1FHDA

Crystal structure of the xylanase cex with xylobiose-derived imidazole inhibitor
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords BETA-1,4-XYLANASE
total genus 129
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fhdA00
2VZTA 1JXKA 5A6KA 1C8YA 3W81A 1HT6A 3WENA 5KEZA 4EKJA 1H11A 3DC0A 2ZUNA 3W37A 4MJ2A 2XFRA 4UZSA 3ZSSA 4OZOA 4CN4A 2G4FA 3I3DA 3AIEA 4Z2IA 4JHZA 5HPOA 1MQRA 1EO5A 4X0NA 1ISXA 1C92A 3L4UA 2CBUA 3WY1A 4LX4A 1DHKA 5D9NA 3WL0A 1S46A 1CGVA 3FXYA 1JD9A 5EFDA 4JFTA 4GZIA 1M01A 4P7RA 1JI1A 2DSWA 3AYRA 1Q4NX 4PUEA 4PUDA 3UR8A 3ZJ6A 3AICA 4PYSA 4W7WA 1UWIA 2RGMA 3TTSA 5M3WA 3GBEA 1LF1A 1B3XA 1J0KA 2WPGA 3OG2A 4YHEA 4Q22A 3WDJA 1B0IA 4UQ9A 4D1JA 1JF5A 3K4AA 1NWRA 6TAAA 4J3TA 1UH4A 2GJXA 2DIJA 4CD6A 1VB9A 4TTGA 2W4XA 1L8NA 1EH9A 1OIMA 5CPSA 1V3JA 1BG9A 1AQ0A 2BFGA 4Z2GA 3BAJA 4HA1A 3RDKA 3WH8A 4M56A 2QV4A 5CGMA 4MJ4A 4UFMA 5D8ZA 3VIOA 2CIPA 1B2YA 1E72M 2VRKA 3VD3A 2WHLA 1E4IA 1J18A 1V6YA 3VDCA 4CD8A 5CPQA 1UUQA 1M03A 4WKHA 3POCA 2GDVA 3WQ5A 3ARWA 5A3HA 2WKGA 3AISA 1G5AA 3PBGA 3MU7A 1H2JA 1XC6A 4U3AA 4ACYA 1UKOA 1V0MA 2AOSA 1LL6A 2YBUA 1EHNA 4MNMA 5HNNA 4OIFA 4ATLA 4MAZA 1AVAA 2EO7A 2V3GA 3CPUA 4M24A 1MQPA 1W3JA 2EPLX 4NZCA 1VFMA 2WMGA 1VBRA 1BGAA 3PZTA 4HU8A 2G3IA 1NWUA 1NH6A 1PX8A 2XG9A 3T08A 1W9UA 1NP2A 4D72A 3GBDA 2D0FA 4L4OA 1XH2A 2NT1A 4FF5A 5A95A 2D3LA 1UR0A 4UCFA 3G6MA 1JDAA 2J7EA 3MANA 3ZQ9A 2BHUA 1JG9A 4AD5A 2WVSA 5BXPA 4RL3A 1R85A 3T2QA 1V08A 3VMOA 4UTFA 1ZJAA 3GH4A 4A4AA 1QNOA 3BAYA 1K9TA 2VX4A 1KB3A 4Q7NA 1PX3A 3U7VA 5DT7A 3OGSA 2ZWYA 4FK9A 1FH7A 5GQBA 1VEMA 1TVNA 2GJPA 3VGEA 2YLAA 1KXVA 3WEOA 1NP0A 5E09A 5EB8A 4D6IA 3APGA 2Y2WA 1MW1A 3CIVA 2ZXAA 2XSBA 2VOTA 1CDGA 2G41A 1WDRA 4P8XA 4TX6A 3MMUA 2A3EA 4AIUA 1PX4A 3GNOA 5GPRA 1W9DM 3EDDA 4N0RA 5AYIA 3W53A 4AZCB 4CD4A 1QNSA 5ABFB 1CGWA 4FLQA 4MTVA 2WVUA 4LPCA 1GHSA 4HOWA 4PSRA 1W3KA 2WCSA 4GO9A 1WAWA 5FKYA 1CXFA 3VIKA 5I6SA 4WSJA 3M46A 2YL8A 1UKPA 2ZX8A 3CUHA 1CTNA 5A2AA 5GNXA 1UG6A 3AROA 3L4ZA 1VF8A 2X09A 1PEZA 2XIBA 1HP4A 1OCQA 2JE8A 2ZX9A 3IJ8A 2JALA 4TUFA 5EBAA 3RM4A 2Y4SA 3PZVA 3T09A 3VD4A 1MW2A 3WUBA 9CGTA 1E6NA 4P8WA 3OLEA 4WSKA 1GQLA 1E1EA 2XFYA 2WANA 4JFVA 3UG4A 1XSJA 5D9MA 4FLOA 1W32A 1FHLA 1GPFA 4JCLA 3OA5A 4HA3A 1OM0A 2G8ZA 5BRPA 2WMJA 4RE3A 5DEZA 3VIFA 1V0KA 3WQVA 1Y7VA 4ZFMA 3U5YA 3CBWA 4ACZB 1W1TA 1VFFA 3ARQA 4Z2JA 2J7FA 4B9YA 1CXIA 1VEOA 3SCRA 1V6XA 3WNMA 3B9EA 1FFQA 1J9YA 5FCZA 1MVYA 4F79A 1J0IA 2ZE0A 4Z2KA 2OYLA 4Z2HA 1CXEA 3CZKA 5A94A 3AIRA 4MPKA 1FA2A 3S6TA 1UWUA 5BYWA 4CKQA 1KQZA 3CZJA 2VUYA 4AD0A 2EPKX 2G3NA 2E3ZA 2Y8KA 4GXPA 3LPFA 4N42A 3W29A 3O2LA 3GNPA 1XH0A 2JEQA 2DSUA 3F4VA 1FP8A 1E4MM 4NSBA 2GK1B 1LQ0A 1GQIA 4H8HA 4MB1A 3KL0A 5E6ZA 2WMIA 1YHTA 1BSIA 4CCEA 2CKSA 3N1AA 4W5ZA 1UR9A 4GZJA 1XHGA 5CJ5A 4HU0A 1ZBCA 3BGAA 2OSWA 3I3EA 4J3XA 3IJ7A 3UERA 3LPPA 1YQ2A 4BQ5A 2YA1A 1X1NA 1BYAA 1K6AA 4MB5A 3W27A 3UCQA 1FHDA 3VD9A 4PMOA 4GKLA 1JFHA 1V03A 1EDQA 4WKFA 1IZKA 2A3BA 4WF7A 1VFOA 3AHXA 2WHKA 4GINA 1W2VA 4OKDA 1JYXA 3GYCA 1MFVA 3WUEA 1J0ZA 4V27A 1JZ8A 2YDRA 2IUZA 2PWHA 2WMHA 2CNCA 1PIGA 3AOFA 1E55A 3AMCA 2ZXDA 5DO8A 1UKQA 2DSVA 1UOKA 5A6BD 2VURA 5IHSA 4PCSA 1HN1A 1UD2A 2XVLA 3QR3A 1UD3A 4GIAA 3CUJA 4R5EA 1WZKA 2FGZA 3ZSTA 4BCEA 3WEMA 4TVCA 3CLWA 1E5NA 1B31A 1U30A 1K9DA 8CGTA 3BAWA 2J7BA 1VIWA 1OT1A 1WB0A 2J8FA 2QPUA 2XGIA 1CYGA 4LYQA 3A3HA 1Q6CA 2GJRA 2XVGA 4J3SA 4QCFA 5LA1A 3WD4A 1H0IA 4P8VA 3WMSA 3K4DA 1VRXA 1EIBA 5BROA 4PMXA 4PTXA 4W7UA 1FH8A 1GW1A 4JL2A 2X0HA 3MSGA 3CUGA 2CETA 3MUAA 2WMIB 3SUTA 3UESA 1WDSA 2XVKA 3ECQA 2WLZA 4UQAA 2CYGA 3LMYA 3VGGA 5TD4A 1CBGA 1W3LA 3ARSA 1E70M 4U5KA 4AEFA 4AW7A 3OGVA 3AXXA 1OINA 1NOUA 3WNOA 4P7OA 1E1FA 1E0VA 5CLTA 4F8XA 3MS8A 3QOKA 3CTTA 3PZUA 1JZ2A 5A6BA 4M81A 2MANA 1WNOA 2O9OA 4DWSA 4JCMA 3SCWA 1EDTA 4MDOA 4UOQA 3ALFA 2BY3A 3VIMA 3WN6A 4H41A 1RPKA 4J3WA 1WDQA 2PWDA 2VRJA 3OZPA 3WQ4A 1GVYA 1GONA 1TA3B 1QW8A 5HOSA 4LYPA 2IXUA 1HXJA 4MNJA 4ATWA 1B9ZA 1TUXA 3EBVA 3M7SA 3PN8A 5A69A 3CHCA 2BVDA 3D5HA 2ZX7A 1AQHA 5A8NA 4U5IA 4AYSA 1DWJM 3N04A 1PBGA 3N17A 4AD4A 1EDGA 4PMYA 5I0DA 3AI0A 4HMDA 1BG4A 3A4WA 2WBKA 2BXYA 1TMQA 3AHYA 3VM5A 4HZ7A 4OBRA 7A3HA 1C3FA 4WJXA 4JAWA 1G01A 2YOCA 2D3NA 3DHPA 2J4GA 1NQ6A 3QHOA 3BMVA 3L4XA 1W3HA 2D23A 3GH7A 3N13A 1V3LA 1KBBA 1GQJA 1PAMA 2BVYA 1GOIA 4M82A 3VX1A 2O9PA 3WH5A 2DDXA 1UWRA 5ABEA 2OWXA 3SEPA 4PCTA 1HJSA 3CMGA 2E40A 3AXHA 4TXEA 1M53A 5AY7A 3NDYA 1BVZA 5I3DA 4MADA 1MW0A 1PZ2A 1Z32X 4J27A 2OYKA 2ZX5A 4CGTA 2XPKA 1LJYA 2OYMA 3B9AA 3AIUA 1E43A 4B15A 2BNJA 2DSKA 4XZWA 1UWSA 3AQUA 2CBJA 3T0BA 2IXVA 3DHUA 1OD0A 4E8DA 2CCRA 4CCDA 3VIPA 3BMWA 3K1DA 1DWIM 5GNZA 4IPNB 4QFUA 5CLWA 4EE9A 4W85A 3BC9A 3NYDA 3AMKA 2A3CA 2DH3A 1CWYA 1LL7A 1HNYA 1W9VA 3NDZA 1WE5A 1E6SM 2QMJA 1QBBA 3KZSA 4K68A 3WBAA 3PZIA 2PI6A 2XSAA 2D0HA 1B3VA 1KR1A 4AZ5A 3BAXA 1LWJA 5D4YA 1BYCA 3VILA 3PZ9A 2WHMA 4M8UA 5FOOA 2F8QA 1X6LA 1UYQA 5LA2A 4BF7A 1CPUA 5IFTA 3SCSA 2BHYA 4W93A 2CESA 3AS1A 5IFPA 1GOMA 2EQDA 2JF7A 2J25A 4QCEA 3FAXA 4LQ1A 1UQYA 3F5JA 4PRWA 2YIHA 2YDQA 