1FHDA

Crystal structure of the xylanase cex with xylobiose-derived imidazole inhibitor
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords BETA-1,4-XYLANASE
total genus 129
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fhdA00
5EFFA 2JFEX 4W87A 2J8FA 1E9LA 3AHVA 3ZT5A 2BY1A 3VGGA 3CUGA 3ZM8A 1EQCA 2BS9A 4D6JA 3AS2A 1CEOA 5HBFA 1JGIA 3VKKA 5LA0A 2J7HA 3KWXA 3A4WA 4W8BA 4FLSA 3D3AA 4QP0A 4D6DA 1CLVA 2WLYA 2JE8A 1V3KA 3AIEA 2OWWA 4UTFA 4H41A 4M1RA 1M53A 2XIIA 2G4FA 3DHUA 2BY0A 3OLDA 2O9TA 1SMAA 3WH5A 1KCKA 2WZHA 1GVIA 3EDKA 3CGTA 4OBRA 4Z2GA 2DDXA 5CLTA 4AD3A 4CD4A 2J74A 2E40A 3NDYA 1UD8A 4H04A 4J3WA 3PZ9A 4CKQA 1KQZA 4B9ZA 1J11A 3DC0A 5BRQA 2XFYA 2VVNA 4GI9A 1BGAA 1HF6A 4DWSD 1ISXA 4UQBA 2F2HA 5HPOA 2QMKA 5E0CA 1BLIA 3WF3A 4OZOA 1UR4A 1GOIA 4ACZB 1VBUA 1E5NA 2VZSA 5A69A 5JIWA 3UETA 1XYZA 1QOXA 5HPCA 4CD7A 1KR0A 1SYTA 4JKKA 2QLYA 1NARA 1GQJA 1XSJA 4J3TA 5HNNA 2FHBA 1UZ1A 1E43A 1S46A 3VNYA 3EDJA 4UFIA 3WEZA 3VD9A 1XD1A 3TP4A 3WF1A 3ZJ6A 1UR0A 3RILA 1HNYA 1UD4A 4P7LA 2GJXA 1D3CA 2PWDA 2QV4A 1W9PA 4NI3A 1NWUA 1CGTA 1Q6CA 3QGVA 2VMFA 4JAWA 4PN2A 1CGVA 1GOWA 1R86A 3WD3A 1BYAA 5BROA 3VDBA 1K6AA 1DHKA 3F5KA 1UYQA 4AZ7A 3KL0A 4UQAA 3K8KA 2XTKA 4OKDA 3VOCA 2WC4A 4RE3A 3RM8A 1CNVA 1PPIA 2G41A 1VEOA 4LPCA 3WNMA 3GXDA 4PMUA 3WNLA 1H41A 2UY4A 2W92A 4HOWA 3RJXA 4DUWA 1JDDA 1CTNA 2O9RA 1VFMA 1US2A 4DUXA 3WSUA 3KZSA 4J3SA 1CBGA 2G3MA 1MW3A 2CYGA 1GOQA 2BVDA 3U7BA 3BMWA 4MTVA 5EBAA 2WAGA 1GUVA 1VFUA 1PBGA 2D23A 4J7RA 2VZTA 1VF8A 4J27A 5A2CA 3W28A 4XZBA 1QI5A 2V3EA 3VD4A 4TX6A 1C7SA 1WDRA 3II1A 4AW7A 4GXPA 1ISZA 2J7DA 4MNJA 4W85A 1FP9A 2J25A 4E8DA 1JYWA 3EMCA 2WC3A 4W7UA 3SURA 2D2OA 4AD2A 5FL0A 3BAWA 5FKYA 1DWAM 4JHOA 3AXXA 1UR8A 2ZUTA 3T08A 3ARRA 2Y4SA 3VGEA 3SCPA 4JFWA 3WF2A 4CVUA 3A3HA 3VIGA 2QPUA 1BYDA 1UKTA 4U31A 2QPSA 3BSHA 3L4XA 3T09A 4OBSA 3ZT6A 2WHKA 3T0AA 3WKZA 2WHLA 1E70M 3GYCA 2VR4A 4LGXA 4HZ7A 4GI6A 4H8HA 1JNDA 3AQUA 1B90A 3RM9A 3L2LA 2AOSA 2BVTA 3APGA 1V0MA 3HMCA 2YA0A 4KMQA 4F66A 1EO7A 5I6SA 2PWFA 3WMCA 1BG4A 2ZUSA 1B30A 1C93A 4F9DA 3VPLA 1AMYA 1KWKA 3RPMA 3TTYA 4X9YA 1E0VA 4PMNA 1V02A 2W63A 2WKGA 2EO7A 1AQHA 2WC7A 1TVPA 3ZJ7A 2VOTA 1B3WA 3M7SA 3VIPA 4KRUA 3T2QA 3OLGA 2VC9A 4UQCA 3ARTA 3IJ9A 2DH3A 4H7VA 1EDTA 1U30A 5KEZA 1E6NA 2GJRA 2YA1A 1V3HA 4TVUA 1G9HA 1NQ6A 1IV8A 1D2KA 2J4GA 3FAXA 2WMKA 1V02E 2PF0A 1ZJAA 2X09A 3WF0A 5BXPA 2BHZA 2VX7A 4CD6A 1JIBA 1KGUA 3VNZA 1E6RA 3LPPA 5A6LA 4RE4A 1V6YA 4UZSA 3QR3A 4NRRA 5IHSA 1LL4A 3AIBA 2CERA 3UG3A 2YKKA 1K9FA 2ZUVA 3CUJA 5KZ6A 4ZENA 1V3MA 2E8YA 3WMSA 3MANA 1BHGA 1W9BM 1F4AA 5F7UA 1GJUA 3CZKA 3WEMA 4MB5A 5M17A 3UERA 1E4IA 2WVTA 1ECEA 3MMWA 4ACYA 5CPTA 2A3HA 1I75A 1WPCA 5A94A 4NRSA 4GQQA 2VX5A 2XM1A 4AISA 2G3NA 2YJQA 1KXHA 1B3ZA 1FFRA 1ZL1A 2JEPA 2VR5A 3IAQA 3WH8A 2D0HA 3ARWA 1UH3A 5ECUA 7TAAA 1OB0A 3WH7A 5M5DA 1QPKA 1DWJM 1PZ2A 4FLRA 4WSKA 3WQWA 3CUFA 3ZQ9A 1X1NA 5A8QA 1QNRA 3HU7A 4TTUA 4CN4A 3SCTA 2ZX5A 4P8UA 2VRQA 1HJWA 2VRJA 3CMGA 2EBNA 3VILA 3PZNA 4M24A 1V3JA 1QHZA 1E0WA 1UHVA 2J7BA 4M82A 4GO9A 4RE2A 4PSPA 1WE5A 3UEQA 1I1XA 1E6ZA 3WNPA 1MQRA 4CU8A 3MKKA 4MAZA 1ZBCA 2FH8A 4MB3A 2GDUA 2GJPA 1DWGM 1JDAA 3MUAA 2E8ZA 1VEPA 2V5CA 4H8VA 3AMCA 3UG4A 1UKPA 1JYNA 2WLZA 2OLHA 3AICA 3BH4A 4L4PA 1PIGA 4XZWA 3GTNA 1W3HA 3PZGA 2YIHA 2CKRA 5E6YA 3OZOA 2JIEA 4M81A 2YDSA 2OSWA 4N0RA 1E73M 3AIVA 3EDDA 1HL9A 4JCLA 3JUGA 3MUY1 1Q6FA 3IJ8A 1ZBKA 1QNOA 4D72A 2OYLA 1TG7A 1BYBA 3VIJA 2DH2A 2YBUA 2VCCA 2WHMA 2J7CA 3OGSA 3WD0A 2O9OA 5I79A 3FHQA 3MV11 1Q6GA 1W9VA 3A4AA 2WSKA 5A2BA 3VMPA 3GH4A 1JYXA 4EAMA 5EFDA 1NWRA 1W3LA 2OYKA 3OLEA 5EMYA 4JL2A 1E6SM 5FOOA 3W29A 3WBEA 3FXYA 2YBTA 3VIIA 1MW2A 1E6QM 4CD8A 4BZYA 1DWHM 1V03A 4HA4A 2OWCA 1WDQA 4BQ2A 3WIJA 1W1TA 2BVYA 1QI3A 2UY2A 4MPKA 4MNLA 1JZ4A 2PBGA 4YPJA 1ISWA 5CPQA 1ZB5A 1EQPA 3WBAA 3NUKA 2WANA 4D71A 1JZ7A 4W93A 3ZO9A 3VGHA 2CXGA 3FN9A 2DSWA 3GZAA 1K9EA 1E5JA 4BA0A 3VMNA 4UQ9A 2VVSA 3VDAA 5D8WA 3PZIA 1CXFA 5A8NA 5AYBA 1GONA 1JFHA 2D22A 2WM0A 3WDPP 5HDRA 3OIHA 2XVNA 3POCA 4N42A 1C90A 3WQ6A 3CZEA 2Y8VA 4YN5A 3FHAA 3J7HA 3OLIA 1UWIA 2JF7A 2TAAA 5AY7A 3PTKA 2D20A 4HZ6A 4UFMA 1M01A 1J9YA 4YHEA 4W84A 3LPFA 3WUEA 1JAEA 3O6AA 5FL1A 3PTQA 3TONA 1JZ3A 7A3HA 1KGWA 2VJXA 1HJSA 4QFUA 1TCMA 1JD7A 2CBVA 2D0GA 3EBVA 1J01A 3WUFA 5CG0A 3WUBA 1GQIA 4EKJA 1JAKA 4JFUA 2WMIB 4W8AA 1UWSA 1PX3A 1H3GA 5A95A 2QF8A 2X2YA 4FLQA 4LX4A 1DTUA 2PWGA 4IPNB 3MMDA 1VIWA 3ARVA 4P7RA 3ARZA 3B9DA 5A8MA 3QOKA 8A3HA 1PIFA 1BF2A 3F5LA 3EMZA 2DEPA 2WMFA 1HX0A 3AYSA 1TUXA 2AAAA 1OGGA 4ZFMA 5AYIA 2X05A 3WEOA 2YL6A 3WDHA 3N17A 1OM0A 1UD6A 2E0PA 3AXHA 5I23A 1NP0A 1OINA 3SCOA 3LPGA 1H0IA 3ALFA 1OD0A 1MFVA 1R85A 1UR9A 1FOBA 3EDEA 1B1YA 1KXQA 4UOQA 2CPUA 2MANA 4GZEA 1KWGA 3WNNA 1E15A 2DT2A 5JBEA 2WWDA 3VIKA 3NDZA 4E2OA 3PTMA 4CN1A 4WLCA 4X0NA 1J0KA 3N9KA 5LA1A 2WHJA 4B16A 3W81A 3W0KA 4BQ5A 1HKKA 1TMQA 5DFAA 1UUQA 4QLLA 5ABGA 1UA3A 4IISA 1O6IA 3GXFA 5CXPA 2VI0A 1W91A 5A6BA 4WK9A 4UR9A 3AIWA 3BLPX 1SFSA 4FLOA 3VVGA 3PZMA 1OT1A 4B9YA 2YLAA 3WH9A 1JF6A 2QHAA 3GNOA 1JI1A 