;  2WJP A;  2AM1 A;  3QCG A;  1BZJ A;  3Q1Y A;  1E8C A;  4KYR A;  2NV5 A;  3RQH A;  5KAC A;  1EEH A;  2I6M A;  4NX8 A;  3ZV2 A;  2IMG A;  1NO6 A;  1V3A A;  2A8B A;  2QDC A;  4H1O A;  4K8T A;  2B49 A;  2QDP A;  4OHI A;  2YDU A;  3IBQ A;  4B8S A;  2VOS A;  4KAD A;  4C13 A;  2I4H A;  4JKU A;  1G7F A;  3D44 A;  3RO1 A;  1P15 A;  1PA1 A;  1ZCK A;  4LCA A;  1EKQ A;  1QXK A;  3LOO A;  1JF7 A;  4YR8 B;  1VHR A;  2NTA A;  2Q05 A;  3PZS A;  4X8F A;  1SUG A;  2BV5 A;  4C5M A;  4HJP A;  2Y1O A;  1PA9 A;  4R0T A;  3GO6 A;  2DCN A;  4K9I A;  4ZIY A;  1PTT A;  2HC1 A;  4KAN A;  4E8Y A;  4UBE A;  1BZC A;  4WTY A;  3I7Z A;  1GC5 A;  2GC6 A;  3QCH A;  1ZC0 A;  5K24 A;  2GC5 A;  4PVG A;  2FV7 A;  4K93 A;  3H49 A;  4S1I B;  2H04 A;  2F6W A;  5KAA A;  1EKK A;  4KI9 A;  4Y14 A;  1JBV A;  4HV4 A;  1GWZ A;  4JMK A;  4N09 A;  4LBG A;  1ONZ A;  3CM3 A;  2HW1 A;  3RY7 A;  3V0G A;  4BJO A;  3RT9 A;  2FJM A;  1G1G A;  4C12 A;  3HJ6 A;  4DU5 A;  3D42 A;  3HYO A;  2FJN A;  2UUO A;  2GJT A;  1UA4 A;  2F70 A;  1NWE A;  3FHY A;  2CM8 A;  1TZ6 A;  1G1H A;  3S3F A;  2X5O A;  3QCM A;  2H4G A;  3D1O A;  3NC9 A;  3RSF A;  3B1O A;  2NZ6 A;  5CM5 A;  2I4E A;  3QKP A;  1E0D A;  4QBW A;  3KEU A;  3QCE A;  4RKK A;  2WTZ A;  5BYE A;  2I6I A;  1LHR A;  2QCT A;  4GFU A;  1NL9 A;  2C49 A;  1TZ3 A;  1XM2 A;  2Y67 A;  2AZR A;  4YAA A;  2QBS A;  4J51 A;  2ABQ A;  1YGJ A;  1LQF A;  3B7O A;  2VEX A;  2VEW A;  4HRF A;  3RQ2 A;  3F41 A;  4K9C A;  2HNQ A;  1JXH A;  4GE5 A;  2F6Y A;  1I57 A;  3B1Q A;  2V78 A;  1PTY A;  2NLK A;  1G7G A;  4B8R A;  3AWF A;  3V0D A;  3LK7 A;  2F6T A;  5J8R A;  5KA3 A;  1ZCL A;  2RBC A;  1ECV A;  3QCJ A;  5KA9 A;  3AWE A;  4S0G A;  3N1C A;  2VTD A;  2RF6 A;  2OZ5 A;  5GTJ A;  2JGV A;  4WU2 A;  3QCC A;  2F6Z A;  2I1Y A;  2PT0 A;  2QBP A;  4RDD A;  3S4E A;  5CGE A;  3BLT A;  5K25 A;  3RTG A;  3ZM0 A;  1GQT A;  5C3Z A;  1Q6M A;  5F11 A;  2VEU A;  4K8K A;  3RRJ A;  2P4D A;  3QCK A;  2R3E A;  3F81 A;  1A5Y A;  3S3K A;  1G4U S;  4E3A A;  2A3K A;  4OHH A;  4E69 A;  4KAL A;  2ZMM A;  3CQD A;  2OC3 A;  1ZZW A;  3NBV A;  2BIJ A;  2I3U A;  3EU0 A;  1YGK A;  3UQD A;  1C84 A;  3LJS A;  1EEN A;  3ZL8 A;  2CMC A;  1OEM X;  3RGQ A;  3O5X A;  2Y68 A;  1YGU A;  2GWO A;  5KA1 A;  2AX3 A;  4XF6 A;  2VAR A;  2Y2F A;  1V1S A;  2ABS A;  5C41 A;  4BUB A;  3NME A;  4U7X A;  2JG1 A;  2I6P