1BYDA 1TVPA 1DWFM 3SUVA 3WFZA 3K8KA 1MXDA 4U2ZA 4AZ7A 1TG7A 2VL4A 5JUVA 4YN5A 1CENA 2JIEA 2ZWZA 2YL9A 3EDKA 4MDPA 2WZEA 4BQ3A 3ZT6A 4U3CA 6A3HA 3BAIA 2PBGA 4MB3A 4D6GA 2EPMX 5C70A 5JBEA 2XHYA 1HKKA 2ZUVA 1JZ6A 1N82A 1JYNA 2YDSA 3PZOA 2XVPA 1XCWA 3ZR5A 2X8RA 2OLHA 1V3MA 4WK9A 4FMVA 1F4AA 5AC5A 1L0PA 1LLOA 1MYRA 3GNRA 4B9ZA 5AC4A 1K9EA 3WMCA 1E71M 3DYMA 1QNRA 1J0HA 3A6OA 2TAAA 3G6LA 2XM2A 2XTKA 1XGZA 4YPJA 2VZVA 1DWHM 4UOZA 3AZTA 1GCYA 4OOZA 3VO0A 5E9AA 4TX8A 4BQ4A 4JKLA 2OWWA 3L4VA 3CGTA 5A6AA 1XYZA 1DP0A 2ZXBA 2WC3A 1H3GA 4C7FA 2J62A 1VEPA 1CGUA 3SUWA 3N18A 1J01A 5I78A 3VU2A 2UY5A 4QLKA 3NCOA 3AMGA 1JD7A 4HZ8A 3MV01 1OGBA 1ZJBA 1I1XA 3NSNA 4UFJA 1XD0A 4GQRA 3N9KA 1SMAA 3IAQA 1EQCA 2XWEA 4GQQA 3PTQA 3L2LA 4M29A 3MSDA 4PN2A 5E6YA 2OSYA 3AS3A 3KEHA 2JEPA 5D9PA 3BCFA 3JUGA 3OLGA 1XSIA 5KZ6A 4H2CA 1OGSA 1HX0A 1JAEA 5A6LA 2YKKA 4MB4A 1QI3A 4KH2A 3L2MA 7TAAA 3KL3A 4UFKA 3SCNA 3T2OA 1E15A 3RM9A 2A3AA 2QMKA 2EEXA 2ZUWA 2VCBA 3AYSA 4PSPA 4A3HA 4BZYA 3S2CA 2C7FA 4LXFA 1HJXA 4ZXOA 1ISYA 1W2PA 2YA2A 3II1A 4W8AA 2A3HA 4PMNA 1V3KA 4JFWA 1JL8A 1DWAM 3WDHA 4M80A 1QI4A 2HISA 3VTRA 1DTUA 2XIIA 4JKKA 1QHOA 1V3IA 3AXIA 1NM9A 2WCAA 3I3BA 3AIQA 3O9NA 3WDIA 2PB1A 1JYVA 2WC7A 3ARXA 2VJXA 3L4YA 3W38A 3WUGA 1ECEA 3WD1A 3GM8A 1TE1A 4W8BA 2WXDM 4B3LA 1UR2A 2CERA 5CSYA 3AIWA 3PZGA 2QPSA 2ZUSA 2VR5A 3GZAA 3MMWA 4URIA 1MWOA 4AC1X 3PZMA 4JFUA 3VOCA 3VMNA 2CKRA 1EOMA 1US2A 5BWFA 3WF4A 1U2YA 1CGYA 3EDEA 4D71A 1E3XA 3SCTA 3W82A 4W8LA 1CLXA 4AZCA 1TZ7A 3CZLA 5A6SA 5A6JA 2FH6A 4P7LA 3OLIA 2VZOA 2BVTA 5DMYA 1C8XA 5FIPA 5F7UA 5FD0A 2V38A 3WD2A 1V02A 4HOXA 3VIHA 1GUVA 3N12A 2CEQA 5A2BA 4PMDA 2DIEA 1CLVA 4W87A 4W86A 3ARPA 4UOJA 1BLIA 3VD5A 4UQBA 1H5VA 2B31A 1ZB5A 2V3FA 2VX7A 5EFFA 4EAMA 3BLPX 5EMYA 3PTKA 2VZUA 2WMFA 2E4TA 2UWFA 3W4RA 3QOMA 1EXPA 1Q6DA 2HVMA 1RP9A 1UKTA 2XJ7A 1BFNA 4P7NA 3ALGA 3OLDA 1QI5A 1D3CA 3ARVA 4AZGA 3BAKA 3THDA 4EK7A 5HBFA 3SIMA 1UR1A 2BXZA 6CGTA 4AIOA 5M5DA 3CH9A 2VRQA 3NJ3A 2ZUMA 1ZBVA 4MNLA 3UEQA 3UR7A 4WLCA 4PTWA 4AXNA 1KWGA 1W1VA 4CN1A 3CHDA 2VNCA 2JIWA 3AIBA 1ZBKA 5AYBA 1E4LA 1BHGA 2UY4A 3KL5A 2W62A 2G3JA 5A2CA 1I1WA 4OUEA 1KR0A 1FFRA 4DWSB 3ZJ7A 2CPUA 2E9BA 2CBVA 3RILA 1XH1A 3VGBA 5C71A 2FHCA 1QBAA 3W6MA 1WCGA 3U5UA 4D6DA 1KFWA 4D1IA 3TA9A 4ZENA 4QLJA 1PJ9A 2D20A 3GH5A 3ZT7A 2WAGA 1EGZA 4J3UA 1G1YA 5FL0A 3WBEA 4D6EA 3BLKA 3WEZA 5BRQA 1UQZA 4U33A 5IDIA 3THCA 3IK2A 4MAVA 1JFXA 2ZX6A 1WZLA 2EXOA 5DT5A 4X9YA 1JAKA 3ZR6A 1VBUA 2WK2A 4B3KA 2D22A 3WH9A 4AD1A 3EMQA 1QHZA 4B16A 1UA7A 1JI2A 1JZ5A 2GFTA 4KWUA 2VZSA 3AJ7A 4PEEA 3GXDA 1W9XA 1I75A 3MO4A 4XZBA 1IV8A 2NW0A 4AEEA 4CCCA 4XX6A 4GPNA 1JNDA 1B90A 2Y24A 4JKMA 1UWTA 4DWSD 2FHFA 3WH6A 1OD8A 3AMLA 3VKKA 2YBTA 4CUCA 1W1YA 1E6PA 1V0NA 2BHZA 2J7HA 2CXGA 2VMFA 3L4TA 1H41A 1DEDA 2QLYA 2AMGA 3WNPA 1WZAA 4LYRA 3TONA 3SUUA 5BXRA 4EANA 3ZOAA 1WPCA 1CGTA 3RJXA 3CZ8A 1E0XA 4AZHA 1VJSA 1KGXA 2DT0A 5JIWA 2D24A 2ESCA 2C8NA 3T0AA 1UZ1A 2J7CA 4IM4A 3RPMA 5DF0A 4KMQA 4RE4A 3WD3A 4QLLA 4TVUA 1CNVA 2GUYA 2FHBA 2XYLA 3GDBA 4ZEPA 3RCNA 2VQTA 4AZIA 5CXPA 3PZNA 3W25A 2EPOA 3AS2A 1KWKA 1V0LA 1CECA 1KXTA 3IANA 1B3ZA 3N11A 3N15A 2OWCA 3FAWA 1JNEA 1UD8A 2E9MA 4ML4A 3ZT5A 3D3AA 1SMDA 4KGLA 2PBOA 1CZ1A 1KGWA 1XD1A 1CXKA 1UR4A 1FOBA 3E1F1 4PTMA 1IZJA 2X1IA 2XWDA 4PMZA 5E0CA 4WKAA 1QNQA 1V02E 4J28A 4BA0A 2WB5A 4E8CA 1JF6A 3K8MA 3FHQA 3TP4A 3WNLA 5FL1A 3AHVA 3VPLA 2ZUUA 2J78A 3GTNA 5I79A 5BXTA 3O6AA 3HJEA 4KGJA 3BH4A 4V2XA 2DSZA 4OJYA 2VX5A 1M04A 1NOFA 3DYPA 1JIBA 4HOZA 3W28A 1E9LA 1UWQA 3FY1A 1KQYA 4CVUA 1EOKA 4HMCA 5GNYA 1QVBA 4JZ5A 3T2PA 1W9BM 2WMKA 1JZ7A 1VENA 3QGVA 4NF7A 3WDPP 3M07A 2VCCA 1W91A 2DGAA 4UFLA 4YHGA 3WIJA 2WNWA 1ISWA 1GHRA 2VTFA 5D9OA 4E4PA 1KXHA 3AFBA 1J10A 3EDFA 2BS9A 4FLRA 1NWSA 2FH8A 3M6DA 2DT2A 3U57A 3GXMA 1A47A 4LGXA 1G94A 2VI0A 4P7QA 4H04A 4ZE5A 2EBNA 3AIVA 1BQCA 5I5RA 4HMEA 1HKMA 3HN3A 4Z2LA 5I2UA 4AD3A 3K8LA 1LG1A 4D6JA 5M03A 2J8GA 1CIUA 5A8MA 5A6MA 1E6RA 2W92A 3WFLA 1OT2A 3VUPA 1BF2A 3EMZA 1UZ4A 2PWFA 3WH7A 4H8VA 3VMPA 4UZUA 4DWSC 2WM0A 3DYOA 2WWCA 1EO7A 1SYTA 3VGFA 4MNKA 5LYRA 1E73M 3A47A 4TVDA 3TTQA 1CGXA 1LL4A 4F66A 1QW9A 1UKSA 2ZXQA 2Q8XA 3ARUA 5JIPA 1HJUA 1CEOA 1UD6A 2W91A 4PMUA 3POHA 3DECA 1GOQA 1C90A 1HL9A 1MQQA 4W89A 1ODUA 3HU7A 3NIYA 5CQ1A 1LG2A 4AZBA 1KCLA 3OGRA 2VCAA 1BTCA 1SR0A 2YL6A 4UFHA 2BY2A 1V6WA 3K46A 4CVWA 2PWGA 1BVNP 5HPCA 2WWDA 3MUY1 4V28A 1WZMA 5D8WA 3RO8A 2J74A 1OBAA 4JFSA 1WKYA 3ARYA 1AMYA 1OB0A 1ZL1A 3VGHA 3WF0A 1P6WA 2W5FA 1RP8A 2Z1SA 2Y8VA 4NI3A 5I23A 2Y5EA 2WZIA 2NSXA 1HVXA 1QHPA 2E8ZA 2XM1A 2V5DA 3ZMRA 4HPHA 1WDPA 3WF2A 2YL5A 5I24A 3QHNA 3MUZ1 1HJVA 2QF8A 2PWEA 5A8PA 1W9PA 4AY1A 4HTYA 1MFUA 7CGTA 1HKIA 4F9JA 1D7FA 2AAAA 2FDMA 2W61A 3U7BA 5BXSA 1G0CA 4HP5A 4NRRA 2ZIDA 4XV0A 1UR8A 1C91A 3J7HA 4BS0A 4CU6A 2J47A 2DPEA 3AS0A 2XFFA 1BAGA 4IUGA 3OZOA 2VR4A 3SUSA 1M7XA 2JFEX 1QI2A 1E5JA 2V5CA 2DEPA 1WP6A 4UQCA 3MV11 3NSMA 4DUXA 1TFVA 2GJXB 3ZJ8A 1CXLA 3QHMA 3WKZA 2WKLA 1BYBA 3WSUA 3VX0A 4H8UA 1KCKA 4TOQA 1R86A 2PF0A 3UG5A 2WC4A 4C7GA 1J12A 