3BAYA 1ISYA 3NSMA 3UCQA 5C8BB 2C0HA 2W66A 1WAWA 1XH2A 1LG2A 5A2AA 3QHNA 2WMHA 1V3LA 1H0GA 1FA2A 4A3YA 4AZIA 3AROA 1WNOA 3SUSA 3RO8A 3U5YA 2EQDA 2W4XA 1EGZA 1W1VA 4JFTA 1WB0A 5IFTA 4PTXA 2VRKA 3L4VA 3A47A 2VCAA 3AZRA 1BQCA 4JFSA 4QAWA 4JCMA 2OYMA 4UQEA 3ZSTA 1E55A 4HPGA 2J7GA 4PMRA 2XSAA 4C7DA 3WDRA 3BC9A 5A8OA 1E3XA 2XG9A 4UFJA 4PCSA 1CGXA 3O9NA 2ZXQA 2YDRA 1QHPA 1Y7VA 3K4AA 3GBEA 3DYOA 5E70A 4FMVA 3LPOA 4W86A 1EOMA 5CLWA 2XGBA 3CZGA 1LQ0A 4KGJA 2D3NA 4W5ZA 4TXEA 1OT2A 3WH6A 3WNKA 3WY1A 1UWQA 2WKLA 4AD1A 1H2JA 1US3A 2E9MA 3VIFA 1KQYA 2V3FA 4AEEA 3OB8A 4DWSA 3WFZA 3NJ3A 3AS3A 2ZOXA 1RP9A 2VCBA 3BLKA 3THDA 2UY3A 3OBAA 3ECQA 2X1IA 4P7OA 2YA2A 1BYCA 4PBGA 1BGGA 5CSYA 3WD4A 1B3XA 3A6OA 1LL6A 4UFHA 2Z1KA 1JXKA 3PZUA 4P8VA 2V3DA 1DEDA 2DT1A 3U5UA 1E40A 3TTQA 3RMEA 1UQYA 4BS0A 2FHFA 1QNPA 3IAPA 3VD7A 1V6VA 4OUEA 3WQ8A 5D9NA 2ZIDA 1M03A 4CVWA 3WMBA 5DT5A 3DECA 4HOZA 5C70A 2V3GA 2YL9A 2ZX6A 4H2CA 1M04A 4OIFA 2X0YA 1X6NA 5BRPA 1LLOA 1XYFA 4OOUA 1UR2A 1GORA 1W9UA 1JXJA 4GKLA 4AZ5A 4CCCA 2WBKA 3ARPA 1QW8A 1UD5A 5BCAA 1C3FA 4PUEA 3VD3A 1PX4A 2XWDA 5D9MA 4B3KA 1CDGA 4PRWA 3CUIA 2J62A 1G94A 2XVLA 4P7NA 1JZ2A 5A8PA 4LQ1A 1MYRA 1XH0A 4QDMA 3TTOA 4JKLA 4PTVA 1CLXA 1UD3A 3W27A 5AC4A 3VIHA 4J28A 3GBDA 3NSNA 2VNCA 3PBGA 4J3VA 3OGVA 1H11A 1E71M 2CBIA 4CN6A 5TD4A 3AISA 1ODUA 4LYPA 3W37A 1QW9A 2DIEA 1UH2A 4ZE4A 1EDQA 2EPNA 1TVNA 3SUWA 1RPKA 4ZE5A 1TA3A 2JEQA 1G5AA 3BAKA 3B8SA 3AI0A 5E09A 1OWQA 3BCFA 2XVGA 1J18A 3I3BA 3MS8A 5D9OA 5GQBA 1ISVA 2B31A 4A3HA 1DWIM 1XRVA 2EJ1A 4XV0A 4ZEPA 1HJVA 3OZPA 1R8LA 3SCNA 3T0BA 1K9TA 1HKIA 1CXLA 2A3AA 2ZX9A 3PZTA 4PEEA 1NH6A 3FAWA 1HKJA 3N1AA 2DSKA 3CHFA 2VZUA 3BAJA 2O9PA 1LL7A 3WDJA 1L8NA 1RH9A 1UWRA 3AZSA 3N13A 4PMZA 3CHCA 4JFVA 4U2ZA 3CLWA 2FDMA 1E4LA 5JIPA 5IXEA 1W32A 4U5IA 1XD0A 2FGLA 1H4PA 1BG9A 2W67A 3M46A 3GNRA 4XX6A 4WIWA 1JD9A 4V2XA 4D1JA 1G1YA 3WUGA 2HVMA 2VX6A 1JFXA 3AS1A 2DPEA 3PZQA 3T0DA 1L0PA 1RP8A 2VL4A 2Y24A 3CPUA 5CGMA 5FIPA 4W7VA 3VIMA 3GXIA 4JIEA 4D1IA 5A6KA 2XVPA 4UOJA 1OGBA 2X8RA 3KE0A 4WKAA 1XC6A 1TZ7A 3AIRA 5I3DA 1B9ZA 2PBOA 3N18A 3SCUA 2Q8XA 4ZXOA 3U57A 3W6MA 2Y5EA 3WQ5A 2WWCA 1HIZA 4MNMA 1E0XA 1GOKA 4K68A 1E1EA 4BQ4A 1HVQA 2BY3A 2JIWA 4TVCA 4TTGA 2ZICA 2W61A 5CZKA 4X0VA 4J3XA 2YOCA 1MFUA 1PEZA 2WZEA 3WELA 4PUDA 3IK2A 4ATDA 2ZWZA 4MDPA 1QNQA 2WVVB 3WDIA 5I24A 4L4OA 2UY5A 1H1NA 1GCYA 2WSPA 3VD5A 2CHOA 3L4ZA 4AD4A 4AXNA 4HU0A 3O2LA 3N04A 4AZCA 4PMVA 3ZMRA 1XCXA 2A3CA 4W7WA 1OGSA 3AOFA 3AIUA 4R27A 3G6MA 2XUCA 2PWEA 1VEMA 5A6SA 1E1FA 1LJYA 1OIFA 3ZSSA 2Y2WA 3GNPA 3K1DA 4WF7A 1JYVA 2WCSA 3VGFA 1LWHA 1CPUA 7CGTA 1BAGA 3MV01 3ZR6A 1VBRA 1GHRA 2CIPA 1J0ZA 2J8GA 3DYMA 1GHSA 4J3UA 3FW6A 3UR8A 1WCGA 1PJ9A 2J79A 4V27A 2CNCA 1C91A 1C8QA 4AEFA 1VRXA 4Z2IA 4DWSB 5ABHA 4PMOA 2VO5A 4HTYA 5I0DA 3L4TA 2VTFA 1CXHA 4CCEA 5FCZA 1QVBA 1OD8A 4LYRA 2CBUA 3PN8A 1JG9A 1V08A 4QCFA 2D1ZA 1Q6DA 4AZGA 3FNDA 1OBAA 1JZ5A 3CIVA 3W53A 1IZJA 1EA9C 1WZAA 3PHAA 5A6BD 2J7FA 2J78A 1W9DM 4DM2A 1H49A 2DSZA 1MVYA 4HA3A 4P7QA 1WZKA 4D6FA 3UESA 1GOMA 3AMGA 1HN1A 2Y8KA 3CHDA 4HU8A 3SCRA 3MSGA 5CPSA 1BFNA 1C7TA 1GNXA 1WDPA 4Z2KA 1XSIA 2YLLA 3N11A 3ARUA 1FH8A 2ZXDA 4UZUA 1Q6EA 2ZUWA 3AJ7A 5CJ5A 3GH7A 1UG6A 1KBBA 2YDQA 1BVNP 3CZJA 4AZBA 4PTMA 3W82A 2BNJA 2D0FA 2WVUA 1UZ4A 2Z1SA 1UOKA 3G6LA 4MB1A 4CU7A 1WO2A 2CESA 4BQ3A 4BF7A 1G0CA 1WZLA 4JL1A 3ZIZA 2WBGA 1GQLA 1KXVA 1W1PA 2XFRA 3NSXA 5LA2A 2FGZA 3AYRA 4E4PA 1GOOA 1HVXA 1EXPA 1J12A 1UQZA 2GUYA 2HISA 2WMGA 4M80A 4U3CA 1C8XA 1V6XA 3N12A 2UWFA 4AYSA 3EDFA 1CXIA 5HXMA 1ZU8A 3CH9A 2ESCA 2GSJA 3BMVA 2RGMA 1GZJA 2X0HA 1QBBA 1ZBVA 2DQXA 1W3JA 2VX4A 4GQRA 4DWSC 4UNIA 2W62A 1U2YA 1NOUA 1V6WA 3GM8A 1V0KA 1GQKA 3RCNA 1X6LA 3WFLA 1NM9A 1XV8A 1KBKA 4UCFA 1QI0A 2DT0A 4XB3A 1UKQA 3SCSA 4HOXA 3AHZA 2J47A 3E1F1 1FP8A 5D9PA 1ODZA 1WDSA 1ZBWA 3TOPA 4HMEA 4NSBA 2QMJA 1XCWA 4AMCA 2WNWA 3RDKA 1J0IA 3MO4A 4MNKA 5E0FA 4EK7A 1JZ8A 1JNEA 1B0IA 1HXJA 5DMYA 4CCDA 1ITXA 3SCVA 4AIEA 2PWHA 1CXEA 1K9DA 2IXVA 4KGLA 4JKMA 3VMOA 3M07A 2XHYA 1KGXA 1VFOA 1V3IA 1JI2A 2WVVA 3U7VA 3CTTA 2VUYA 1UWTA 2BFGA 1V0LA 4R5EA 1HJUA 2CHNA 1UKSA 3KEHA 3WDQA 4GI8A 3SCWA 5JBDA 1JF5A 1WP6A 3DHPA 3SCQA 4CD5A 3IANA 3AHYA 2PI6A 4M56A 1A3HA 3VDHA 4CUCA 2WZIA 1TR1A 2WCAA 4D6IA 3TA9A 2OWXA 1YQ2A 2RGLA 1VB9A 4U2YA 1KR1A 1BPLB 1CZ1A 3GXMA 3AHXA 3MUIA 1IT0A 1ITCA 1V6UA 4FF5A 3ZT7A 3AFBA 1CGUA 5ABFA 2FHCA 1D7FA 4CGTA 4D6GA 2ZUMA 2ZX7A 5DT7A 3QHMA 5DO8A 1CIUA 1QI2A 2CKSA 1ZS2A 2WCGA 3HJEA 2A3EA 3W24A 2ZWYA 2J77A 3PZOA 1FH7A 2XGIA 3L4UA 3EMQA 1MW1A 3CUHA 4HA1A 4HP5A 5I78A 1XHGA 1E4MM 3VIOA 3QHOA 3MSDA 1NWTA 3NCOA 1H5VA 3BCDA 1KCLA 1VJSA 3NIYA 1PAMA 4MJ4A 2OSXA 3M6DA 4UQDA 5I77A 1KXTA 4PMXA 3TTSA 5D4YA 1E72M 3K4DA 4QCEA 5DF0A 2OSYA 2GK1B 1EOKA 1NOWA 4NF7A 2BXZA 3S6TA 4Z2JA 1HL8A 5E9AA 1QI4A 1BTCA 3RM4A 1MWOA 2BV9A 3VO0A 2EPOA 3OA5A 3OG2A 8CGTA 1B3VA 3W25A 4F8XA 2V38A 5CGTA 1OIMA 1G01A 1HJXA 1B3YA 1OCQA 2ZXBA 1TA3B 2F8QA 4WKFA 5HOSA 3D5HA 3CO4A 2ZUNA 2DSVA 2VQTA 4GZIA 4MDOA 4E8CA 4PCTA 2CBJA 4P8WA 4IUGA 5I5RA 4D6EA 1GW1A 