A;  3BM8 A;  4JKS A;  2VOR A;  1RFT A;  4YWR A;  5A5F A;  4NND A;  2YXU A;  3BLU A;  3UQE A;  4GM6 A;  4QUN A;  2OOQ A;  1LAR A;  1PTU A;  4RI5 A;  1OEO X;  3QCN A;  4ERC A;  2I75 A;  3IN1 A;  2GCB A;  3B3L A;  2F02 A;  2NWH A;  2QHP A;  2BZL A;  5BUG A;  1LIO A;  2E0T A;  3RU3 A;  1Q6S A;  3UMO A;  2CMB A;  3NL6 A;  3V0J A;  3PS5 A;  5BX1 A;  4PYH A;  1WRM A;  4QBE A;  3ZS7 A;  2H4K A;  3GBU A;  5I6V A;  4JJP A;  5KAD A;  4HJQ A;  1C88 A;  2I4G A;  2QBQ A;  2A9Y A;  2AB8 A;  3HPD A;  4C5J A;  5KA2 A;  3RRE A;  1FPZ A;  1QZ0 A;  4O1G A;  2AWD A;  2VEY A;  5KAB A;  1RKA A;  1C85 A;  2PKN A;  3RQ6 A;  1JLN A;  1L2L A;  3O4U A;  4GE2 A;  4YL5 A;  4D3P A;  4R30 A;  3GO7 A;  3W4S A;  4UAG A;  1JXI A;  3RRF A;  1Q6T A;  3RQQ A;  2GCA A;  1ESQ A;  3QCZ A;  5EHP A;  3SR9 A;  1J6U A;  3EB1 A;  3GXG A;  1FGS A;  3ZM1 A;  5HDE A;  2HXP A;  3NM1 A;  4E8W A;  3M4U A;  1W7K A;  4TVV A;  4XDA A;  1GFY A;  3RQX A;  3IH0 A;  1DGM A;  3LKI A;  1C86 A;  1YWF A;  3CWE A;  3SME A;  4QUM A;  2GP0 A;  3B1N A;  1KAV A;  3RTA A;  4D3R A;  2WGP A;  4S1I A;  3QCB A;  2XJA A;  2A9Z A;  3HN7 A;  4O1L A;  2HY3 A;  5LXQ B;  2XPC A;  5K23 A;  3V0E A;  2J16 B;  2UUP A;  2SHP A;  1RKD A;  3NL5 A;  3RPH A;  1V1A A;  4C5N A;  4DGP A;  3K5W A;  4E84 A;  4EOH A;  1Q6J A;  4WJM A;  4GE6 A;  3IQ0 A;  2B3O A;  2I3R A;  3NC2 A;  1LIK A;  3I80 A;  4PVV A;  3PL2 A;  3KTN A;  3NCA A;  4GS0 A;  2CFV A;  3S4O A;  1Q6N A;  1WAX A;  1LII A;  1YN9 A;  2AA0 A;  1PH0 A;  2CNI A;  3RTE A;  2I6O A;  4DGX A;  4CVM A;  4S1H A;  2C4E A;  2HB1 A;  4QF5 A;  5F0Z A;  3ZM3 A;  4CVK A;  4QDI A;  3DRW A;  3MOZ A;  4BUC A;  4QAH A;  1RPM A;  3OTX A;  2QDM A;  2P6X A;  1LIJ A;  3H2X A;  3NL3 A;  5KA8 A;  2QEP A;  4ZRT A;  3Q92 A;  1TYY A;  3F99 A;  3RT7 A;  4QAP A;  1ONY A;  2I42 A;  1GQY A;  2QBR A;  1FPR A;  3D1H A;  2CNG A;  2CMA A;  3LHX A;  3S3E A;  3B1R A;  3RTB A;  4EBU A;  1YFO A;  3F9A A;  1OEV A;  4ZN5 A;  2PKF A;  1NZ7 A;  4JBC A;  4ZI4 A;  1YGR A;  1WYE A;  4K8P A;  4GRY A;  1D5R A;  2I6J A;  3GXH A;  3MBH A;  5M43 A;  2BGE A;  1J4X A;  4D3Q A;  2AJR A;  3I3Y A;  4KAH A;  1RXD A;  3JUL A;  3KD6 A;  3OLR A;  3ZMQ A;  1P31 A;  4C5K A;  4GRZ A;  2B4P A;  1PYN A;  2QCJ A;  3QCD A;  3UQ9 A;  3EWM A;  1U2X A;  1PXH A;  2AHS A;  1UB0 A;  1ESJ A;  4NWF A;  3QKQ A;  5KA4 A;  1XBO A;  2AJP A;  