1VJZA 3VGDA 1RH9A 3VM7A 2YJQA 2J79A 1JYWA 5ABFA 1GVIA 3WD0A 5HXMA 4PMRA 2E8YA 1XSKA 3A4AA 3ARTA 3RM8A 4OOUA 3SCOA 4GO8A 3TTOA 1G9HA 1B1YA 3CHFA 1UA3A 1E6QM 1GNXA 1R7AA 4D6FA 3NUKA 2VT0A 4GI9A 1H09A 5HDRA 3PHAA 3CUFA 2O9TA 3VNYA 2VO5A 4GZEA 2RGLA 1E6ZA 1GOKA 5C8BB 3OB8A 4DUVA 1OGGA 5IXEA 1E4NA 3BXWA 1VAHA 3VD7A 1B3WA 2WW5A 8A3HA 2CITA 1ISZA 3F5LA 3W6LA 2XGBA 4XB3A 4AZ6A 4HPGA 1R87A 1BGGA 1VFUA 3IAPA 3L4WA 1Q6EA 2OSXA 2X0YA 4KRTA 3T0DA 5CSUA 3UG3A 1PPIA 4DM1A 4ATDA 2D1ZA 1EA9C 5CPTA 2BY0A 2ZOXA 3VDAA 4PTVA 4NRSA 2E9LA 3IJ9A 5CZKA 3WDRA 1TA3A 3VIGA 4CU8A 3MUIA 4PMQA 1QNPA 2J7DA 4QP0A 1ITCA 3W0KA 2DT1A 2O92A 2D0GA 3OIHA 3WQWA 3SCQA 3AZRA 1OSEA 3RMEA 1GZJA 1SFSA 1RD6A 1UD5A 1K9FA 5ECUA 2VQUA 3CZGA 3PTMA 4R27A 1E3ZA 5BCAA 3VVGA 3AHZA 5A8OA 3ZO9A 4UNIA 3BSGA 4JHOA 3AHTA 1PZ3A 5M17A 1C7TA 1ZS2A 2CHOA 3W26A 2X2YA 2Z1KA 3WMBA 1HKJA 2V3EA 1Q6GA 2WSPA 4GI6A 1UH3A 4GI8A 1TR1A 2FGLA 2CBIA 1JGIA 3WQ8A 1JXJA 3WL1A 4U2YA 3WQ6A 3WF3A 3ZIZA 3FW6A 4CN6A 4DUWA 1EHAA 1MXGA 2X05A 1J0YA 1GJUA 1DWGM 2WVVB 3MKKA 2O9RA 1OIFA 5DFAA 2YA0A 2GDUA 1QI0A 1UH2A 1FH9A 2NT0A 2BY1A 2D2OA 3GXFA 3B8SA 2ZICA 1V3HA 4D6HA 2G3MA 4J7RA 4D6CA 1ISVA 1QOXA 5JBFA 1OWQA 2XVNA 5CG0A 4P8UA 2VVNA 1A3HA 1D2KA 3SURA 1JDDA 3SCPA 1C8QA 1H4PA 3PZQA 4WIWA 1AQMA 1E6XM 4AWEA 5LA0A 3FHAA 3TOPA 2F2HA 2YLLA 4UQDA 1GOOA 1QPKA 3HMCA 1C93A 3KE0A 1GORA 3BCDA 1W1PA 3GXIA 1GOWA 3VDHA 1V6UA 4BQ2A 5E70A 2BV9A 2WSKA 1HIZA 1R8LA 2WCGA 1H1NA 1J11A 4CU7A 3F5KA 3SCVA 1U33A 1HVQA 1V6VA 2GVYA 2JF6A 4TTUA 2DH2A 1ODZA 1ZBWA 1UD4A 2VC9A 4C7DA 2W66A 2J75A 4S3KA 4HA4A 1HJQA 4DM2A 1EQPA 1BPLB 3WNKA 1PIFA 5JBDA 1LWHA 4AIEA 4W88A 3ARZA 1XCXA 4M1RA 4W7VA 3EYPA 2QHAA 3EDJA 4CD7A 1XYFA 4HZ6A 4W5UA 4UQEA 1J0JA 3EMCA 1O7AA 4CD5A 2EJ1A 1JZ4A 1E40A 2DT3A 1WO2A 1F4HA 3AMDA 4KRUA 2F61A 2WYSA 3WF1A 4XUYA 3A4XA 1HF6A 3WNNA 3ZM8A 2VVSA 4PBGA 4PMVA 3CHEA 3AZSA 2V3DA 2XUCA 5CGTA 2WLYA 4L4PA 3ZJKA 4QDMA 1GJWA 2CHNA 3UETA 1FP9A 1ESWA 2GK1A 5A8QA 4U31A 2WVVA 3VDBA 2WBGA 5ABGA 3WUFA 2DQXA 1ITXA 1H0GA 3FNDA 4FLSA 5I77A 2GSJA 4Y7EA 2EPNA 4IISA 4ZXLA 1TCMA 4J3VA 5A1AA 3CZEA 1C7SA 1B3YA 2VX6A 2W63A 1KGUA 4ACZA 3NSXA 1O6IA 1KXQA 4W84A 3CO4A 2E0PA 1JZ3A 1XV8A 4UFIA 1XRVA 3MMDA 3VINA 4ZE4A 4X0VA 4H7VA 2PC8A 3BSHA 3VNZA 4S3JA 4JIEA 3CMJA 1IT0A 3CUIA 2UY3A 4QAWA 3VIJA 4E2OA 1US3A 4JL1A 3W24A 2J7GA 2WVTA 4F9DA 1JDCA 4IPLA 1Q6FA 2ZUTA 2UY2A 3RIKA 1E0WA 3LPOA 3WDQA 4AISA 3LPGA 3OBAA 1MW3A 4RE2A 3TTYA 1E56A 2C0HA 3VIIA 3ARRA 1ZU8A 1B30A 3B9DA 3KWXA 1UHVA 1H49A 4OBSA 2WHJA 2WZHA 3FN9A 1X6NA 4A3YA 1HJWA 5ABHA 1HP5A 1NWTA 1HL8A 1CXHA 2W67A 1NOWA 1KBKA 1NARA 3RJYA 3WELA 4UR9A 5E0FA 3SCUA 4AD2A 5IHRA 4AMCA 1GQKA 1R7OA 2J77A
chains in the Genus database with same CATH superfamily
4M6VA 5G1MA 5A6KA 3WQPA 4PUKA 3BZGA 4ZCWA 1PVNA 4EKJA 3DC0A 2ZC8A 3NXLA 5A6TC 5LHEA 3EWDA 1XLGA 1O1HA 4XIAA 5HJXA 2VC7A 2J9YA 2Y85A 1ENUA 1NSJA 4N4PA 4G7FA 4LSBA 4X2RA 2DZPA 3WY1A 4LX4A 1DHKA 5D9NA 3UWWA 1S46A 3WL0A 1L9WA 4ZBCA 3UXKA 4ADUA 4O54A 5EL1A 1M01A 2G3FA 2AKZA 1EJ7L 1YDYA 3AYRA 3E2VA 1GJPA 1Q4NX 4PUEA 4YTQA 3VE7A 3AICA 1Y8BA 2RGMA 1C9WA 4TO8A 1LF1A 1J0KA 3OG2A 4YHEA 4QQ3A 3WDJA 4D1JA 3H23A 2OEJA 4M6QA 2BTMA 4IWWA 2GJXA 1NDYA 4DJFC 4CD6A 2W4XA 3QW4B 1EH9A 1TV4A 1BXBA 2OR2A 3O7UA 5MKGB 1DORA 3BAJA 5HMSA 1O68A 3CU2A 1VLWA 4MJ4A 3SRHA 1UW9A 2NV9A 3VIOA 1B2YA 2HMCA 1S3HA 2INFA 2OEMA 3ABSA 5L6UA 4CD8A 1EGVA 3TYUA 1UUQA 4WKHA 1QWGA 2GDVA 1K8YA 3ARWA 2WKGA 5A3HA 3MU7A 1EP1A 1XC6A 2HK0A 1UKOA 1V0MA 3BLFA 4MNMA 5HNNA 2I57A 3SQLA 5JMUA 4S3CA 3UWVA 4JIHA 5ABTA 1AVAA 2V3GA 3MCOA 5M1TA 4Z1DA 1SZGA 2HE8A 4XAPA 1VBHA 4H8NA 1SUXA 4N9BA 1FWHC 4HU8A 1P0BA 1YDOA 1NWUA 2CZDA 4UBPC 1PX8A 1QMLA 2XG9A 2AKMA 2FJUB 3MY9A 1GZ1A 4D72A 5FI8A 3IGXA 4REQB 1XH2A 4FF5A 1UR0A 4UCFA 4FA3A 5HUPA 4QG8A 4DYJA 1Q7ZA 4G9PA 2WVSA 2FZDA 1R30A 1R85A 5GJNA 1PZ0A 2Z7KA 1TV2A 1POJA 3T2QA 1V08A 3VMOA 1QXLA 1ZJAA 3KZPA 3GH4A 4A4AA 1QNOA 4C6IA 2VX4A 4KFOA 4H9UA 1SO6A 4YTUA 2GOUA 3T44A 2IKGA 1FH7A 2R9RA 3AXMA 5C9XA 3UW6A 3L12A 3WEOA 4YVPA 5EB8A 3O16A 4KW2A 3LGGA 2Y2WA 4WSHA 2YPIA 3PUDA 4W4QA 4BKNA 2GWNA 3WLIA 2VOTA 3GLCA 2DZTA 3M0ZA 1OX6A 1KFEA 3THAA 3JRKA 1W9DM 3EDDA 3W2UA 4DYKA 1T99A 4CD4A 4F48A 5ABFB 2ADAA 4LVDA 3QY6A 4LCRA 1WAWA 3W7LA 2V81A 1NELA 1P1XA 1UASA 4ZOEA 2BB0A 4FNRA 3GDKA 1TPB1 5A2AA 3EPMA 3AROA 2C16A 1F6KA 1VF8A 4AEOA 5CZTA 1A5AA 3TR2A 2G37A 3LENA 2JE8A 1KRCC 1M7OA 2X7WA 3TMQA 3TYCA 4TUFA 5EBAA 4C6MA 1QAPA 9CGTA 2PFHA 1RXOB 3H2AA 4P8WA 2TODA 3TAKA 3HGRA 3M0YA 3CQJA 3RO6A 4JFVA 2ZDSA 1W32A 4FLOA 4BK9A 5E9XA 3OA5A 1OM0A 1L8PA 4G1NA 4YTSA 2G50A 1TPC1 1G4EA 4RE3A 5DEZA 2F7FA 3BJSA 1W1TA 3ARQA 4Z2JA 3T07A 3R89A 2CLMA 4OWGA 1KO0A 1SSGA 1NFPA 1XC4A 4F79A 1K7FA 3B0PA 3BMXA 1J96A 2QUVA 4XK2A 1P0DA 3CZKA 3MBDA 5A94A 5I03A 3SRDA 4NU7A 4GGBA 1VD6A 4GUJA 4GJJA 2R6OA 1P0KA 1IT8A 2AQWA 2C19A 2B7QA 4CQCA 3KBMA 2Z27A 2JEQA 3BG9A 2VFIA 4NSBA 2GK1B 1LQ0A 4H8HA 4MB1A 3OG3A 4HD5A 3HB9A 1ICSA 4YNGA 1DL3A 1ZBCA 3BGAA 3N2OA 4EPEC 2AQVA 4Q8WA 4NXSA 2Z1BA 5LNWA 4LUIA 4BQ5A 4DJEA 1DXIA 2YA1A 