1R87A 2VT0A 3THCA 3SIMA 3OGRA 2J7EA 5BXSA 1AVAA 3FY1A 4KH2A 2E4TA 3VM7A 4M29A 2WK2A 3VX1A 1HP4A 3ZJKA 1CYGA 1Z32X 3K46A 4OJYA 3BSGA 3WN6A 2FH6A 3GDBA 1HP5A 4F9JA 1LF1A 4W8LA 1TE1A 1WKYA 1V0NA 4Z2HA 3UG5A 1A47A 4U33A 5BXTA 3MMUA 2DGAA 2NT1A 1MW0A 1SMDA 3T2PA 3ZJ8A 4PTWA 4IM4A 3AS0A 1EHAA 1LWJA 1MQQA 3AXIA 2WMJA 4PSRA 5GPRA 3AIQA 2EEXA 3VU2A 4H8UA 1W9XA 2EPMX 3ZR5A 3CBWA 4AWEA 3L2MA 3RJYA 2XJ7A 4HMCA 4QLKA 5AC5A 1C8YA 2NT0A 5GNYA 1DP0A 2V5DA 4WSJA 1EO5A 5CSUA 3ARXA 1N82A 3HN3A 2IUZA 3MUZ1 5M3WA 5A6MA 1C92A 4UFLA 1QNSA 2DT3A 4TX8A 3WL1A 2J75A 1XSKA 1HT6A 2CETA 2XSBA 2A3BA 2EPLX 5JBFA 2VQUA 3ARYA 3A4XA 5GNXA 2NW0A 3CZ8A 1H09A 3AHTA 1PX8A 1F4HA 2G3JA 3VGDA 1WZMA 5IFPA 4Q7NA 3WQVA 1NOFA 1E56A 3QOMA 4W89A 3ZOAA 1E6PA 4AY1A 1M7XA 2DIJA 4JHZA 2GJXB 2WVSA 4IPLA 1VAHA 5DEZA 1O7AA 2BY2A 3B9AA 1AQMA 4S3JA 3RIKA 1B2YA 4PYSA 5C71A 1XH1A 1W3KA 1AQ0A 4MB4A 1GVYA 3W26A 2PC8A 4U5KA 4PMYA 5BXRA 3ARQA 4FK9A 3I3DA 4GO8A 1KB3A 2D24A 2NSXA 2ZE0A 2CEQA 2WPGA 4TUFA 5A3HA 5LYRA 2GDVA 2JALA 4HZ8A 5JUVA 4B3LA 2DSUA 3AMKA 3VUPA 4ACZA 4ATWA 5IDIA 1MXDA 5CQ1A 1FFQA 2JF6A 1R7OA 2XWEA 2EXOA 4DM1A 4ML4A 1EDGA 2YL8A 3EYPA 4M8UA 4BCEA 2G3IA 1GJWA 6A3HA 1U33A 2E9BA 5D8ZA 3W4RA 3WQ4A 2VURA 3KL5A 1CGYA 3T2OA 4TVDA 1UH4A 4LXFA 5BWFA 4W5UA 4LYQA 4PMDA 1FH9A 4YHGA 3WENA 4JZ5A 1J0YA 3BXWA 3N15A 2WB5A 1BSIA 4P8XA 5M03A 3SEPA 2G8ZA 3L4WA 5IHRA 1ESWA 1KFWA 1XGZA 2AMGA 3SUTA 3NYDA 5BYWA 3S2CA 3LMYA 3SUVA 4CU6A 6CGTA 3AMLA 4PMQA 4AZHA 3I3EA 4AIUA 5I2UA 3UR7A 4HPHA 1CGWA 1QHOA 3VX0A 1P6WA 2XYLA 2WW5A 3WNOA 3BAIA 1UKOA 4UFKA 1HKMA 4HMDA 2VZVA 4AIOA 2C8NA 5A6AA 1E3ZA 1YHTA 5E6ZA 1HJQA 1CENA 4QLJA 2GK1A 3WF4A 1NP2A 1FHDA 2W91A 2O92A 4AZCB 4C7FA 1JDCA 4U3AA 1J0HA 3WD1A 1VJZA 2F61A 3F5JA 4D6CA 3KL3A 2E9LA 1UR1A 1E4NA 1CWYA 3ARSA 3AZTA 4A4AA 1CXKA 3MU7A 4OOZA 1MQPA 3K8LA 4C7GA 1RD6A 4V28A 3W38A 4DUVA 4XUYA 1UA7A 3DYPA 3VINA 2W5FA 3POHA 2EPKX 3F4VA 2XVKA 2XIBA 4D6HA 4ATLA 5ABFB 2WMIA 1UD2A 3AMDA 4Y7EA 2GVYA 5ABEA 4EE9A 1R7AA 4GIAA 4KRTA 1JL8A 1BVZA 4B15A 3BAXA 3PZVA 3WD2A 1FHLA 4Q22A 1DWFM 1E6XM 2WXDM 3IJ7A 1J0JA 1Q4NX 1VFFA 3VDCA 3CZLA 2XPKA 1CECA 4AC1X 4MADA 4UOZA 1EHNA 1UWUA 2CCRA 5EB8A 3WL0A 2BHYA 2BHUA 4Z2LA 2XM2A 5GNZA 2WYSA 1EIBA 1TFVA 4GINA 1W1YA 4MJ2A 1GPFA 3SUUA 4F79A 4ZXLA 6TAAA 3CMJA 4KWUA 3VGBA 4TOQA 4NZCA 1IZKA 3CHEA 1SR0A 1I1WA 3K8MA 2E3ZA 1ZJBA 2CITA 4URIA 4WKHA 4S3KA 2VZOA 2YL5A 3ALGA 3VM5A 4AZ6A 4WJXA 9CGTA 3W6LA 1VENA 2ZX8A 4EANA 1W2PA 2GFTA 4MAVA 3BGAA 2ZXAA 2XFFA 1PZ3A 1LG1A 4GZJA 2PB1A 2D3LA 5A6JA 2IXUA 5A1AA 3GH5A 4GPNA 1W2VA 1J10A 1B31A 1EH9A 1MXGA 3B9EA 2C7FA 4RL3A 1QBAA 4AD5A 4AD0A 2BXYA 5FD0A 3VTRA 2ZUUA 1OSEA 3L4YA 1NWSA 1JZ6A 4W88A
chains in the Genus database with same CATH superfamily
3T9PA 1JUEA 2F6KA 2Y63A 3ZT5A 1WAUA 2DZVA 2ACUA 3W1UA 3VKKA 5LA0A 4Q4PA 3KWXA 4HKPA 3URBA 4FLSA 3NPWA 3BANA 4QP0A 2CLMA 2GGIA 2IPGA 2OWWA 1S3TC 4UTFA 4H41A 1SO4A 4JDBA 4EACA 3R8HA 2O0TA 4AHOA 3KOYA 2WZHA 3W00A 3EDKA 3RPDA 4UMCA 3ISIX 3ITCA 5I3JA 1K8CA 4JX4A 4CD4A 2J74A 3NDYA 1UD8A 2HPMA 4H04A 4J3WA 1KQZA 1J11A 3DC0A 1BGAA 1HF6A 4DWSD 3MZNA 4UQBA 4ERAA 5E0CA 4XAFA 3TW6A 3IRSA 1VBUA 4ZSUA 3GE7A 5JIWA 3UETA 4BJHA 1XYZA 1KV8A 1I2OA 1QK0A 3N2OA 2NQHA 3MA8A 1WKFA 3LY0A 3MYPA 4BF9A 3GFZA 1GQJA 3LK6A 4PZVA 3PSVA 5HNNA 4FOUA 2FHBA 1KM1A 2PFHA 1S46A 3A3XA 4K37A 3IUDA 1XG4A 3L2IA 3RILA 1HNYA 3QV6A 2GJXA 2PWDA 2QV4A 1EEXA 2HXUA 4WEVX 4ZQPA 3PY2A 1KRAC 2PDXA 3PJUA 3RCYA 3UWEA 1F61A 2DIKA 2PAJA 3CV1A 3F5KA 2J6XA 3QPYA 3TX9A 4UWMA 3KL0A 3NGJA 4RZBA 2PDUA 4OKDA 3VOCA 2WC4A 4RDWA 2EKCA 3RM8A 2ATSA 1CNVA 1TRDA 4Q6XA 3QGKC 2PDGA 5F1VA 3LCXA 3WNLA 2UY4A 4JDYA 1KCZA 2W92A 3S3GA 1A0EA 4DUWA 4QJ4B 3SFKA 3R2GA 1DJXA 3TQKA 3IGXA 4Q4SA 3WLPA 1US2A 2FTPA 3HG4A 3LM3A 4DUXA 3OQEA 3WSUA 5MKGB 1ZJIA 3KCLA 4DIAA 5J5RA 2EG6A 2TMDA 4HU4A 4DBUA 3GS6A 4X22A 4B92A 4JIPA 4MWAA 4ZR8A 1CW2A 4HBKA 1YYAA 1VFUA 1PBGA 4D8ZA 1VF8A 2RFGA 4J27A 2QCDA 1TB3A 3QKZA 2HTMA 1WDRA 3HPSA 3W1AA 4MNJA 2Q71A 5CKSA 4TX9A 4E8DA 1MZHA 2D2OA 1U1HA 5FKYA 4YVXA 2DUAA 2ZUTA 2OQYA 3ARRA 1PUDA 3SCPA 4JY8A 2PDQA 4IIBA 5I7GA 3BV4A 1BYDA 2DZBA 3H2OA 4U31A 2QPSA 3THUA 3CQJA 3T09A 2Y5SA 3OQ8A 3GYCA 5AC6A 4LGXA 4HZ7A 1F74A 3WYZA 4Z08A 3UR5A 1JNDA 3DN5A 5KMYA 3DC8A 3T0TA 1W8SA 3L2LA 3W7QA 4LUTB 3H70A 4QM1A 3HMCA 4KMQA 5I6SA 2HK1A 3WMCA 5D33A 2I7GA 4F9DA 1KWKA 3TTYA 1POKA 4X9YA 1E0VA 4PMNA 2OZTA 4XVEA 2XSXA 1AQHA 2WC7A 1IT8A 3GNNA 1PKYA 2VOTA 3M7SA 3GVVA 2ZA1A 2C3ZA 1MUCA 3T2QA 2VC9A 4UQCA 3STCA 3ARTA 1FY6A 1Q6LA 1SJAA 1CI1A 2GUBA 4E3VA 1G7VA 4PCPA 1UC4A 5KEZA 2GJRA 2VEMA 2YA1A 4PMJA 4N6EA 1NQ6A 1D2KA 2PF0A 3TE9A 5D30A 3V1HA 1JIBA 2W27A 5CCZA 5CC3A 2ISFA 3VZXA 1OFEA 1V6YA 5CBIA 4UZSA 3QR3A 4NRRA 2CERA 3UG3A 1K9FA 3O8AA 1K6WA 2FTWA 1E51A 2VYOA 5LIYX 3CV6A 4JTJA 5KZ6A 3WMSA 2VFIA 3A5FA 1BHGA 1RPXA 1AQFA 3EOUA 5M17A 3FA3A 1M41A 4QR6A 4GWEA 3HTWA 3MMWA 3ITLA 4LJ3A 1JCYA 1TYGA 1V7AA 2A3HA 1I75A 5CPTA 4DO5A 4DO6A 4GQQA 2VX5A 5FF4A 5D2VA 3AJXA 2G3NA 4ASTA 3XINA 3P82A 2HCVA 3ARWA 1UH3A 5ECUA 1OB0A 3N29A 3WH7A 4JICA 3B4UA 