1WCH A;  2Y96 A;  1NWL A;  2I6A A;  1KYH A;  1RKS A;  3NM3 A;  3RPZ A;  1W78 A;  5B6A A;  4RH9 A;  5MMZ B;  3QCF A;  4GWF A;  4IKC A;  1KAK A;  3D1Q A;  2JFG A;  2R3B A;  1C83 A;  3V0H A;  2Q5R A;  4LC4 A;  1XXP A;  3O4T A;  2Y66 A;  2HVL A;  3MMJ A;  2HNP A;  2VTE A;  1MKP A;  2PKM A;  2H03 A;  4K8C A;  4RHG A;  3QA2 A;  4N08 A;  2I5X A;  4BPC A;  4EUM A;  1OHE A;  4KYQ A;  1M3G A;  1AAX A;  2G59 A;  1L8G A;  1OES A;  3ZM5 A;  2B4O A;  2G6Z A;  2HLZ A;  1C87 A;  3FHX A;  4LBX A;  1EEO A;  2QCV A;  4ICZ A;  3MOW A;  2JG5 A;  1GQQ A;  2F7K A;  1L8K A;  2C7S A;  1Q1M A;  1YTS A;  3RGO A;  5IBS A;  2JFF A;  4KBE A;  3VAS A;  2CJZ A;  5BZZ A;  3BGK A;  1VK4 A;  1RFV A;  2H02 A;  3EMU A;  2J16 A;  4Y2E A;  3RTC A;  1Q6P A;  1I9S A;  4OHL A;  3RQ8 A;  4CVL A;  3UQ6 A;  1C3Q A;  3RM5 A;  3LJ8 A;  5TQI A;  3U96 A;  2UAG A;  1G4W R;  2HQQ A;  3QAI A;  3VAQ A;  1U26 A;  2NT2 A;  3K9E A;  1T4J A;  3A5K A;  5AWX A;  3QCL A;  5A5E A;  2JJD A;  2DDO A;  2Q47 A;  3S3H A;  3N0A A;  4B04 A;  5EYN A;  3UMP A;  2PBN A;  2CM2 A;  2DDW A;  2PKK A;  1OHC A;  1NNY A;  1V1B A;  3EZZ A;  4NYH A;  2C46 A;  1R6H A;  1LYV A;  1O5Z A;  4WU3 A;  3I36 A;  4EN4 A;  3D9C A;  3RSQ A;  1YTW A;  2CNF A;  5BZX A;  4NWG A;  1BX4 A;  5EY7 A;  3EAX A;  3RU2 A;  3NRS A;  1XXV A;  3RRB A;  5BYF A;  3EAG A;  2VEV A;  5IBM A;  5CGA A;  2F46 A;  5EHR A;  3RSG A;  3QCI A;  2HCM A;  2F6F A;  4GFV A;  3UBO A;  3B1P A;  2AFB A;  2PA5 A;  2BGD A;  1LHP A;  3ZMP A;  3RTD A;  4H34 A;  5C3Y A;  3RSS A;  4DC3 A;  1U25 A;  2YXT A;  2DXP A;  1GG4 A;  1VM7 A;  3RO4 A;  3RS8 A;  2JFH A; 
#chains in the Genus database with same CATH homology
 2GCA A;  3QCZ A;  2Y68 A;  3PYZ A;  1J6U A;  4CVL A;  3NRS A;  1FGS A;  2Y67 A;  2UAG A;  2WJP A;  2AM1 A;  4BUB A;  1GQY A;  3EAG A;  1E8C A;  5A5E A;  1UAG A;  4C12 A;  2VOR A;  1EEH A;  1W7K A;  2UUO A;  2Y1O A;  3UAG A;  5A5F A;  1W78 A;  3ZM5 A;  4ZIY A;  2AM2 A;  3MVN A;  4HV4 A;  4CVM A;  2JFG A;  2X5O A;  3N2A A;  1GQQ A;  2GC6 A;  4QF5 A;  4CVK A;  2GC5 A;  1JBW A;  1E0D A;  3LK7 A;  4QDI A;  2F00 A;  2JFF A;  2Y66 A;  2GCB A;  3ZM6 A;  1P3D A;  2WTZ A;  2XJA A;  4BUC A;  2VOS A;  3HN7 A;  4C13 A;  2JFH A;  2XPC A;  4UAG A;  1O5Z A;  1GG4 A;  2VTE A;  1JBV A;  3ZL8 A;  2UUP A;  1P31 A;  2VTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...