1V77A 1K6AA 4MB5A 3W27A 1FHDA 4GJIA 3DEQA 2KZHA 4NNBA 4Q8NA 1VFOA 3AHXA 5CPOA 1W2VA 1FWAC 1SZEA 3GYCA 2PDBA 3F2BA 5CGQA 2KAUC 1IXOA 1T0OA 2NQ9A 3O06A 3B03A 3GU2A 5A6BD 2ZXDA 3WLMA 4AU0A 1UD2A 2XVLA 1EX5A 2JKEA 3IGHX 1F6PA 2PSNA 4GIRA 3CLWA 1B31A 1U30A 3NZQA 4LRTA 1E51A 1WB0A 4K36A 2J8FA 2QPUA 4JQ4A 1FWCC 4XO7A 1CYGA 1Q6CA 4JQ1A 1XS2A 1UC4A 3NGFA 2OXNA 4S39A 1ME7A 4A05A 3QYQA 4R7JA 3CL6A 4J2MA 2X0HA 4LUSA 3CUGA 2RHGA 2RJGA 1WDSA 2XVKA 4GG9A 3ABXA 1CBGA 2UZ9A 3URBA 4F40A 2D2HA 1KFKA 3ARSA 5CC6A 4AEFA 5D2WA 4AW7A 3OGVA 4FXJA 3AXXA 3TJIA 1OINA 3MC5A 1XLHA 1FWBC 3O8AA 4P7OA 2X2GA 4KETA 3UNDA 4F8XA 2INZA 1JZ2A 1KFLA 1HO1A 4GACA 1U1UA 1WNOA 4DWSA 2ABAA 4QHRA 3M16A 3CB8A 4MDOA 4ZB0A 1EA0A 3ALFA 3K5XA 3L68A 2PDWA 4JPGA 1RPKA 3TX9A 3OZPA 2Y1HA 4AF0A 3PSVA 3KVKA 4LYPA 4YTTA 1O5KA 4O1AA 2C79A 4FOUA 1B9ZA 1TUXA 1BD0A 5IBXA 3M7SA 3PN8A 5A69A 1VS1A 3SAZA 2ZX7A 1OFOA 1DWJM 3N17A 3UWUA 1XDJA 1KM3A 3MJMA 4DJDA 3SADA 1KD0A 4PB3A 2BXYA 1TMQA 4HJFA 1LLWA 4EX4A 2DW6A 4OBRA 4FS9A 4GZ7A 3NQEA 1C3FA 4WJXA 3VA8A 2ZA2A 4LB4A 2YOCA 4DJFD 4NY2A 1W3HA 2B7OA 3T8QA 1GQJA 3QPZA 2IW0A 1WAUA 4IXHA 2O9PA 1TUFA 5ABEA 4PCTA 4LC8A 1C8VA 4TXEA 3TQ0A 3OODA 4QBXA 5FJIA 3HGOA 3QSTA 2PDJA 4UNKA 4J27A 4M51A 4RW5A 2F6KA 4B15A 1ALDA 2DSKA 3LM7A 4XZWA 4MJMA 3TUUA 3DHUA 4ZO8A 3TR9A 4S23A 2CCRA 3R94A 1L6SA 3BMWA 2PURA 4XZMX 1K8CA 2PTXA 3CH0A 3H12A 5GNZA 5G4HC 4IPNB 1MNSA 3QPEA 4QFUA 4FX6M 4IMGA 4IGSA 3BC9A 4NQ1A 3KRBA 2DH3A 1CWYA 1LL7A 2BWGA 1W9VA 3T42A 3UYCA 4L80A 1UIOA 1OQFA 1WE5A 4C6LA 3OYXA 2QMJA 3VABA 3WBAA 4QJ4B 2BX7A 2VDHA 1KR1A 1Q6RA 1LWJA 5D4YA 2RDWA 4FX8A 4H83A 3GC5A 2A79A 3W87A 3NM1A 1X6LA 5F2GA 1UYQA 3TC6A 2QGHA 3LI1A 5LA2A 1RBLA 4XSLA 2BHYA 2OX4A 3UP8A 3T9PA 2WQPA 3SZ8A 3AS1A 5IFPA 1GOMA 1YMYA 3N9RA 5CCZA 1RLDA 1UQYA 3F5JA 3H8AA 2YIHA 2HS6A 2FZMA 4WY0A 1TVPA 1P43A 1DWFM 3SUVA 3B9NA 1MXDA 3UZ5A 4U2ZA 5JUVA 1OF6A 4YN5A 1CENA 4KFNA 4A22A 1O94A 3SGZA 4MDPA 2PLJA 4YJ5A 1TSIA 4MB3A 4D6GA 5C70A 3FSTA 2XHYA 2XIOA 2XFWA 3MTWA 2ZUVA 1JZ6A 2HE5A 1N82A 4BHYA 5I3IA 4ZQPA 4D2JA 4CQBA 3FJ4A 1F4AA 1VCGA 1DJWA 3C2VA 1LRQA 4FO4A 3GNRA 1ADSA 2FB2A 1QNRA 1IR2A 1J0HA 3E38A 3G6LA 2W3ZA 1W37A 2XM2A 2XTKA 1XGZA 3NZGA 2X1UA 4YPJA 5LGXA 1TWSA 2YSWA 1VYSX 2C18A 1ITQA 5IDZA 4AMAA 2CLIA 3B9OA 1H3GA 2J62A 1SVDA 1VFHA 4S2CA 2CLFA 1J01A 5I78A 1JCXA 3NCOA 2VFEA 3WJXA 2Q3RA 3MV01 5ECVA 2OZ8A 4FOJA 3O6YX 4GJ1A 4PODA 3BE7A 1XD0A 2OT0A 4I7UA 3HPXA 3QQWA 1B5TA 1EQCA 2XWEA 4GQQA 3PTQA 3GNDA 2VENA 3CHVA 5MHBA 1AH0A 3JUGA 1GPWA 5KZ6A 1C9DA 4H2CA 2EG6A 3FS2A 3CAQA 1M3UA 2YKKA 4F2UA 5DY3A 3V5CA 4WQ6A 4WVXA 7TAAA 3KL3A 1Q5MA 1JR1A 4PSPA 4F0KA 2DP3A 5FJJA 4A3HA 4Y9OA 2C7FA 4LXFA 3GRIA 1X8FA 2WM1A 2YA2A 1ZJIA 2A3HA 3BJTA 4PMNA 3MBFA 1JL8A 1DWAM 4H1ZA 3VTRA 3WJWA 2ZZ2A 5C7VA 1MDRA 2WCAA 3GTXA 3IIXA 1A5OC 3AIQA 4LAKA 3O9NA 1U5JA 3EWWA 2PC4A 1JYVA 5LIXX 3S2NA 3WD1A 3FJNA 1ONRA 4LAUA 2CERA 3RG6A 1H7PA 2ZUSA 4IIBA 2Z25A 3VOJA 3PZMA 2JKAA 5BWFA 1CGYA 1E3XA 3BTNA 3W82A 4W8LA 1TZ7A 1BF6A 2VZOA 2BVTA 4XBSA 4L9XA 3TA6A 3B05A 4Z1BA 4QSHA 1NY1A 1Q2SA 1TTJA 4MWAE 5FD0A 3WD2A 1J2WA 4HNNA 1GUVA 1IIHA 1NDWA 2CEQA 4KCUA 4X22A 3EEGA 4PMDA 4V1YA 2PTWA 1R3QA 4H19A 4DBUA 2VEMA 4UOJA 2QCMA 1H5VA 3G8RA 1ZB5A 2E1WA 5EFFA 3QV7A 3WLJA 4CQ8A 1K70A 2ABBA 3R10A 4A2RA 5G4EA 1QOQA 2VZUA 2Z1XA 2E4TA 4KCTA 4JX6A 5DQPA 3MCNA 2HVMA 3I65A 1UKTA 2VGBA 4P7NA 3ZVHA 4AAJA 1TJ2A 1D3CA 3THDA 4LCSA 2C1GA 4C6KA 3I6TA 1G67A 2WZMA 5BMWA 1P7TB 2BXZA 3EPNA 3P7YA 3V35A 3U2EA 2ZUMA 1ZBVA 4MNLA 4WR3A 4RZ4A 2NUWA 4MYAA 3UR7A 2FTPA 5EGRA 4CN1A 1FHVA 2Z7GA 3ABZA 1B4EA 2JIWA 3AIBA 5AYBA 3NPWA 1E4LA 1SW3A 1BHGA 7ODCA 4BWLA 2W62A 3S2JA 2G3JA 4O0KA 3W88A 1I1WA 1CB7B 1US0A 1FFRA 5A2CA 1M9HA 1W1ZA 1KRAC 3QW3A 1KM4A 2PDGA 4HHLA 2FHCA 1QBAA 3V7PA 1WCGA 3UU0A 3A5VA 4D1IA 1PJ9A 2NWSA 3CK5A 2D20A 3GH5A 3L21A 3ZT7A 2WAGA 4JEJA 3A22A 4MGGA 3MI6A 1XLLA 4D6EA 3WEZA 4Q8OA 2C71A 2HSAA 4Q4QA 4CQDA 4IMEA 3M0IA 6TIMA 4E2DA 2QJIA 4MAVA 3NQ7A 3LZ3A 3NQMA 3IIVA 1WZLA 2EXOA 5DT5A 3QN3A 3QY7A 3TYBA 1ZQ5A 2QW5A 1JAKA 4QE1A 1ADOA 3WH9A 1K03A 4ICMA 4ZSUA 2GFTA 3EX1A 4KWUA 1EYEA 3PS7A 4PFHA 4C6BA 3GR7A 3F4WA 3AJ7A 3GXDA 4OHQA 1W9XA 3S4TA 3G1SA 4XZBA 2YXXA 2ACUA 2NW0A 1JJKA 4GPNA 1B90A 3Q94A 2Y24A 4JKMA 2GZXA 2FHFA 3AMLA 1W1YA 4GIEA 3R58A 1FCUA 3EWZA 3N4FA 3EXTA 2BHZA 3BV4A 4RZBA 2BODX 4HSNA 1HQTA 1WPCA 1XBYA 1CGTA 3OPSA 3ITLA 3RJXA 4JN8A 1E0XA 4AZHA 4OT7A 5AHLA 5DELA 4E5TA 5DXXA 1CB2A 2E09A 4QNWA 3QJAA 4QX4A 2PDCA 3GFXA 3NO3A 4K38A 5FJRA 3FSUA 5DF0A 2XGZA 4KMQA 4RE4A 1BTMA 1R9XA 1H1ZA 4I9TA 2FHBA 2RDTA 3RX3A 3RCNA 1ZSXA 4AZIA 3AS2A 4AF0B 1CECA 3MDUA 3MDWA 3N11A 3FAWA 3IGUA 4ML4A 3FGCA 2IPWA 1KGWA 4YMZA 1TYGA 4Q8TA 1DBTA 2FZ9A 4R33A 4PMZA 5E0CA 4E8CA 1LBLA 2ISDA 4A3RA 5FL1A 1EUNA 2QCEA 4E3TA 3LCHA 3HJEA 4KGJA 4GRSA 3BH4A 4RZ5A 4V2XA 4OJYA 4NJIA 1J6OA 5H2ZA 2FIQA 3VNLA 3DYPA 1HZYA 3CV7A 1KQYA 1EOKA 5GNYA 3PP7A 1QVBA 1UPPA 4LBSA 1W9BM 3T2PA 4EF8A 3KLLA 4NF7A 5A8GA 4UFLA 4YHGA 1J93A 3T81A 1JPMA 5D9OA 1KXHA 1S1RA 4B5VA 4FLRA 1NWSA 3HO8A 5CH9A 4L56A 3HOJA 