4QXIA 4Z42C 2PGEA 4K8GA 1FUYA 2YB4A 3K2GA 1X1NA 4DUOA 1AL8A 1T40A 4TTUA 3SCTA 4K1WA 2VRQA 1XQKA 4KKXA 2PZ0A 3VILA 1RR2A 4M24A 4C6BA 2H3DA 1FCQA 4GO9A 3G1AA 3KHJA 1ICQA 1E6ZA 1GYLA 4Q8TA 4HYVA 4H19A 4MAZA 3W2MA 2GDUA 2GJPA 1DWGM 1ML1A 1NAL1 1BRLA 2V5CA 3AMCA 1FTXA 1UKPA 3MY9A 1PIIA 3VFLA 3BH4A 4Y9NA 3SGZA 3W87A 3OZOA 4GYFA 2YDSA 2YZRA 3C52A 4IMAA 2NQLA 1YX1A 1PHWA 1SGJA 3AXKA 4ICCX 4Y9OA 2ALDA 3AIVA 3W73A 1SFJA 3M16A 3UY7A 1Q6FA 5TF0A 3PPCA 1JUBA 1WDWA 1XKJA 2POTA 1BYBA 4DZHA 2DH2A 2PGRA 4PFMA 2WHMA 1TX2A 3OGSA 1DV7A 3WD0A 1UZDA 4C1NB 5AC7A 1B4EA 5HUOA 4CNPA 4EAMA 5EFDA 1NWRA 3E38A 4LCRA 3NXLA 3KRBA 3R10A 3AU6A 4CQAA 3FXYA 4GQ0A 4G8TA 4JTIA 5HMFA 4C90A 4Z17A 3SBFA 2BVYA 3VKAA 3W85A 4IQDA 1ZB5A 3WBAA 3P81A 4Y9PA 4L1WA 2WANA 3F4DA 3C2OA 2DSWA 4GLEA 2Z28A 1KV5A 3VUSA 4ALDA 5AYBA 5DCDA 4ERIA 1JFHA 2D22A 4QBXA 5C2XA 3HJZA 2G3FA 3NGFA 5JMUA 5DY3A 4ZO9A 2QZRA 1FWHC 3CZEA 1JUKA 4H6QA 2D20A 4YHEA 3OW1A 2ISVA 3UY8A 1VCFA 3TONA 3B3DA 1KGWA 1G4TA 4DRSA 1I0DA 4GRSA 4QFUA 1JD7A 2PDNA 4PRTA 2CBVA 3EBVA 5CG0A 1X1OA 2ZRXA 1WXYA 4ORMA 4IX0A 3AALA 1H3GA 3CXOA 2FZDA 4GY0A 2ABAA 2QF8A 2X2YA 5T9CE 2DZXA 2NVDA 5SWUA 4LX4A 1DTUA 2PWGA 4NZJA 4C6JA 4DPQA 3ARVA 4G1NA 1B3OA 4ZQOA 2HE8A 3RLHA 2DEPA 2WMFA 1EEPA 1F2JA 3AYSA 1Z44A 4IIEA 2PURA 1ZAHA 1K4GA 2ALRA 3M64A 2Z0IA 3WDHA 1UD6A 3AXHA 3IK4A 5I23A 1OINA 3SCOA 3TQPA 4UNLA 3LPGA 3ALFA 4CEUC 1TV8A 3T1GA 4E2DA 1E15A 2G0WA 2NQ5A 1FDYA 3OYXA 1XR2A 5JBEA 2PP3A 5LIXX 4DBWA 3VIKA 3CEPA 2XIQA 4X0NA 1J0KA 1O60A 1OC5A 1PKLA 2PGWA 3N9KA 4GHRA 4PUMA 3W81A 2ISDA 4IWWA 3AU2A 5DFAA 1UUQA 3KDOA 1RCXB 3C3UA 1QDSA 1Y5VA 2VI0A 4EPDC 3W9ZA 3DKLA 1W91A 5A6BA 3FKRA 4GH1A 4WK9A 3ZYZA 4DAFA 1OT1A 3GTFA 2YLAA 5CZSA 3WH9A 4QX4A 4LF2A 1EF2A 3UD6A 5U4NA 4B90A 1H62A 1TMLA 5HJLA 4IJCA 1ISYA 1PDZA 3UCQA 5C8BB 1XH2A 5A2AA 5AVNA 1VPXA 1O5KA 4A3YA 4M7SA 3SUSA 3C0JA 1W1VA 5F2LA 1WB0A 8RUCA 4A3QA 5IFTA 3L4VA 3UPWA 4NUWA 3W88A 4JFSA 1QK2A 4HPGA 3JW7A 3ZS4A 4ZODA 2J7GA 4PMRA 2XSAA 1S1RA 4JPGA 3B8IA 3BC9A 1E3XA 3GKFA 3LU2A 3MHFA 3N2XA 4HPXA 2YDRA 4H9UA 3MCOA 2F6UA 2OT0A 2ZBTA 4ZB5A 3RRXA 1LBMA 2VD9A 3LPOA 1R2RA 1BSLA 2QJMA 5AHFA 3OYZA 1EOMA 3EWYA 2XGBA 1KM6A 3D0CA 5CAKA 1OT2A 3IGHX 2KX9A 3WY1A 2WKLA 2VFDA 2E9MA 3BVJA 2Y8UA 3E0WA 2QT3A 3NJ3A 4KCWA 1A5AA 4JTCA 5FEXA 2P0IA 4LUJA 3UJRA 3ECQA 5IRPA 4CNSA 4P7OA 4IH3A 1GGOA 1BGGA 3R12A 3FDKA 1CX9A 1P43A 2O55A 3ONCA 5HULA 1LL6A 5JH2A 1JXKA 4P8VA 1Q8AA 1XLLA 3CUXA 4P2VA 4HGXA 4MLRA 3Q2DA 4H00A 1NFGA 1S2AA 5GJMA 3TC6A 3IAPA 3LRLA 1XIBA 5TAOA 5DT5A 4IIDA 3UXLA 5F2IA 1ZTVA 2X40A 4Q8WA 2J9ZA 2ZX6A 6TIMA 1BVWA 1G7UA 4OIFA 1A5KC 4Z0JA 3T8LA 2J27A 2QCEA 1QW8A 4MM1A 5FEWA 4ZOCA 5H1WA 3QPZA 3VD3A 2J9XA 1PX4A 2XWDA 4CCZA 4NIRA 1S5TA 3CUIA 2XU2A 2PP1A 3E02A 2J62A 1G94A 4P7NA 3TCSA 3DFPA 1XH0A 3O06A 2A6NA 5HAOA 2CFFA 3SJ3A 3SADA 3IIOA 2JKPA 3W27A 4DQWA 1SFTA 2NXHA 4UTMA 2ZQ0A 3A13A 5TD4A 4LYPA 1TMHA 1H63A 4EOUA 1IQ8A 3OODA 3FVDA 2QR6A 1QW9A 2Z1WA 3ATZA 4H3DA 4RXFA 2NQJA 5D38A 4I90A 5C6MA 1P5BA 3TYDA 4LV4A 3LSCA 2NZLA 4IMEA 1XP3A 3AI0A 2P1FA 4DYKA 3I3BA 4JIHA 3TN6A 2ZKMX 1ISVA 1DWIM 1HO4A 3BGJA 3MCMA 2EJ1A 1EX5A 2RDWA 4XV0A 1SJCA 3G8EA 4IGMA 2FB2A 4YU1A 3T0BA 1HKIA 1CXLA 1AFSA 1R6WA 1V5XA 4FALA 1EUAA 2NSOA 2VZUA 1L8NA 1CB2A 3HV8A 4JFVA 4U2ZA 3CLWA 5IOBA 3AYVA 1H4PA 3DG7A 4FNUA 1BG9A 1EPVA 2W67A 4XX6A 3GNRA 1IXPA 3W7GA 4D1JA 3WUGA 4U28A 1JFXA 1P1XA 3WK0A 1VCVA 3TN5A 2DPEA 3IEBA 5C55A 2FVMA 3G77A 1XQLA 4F3HA 3RMJA 2NLIA 4UOJA 1OGBA 5BOOA 1R3TA 2X8RA 2TRSA 1HQTA 1YKWA 4YYFA 3GG7A 3N18A 2BOEX 2VC5A 3G1RA 3N14A 3WQGA 4FI4A 3FGCA 5G1MA 1XGDA 3W7JA 2G95A 1HIZA 3H2NA 1OFOA 1OCBA 3GIYA 4K68A 2IQTA 3QV9A 1UZHA 5H2ZA 4BQ4A 1L2QA 1TRIA 3W7CA 2JIWA 4F0MA 4TVCA 4TTGA 2ZICA 4QEHA 4O57A 3WLRA 3FV9A 4J3XA 2NVCA 1S5NA 3QPEA 3S2JA 1AK5A 1PEZA 2PDLA 2WZEA 1K8YA 3HQOA 4MKVA 2Z26A 1C29A 3NPXA 3UVIA 4AVNA 2HV5A 4ATDA 2ZWZA 3K1GA 1S38A 1UCWA 3B8TA 3HGSA 4US5D 1BTMA 1XLIA 2WSPA 3VD5A 3L4ZA 4AXNA 3TV8A 1B57A 3N04A 4PMVA 1A0DA 4GVFA 4IQEA 3G6MA 3VFCA 1VEMA 5DELA 2Y2WA 3P67A 1JYVA 2ICSA 3VGFA 7CGTA 1BAGA 3ORWA 5CBBA 3ZR6A 3LGDA 1GHRA 2J8GA 2RDTA 3MP5A 4J3UA 3UR8A 1PJ9A 4V27A 2CNCA 4AEFA 2VELA 3MJYA 5U7SA 2ZYFA 5ABHA 4PMOA 1FKXA 2FZ8A 3M0KA 3TYAA 4HTYA 5C9RA 2WO5A 4C65A 2G97A 1CXHA 1KC7A 4YCOA 3TLLA 4LYRA 3ELFA 4QCFA 1AD4A 3FNDA 3IV8A 1TPC1 3L5MA 2VEFA 1FKWA 2PC4A 1ZP4A 3PHAA 1FHVA 3RXZA 3M44A 4I7WA 1JPDX 1MVYA 1WZKA 4D6FA 3UXAA 3UFYA 3MZ2A 3SCRA 1T6MA 3BG5A 1C7TA 1GNXA 1U22A 4KWVA 4UZUA 1Q6EA 3WQDA 2CXEA 1NFPA 1DOSA 4HPJA 2YDQA 4RK8A 1BVNP 4M6UA 5FJRA 2NV1A 3W82A 1OX4A 1R3RA 1JQXA 4DJDC 1W37A 4R53A 1UZ4A 2Z1SA 1OX5A 4WGHA 4CU7A 2RJGA 2VDIA 2CESA 4MZ1A 2C14A 3C2FA 4A2RA 2WBGA 1KXVA 3MHUA 4KW2A 5EMUA 2QYGA 2DY3A 3AYRA 1ICPA 3P62A 5BMXA 4Y8EA 1UQZA 3NQ8A 4BWLC 4AYSA 3ZZ1A 3FVMA 3GD6A 1ITUA 4K2SA 2GSJA 3BMVA 1AJZA 2SFPA 1DPMA 2L5HA 2DQXA 3NO5A 2VX4A 3NFUA 4DWSC 3BTNA 3DENA 4O50A 2NX1A 4N6FA 3CWOX 3ZVHB 3WQPA 3SN0A 1A3XA 1KBKA 2PEVA 3BLOA 2E09A 2DT0A 3PJTA 3JS3A 4HOXA 1IGSA 1X98A 2J47A 3E1F1 3HG2A 5D9PA 1ZBWA 