2DT2A 2JBMA 1TB3A 5DCEA 4XAFA 4IJCA 2X16A 3ANVA 1A47A 3FYOA 4P7QA 2VI0A 1H62A 4J1OA 1OABA 3AIVA 1BQCA 1SW0A 3GNXA 2ISVA 4HMEA 3LK6A 2FGBA 1MI3A 1N8FA 3NQ8A 3ABRA 3GHUA 3M4HA 1LROA 4J3ZA 1GWJA 1CIUA 2ZE3A 3ZXWA 1GKRA 1Z7AA 2PWFA 4UZUA 4DWSC 4B5NA 2WM0A 3DYOA 3UD6A 1EO7A 4DIAA 1PWMA 4ZSTA 1FTXA 4MNKA 3CXOA 5F1VA 4F0RA 4TVDA 2HNEA 5J04A 2R24A 2V30A 3RCYA 1AUSL 3A5FA 3Q58A 1UKSA 4ZA0A 3HBLA 1MDLA 3XINA 2ZXQA 5JIPA 4U10A 3KRSA 1UD6A 3I6EA 1XFBA 1GOQA 1MQQA 2VD9A 3LY0A 4KWVA 4W89A 1OYBA 3M6YA 3LYEA 1KCLA 3PPGA 3TQKA 3W1QA 5CZ0A 2PWGA 3A4JA 1F2JA 4H6EA 2IQTA 4L65A 5K9CA 3WFAA 4V28A 1WZMA 3RO8A 1R9YA 2QF7A 3LBMA 4YS1A 3WF0A 3LTSA 1SJDA 1FWGC 1PDZA 3TVAA 3UXAA 3UXLA 5I23A 1HVXA 1QHPA 3OO2A 4XSMA 3P74A 5LNSA 3SDOA 4IFKA 1HJVA 4LALA 2CXEA 3VI2A 1VP5A 3TCEA 2ISFA 3NQ2A 3JU2A 4ALDA 3S1GA 4AX7A 1HKIA 3PG9A 3H4GA 4NYYA 4DEFA 4IL2A 4QDPA 2WJFA 4HP5A 4NRRA 4ZVJA 4XV0A 4A6GA 3WBXA 5B7ZA 3V1PA 1FDZA 3KHDA 4PCFA 3W23A 3J7HA 5J8LA 2HVNA 2BGSA 3QBUA 2V2CA 1K8XA 3LCLA 1BAGA 2BXVA 3LUTA 3URAA 4Q33A 2ZRVA 5HNUA 4KQNA 2Y70A 3OOQA 4UQCA 2ICSA 2GUBA 1AK5A 1TFVA 3ZJ8A 1CXLA 4Q7BA 2WKLA 1QPNA 1ZP4A 4OFCA 1RA5A 3S6DA 2PF0A 3QQ1A 1JPDX 1ZY9A 1IWAA 2OZTA 4JTCA 2W0UA 3FXGA 1J12A 3M43A 1OX4B 2J79A 4L4LA 5HXMA 4QAIA 3RM8A 2H9AB 1FWEC 2FB3A 3CHFA 1FWNA 3TH6A 1GNXA 4D6FA 3USZA 3NUKA 3B8DA 2Y7DA 3KDOA 4Z0JA 3I7QA 4DBEA 1GKPA 3E0LA 1TTIA 4NYUA 3W7CA 3G1AA 1A3WA 2E68A 2C13A 1P1MA 3RITA 1GGOA 1Z9AA 2OEKA 3W6LA 2XGBA 2VDGA 4XB3A 4B92A 4AZ6A 4LS1A 1BGGA 4JTAA 5CZJA 2D69A 3N2MA 4GYFA 1XIGA 1TV8A 3T0DA 5CSUA 4V33A 4JIIX 1PPIA 1CCWB 2R1NA 1KW1A 3DOPA 5CPTA 1XX1A 1BXNA 4NRSA 4ZOCA 3WDRA 4PMQA 2J7DA 1V51A 3M0HA 2E5DA 1ITCA 3W0KA 4G7EA 5BOOA 2DQWA 3CMFA 4W9TA 4GNKB 5DXYA 1AMKA 5I07A 1YEYA 3GG0A 4PRRA 3QZEA 2A7PA 4AWSA 1PKYA 1SFSA 3BQ5A 3V0UA 2VKZG 3CZGA 1F61A 4Q4SA 3VVGA 3VZYA 4ERGA 4QSFA 3LMZA 3DUGA 2CHOA 2Z1KA 3NG3A 1Q6GA 4DXXA 2CC0A 3C0SA 4R7WA 2FGLA 2CBIA 1JGIA 2PD5A 3WQ6A 2NVCA 1G4TA 4CEXC 3ZIZA 1OFDA 2DORA 2QNEA 4CN6A 3P5YA 1EHAA 3CV1A 1J0YA 1GJUA 4Z42C 5MKGA 3MVIA 3JR2A 5C55A 3PUOA 4LH8A 4GUIA 4AVNA 5TF0A 1XF0A 5DFAA 1QI0A 3A3WA 2NT0A 2D2OA 3W86A 1V3HA 2DZSA 2QCNA 1W17A 4I7WA 1I2QA 1PYMA 2A2IA 3W1NA 2XVNA 4N9DA 2FMOA 4P8UA 1I0DA 3NNTA 1JDDA 4KEVA 5F4XA 4DJEC 3SSZA 5K9DA 1AQMA 1E6XM 2UV8G 1PHWA 3Q2DA 1X8CA 2F2HA 1F73A 1GOOA 1QPKA 2VFFA 3KE0A 3N2BA 5FESA 4UMCA 4K3ZA 1B54A 1PZ1A 2V5BA 2BV9A 2WSKA 1QO2A 2EF9A 1H1NA 3F5KA 1KM2A 4XVDA 2Y88A 3GU9A 1HVQA 4TTUA 2GVYA 5FF4A 3UYIA 1VHCA 2W66A 5CJNA 4HA4A 3ITOA 1IR1A 4DM2A 1XBXA 3N4EA 1B57A 2QCLA 4YL2A 3NPXA 3FIGA 3WZ0E 1XCXA 2QXWA 1TRIA 4C60A 2QHAA 3U2ZA 4TMCA 4HZ6A 2XH0A 1J0JA 1O7AA 1SJBA 4O12A 1JZ4A 4L1XA 3S1WA 3B4YA 4MLJA 1BWKA 1F4HA 5KZDA 1LBFA 3WQDA 2F61A 1Q7MA 2WNZA 3SBFA 3VNDA 3A4XA 2PS2A 3ZM8A 2GGEA 2RFGA 4PBGA 4PMVA 1W6TA 3M9YA 3A9BA 2OT1A 1OX5A 2YCIX 5F1UA 1LUCB 2WLYA 4N2YA 2H90A 4J4KA 2C91A 3ZJKA 4GUHA 2FFIA 4QDMA 1EKOA 3UETA 1A5BA 4CNOA 4JR5A 5ABGA 3UNTA 2CLLA 3WUFA 3VXGA 1OYAA 5EMMA 3WQFA 1Y5VA 4YLWA 1TWWA 4HPNA 4ZXLA 1K4GA 5HQLA 4HNUA 4RNFA 3CZEA 2W63A 4ACZA 1KXQA 4W84A 1PKMA 3CO4A 1ZGDA 4H9TA 3RX4A 2VYOA 3N3MA 1XV8A 1AJ0A 4GVIA 1O12A 1A5MC 4RDYA 3H55A 3PB0A 2PC8A 3BSHA 1E0UA 3BL3A 3VNZA 3APTA 4JIEA 1IT0A 2CFFA 5TNVA 3VIJA 2JGQA 2J7GA 2WVTA 1XLJA 3G22A 2CW6A 3A12A 4JY9A 3RAOA 3NOYA 4WCJA 3TC7A 4DJDC 2UY2A 4TIMA 4RX0A 3OQ8A 3BCJA 3LPOA 1V4YA 3CT7A 3GIQA 1D9EA 3AALA 1ZU8A 1B30A 1RAKA 3B9DA 3KWXA 4MKSA 1UHVA 1UIPA 4LBUA 1S1PA 3CUZA 1HJWA 2NUXA 1NWTA 3PC0A 2REQA 2QDGA 3IGSA 3M0JA 1NOWA 3QEZA 4ZOBA 5IHRA 3DBPA 5D30A 3ITTA 2VZTA 1EEXA 1O5QA 4V15A 1IT7A 4IGHA 2V5JA 5G1TA 5KEZA 1H11A 3JZUA 3GO2A 3W37A 4MJ2A 2XFRA 4DXVA 4CN4A 4B5WA 3I3DA 4Z2IA 4G2DA 4JHZA 1Z44A 3DESA 2BSLA 4X0NA 1REQA 4KESA 1C92A 3L4UA 3LS9A 3K13A 1F7BA 1DJZA 1RJPA 1JD9A 1ZALA 4JD4A 3EOOA 1OX4A 4GZIA 1L6WA 3CQIA 3P0XA 1JI1A 4PUDA 3ZJ6A 2I5QA 2J8TA 3V18A 2DV0A 4DZHA 4Q22A 3BGGA 4WUIA 4EVZA 4BY3A 2DIJA 1VB9A 5E0KA 1DXFA 1OIMA 4I7VA 3M44A 5CPSA 1BG9A 3JZEA 3SY8A 2BFGA 3SQMA 4HA1A 1YPFA 3MW7A 4ZQOA 1ZTVA 1NAL1 2CIPA 1WDWA 4O50A 1J18A 3HF3A 1XJBA 1J8VA 3M0MA 3P14A 1M03A 4RKAA 3POCA 1WDDA 4X3ZA 4U3AA 4ACYA 5CEWA 1TE6A 1LL6A 2YBUA 2IKJA 3S0CA 4OIFA 3VUSA 3TAOA 4ATLA 3C52A 1S38A 2EO7A 3TNOA 4AWUA 1XYMA 5AFDA 1QPRA 2I7GA 4M24A 1IGSA 2FPYA 1MQPA 3T0TA 2GWGA 2EPLX 3NAVA 3F2DA 2PDPA 5EKYA 1VFMA 4CNTA 3GR4A 2WMGA 3RHGA 1BGAA 2G3IA 3CNYA 5BRBA 4IGNA 4IQJA 2Y7EA 1W9UA 1NP2A 1JVNA 3HG2A 2D0FA 3PK7A 1LM1A 2NT1A 5A95A 1VJIA 3GFZA 1W31A 2VFGA 2BHUA 1JG9A 3NQAA 4AD5A 4FNTA 2G4JA 4AFYA 2ACRA 1LWIA 1YXCA 3ITVA 4UTFA 4I5RA 3BAYA 8RUCA 3U7VA 4FK9A 2Y6ZA 3EOSA 1NP0A 5E09A 3APGA 5F2LA 1AH3A 3M41A 1VIZA 2XSBA 1SJCA 3BOFA 4JQAA 3S1UA 2G41A 1WDRA 4P8XA 4TX6A 2MUCA 2A3EA 3ID7A 4XAGA 4AZCB 2Q02A 2V2DA 4PUJA 4ICCX 1SSDA 4FLQA 3QH2A 4GK8A 4PSRA 5F4SA 2PDIA 1OG6A 2Q8ZA 2PTZA 5FKYA 1CXFA 3FCPA 4ML9A 3KW3A 5I6SA 2PWVA 4WSJA 3P60A 5HAOA 3M46A 1UKPA 2ZX8A 1E0TA 3CUHA 3V1HA 4B90A 3MI3A 4WRHA 1PEZA 4E2VA 4C6JA 2DVUA 1F5ZA 1L6GA 4REQA 5E93A 1OCQA 3ZS4A 4UTMA 5FAGA 2ZKMX 2ZX9A 3MA8A 1W1B1 3FOKA 5FSDC 1HTIA 1XIJA 3XISA 3GTIA 3PZVA 3T09A 3VD4A 1MW2A 3WUBA 3CJPA 3FYPA 4GQBA 1L6YA 4UCGA 5LNVA 1GQLA 2WANA 3UG4A 4GFIA 4JTLA 4JCLA 7REQA 2G8ZA 2WMJA 1V0KA 3WQVA 3THUA 4EIVA 4GE8A 1EWDA 1Q6OA 1P6CA 1DOSA 1VEOA 3HPFA 3W75A 2ZTKA 1FFQA 3W71A 1MVYA 3G0UA 3V0SA 1S2VA 1J0IA 4TMBA 1AZ1A 2ZE0A 4Z2KA 2OYLA 3GIYA 3GKFA 2DZBA 4MPKA 3S6TA 1D8WA 1RCOB 3R1ZA 3W84A 4H6KA 4L1WA 2VUYA 5HINA 4AD0A 1VCFA 2EPKX 4F0SA 2G3NA 1AD1A 4JIPA 3W29A 3AWNA 3GNPA 3QRHA 3S5OA 1LORA 3R7MA 1BEUA 3I6RA 1A4MA 1BSIA 1UR9A 5CJ5A 2GGJA 4MY9A 4J3XA 2ZA1A 1MSSA 2DZWA 1BYAA 3LNPA 5EMKA 1IXNA 4PBFA 3DHFA 3Q37A 4GKLA 3M0KA 3QFWA 1E9YB 1IZKA 3W85A 2A3BA 4WF7A 4FR6A 1NJJA 3VKCA 1KLYA 2WHKA 3EKZA 1WXZA 3SECA 1JYXA 3HIJA 1MFVA 1J0ZA 1JZ8A 2YDRA 1LT8A 3RYSA 2WMHA 1E55A 3AMCA 5DO8A 1UKQA 2DSVA 1XIEA 4PCSA 3DH7A 1UD3A 3RF9A 4R5EA 3ZSTA 1E5NA 2J7BA 1VBGA 4DWDA 3UCDA 1VIWA 4E8GA 2HROA 3SGUA 4LYQA 5HWMA 3OJGA 2AL2A 2Y63A 4QCFA 2EPHA 4UTJA 1H0IA 4NAEA 4O8AA 4RNIA 5BROA 3HV8A 3NTYA 1GW1A 5H8PA 4JL2A 2GQAA 5FA5A 3MSGA 3PVFA 1JUEA 3SUTA 1U5VA 3ECQA 2B4GA 4UQAA 4BWLC 4M0XA 5CPNA 3TLQA 1W3LA 3S8HA 4NJJA 1P4CA 4JY8A 3U4FA 4WY0F 3HQNA 1AQFA 3B4UA 3WNOA 3NGJA 2XISA 3Q65A 1E1FA 1E0VA 1NDVA 5FJTA 2OCZA 2G5WA 3CTTA 3W00A 2IQDA 4GFSA 1QT1A 1EX1A 4UOQA 4K1GA 3VIMA 4H41A 1HG3A 2BOEX 4PCPA 4EWND 5HOSA 4YWSA 3WLOA 3F4DA 3H7VA 3SN4A 3JS3A 3CHCA 2BVDA 1AQHA 3LERA 8XIAA 4HK5A 2ATSA 2QJJA 3N04A 1PBGA 1EDGA 2QR6A 1ML1A 4C1NA 4X9SA 1BG4A 5IBXC 2WBKA 3W01A 4HZ7A 4FXSA 4HSHA 4H7ZA 4FP1A 7A3HA 2A1YA 2PTDA 3LZ5A 3WYZA 4JEQA 1SU5A 4DBWA 4YXGA 2B81A 3PNUA 3UT0A 2HS8A 2J4GA 3P84A 3A24A 3OBEA 4M7TA 1NQ6A 3QHOA 3BMVA 3W6YA 3IIZA 3CL7A 3N13A 4DAIA 4MFDA 3GE7A 2BDQA 1FBAA 4MLRA 4NHVA 3VX1A 4J2PA 2XN0A 4KPLA 1HJSA 3AXHA 3IVUA 4A2SA 1BVZA 5I3DA 4GY7A 3T7VA 2HPMA 2ODOA 1PZ2A 3FV9A 3ENLA 4CGTA 3B0VC 3H4WA 2XPKA 2OYMA 5U4NA 1E43A 3N6HA 2BNJA 2X1TA 4H9XA 4OVXA 3T0BA 3BJFA 1OD0A 5FF3A 4E8DA 1XLFA 3VIPA 1OZMA 2Q6ZA 1TPH1 1DWIM 2P53A 3LRMA 3R8HA 3S9YA 1XISA 1S5NA 3M0LA 3LDVA 3DFPA 1AA1B 2WPBA 4AC7C 3GFYA 3PZIA 2ASHA 2XSAA 4IJBA 2D0HA 1B3VA 3QMRA 4FNSA 4FIQA 3VYLA 4JN6A 3LOTA 3GVVA 1PE1A 2OGJA 4PRTA 3FLUA 5U7SA 4BF7A 5HR6A 3CYVA 4P61A 2CESA 3MUCA 3N25A 4IFKB 3QYSA 2VFDA 3QR0A 3OZMA 5HJYA 3S5YA 5IOBA 3CS2A 4LQ1A 4PULA 4QG6A 4AIBA 2YDQA 1KM5A 3K8KA 3VKJA 4O4WA 1M7JA 4AZ7A 3EKLA 1TG7A 5K7JA 5T91A 2JIEA 3C2RA 3C0LA 2ZWZA 2YL9A 4O1FA 3QVQA 4GUGA 2HQAA 4U3CA 3BAIA 3UWQA 5RUBA 3Q67A 1V7YA 2YDSA 3PZOA 5L9FA 4AHPA 2XVPA 3ZR5A 3I10A 1FXPA 2OLHA 3VNMA 1GEQA 2G95A 3BOLA 1VPXA 1MYRA 1XLMA 3SY5A 3DYMA 2DU2A 2NX1A 4HKPA 3QKEA 3L7RA 5CBJA 3A6OA 4HT3A 3USBA 3G1RA 2ZZ3A 1LRTA 2GL5A 4N6EA 3H22A 3C4UA 1EXBA 3AZTA 3VO0A 4BQ4A 8TIMA 1IEQA 3TW9A 3CGTA 4PMJA 1XYZA 2TMDA 4MJZA 4RZ6A 3DIPA 3RU8X 1A5SA 4XZNX 1QWKA 3PWIA 1TV3A 3R12A 5H91A 3S1VA 1PYFA 4B5TA 2UY5A 1L6FA 4GCXA 2PGRA 1OGBA 4DLFA 3MHUA 1I1XA 3OIXA 4N9CA 3NSNA 4IIHA 4GQRA 4G56A 1T8QA 1SMAA 3CO8A 3L2LA 3UR5A 4C6PA 5D32A 3MSDA 1KM0A 4PN2A 3KEHA 4PEKA 2JEPA 3BCFA 3OLGA 1QJWA 1OGSA 2RDXA 2NVDA 1F3TA 3VE9A 3NR0A 2GSEA 3BLIA 3ME3A 1TVLA 2O0TA 1H63A 4UFKA 3R13A 3T2OA 1W3IA 3RM9A 5C2XA 3KWSA 2FTWA 3AYSA 1QU4A 3EWYA 4S3EA 5AHIA 3S2CA 1KA9F 1ISYA 4JYFA 1W2PA 2PDHA 3L0GA 5G2WA 1VKFA 4D8ZA 3F4NA 4M80A 3M5VA 3SRFA 5H1WA 2XIIA 1QHOA 4ORMA 5KINA 3AXIA 5G1YA 3R4IA 1UCWA 1XIHA 2QCDA 1XINA 1DIKA 1Q6QA 3O6CA 4O53A 3WDIA 3WQEA 1NFGA 3HGSA 3ARXA 2VJXA 3L4YA 4XD3A 4AX6A 3H2NA 1TE1A 3GDMA 2FVLA 2PDXA 3PBWA 1UR2A 2I9UA 5CSYA 1R5YA 3LHVA 5EU9A 1EC9A 5DLCA 4H4IA 3ANUA 1K8ZA 4AC1X 1IWBA 3VOCA 3VMNA 2CZVA 4QDWA 1EOMA 5JQ9A 1FKXA 3KOFA 3HQ1A 1YTDA 3M7WA 1CLXA 3CZLA 1XW8A 1Q8AA 3OLIA 4BI7A 5AHFA 1X7FA 3VCNA 2R82A 5DBTA 1P0EA 5D05A 2V38A 3VIHA 1MZHA 1XR2A 4R3UA 5A2BA 4ENLA 2DIEA 5XIMA 5C9UA 4W87A 4PTNA 2FQIA 3ARPA 4WXYA 1N8WA 3V75A 3E6EA 3VD5A 1ZRQA 4NZ1A 3GHSA 4EAMA 1F07A 3BLPX 4Y8EA 2RH9A 1H7OA 3K30A 5T8GA 3EXRA 1R2SA 2UWFA 3DC8A 4P2VA 1WOAA 3QOMA 3GKAA 3O0KA 4AYGA 2AQOA 2XJ7A 2FTYA 3ALGA 3OLDA 1QI5A 4GXWA 3V36A 4P5UA 1ICPA 4Y9PA 3BAKA 1GG1A 3SIMA 4OV4A 2WV8A 3UGRA 1AH4A 1FCQA 1RJQA 4JNMA 1EC8A 3UEQA 3IV3A 4WLCA 4FI4A 3S46A 3CQ0A 3PFMA 2VNCA 1ZBKA 2O4MA 1ICQA 3CQKA 3M1ZA 1JEZA 2UY4A 3VFLA 5G4WA 1W1A1 2NQHA 3QC3A 4RJEA 2P0IA 1AD4A 3RILA 3W1UA 3GG7A 4GVHA 2QJHA 3W6MA 1JRBA 4D6DA 3U5UA 4GX8A 4ZENA 4JDBA 4QLJA 4RCXA 4AQLA 3STCA 2RKXA 1T5AA 5IRPA 5HATA 1SO3A 3BLKA 1EUAA 3MWAA 1TPUA 1UQZA 1MNZA 1K02A 3THCA 2ZRXA 3IK2A 4F2TA 1HW6A 1VBUA 3IARA 4H9MA 4AD1A 4B3ZA 3EMQA 3L0KA 2PGWA 2PP0A 4O18A 1IXQA 3DDMA 4ZR8A 4IT1A 3THQA 1JI2A 1JZ5A 4YTRA 3HG5A 1PKLA 3H7UA 2VZSA 1XWYA 2HBXA 2ZCGA 4PEEA 2OQYA 1I75A 3MO4A 1IV8A 1WKFA 4CCCA 4XX6A 1JNDA 2YX0A 3FKRA 1TMLA 1UWTA 1Z6KA 3LBOA 3W7NA 4DRSA 3VKKA 1DJYA 4QIUA 4C1KA 2PDLA 1E6PA 5CC7A 4GIYA 1V0NA 1ZUAX 1SZRA 2GGGA 3LSCA 2CXGA 1QFEA 1H41A 2J88A 4LUTB 2A21A 2GOKA 1H7XA 5TBOA 4UTHA 4LYRA 1THFD 1PL9A 3SUUA 4ILSA 4EANA 2ZZ4A 4B5SA 4HMNA 3CZ8A 2P8CA 4UR7A 3MYPA 3LXAA 1YNYA 3H7RA 1LRNA 3PB2A 4O10A 5JIWA 3NO1A 2ESCA 2J7CA 5AVNA 4B5UA 