3GHUA 1XCWA 4FIQA 1F07A 2ACQA 4LY4A 4E4UA 5LHEA 4B91A 3PWGA 4QNWA 4H9ZA 2GJNA 5IM51 1VJIA 3G3DA 4KGLA 3TC7A 3DFSA 3PANA 1V3IA 2NV2A 5HNTA 1JI2A 2BFGA 2XIMA 4HCDA 3SQMA 1UKSA 2QULA 1JF5A 1WP6A 3ANVA 1EP2A 4CD5A 2NV9A 3KM8A 3DDMA 3IANA 2PI6A 1OF6A 4QRNA 4A8RA 1Z48A 9XIAA 4LALA 2WCAA 3O07A 4D6IA 3EPOA 3TA9A 4K1GA 4FXRA 5LGZA 5HANA 1K03A 3CNYA 3BZGA 1DIOA 4L61A 4HCHA 4HB7A 1ITCA 2FHCA 1D7FA 1A5NC 2C71A 5DT7A 1CIUA 2OQHA 1QI2A 1ZS2A 2PF8A 3CM4A 4O18A 5J8LA 3W24A 3QZAA 1OFBA 3L4UA 3EMQA 3LGEA 1OFPA 2FPTA 3F4NA 1DQXA 3H2CA 1E4MM 3QHOA 3MSDA 5G5IA 2GWNA 1VJSA 3UF9A 4FP1A 1PAMA 4MJ4A 3UQNA 2QUMA 5HWJA 5I77A 1KKOA 3F4CA 4INFA 4EPEC 3SW6A 4PMXA 5D4YA 1E72M 4XUGA 4QCEA 5DF0A 3GX9A 3WJZA 5F2GA 2GK1B 4JNYA 4JYEA 4UTUA 2Z24A 4Q8QA 1QI4A 1BTCA 1QATA 3RM4A 3N3TA 2H9AA 3REQA 1B3VA 1XWYA 4TMBA 1BXCA 1KFKA 3IUHA 2XN1A 3W7DA 2ZXBA 2F8QA 5HOSA 2I9EA 5I03A 4MZ8A 4NY2A 4IF2A 2O4MA 4D6EA 1ADSA 2W9MA 1TV5A 3MJMA 3FJ4A 3GG8A 2VDGA 4O15A 5FJOA 2J7EA 4WXZA 1D3HA 4AC7C 3BCJA 4QG8A 1OY0A 3FY1A 4KH2A 4M29A 4K7VA 1HP4A 1Z32X 1TPWA 4HD5A 3BSGA 3GDBA 1HP5A 1LF1A 3OHIA 1WKYA 4R88A 1H51A 1Q63A 2J6VA 4OWGA 4YTSA 1IEXA 1TWDA 3UG5A 3UNTA 1Z7AA 2OG9A 3D6NA 3WFAA 1LT7A 6REQA 3H4XA 4B5XA 3GC2A 2Z1VA 2DGAA 2NT1A 1KBJA 1SMDA 4PTWA 4KPLA 3SN4A 3GR4A 4IFKB 1S1PA 2ISSA 1RZMA 3AXIA 5GPRA 3V5CA 2EEXA 3MUXA 3GKAA 2EPMX 4HNTA 4JGDA 1HTIA 1MZRA 1T41A 4AWEA 3RJYA 3LHTA 3TYCA 4HMCA 2NT0A 1O5XA 3W7OA 2V5DA 4WSJA 1WX0A 4GA8A 3FK4A 4LU0A 3STEA 5RUBA 4FB7A 5CSUA 1JQVA 1D7KA 1L6SA 2INEA 1VD6A 3CL6A 5A6MA 4UTWC 4UFLA 2DT3A 4IOTA 3WL1A 1T5AA 2J75A 1TWIA 1XSKA 5CZJA 2A21A 4O4VA 1HT6A 4QROA 4QJ3B 4WY0F 2F6XA 3P5ZA 2A3BA 2HBVA 5D2XA 5GNXA 4YCPA 1UBSA 1H09A 3DFYA 1SJDA 1PX8A 2G3JA 1WZMA 3WQVA 1XC4A 2IKJA 6XIAA 3NZRA 3LB0A 4AY1A 3LCWA 4JHZA 1F8MA 4O52A 3H2FA 1R9ZA 3B9AA 5HWNA 4LVGA 2ZCGA 1W3KA 1GG1A 3TW9A 5REQA 1GVYA 1XLEA 4U5KA 1Z89A 3ARQA 2E1DA 2HJPA 3F1QA 1KB3A 3ABSA 4TUFA 4I8YA 2JALA 2OVLA 4B3LA 5JUVA 5JU6A 4ACZA 1C8VA 4ATWA 1R38A 5IDIA 2EAWA 1R7OA 4NILA 4DM1A 4ML4A 3CMFA 2UBPC 3LSBA 4HZMA 1U33A 1IIHA 5D8ZA 3RN6A 3W4RA 1K70A 3VOJA 5HUPA 2BXVA 3GDMA 3A5VA 4BY3A 4NU7A 4LYQA 4PMDA 1M65A 4JZ5A 4AG0A 3TUUA 1EX1A 4P8XA 2WB5A 2G8ZA 5IHRA 3A4JA 4LNYA 1FWCC 2AMGA 2P5NA 3NYDA 5BYWA 3S2CA 5AYXA 4JTKA 2R1NA 4GOAA 2F84A 3NWRA 1QR7A 2YZ5A 2PLCA 4O8RA 1LRNA 1VFSA 4KEVA 4XO6A 2R1KA 1A4LA 3I3EA 4GYKA 4AIUA 3BG3A 5I2UA 3UR7A 3CAVA 1R47A 3NQMA 1XM3A 2WW5A 4XWUA 3H53A 2A2IA 1UKOA 4UFKA 1HKMA 4HMDA 2F2KA 5E6ZA 1HJQA 2GK1A 1FHDA 3V7PA 1FWDC 2W91A 4AZCB 1H60A 3C0QA 1UR3M 4YTRA 4ENLA 2FQIA 2F61A 3F5JA 1F3EA 2I57A 1E4NA 4JTLA 3ARSA 1W5QA 4A4AA 3ME3A 3MU7A 4MGGA 3K8LA 4C7GA 1KBIA 3VINA 2PDBA 1I2NA 2WMIA 2ZZ7A 1FWAC 2AL2B 1DXFA 3I6TA 5ABEA 4XZLX 2QW5A 1R7AA 3ATYA 4KRTA 3EEGA 3W83A 1U5HA 1BVZA 1OC6A 4B15A 1DWFM 1E6XM 2WXDM 2ACSA 3VDCA 1E1CA 2XPKA 1SQ7A 1P48A 4AC1X 3UA4A 4ZOBA 3R43A 4UOZA 2J13A 1VBHA 3WL0A 1FWSA 2BHYA 5DBTA 4HCLA 3HURA 3UWUA 2PTZA 4F79A 1TE6A 3JR2A 6TAAA 2OU4A 2NLYA 1TPEA 4TOQA 4IX2A 1TTPA 3EOLA 4TV5A 3K8MA 4LSBA 1ZJBA 1ZP3A 3LRKA 2YL5A 3TFCA 3H7RA 2BBFA 4TIMA 2GGHA 2PRMA 1W2PA 3QC0A 4MAVA 4QS6A 4FZIA 1YPIA 1LG1A 4TU1A 3VKBA 5I3IA 4ZO8A 1ZJHA 2C1HA 1VKFA 1J10A 4YTUA 1SJBA 3B9EA 5CSRA 4RL3A 1QBAA 3FDGA 3G1FA 5FD0A 3VTRA 2ZUUA 2OZ3A 4S2BA 1BKSA 1FWGC 3E2VA 3ES8A 3ZVHA 1JZ6A 4QQUA 3FIGA 3TR2A 5KINA 2X2GA 4ECLA 2J8FA 2WZMA 3AHVA 1R2TA 3VGGA 3TMQA 1BF6A 2BS9A 3UA3A 4IMFA 3DFQA 2QCHA 4D6JA 4YNGA 1VH7A 3LGGA 1MSSA 4EPBC 4GJ1A 3P8JA 5H91A 1CLVA 2JE8A 5GJNA 5LNRA 2YCEA 3QY7A 1A49A 1M53A 2R91A 3DHUA 3UPMA 2O9TA 1KFCA 6XIMA 5C9ZA 3WH5A 1KCKA 1GVIA 2CLFA 1LLWA 4H7CA 4D2JA 4G9PA 3CYJA 3UCCA 4EVZA 5CLTA 4AD3A 1P0DA 2YBVA 1XIMA 2E40A 2XIOA 4V1YA 4B3ZA 2QV5A 3W7PA 2XFYA 3HGRA 3M0VA 1BLIA 3WF3A 1UR4A 4ACZB 3WK1A 1E5NA 3GY1A 4S3BA 2ZA3A 3QMSA 3CAWA 1YE6A 1QOXA 4X63A 2BGQA 1TELA 2QJIA 4JKKA 1EGMA 4MIMA 5HMSA 1H7NA 1O94A 1GZ1A 2QLYA 4J3TA 3RX4A 1E43A 3PSWA 4UFIA 1TV4A 3WF1A 1K1DA 1J4EA 1UD4A 4P7LA 4LTSA 4XZMX 1EJTC 1Q6CA 4WX2A 2VMFA 5C54A 5HMDA 3KOXA 4JAWA 3UYCA 3LHZA 3IJDA 1R86A 4HJWA 3WD3A 1T99A 3VDBA 2EG7A 4C91A 2R24A 4AZ7A 3QYQA 1UIPA 2XH2A 2XTKA 4S39A 2E25A 2W6RA 4ICNA 3CUZA 4IXHA 1PPIA 3WLMA 2RDUA 1J93A 1VEOA 4Q33A 4DXKA 4NXSA 2QCMA 1CTNA 5EKYA 3CQKA 4GMEA 3KZSA 3MWCA 3H22A 3O0FA 4AF0B 3EOEA 2G3MA 1MW3A 3U7BA 3BMWA 3B0PA 1XLFA 4MTVA 3VZYA 1GUVA 4NT0A 4J7RA 2D23A 2AL2A 1Q13A 3W28A 2BDQA 4MUPA 4AW7A 4GXPA 2PDJA 2J7DA 1W1ZA 3OZYA 1FP9A 2J25A 5EMMA 4QDPA 5HQEA 2WC3A 3EX1A 4JQAA 4UMAA 3S2MA 1R46A 1N8FA 3QM3A 1DWAM 4Q7IA 1HW6A 3VABA 2Y4SA 1YPFA 3VGEA 1L9WA 3RNDA 2QPUA 3MDWA 1UKTA 1XYAA 2P3ZA 4O28A 3MP4A 2V0TA 3N4EA 4LNCA 1GKPA 1QWGA 3BSHA 4C6LA 2WHLA 2VP8A 4X61A 5D09A 2VR4A 1S2WA 4GI6A 4EXQA 2JKAA 4EX4A 3W7NA 1B90A 3RM9A 6ALDA 4L7ZA 1LOLA 1LQAA 1V0MA 5K9XA 4RPPA 3R94A 4F66A 1EO7A 1IXQA 1BG4A 4ICMA 2CZ5A 1UIOA 2BTMA 3B4YA 4Q8NA 4QGCA 1RQHA 4GYJA 2C19A 4ZCWA 1EJXC 3S5NA 3DCPA 4C6MA 1FWRA 1XYBA 3VIPA 4S1FA 2TYSA 3MBDA 4KRUA 3OLGA 3I68A 2DH3A 4H7VA 4YMZA 4FIRA 3VKDA 4K36A 4C60A 5CH9A 3U2OA 