5C5YA 4ZTYA 1HUVA 1B9BA 1R38A 3WD3A 3UPWA 1CNVA 3R0DA 3UWEA 2XYLA 1T40A 3KCJA 2OELA 2NUYA 1BSLA 2DVXA 2VQTA 5CXPA 3PZNA 3W25A 2EPOA 2OU4A 4C1NB 3WQGA 4O1DA 2YCKX 2E9MA 1RZMA 3D3AA 4WHBA 1SMDA 2PLMA 4QE4A 2IKIA 4CEUC 1GZGA 5I00A 4LANA 1XLDA 4EPBC 4Z17A 1V02E 2O56A 2WB5A 3TP4A 2X40A 1XICA 2J78A 3GTNA 1DE6A 4B91A 3V5OA 5BXTA 1UB3A 1AJ2A 2DSZA 3O63A 1GYNA 2VX5A 3BLOA 1JUKA 3WK0A 1JIBA 4A8NA 3UPMA 3IACA 4HMCA 5C9ZA 4XKMA 2EAWA 4O16A 4Y2WA 2NX3A 4BFAA 1VENA 5D04C 3M07A 2GJNA 5KETA 2VCCA 1TPFA 2DGAA 3DENA 2WNWA 3CYJA 7TIMA 4X60A 1GHRA 4BI6A 1GYLA 2VTFA 1KTBA 1J10A 2WNNA 3U57A 3GXMA 4HJWA 4I9JA 4LGXA 1G94A 3FFSA 4H04A 4NAFB 4UXDA 1DJHA 3TV8A 1Q65A 3SQSA 5TAOA 3IUDA 3OZYA 2FPVA 2E6FA 4KFPA 3PPFA 3HN3A 4Z2LA 4X2PA 5HWJA 4C6DA 2DUZA 1MUCA 4HYRA 3NDOA 3IUHA 1XDLA 4LYKA 3GC2A 4D6JA 4Y8FA 3N6QA 2J8GA 4GXMA 4H3DA 4ROQA 5A6MA 1OFAA 4GUFA 2OQHA 4GKTA 1OT2A 1VRDA 3VUPA 3EMZA 1UZ4A 4DHGA 5REQA 1Z89A 2X41A 2FDSA 3LQGA 1QO5A 1FDJA 1X1OA 1U22A 2ZBTA 4OE7A 1KKRA 5LYRA 1FCBA 4RXFA 1E73M 1I45A 4QTGA 3H24A 3DKLA 3NL6A 3LHYA 1CGXA 4NX5A 5BZAA 1REQB 4E0CA 1LL4A 3LM3A 4F66A 4WX2A 1QW9A 2V82A 4DNMA 3GUGA 2HEJA 1HJUA 4NIRA 2W91A 4IMCA 3POHA 5DN1A 2HBVA 4PL2A 1DHPA 1F3XA 1HL9A 1A5CA 3YPIA 4YCOA 3HA1A 4H9ZA 5CQ1A 4QITA 4FB7A 1R3TA 1PCWA 2Y61A 2YL6A 3EB3A 1XLEA 2D2JA 3GDTA 1EPVA 4UFHA 4XZ9A 1V6WA 3K46A 3FX4A 1BVNP 3CTLA 3LCIA 4BR1A 5FEZA 4CNSA 5D8WA 3O1NA 5K3VA 1OBAA 3ARYA 1H50A 1ZL1A 1OCNA 3E12A 2B7PA 3NQDA 1LQ2A 2WZIA 2Y5EA 3Q45A 4M7SA 4LF1A 4UTUA 1EB3A 4Q8MA 2E8ZA 2V5DA 4HCHA 4HPHA 1WDPA 4IMAA 3WF2A 5I24A 3QHNA 1FWJC 4RDZA 1F74A 3C0JA 3E0IA 1SGJA 4L9YA 1XIIA 2UBPC 4UR8A 2HV5A 3D47A 3FJLA 4ICNA 5K9XA 5GVJA 1LP6A 3BPWA 4XD5A 3H70A 3GW0A 1FQ0A 3CEUA 5BXSA 1QDSA 4DXKA 1P48A 2I5GA 4Q8PA 2PWUA 1C91A 1WOBA 2Y7FA 3P8JA 2J47A 4GWEA 4IUGA 3ZZ1A 3QY8A 2HDJA 2V5CA 3EA1A 1WP6A 3KVMA 3MV11 3W74A 4KRZA 4FZIA 4JICA 1ZAJA 3U8GA 1BYBA 3VX0A 1KCKA 3A3XA 4TOQA 4NZ4A 1R2TA 1R86A 4S3BA 1HKWA 1XG4A 3UG5A 3WLNA 3DCPA 3HG4A 4IPIA 4C7GA 3VGDA 3VM7A 5C2GA 4GC4A 2YJQA 1M65A 1GVIA 3WD0A 2E8YA 1XSKA 2JQXA 2QAPA 4E4UA 3UJEA 5LZLA 5KMYA 3K4WA 4PE8A 3SM0A 1FVPA 1UA3A 3LCFA 2VT0A 4QS6A 1H09A 3GVGA 4HPJA 4I3GA 5HDRA 2O9TA 3VNYA 1RBAA 3QMTA 4RXGA 3G3DA 3TTEA 3RNDA 4UMAA 4BF9A 3MPGA 1YIXA 3D0CA 2Q71A 1GOKA 3NA8A 1IEXA 5FJPA 3BXWA 2PDMA 2QCFA 1B3WA 2XIQA 8A3HA 1V93A 2CZ5A 3IEBA 3F5LA 1FUYA 3LXBA 3NQFA 3EX4A 4QISA 1VFUA 1J79A 3FEQA 2ANUA 1Q6EA 3HV9A 2OSXA 4KRTA 2Z29A 1KV5A 2VC6A 4DM1A 3BG5A 4NAFA 1MEIA 3IJ9A 2R14A 3M5YA 5I7GA 1TA3A 2V8ZA 3VIGA 4CU8A 3MUIA 3KFTA 2E25A 2GQ9A 4E2BA 2QUMA 4JBRA 4HYWA 3MVTA 4BEUA 1V79A 3EA3A 1WV2A 3ATYA 3WQWA 3SCQA 3R79A 1NQKA 3AZRA 4YIWA 3CEPA 1MRQA 4DPPA 2WNQA 5AC7A 1PWLA 3LHTA 5ECUA 2QCCA 2VQUA 4GVFA 3MI2A 4GNJA 3PTMA 4R27A 5BCAA 1CW2A 3N34A 3P61A 3G77A 3ZO9A 4UNIA 3ONBA 3G18A 3BW2A 1ZS2A 2X2YA 3WMBA 2NXHA 1ECQA 4GI6A 1UH3A 4JNZA 3EOLA 4U2YA 4KIRA 3WF3A 5CSSA 1XGEA 5LGZA 2XIJA 3T05A 2X05A 3MKKA 2O9RA 1T8XA 1NDZA 1PTAA 1NU5A 4F0MA 4WD0A 2BY1A 3UZXA 3W1AA 2OOFA 4D6HA 2H6RA 2G3MA 4JS3A 4O57A 1ISVA 2CLHA 4GYKA 1OY0A 5LIKX 5JBFA 5TIMA 1OWQA 3KOZA 4DO7A 3VFCA 1FY6A 2FLIA 3SURA 1SW7A 1JCLA 1C8QA 3CPRA 3DFHA 3H2FA 3CV2A 1TTQA 3HMCA 1C93A 1JGMA 2Y8UA 1A50A 5HK4A 4HNVA 2V67A 1EZ2A 1S5VA 3E5PA 2F6UA 1W0MA 1OK6A 2B0MA 1SZFA 3KP0A 1ZBWA 4MIMA 4GVGA 2J75A 1DIDA 4G5DA 3TWAA 1TIMA 3B97A 5DX7A 1EQPA 3LTPA 5JBDA 1LWHA 5AYYA 4AIEA 1EYWA 3GVRA 3EYPA 2DJXA 1RPXA 4WOZA 3KDNA 1XLKA 1W3TA 1D3HA 3P0WA 3W1RA 1WO2A 2BGNE 1TWZA 4KRUA 1XBZA 2OOGA 2WYSA 3LGEA 4XUYA 1HF6A 5EMLA 3NQBA 3C3NA 3WK1A 3L0NA 4MF4A 4PTDA 3O07A 3QZ6A 4B2DD 1J5TA 4IFRA 5KSWA 5HANA 4LF2A 4FOKA 1QOPA 4RE0A 2CHNA 1NFBA 2GQ3A 2QS8A 1ESWA 2GK1A 2WVVA 3GXNA 4K1WA 3BANA 3W02A 2DQXA 3GXTA 3NPVA 3FNDA 4FLSA 4GCAA 5I77A 4MWAC 1TJ1A 4IISA 4J3VA 1C7SA 2GVLA 5K4ZA 4A8LA 2E0PA 1A0DA 1PB0A 3N4AA 1JZ3A 3NL5A 3VINA 1XRVA 3MMDA 3CPGA 3K2GA 2O4QA 5ENLA 1YE4A 4S3JA 3G0XA 3S3GA 2UY3A 4JL1A 1IEIA 1JDCA 1IXPA 3GC4A 3IV8A 1Q6FA 5GJMA 1V7AA 4PA8A 1XXXA 3FA5A 3W2JA 4MY1A 4O14A 3WDQA 2C14A 4AISA 3E02A 2YCEA 3CB3A 3P3BA 4HA0A 2P0OA 1E56A 3W7MA 4UC5A 1KCZA 2OLSA 3CM4A 1QPOA 2YGYA 2WHJA 5JXQA 3LV5A 1X6NA 4A3YA 3H2MA 1HL8A 3BLDA 3APYA 1KBKA 3RJYA 3WELA 5DBUA 1YXDA 3SCUA 4PC8A 1Y5XA 3KP1A 3C3UA 3L67A 1R7OA 2J77A 4PZVA 3C8FA 1IZCA 1JXKA 1C8YA 3LG3A 1HT6A 1R47A 4HHPA 3WENA 1AW5A 3RLUA 4G8TA 3WLRA 2G4FA 4Z1CA 4FXFA 1R3RA 3AIEA 3DFNA 3OEXA 4IL0A 1KRMA 1ISXA 2RUSA 2CBUA 4RW3A 4IP7A 1EL3A 3R25A 3MO7A 1BRLA 4Q4KA 4S3DA 4LNCA 5EFDA 3DXIA 3VCRA 2W27A 4QEHA 2DSWA 3ERPA 1ZNNA 1A53A 1BKSA 2I1OA 4XAZA 3UR8A 3VK5A 1YDVA 3AUOA 1UWIA 2CLOA 3LNMA 1OC5A 5M3WA 4H7CA 1B3XA 4UQ9A 2ZZ7A 6TAAA 4K8HA 1UH4A 1VYPX 1XYBA 3G8EA 2GGIA 4S3AA 3BVJA 1KBJA 3M0XA 1V3JA 3C0QA 4Z2GA 1FWRA 4K8GA 3WLQA 5C0QA 3RDKA 2A5HA 3WH8A 1A3XA 5D8ZA 4NX0A 1Z48A 4LBRA 3UR2A 3ORWA 3H2OA 4QGCA 2Q3OA 1E72M 2VRKA 1AW2A 3MCMA 3SIZA 2PRHA 4YCPA 1E4IA 1W54A 1V6YA 2QDDA 1G6CA 1S2AA 1EJRC 5D2VA 1OFBA 3WQ5A 1I0BA 3AISA 3PG8A 1G5AA 3PBGA 2Q01A 2Y0FA 3PBUA 3SFKA 2BG5A 4MAZA 