4OECA 2VD8A 1V3HA 4J35A 1G9HA 3EPMA 2J4GA 2WMKA 1K8ZA 1TR9A 3M0XA 4MYXA 3WJWA 5KSWA 3A12A 4CD6A 1OZMA 4JTFA 1J6PA 3KCJA 4U10A 1UJQA 3SAZA 5CEWA 3AIBA 2CU0A 1TTIA 2YKKA 3PPFA 4UTHA 3G2GA 3WLNA 3Q65A 1Q7ZA 5DMLA 2JK2A 3CUJA 1V3MA 3WLQA 4ZTYA 1W9BM 7PTDA 5F7UA 1GJUA 4Q4RA 3W1LA 4KIEA 4LB4A 4H9YA 4ROPA 1RLDA 1Z69A 1FQ0A 1E4IA 2WVTA 1ECEA 4GUIA 2P8BA 1IR2A 4NRSA 3P14A 1RK6A 4US5A 4L4MA 4UXDA 2WNQA 1KXHA 1GPWA 3INPA 4ADTA 2DW7A 1NEYA 1YTKA 3WH8A 2D0HA 4AYGA 3TCEA 3LHVA 5M5DA 5PTDA 4FLRA 2BOGX 4QDWA 3OJGA 3WQEA 1W1B1 4WJEA 4DF2A 4NYUA 3LZ3A 4HSNA 1QNRA 1F76A 5I3HA 3S1UA 2OZ0A 4YXGA 1GEQA 2EBNA 4JTUA 4DBSA 4WVXA 3NA8A 1R3WA 1BEUA 3S1WA 1RBLA 4MWAD 1V3JA 4RZ6A 4GCXA 1R0MA 1UHVA 4M82A 3DFTA 1SO6A 1QAPA 1PV8A 2C79A 3O0KA 1WE5A 4KF1A 3UEQA 2GQ3A 1ZBCA 3TQVA 3T4WA 3ERPA 2A1YA 2O7QA 1AW1A 2QCFA 1JDAA 3MUAA 3T81A 4O53A 1VEPA 2XZ7A 4GACA 4H8VA 4M5PA 3SQSA 3LCIA 3AICA 4XZWA 3TA6A 2ONEA 3E0VA 2HWGA 1W3HA 1LYXA 3PZGA 5E6YA 2JIEA 3CQHA 3UR2A 4UTJA 1S2UA 2YFNA 4AEOA 3PAOA 5K4ZA 2ZC1A 1E73M 1KKRA 4XZIA 3SM0A 4MWAE 1XRFA 4JCLA 3MUY1 1J96A 4XO7A 3LCFA 1ZBKA 1U1UA 4D72A 5CJMA 3VIJA 2DORA 2WNZA 2FZBA 2OO0A 3QYSA 1W9VA 4BK9A 4XAZA 1O1ZA 3A4AA 2WSKA 4DLFA 1Q4WA 5A2BA 4XD5A 3E2QA 4L6OA 2GOUA 3GH4A 1JYXA 4MWAC 4Y8FA 4GNVA 4NHVA 3BE7A 5C7HA 3QBUA 3TQ0A 5F4WA 5HNRA 3B0YA 4Y6GA 2YBTA 3VIIA 4JTDA 3PBUA 4Q4OA 1DWHM 1PWLA 1V03A 4CNTA 2XINA 1XBYA 5K3VA 1QI3A 4K39A 4MPKA 1JZ4A 2GJLA 4C6IA 1OADA 4X60A 3OEXA 2PBGA 4H1ZA 1WYIA 5CPQA 1EQPA 2HQAA 1X38A 1GJPA 3N25A 1JZ7A 4W93A 3NOEA 3G3MA 3W23A 2DV0A 3GZAA 4YTQA 4LVFA 4S3DA 1Q6OA 1TWZA 4F2UA 2R1LA 1W3TA 2CLLA 5AFDA 5B80A 4LVDA 4NJKA 4LBSA 4N9BA 2WM0A 3NR0A 1XI3A 3WDPP 3IJ6A 4JOMA 3OIHA 2Z27A 2Z2AA 3GDTA 3H4WA 2WOQA 4V33A 3CU2A 4NL1A 2E28A 4BI6A 3PS7A 3WQ6A 1FWWA 2Y8VA 3FYYA 3FHAA 2YPIA 3J7HA 4ZB0A 3OLIA 4DYJA 4LANA 2TAAA 3RLVA 4QSHA 3EWZA 3DZ1A 3TC3A 3NO3A 1ONEA 1RALA 3HGOA 4NP7A 1KM0A 4OHQA 4ADSA 7A3HA 2VJXA 2WQDA 1J01A 3FJ6A 1N2VA 3WUBA 2IW0A 3PVFA 3AWNA 3YPIA 4H6EA 3M47A 5A95A 1DXEA 2QIWA 3MB9A 5H8UA 3FSTA 4FLQA 4S3GA 2BX7A 2DW6A 1EYWA 3G1HA 1NDZA 1SFLA 3W7IA 5M1TA 2P8CA 1KM5A 5EMJA 2CW6A 2EHHA 3B9DA 3O15A 2X30A 4LB3A 5A8MA 2UZ9A 3T6CA 2C13A 1BF2A 3EMZA 2B81A 3O3RA 4L9YA 3GWQA 3REQB 3CL8A 3VKCA 3DX5A 4ZFMA 1RBAA 3KBVA 2YL6A 1WKDA 1VS1A 2E0PA 3KBSA 1QPNA 3URNA 1Q66A 1R85A 2V6AA 3LQLA 1KRMA 4R85A 4UOQA 2CPUA 4YL2A 4GZEA 1KWGA 1QPQA 2DT2A 5TIMA 4L6DA 3V75A 2VEPA 2Z00A 3SY8A 4LF1A 2WHJA 4O1BA 1VC4A 2I16A 1JPHA 4CNNA 1EPXA 1UA3A 2ZZ5A 1RXOB 1E9YB 3KOZA 5GJPA 5ENLA 2X7WA 2QUNA 4UR9A 4IPJA 1EBGA 3BLPX 3DOPA 3PUGA 4FLOA 3VVGA 3PZMA 3B05A 1S5WA 2HZGA 1JF6A 3GC5A 2QHAA 4D9PA 1Q7QA 5G1TA 4ZQMA 2W66A 4HN4A 1U5VA 2Z6IA 4C1LA 1TZ9A 1FA2A 3GNDA 4H9VA 3CTLA 1WNOA 4RDYA 4AU0A 3U5YA 1NDYA 3UZZA 1TWSA 1EGZA 4IL2A 3R7MA 2HS8A 2DZTA 4PTXA 5BWAA 4CEXC 2VRKA 2VCAA 3MMTA 2FMOA 1Q85A 4E2VA 1ADOA 2PODA 4UQEA 3ZSTA 4AXKA 3UWWA 4C7DA 2J88A 2H90A 5A8OA 2XG9A 1DQWA 2BASA 1CGXA 3O9NA 2ZXQA 1ITQA 3QY6A 3W3OA 4UTLA 3VE9A 3NQVA 1QHPA 3DI0A 1Y7VA 3K4AA 3H2MA 1GKRA 1XF0A 3CB3A 4FMVA 1XPGA 4J4KA 3ZLFA 4W86A 4OT7A 5CLWA 4PL1A 3CZGA 1AH3A 4IGSA 3RU6A 4HHMA 4JTGA 4HIBA 4AD1A 1Q7MA 1KBLA 1KQYA 2V3FA 3PF3A 4L56A 4FNPA 3OB8A 3BJSA 3AS3A 2ZOXA 1VRDA 1RP9A 3BLKA 1RQBA 3VKJA 3TSMA 2X1IA 2Z1XA 1XIGA 2GYIA 4EXBA 1BYCA 4H83A 2E6FA 4XBSA 3ITYA 5CSYA 1B3XA 3A6OA 4N9DA 4UFHA 2Z1KA 4F0RA 3SIZA 1DEDA 3N73A 3U0HA 1E40A 3EWUA 5H8MA 2GGEA 3VD7A 1V6VA 5D9NA 2C6QA 1M03A 3WMBA 1Q45A 4EF9A 4O13A 1W5MA 4O10A 4OQVA 2J66A 5DRIA 2GQAA 3CK5A 5BRPA 1QO5A 1QW7A 1UR2A 1GORA 1JXJA 4HT3A 2WNNA 1VQTA 3GW3A 3G1YA 1POJA 5A8GA 2Q8LA 1C9WA 2BSLA 3PFRA 3B8UA 4LUIA 1IEVA 1M6JA 2WM1A 4GQGA 2A85A 2XVLA 1JZ2A 2YXXA 4MY8A 4LQ1A 4POCA 1MYRA 4O19A 3CPRA 2QS8A 5C2GA 1FBAA 3VIHA 4J28A 4DJDA 3NSNA 3PBGA 3OGVA 4MYAA 1FWBC 3S47A 1E71M 3PUOA 2CBIA 3D47A 4O1DA 5KZMA 3W37A 4F2BA 4LUYA 1UH2A 4ZE4A 3LDVA 2OKTA 3BOXA 1TVNA 3SJNA 1TA3A 2QJJA 4E4FA 4GNKB 4NJHA 3WBWA 3CASA 1T8XA 2XVGA 2FKPA 4LUTA 3MS8A 5GQBA 1E9IA 4JN8A 1XRVA 4JYFA 3OZPA 2VFEA 4EPKA 1R3VA 5L6UA 4F0KA 4A22A 4PTNA 2A3AA 5B7ZA 1W1A1 1FWTA 3N1AA 2DSKA 3M0YA 4WY0A 3CHFA 5DY2A 1LL7A 1RH9A 1BXNA 2ZZ1A 4O14A 4PMZA 3N19B 4ES4A 2QDHA 3QEZA 1BXBA 4LVAA 4OBTA 2A7RA 4KCUA 4U5IA 4Y9MA 1XD0A 2FGLA 3KBJA 3GQYA 1UPMB 3M46A 4R34A 1F05A 1G1YA 3RG6A 3H21A 4JD4A 2HVMA 1OEPA 3LENA 1LBFA 3PZQA 3T0DA 3PG9A 1RP8A 2VL4A 4P5UA 4H9MA 3CPUA 3M1ZA 4LAKA 1REQB 4W7VA 3VIMA 3PUDA 4D1IA 4DNHA 1YXYA 3W1RA 2IKIA 4WKAA 1CCWB 2PBOA 1P1MA 4IP5A 2O4QA 4JR5A 4QAIA 2Q8XA 4ZXOA 3U57A 3W6MA 2Y5EA 3CS2A 3TMLA 2WWCA 3LHYA 1E0XA 2CZDA 2BMBA 4V1XA 3BW2A 1HVQA 1U83A 1NTHA 4AUBA 3PR2A 1PWMA 3PBVA 2YOCA 5FJPA 4UTWA 3RO6A 3B03A 4AX6A 2AQVA 1SW7A 1PZ0A 4PUDA 3IK2A 3T05A 3JVAA 3W6YA 1BKHA 4DO4A 1ENUA 2WVVB 5I24A 1S2CA 4QS5A 5MKGA 2QDGA 4HU0A 1O68A 3CQ0A 4AZCA 1QUMA 2A3CA 1EGVA 1OGSA 3AOFA 3AIUA 3LYEA 4FR6A 3NQAA 4FXJA 3PNZA 3VCNA 2QCLA 4HNVA 3ZSSA 3OZMA 1SZRA 4WF7A 1EJUC 1N8IA 1LWHA 3VC5A 4YTTA 3MT1A 3DYMA 1GHSA 2QVHA 3FW6A 2PMQA 3W72A 2J79A 4XTDA 4BKNA 5E0KA 1C91A 