2BMBA 4XKYA 1XLCA 3CPUA 2P10A 4ZFCA 4Q7IA 1TV5A 3GDLA 1VBRA 4NUWA 2WSYA 4IIDA 1A5KC 3FVMA 3ONCA 4Z08A 4FXRA 3ITCA 1W5PA 5H8MA 3GBDA 3UA3A 3UZYA 4L4OA 1JCJA 2D3LA 2AAMA 4L6DA 3G6MA 1DQUA 2OTDA 3MANA 3BV7A 3ZQ9A 3SR7A 1K3UA 2YXOA 4MUPA 1ONXA 4LS2A 1Z3NA 1K9TA 4Q7NA 2HK1A 5DT7A 1IWPA 2PDKA 3OGSA 2ZQ0A 4DBSA 5FJOA 2EJAA 3SO7A 2GJPA 2YLAA 1KXVA 4D6IA 4LB3A 3CIVA 4JTIA 3ZWTA 4X61A 4YYFA 4NP7A 4JTDA 2JK2A 3B0UX 4U28A 4AIUA 1QK2A 1PX4A 2H9AA 2XH2A 3G2GA 3GNOA 2X1SA 5AYIA 3ES7A 3KOYA 2GSHA 4YYCA 1UP0A 1QNSA 1CGWA 3PUGA 4MTVA 5REQB 2WVUA 2RDUA 1GHSA 4LPCA 4HOWA 2G96A 1W3KA 2WCSA 1XPYA 4O1EA 1GOXA 2E67A 3VIKA 3IK4A 1FHUA 2YL8A 3KBWA 4HTBA 2QV5A 1CTNA 5GNXA 3FJ6A 1UG6A 6REQA 3L4ZA 2X09A 1HP4A 3U48A 4E6MA 4HYVA 3IJ8A 2JALA 5D2TA 3RM4A 2Y4SA 1OC7A 1R46A 2YB1A 1TKKA 3HFTA 3OLEA 5CKSA 3CAVA 3ELFA 1E1EA 4XZIA 2Z26A 1XSJA 4F3HA 2FZ8A 3LHWA 4HA3A 1X39A 5BRPA 3VIFA 1Y7VA 4ZFMA 3CBWA 1VFFA 2J7FA 1ZP3A 1CXIA 1V6XA 2FMNA 5AHEA 4IIFA 2PRLA 1CXEA 2C6QA 4TU1A 4GY1A 2O55A 1UWUA 1R3VA 4R9XA 5BYWA 4CKQA 4XWUA 2HXUA 1KQZA 5D33A 2ZDRA 4LUSB 1V8EA 3CZJA 2XDFA 3KAOA 2VR2A 5HR7A 3RCMA 4C5ZA 5EMUA 4GXPA 1ELSA 3LPFA 3QQ0A 4N42A 4ZO7A 3O2LA 2DSUA 3QGKC 5GJPA 3NL2A 1HKVA 4MSSA 2X30A 2YCLB 4HN4A 4DY1A 3KL0A 1EIXA 2WMIA 4CCEA 2CKSA 1O66A 6XIAA 1S2WA 3HQOA 1XHGA 4HU0A 1M6JA 3W7QA 1GK8A 4WGXA 3IUIA 3LPPA 1YQ2A 2G0WA 2F84A 3KUMA 1OYCA 3HURA 3VKDA 3UCQA 4HNLA 1JQXA 1O1ZA 1EDQA 4WKFA 2PDYA 3GB6A 4OKDA 3RFAA 1GVOA 4IICA 4IG2A 2A4AA 4NZ5A 3A9IA 1XM3A 2IUZA 2PWHA 4J35A 1PIGA 4L5ZA 1UOKA 2WO5A 3N9SA 4FNQA 3R5EA 5LIUX 3CUJA 3CAKA 1ZZMA 5AOUA 3E0WA 8CGTA 4K39A 1W5QA 1OT1A 2ACQA 3WK2A 2BLEA 3OHMB 2OG9A 2Y89A 3MYOA 5AECA 2XVGA 1DJQA 2GJRA 4P8VA 1JPKA 4AHOA 3M64A 3WMSA 3K4DA 3MHGA 1EIBA 4UTTC 4PMXA 1OK4A 1FH8A 2J6VA 2CETA 1FCVA 3ZR4A 2WMIB 3EX3A 3E2RA 2LLEA 3DFTA 3VGGA 2ZRUA 1JDFA 3LMYA 4AVFA 1MMFA 4B2DA 5C9RA 4IMFA 1YBQA 4MMWA 4U5KA 3DI1A 1VLIA 3WLKX 3UVIA 2NLIA 2QT3A 1NOUA 3FKKA 3LV6A 4ES4A 4ZMGA 1XI3A 3MS8A 1PCKA 1WBJA 3PZUA 3B8UA 5A6BA 2MANA 3SCWA 1EDTA 4QJ5B 4Q6XA 3SI9A 3WN6A 1XYAA 1WDQA 1GVYA 1GONA 1TA3B 3SW6A 4AG0A 4K2SA 2IXUA 4CCZA 3R8GA 4MNJA 4E38A 5I3HA 4ATWA 1PV8A 3SY1A 2QZRA 3EBVA 4HSOA 3D5HA 4AWTA 5A8NA 4POCA 1TR9A 3E3HA 2FZBA 4U5IA 1XL9A 2OQLA 4PMYA 5FACA 5K4XA 5I0DA 4N7QA 3WJSA 1FDYA 1Q7QA 3AI0A 4MHBA 5IM51 5EY5A 2VWTA 3A4WA 1KTNA 1G7UA 3VM5A 3B3DA 4DELA 3PAOA 3QTGA 1G01A 2D3NA 1RCQA 1XIFA 1T6MA 1WUEA 1MEWA 5AVHA 3L4XA 2D23A 3GH7A 4LFYA 1IEVA 3WH5A 1UWRA 2NQ5A 3IWPA 3HPZA 3KX6A 3RK8A 1VFTA 5LIWX 2E40A 3IS4A 3TYAA 1DYSA 1M53A 4C6FA 3NDYA 4MADA 2TPSA 2CLEA 4JX5A 2R8WA 2NQZA 4L6OA 3PTDA 3AO0A 1LJYA 3OVPA 4LTSA 1UWSA 1DJGA 4IP4A 2IXVA 3T40A 3NWRA 4CCDA 4AUBA 4GQGA 1AL7A 1JDEA 4EXQA 5LXXA 5CLWA 2F9RA 4W85A 3BICA 3E49A 4WOQA 3TXZA 2A3CA 3AMKA 3S5SA 3NDZA 1E6SM 4N6FA 1QBBA 7ENLA 1F3WA 3N19B 1JPIA 4M6PA 3KS5A 2PI6A 4JTFA 3LCGA 4RR4A 3P2VA 4I8DA 3TDFA 3WLHA 1BYCA 2P8BA 1I2NA 3NM3A 3R0KA 6PTDA 5FOOA 2NXIA 5F2IA 3CIXA 3QV8A 5IFTA 3SCSA 4MG4A 3D6NA 4MPQA 4WEVX 4WY0B 2EQDA 2J25A 4D8AA 4J9JA 4MY8A 1TPWA 1KRBC 4GD0A 1BYDA 1X38A 3TEVA 3E0FA 4M3PA 2VL4A 4HU3A 4JNYA 2ZRWA 2YZ5A 2WJZA 2EHHA 3JW7A 1YTKA 3EDKA 1VH7A 2ALRA 1SQ7A 2NQLA 1S5TA 2W79A 3PM6A 4MZYA 4BQ3A 3KBNA 3F1QA 4H6QA 5JBEA 1O4UA 1OC6A 1RV8A 1R3YA 1XCWA 4MVAA 2X8RA 4XBJA 4M5PA 4FMVA 1L0PA 1LLOA 1AZ2A 3L9CA 1K9EA 3W7KA 1RQHA 3LLFA 3TN3A 3LEPA 2TAAA 2PP1A 3K1GA 3DG3A 3ES8A 4HVXA 1DWHM 4O17A 4F2BA 2VEIA 1GCYA 4OOZA 2R1PA 5E9AA 4N9EA 4JX4A 3PULA 4NXKA 2OWWA 3T0CA 5A6AA 1TPEA 1DP0A 2ZXBA 4C7FA 3V4BA 2Z2UA 2VOMA 4HNCA 3SUWA 3F2CA 3N18A 1BRLB 1BQGA 3VU2A 3B8TA 4LUYA 2ZTJA 1ZHAA 1XLIA 1ZJBA 3TLLA 4EAYA 4UFJA 4BEQA 3W1LA 4RK8A 2IQ0A 4M29A 4JTTA 1NEYA 3TROA 5E6YA 3AS3A 1DIOA 3KHJA 5C54A 5D9PA 2C3ZA 4ECLA 4DB7A 3LB0A 1HX0A 2O7SA 3UWZA 4X63A 5A6LA 3DGRA 5M2FX 1RUSA 3E96A 2E6YA 1OFPA 4RLIA 1QI3A 2VP8A 4KH2A 3L2MA 3SCNA 2CHRA 5AC6A 2VEKA 1E15A 3W7DA 5D38A 2ZYFA 2EEXA 3PWGA 1KCXA 1SFTA 4Y9AA 1RY8A 1TV7A 1Q66A 4ZXOA 2QKFA 4ZODA 4O8RA 2YW3A 3U6WA 3VOHA 3GTFA 1D7KA 1W5NA 1IEWA 1V3KA 1H61A 3W3OA 5BNKA 1QI4A 3OQEA 2HISA 3S5NA 1B4KA 2XH7A 4YWIA 4JKKA 2AMXA 3GZ3A 3L65A 3NEHA 3I3BA 4LV4A 4G1KA 2E5CA 3BQ6A 1FWFC 1H7WA 4XD6A 3TWBA 1EJSC 3W38A 3WUGA 1ECEA 4KWSA 2BZNA 4HBKA 1RLCL 3GM8A 5D2XA 2AGTA 4W8BA 2WXDM 4B3LA 2EG8A 3KBSA 5DMLA 2YBVA 2QPSA 4JTHA 2V5LA 2VR5A 3GZAA 3TJ4A 3PJWA 4URIA 1TQXA 3PBMA 4JFUA 2VDIA 1GKQA 3MJYA 1US2A 3EDEA 3TQPA 4D71A 3SCTA 4Y9MA 1PUDA 3I7SA 2FH6A 3PJTA 4P7LA 4R53A 2PEVA 1WA3A 5DMYA 3DKJA 3MQTA 1G69A 5FIPA 3RXZA 3W7RA 4HOXA 3BGJA 3N12A 3HFYA 1H7RA 3BZJA 1UMLA 3S5ZA 1WX0A 3H54A 4W86A 4NKCA 4ZB5A 2B31A 2V3FA 3UZWA 2VX7A 1KM6A 1K4HA 1L2UA 2QIWA 5EMYA 1RQEA 3PTKA 3O0FA 2YXGA 4M1BA 2I17A 3TIMA 2VGFA 1BFNA 4DBDA 2Z24A 4IIEA 4AZGA 4EK7A 4IQLA 1UR1A 4C6OA 6CGTA 1KLZA 1LOSA 4AIOA 3CH9A 1WXYA 3NJ3A 3U4AA 1XDMA 2HVOA 3S83A 1GVSA 4XO6A 4GQ0A 4JDYA 4PTWA 4AXNA 2ZVIA 1JPHA 2V2HA 3DN5A 2GQ8A 3S42A 2NQJA 1JCYA 4DX3A 1UOZA 3KL5A 3TYEA 5HQMA 1R9ZA 2PDNA 4OUEA 1KR0A 3ZJ7A 2MNRA 3AU2A 4ADSA 4GLEA 2CLKA 1WXJA