1C8QA 3DBPA 5AYYA 1VRXA 2WJEA 3P0XA 4Z2IA 4O11A 2OODA 4O1FA 2FIQA 5MF5A 2V63A 5I0DA 3L4TA 1P7TA 4IGHA 5K9CA 1ZZMA 3JZUA 3PN8A 1TSIA 1SSDA 1EBHA 4NZFA 3VK5A 3CIVA 4MF4A 1JCMP 3W53A 1XL9A 1L2UA 1LRQA 3M0LA 1WZAA 1A5BA 4JTSA 5GVJA 1X8CA 4REQA 5A6BD 5D2YA 2J78A 1W9DM 2Y6ZA 2DSZA 4P7QA 5LGXA 5A6TC 1TWWA 3AMGA 1HN1A 5JH1A 1PYFA 4M3PA 1YEYA 1WA3A 1T0OA 3FGCB 4IL0A 5EY5A 4C1KA 1EF3A 1EZ2A 3HOJA 3NG3A 2ZXDA 1V8EA 2ZUWA 2VGFA 1RJPA 1YDNA 3P2VA 1EUNA 2ZRUA 3R89A 4AZBA 4PTMA 2BNJA 3Q67A 5I06A 3KRSA 4PGLA 3LXAA 4GXWA 1UOKA 3IV3A 3VE7A 3I4EA 4NAFA 4MB1A 4JIQA 1WO2A 4BQ3A 2ZDRA 1ONXA 3TSDA 1W1PA 4WR3A 2XFRA 2YYTA 5LA2A 2FGZA 3Q94A 4PBFA 1V93A 1HVXA 2P0OA 2YXGA 2ATMA 2Z29A 2WMGA 4A05A 1C8XA 4S3FA 2J8TA 2ZDSA 3CAKA 3V5OA 1ECQA 5H6HA 1ZU8A 2ESCA 2VENA 1O5RA 1KTNA 1ICSA 2F7FA 1PO9A 1I2QA 1GZJA 1QBBA 1ZBVA 2X0HA 1W3JA 1OHLA 3NZGA 3LBMA 1ZAJA 2TPSA 5E1QA 1U2YA 2OJPA 1NOUA 4GFIA 3OU8A 4DYEA 3GM8A 1V0KA 3PBYA 3U48A 3RCNA 1JCLA 3AO0A 1NM9A 5I3FA 4Z1BA 1IWAA 3M6YA 2QJHA 2FTYA 3H8AA 2YGYA 3SCSA 5BU9A 3IGSA 4KFOA 1WDSA 4LAOA 3TOPA 3I6EA 2WNWA 3EWDA 1RD5A 3CWHA 5D32A 1YNQA 3MO4A 4MNKA 1H1YA 4Y90A 3BW4A 3ABXA 1HXJA 2PWHA 1CXEA 1OFRA 1K9DA 3QRHA 1ONRA 3EPNA 2HBXA 4JKMA 3T7VA 4KEZA 4RNHA 2XHYA 1F5ZA 4MPQA 1YBQB 3CTTA 2VUYA 1UWTA 4R5EA 1HJUA 2OT1A 3T0CA 3O6DA 3SCWA 1CB7B 4I6KA 1GT8A 5AN7A 4K38A 3HPZA 1WQ5A 5G4WA 3ZFHA 5BRBA 1TR1A 3LLDA 3NZQA 3LCGA 4O12A 4DJFA 1YQ2A 2JGQA 4S3AA 3EXSA 1BPLB 1CZ1A 3AHXA 1IR1A 5DBUA 1U1JA 3AFBA 2FZMA 3IJLA 3IGUA 1K4HA 2WCGA 5DCEA 3UJEA 3HJEA 3L65A 1TPB1 3PZOA 2XGIA 2B7NA 2DZSA 4DELA 1Z41A 3CUHA 3VA8A 3TJ4A 3AXMA 4C6QA 1H5VA 3ITGA 3LNPA 1KCLA 3NIYA 3M6DA 4Q7BA 4UQDA 2C15A 1KXTA 4MFEA 4GE8A 3TTSA 1XIDA 1PL9A 3ONBA 1QPRA 3GTXA 3WLOA 5LIWX 4L4LA 1EOKA 4Q3MA 4NF7A 1BWVA 5EMLA 4AAJA 4NJGA 4G6CA 2E5DA 3VO0A 8CGTA 1WXJA 3CL7A 3T8QA 4F8XA 2OX1A 4JYDA 1DE5A 5CGTA 3SZ8A 1G01A 2ZRWA 3VXGA 3HFYA 1TA3B 2CZVA 3GG1A 3CO4A 4GYPC 4UMBA 2OGJA 3O16A 2CBJA 4P8WA 4IUGA 2WZTA 4O0QA 3AUOA 3EA2A 3S1GA 1R87A 4O1CA 2QGYA 1XLHA 1UC5A 3GVQA 5F4XA 4WDXA 3RF9A 1ME9A 3RUBL 4I8DA 4X2RA 1JJKA 2AGKA 3VM7A 3VX1A 4GUGA 4S3EA 3K46A 1AL7A 3PPGA 4W8LA 1XINA 1YNYA 2V9DA 2PPGA 4GUJA 4Z2HA 3HFTA 3QTPA 4RKAA 3S1VA 3MKVA 1FHUA 4PULA 2R6OA 1XXXA 3MKCA 4UTTC 2ON3A 3AS0A 4RNFA 3UYIA 1ZLPA 4PSRA 4OGZA 2C1IA 3GZ3A 1VFTA 3LOTA 4H8UA 3U4AA 4XD3A 1THFD 3UNDA 3NYZA 1JDEA 3L2MA 2HVOA 3TTEA 1TJPA 2VGBA 3MDUA 5AC5A 3QLLA 3A9IA 3N2MA 3QZEA 5DMNA 4HNUA 1EO5A 1GVSA 3ARXA 1MO0A 3R8GA 2IUZA 1GVRA 5M3WA 4YVPA 3RPTA 3V18A 1QNSA 4KEUA 1F73A 3M0MA 3NVDA 3SECA 2CETA 1LLZA 1BWLA 2A0NA 3EKZA 4GIYA 3V3WA 4M0XA 5JBFA 4ZOAA 3ARYA 3TU9A 3CZ8A 3EX2A 3LS9A 3AHTA 2YCJA 1F4HA 5G2IA 3VGDA 3VNKA 5BNKA 5IFPA 1EL3A 4K8EA 3QOMA 1HO1A 3TWAA 1H7OA 3O6CA 2GJXB 2WVSA 2MUCA 2ZZ3A 3DIPA 4GBUA 4IPLA 1VAHA 1O7AA 1AQMA 1XG3A 3RIKA 1AQ0A 4MB4A 4PUUA 3L9CA 3W26A 2PC8A 5E93A 4UIOA 4MJMA 4PMYA 3L7RA 4QNEA 3A9BA 3I3DA 1TIMA 2NSXA 2CEQA 5A3HA 4M51A 5HR7A 5LYRA 3VNJA 4M6QA 1O12A 1R3QA 1WBJA 1XCFA 1YPXA 4LVBA 3RCMA 3RX2A 2JF6A 3GC4A 2IKGA 2XWEA 4LW7A 1EFZA 1EDGA 1HGYA 2YL8A 4C6OA 4M8UA 4IXXA 2G3IA 1G4PA 2VURA 3WLSA 1CGYA 2V5LA 4KQNA 1RY8A 1VBGA 5FF2A 1UH4A 4LXFA 3WO8A 1TJRA 5BWFA 2J24A 2OKOA 1SW0A 4C6CA 4M7TA 4HSHA 1J0YA 3BXWA 1IXNA 3N15A 3SEPA 1CLKA 3LQGA 3WBXA 1A5CA 3SRKA 3R25A 2GSHA 3SUTA 3G1XA 2GSEA 3KWSA 4L9XA 4I9JA 6CGTA 2V5JA 4NVTA 3P3BA 4PMQA 1P7TB 3WLHA 1KM4A 3GU9A 2FB3A 2FVLA 5C0QA 4AZHA 1QHOA 2PRHA 1VPQA 4BWLA 4GI4A 2I14A 1GK8A 3KOFA 4E3TA 1A5SA 2VZVA 4IPPA 2C8NA 4GIEA 2Q01A 3UJSA 4C1NA 4LAUA 1SW3A 1N8WA 1R30A 1JDCA 4U3AA 2WSRA 4H9XA 2XDFA 4HK7A 3TN3A 3FYPA 5D03A 4D6CA 3KL3A 2E9LA 3S9ZA 4H4IA 2W3ZA 4OOZA 1RD6A 3PAJA 3QQ1A 4D8AA 3CV2A 2XIBA 4D6HA 3NQ6A 4MG4A 3AMDA 2WSQA 4Y7EA 4EE9A 3WLJA 4HU3A 3GIPA 2OFJA 3N3MA 1OFQA 1Y0EA 4A21A 3TYZA 1SU5A 1A3WA 3LXCA 4KIRA 1Q4NX 2CLHA 3GLCA 4PRRA 3CZLA 2IMRA 3I7RA 2CCRA 2KZHA 4M6VA 5EB8A 4I9MA 2WYSA 5XINA 1EIBA 1Z6KA 1W1YA 4MKSA 1GPFA 5H8PA 4KWUA 4F48A 4RW5A 3PC0A 3PB0A 2YX0A 5HK4A 1JGMA 4NX5A 3UWYA 2E3ZA 4URIA 4O4WA 2Y61A 4WKHA 4S3KA 4JEQA 1OQFA 1ELSA 3VM5A 4AZ6A 2OO6A 3W2UA 3KCOA 1W1IE 3U4FA 3APYA 5CC6A 2XFFA 1NVMA 4HJFA 4RV3A 3BURA 3CHVA 3GH5A 1B31A 1EH9A 4A3UA 5BOFA 3MI6A 4RNIA 2DFAA 2D2JA 4KWWA 1W6TA 2JFEX 3GB6A 4W87A 1E9LA 2BY1A 4AVOA 3CUGA 1EQCA 3S5OA 3W1TA 1W56A 1QMLA 3AS2A 1CEOA 1PCKA 2DZUA 2FZ9A 3A4WA 3W76A 1AD1A 4D6DA 4EXAA 3H4GA 3DHDA 2XIIA 2G4FA 1W3NA 3IVSA 2BY0A 3OLDA 5IDZA 3LCHA 1ADDA 5F4SA 3CGTA 3W7MA 4OBRA 3MWAA 2DDXA 3WQCA 4GUHA 1EJWC 1P0NA 2QUTA 2PDFA 2BP1A 3L5AA 1KRBC 3FA4A 4CKQA 2OPJA 3FFSA 1PZ1A 5BRQA 2VVNA 1ISXA 3UVAA 5HPOA 3E2SA 4KCVA 3VNDA 2VZSA 5A69A 3IWPA 4XKYB 3PB2A 1M5WA 5HPCA 1T7LA 1KR0A 5CPNA 3DG3A 3WCZA 4DJFD 5HA7A 4ROQA 3EB4A 1IEIA 3FKKA 1PCWA 3H24A 3WEZA 3VD9A 3TP4A 3ITOA 2QCGA 3R0UA 4K8HA 1W9PA 3GAYA 4NI3A 3V4BA 3S2NA 1CGTA 4WSHA 3W7LA 5AHMA 2BODX 4DXVA 3KOWA 2D73A 3C2RA 3IIVA 3G0SA 1Q65A 1VFHA 5I00A 1DHKA 4PB4A 4DLMA 4M1BA 1D3GA 2EG8A 4XQ6A 3KFTA 2V68A 5L9FA 3LBCA 1UP2A 3MSYA 4HMNA 3KBWA 4LPCA 3WNMA 3NO1A 3BLDA 3I7QA 4Q8MA 3B0VC 2NQ9A 1W5NA 3RJXA 3ITTA 2XN2A 3EEZA 4DZ5A 2GVGA 2O9RA 4NXKA 1VFMA 1PE1A 3E6EA 1X6UA 1M7JA 1YMYA 3LI0A 1XBXA 5BZAA 4NX0A 4PA8A 3O05A 1XLAA 1QOPA 3THAA 4DF1A 2CYGA 3ICJA 2WAGA 2VZTA 5A2CA 3R4IA 8XIAA 3SQLA 2YCKX 2QUUA 3VD4A 3F2DA 4TX6A 3II1A 4RZ5A 1ISZA 3URQA 2OOFA 1FCBA 1PKMA 2Y88A 3MYOA 5JXQA 1NDWA 4XG1A 1OK4A 1W3IA 3EMCA 4W7UA 5CPLA 1NQKA 1K7XA 2KAUC 4AHPA 2VKZG 5CJNA 4ZTXA 4JHOA 3AXXA 1UR8A 1L6YA 1HG3A 3BOFA 4CVUA 3UWQA 1XICA 2PLJA 2BZNA 3L4XA 5HMEA 4FXFA 3ZT6A 2WHKA 3T0AA 5K7JA 2QJNA 3W7KA 3C61A 3HQNA 3LTSA 4FPSA 3IRDA 4ONVA 4Y9AA 4GZ7A 3AQUA 4E0CA 1GOXA 5T91A 2GUUA 2AOSA 4HHLA 3APGA 1DE6A 1VHNA 3VZZA 4B2DA 4XD6A 1B30A 1C93A 3KAOA 1AMYA 3DH7A 4LUSA 3Q58A 1Z8AA 2W63A 3K30A 1ZCCA 2W79A 2EO7A 3ZJ7A 1DYSA 2E7FA 1KCXA 1G4SA 1I2RA 1YIXA 5F2MA 4FX8A 3TLQA 3IJ9A 2ZRYA 1EDTA 2PD9A 2WJZA 3LI1A 4AH7A 1U30A 3GXNA 1N55A 1NJJA 1LROA 3C8FA 4TVUA 3CIWA 2X0SA 4BFAA 3FAXA 5AZ0A 2R94A 1GYMA 4S23A 5BXPA 1PDYA 4N02A 2VX7A 1YLVA 4OE7A 1KGUA 3RHGA 1E6RA 3QXBA 4PB3A 1RV8A 3UXDA 3UGRA 4H9TA 4F0HA 1LL4A 2REQA 1DJNA 2ZUVA 3ZLHA 1AG1O 4HYWA 4ZQNA 3MVIA 1XRTA 1QRQA 1F4AA 1Q5MA 3WEMA 4MB5A 3UERA 4I6VA 5LNSA 3T44A 5AOUA 4PTDA 1DBTA 4GX9A 4ACYA 3GFYA 5K9DA 1XIIA 2VWTA 3MTWA 3OVQA 1XFBA 2XM1A 3DBNA 4AISA 4B4HA 4AY8A 2BLEA 2FDSA 1ZL1A 4JQ4A 3NQ2A 2VR5A 3LG3A 1K8XA 4R7JA 1TPDA 1O5QA 3G1DA 3IVTA 1QPKA 3WQWA 1PZ2A 1SPQA 1ZALA 4IFRA 3CUFA 3ZQ9A 5A8QA 4QJ5B 5EL1A 1W0MA 3HU7A 2ZX5A 3R8RA 2VOMA 1QASA 2VRJA 3IJQA 3CT2A 3HG3A 1QHZA 2I56A 1KM3A 6REQB 4PUNA 3E96A 3F2CA 1I1XA 4PH6A 1MQRA 4HK6A 4AWSA 3L12A 2FH8A 4MB3A 1RA0A 2DZPA 4Z1YA 4ZOEA 2E8ZA 3PUEA 5HATA 2WLZA 2D2HA 5DQPA 1ZUAX 4L4PA 3E5BA 4NJJA 1R5YA 2CKRA 2YIHA 5AVHA 7REQA 2OSWA 4N0RA 3VC6A 1DHPA 3UPBA 1J2BA 2NUXA 1NIUA 1HL9A 4TO8A 3JUGA 2V2DA 3QKEA 3CQIA 2QCDB 4KERA 2OYLA 1TG7A 4I7UA 4JTEA 3VDGA 3NPUA 4X2PA 2VCCA 2J7CA 2O9OA 3RITA 1KLYA 4WRHA 5LHFA 4UTIA 3LV5A 1HL2A 4CQ9A 3EA3A 2RDXA 2AKZA 1E6SM 3LN3A 3W29A 3KTXA 3LZ5A 3CT7A 2AQWA 7REQB 1MW2A 2BGNE 2VFFA 2ZZ2A 3S2LA 4QQ3A 1WDQA 4BQ2A 1IWPA 3WIJA 2UY2A 4RW3A 3CEUA 1XRSA 3URAA 3W1MA 3GYEA 2H8XA 5CZ0A 1ISWA 3NL6A 3R0KA 4OTKA 3NUKA 3WLIA 4D71A 1S2TA 4JNZA 4NKCA 4MY9A 3H6OA 1XIEA 4GJIA 4JXCA 3BL3A 3VMNA 3VDAA 5D8WA 1CXFA 3GU2A 1LZOA 2Y7FA 2Z7GA 4QITA 1GONA 2YSWA 2XVNA 4N42A 4XVDA 4OV4A 3TNOA 4LAMA 2OLSA 3LBOA 3B9OA 1NF7A 4HNNA 2JF7A 5AY7A 1F6PA 3H23A 4ZBCA 4B5UA 1M01A 1J9YA 2ZRVA 4O1EA 4W84A 3LPFA 4XBJA 1JAEA 3O6AA 1X7IA 3V0TA 3MO7A 3PTQA 1LM1A 3CC1A 2V5KA 1JZ3A 2ZZ6A 2POZA 1HJSA 2IQDA 1TCMA 4NZ3A 2QQ6A 2D0GA 3P7YA 3WUFA 3MQTA 4GIRA 1JAKA 2WMIB 3P61A 3QY8A 3TYUA 3BJTA 2BOFX 1PX3A 3E12A 3GTHA 3TEVA 1Y8BA 4CQCA 4DZIA 1SO5A 4JHMA 1XBVA 3P84A 3P5YA 2NWRA 2A3LA 1F3TA 1L6GA 3MMDA 1VP5A 5BOEA 3WLTA 4P7RA 3ARZA 1OG6A 3QOKA 1HZYA 1DIEA 3C0SA 4FR1A 1PIFA 3F5LA 4IG2B 3W7RA 3IIZA 3KTCA 1LUCA 3QZ6A 4AMAA 3FJNA 5BW6A 1OM0A 2V82A 2QVNA 1H0IA 1MFVA 3UBPC 1B1YA 4N9CA 2PS2A 2PU1A 3NDZA 3DKJA 3PTMA 3U6WA 4WOZA 1VPYA 3ZWTA 4B16A 2H9AB 4BQ5A 1HKKA 1F3WA 3HM7A 4BEUA 4QLLA 2EJAA 5ABGA 4IISA 2Y7DA 1O6IA 4R7OA 5CXPA 1L6WA 3OBKA 1A4MA 3KVJA 1K7EA 3ABRA 3AIWA 2DUZA 3I6RA 1YW1A 1Y65A 4GY7A 2ZRZA 4YJ5A 2CLOA 3GNOA 3PULA 3NSMA 4F2TA 2ZTJA 1WAWA 1RAKA 1LG2A 4G7EB 3DGRA 1S5VA 4KT2A 1V3LA 1FVPA 2VFHA 4LC6A 4ADUA 2OELA 4HTBA 1OF8A 1UWAA 3RO8A 3KP1A 2Z7KA 2EQDA 4JFTA 3ITXA 2IKHA 4DB7A 3AZRA 1BQCA 1QO2A 4IIGA 4QAWA 4DJDD 3FOKA 4GQBA 3ZLGA 1XLJA 1E55A 2QUVA 3QQWA 1L8PA 3ANUA 3WDRA 3K4WA 3G0XA 4GK8A 4UFJA 3PM6A 4PCSA 3FCPA 4LUSB 3H2EA 3EOOA 1XJBA 4IHCA 1CT5A 3H55A 4XZHA 4DF0A 1JCTA 3O63A 3GBEA 4AWUA 3NQFA 1S2VA 5E70A 3BPWA 3GK0A 1VYPX 1TPUA 3UZXA 1KD0A 4KGJA 2D3NA 3TSBA 4TXEA 1I9CB 4HNCA 3WNKA 1UWQA 1US3A 3LEPA 1P4CA 3VIFA 3BG9A 3CPGA 4PEKA 1OC7A 1JCXA 1ZSXA 4QE4A 1B54A 3TK7A 4AEEA 2BWGA 1ZENA 3WFZA 4DWSA 4IQLA 2GPTA 2VCBA 4RUBA 3QVQA 1H61A 4LV9A 4XKMA 4FNTA 2YA2A 1KA9F 3NTYA 3PZUA 2V3DA 4BF5A 3U5UA 2V30A 3TTQA 4E38A 4ILSA 4IMDA 4OUEA 1UMLA 4CVWA 2WKJA 1UROA 4G5DA 3NL2A 2DVTA 2V3GA 2YL9A 1UUOA 2VEIA 4H2CA 2X0YA 3T40A 1XISA 1LLOA 1XYFA 4LWWA 1MUWA 4IQJA 1W9UA 4GKLA 3KX6A 3HA1A 2WBKA 3T42A 1UD5A 5HNUA 4PUEA 4B3KA 1CDGA 5FJTA 1TPVA 3KW3A 3TWBA 5AZ1A 3V1PA 4JTAA 3F7JA 1P0BA 3VCRA 1E1CB 3ZR4A 4JKLA 3N4FA 4PTVA 1CLXA 2DJLA 3NQCA 1UD3A 3APTA 1IT7A 2NQZA 2VNCA 4J3VA 1H11A 4NNCA 5HR6A 3TFXA 1NFBA 4HYRA 3AISA 4GVHA 1ODUA 3BZJA 1RQEA 4EAYA 3GAKA 2ZE3A 2DIEA 1EDQA 3KRUA 4CLMA 5LIKX 3SUWA 1RPKA 4ZE5A 4FA3A 2JEQA 3N2TA 1MRAA 1J79A 3FLUA 3BAKA 3VNIA 1OWQA 3PTDA 3UZJA 1X8FA 5D9OA 3BLFA 4ZEPA 1HJVA 3S5YA 1R8LA 2R14A 3SCNA 1K9TA 3PZTA 4Q8VA 1HKJA 4US6A 4YWIA 3WDJA 1YADA 3AZSA 3N13A 1AA1B 4IFKA 3NQ7A 5AHEA 1RVGA 1OFDA 1Q6RA 1VIZA 2ZC8A 4IP7A 1JD9A 3MSRA 3A22A 1JPIA 4QEEA 4M19A 1RY0A 3QW4B 3I65A 4GH3A 2Y24A 5TNVA 1GVFA 5FIPA 3S5SA 5A6KA 3RFAA 3KE0A 4Z0SA 4ZQRA 5FF0A 5I3DA 3PPHA 1OG0A 4MKNA 3SCUA 2XFWA 4MZYA 4X3ZA 1GTHA 3PJXA 4DO7A 4GG9A 1GOKA 3CH0A 1AJ0A 1E1EA 3MHGA 2EF9A 2BY3A 3GRIA 4REQB 4YLWA 1NELA 1P0EA 3N6HA 3TNBA 3OO2A 2VUNA 1XLKA 1I8JA 3WELA 5D04C 5LNWA 1EJRC