1FHDA

Crystal structure of the xylanase cex with xylobiose-derived imidazole inhibitor
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords BETA-1,4-XYLANASE
total genus 129
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fhdA00
1V02E 1GOOA 3ZJ6A 5HPOA 2DH2A 1C8QA 1W1TA 1EDQA 1B1YA 3GNRA 2VC9A 4JAWA 1FA2A 3VU2A 1WZLA 1DWGM 1EXPA 1B3WA 3VD9A 5BROA 1JF6A 2E8ZA 3AMCA 4F9JA 1FH8A 4J3SA 4TVDA 1E70M 3SCNA 1KR0A 4PTWA 3BH4A 5BWFA 3VMPA 1AQ0A 3EMQA 3QHNA 1VEPA 1MYRA 1C91A 5FL1A 1C93A 2XWEA 3HMCA 3CHEA 4CGTA 2X2YA 1O6IA 1MQQA 3WQ8A 2D3LA 3CHDA 4GKLA 3RJXA 1E1EA 4C7FA 1ISZA 3MU7A 4BQ4A 4D6CA 1UWRA 4FLSA 1GOKA 2DPEA 4DUXA 2WMIB 4W7UA 2ZX5A 4PMRA 1C8XA 4KWUA 1BVNP 1NP2A 5C70A 4MB4A 5CGMA 2ZIDA 1TFVA 3WFZA 1JYNA 4JFSA 2VZUA 3VVGA 2VRQA 3W24A 5A8PA 1E6QM 5A3HA 3QOMA 1HKKA 2WWCA 3SCUA 4FLOA 3VGFA 4P8XA 1R8LA 1X6NA 4M81A 3TTSA 1E1FA 4DUWA 1XD0A 3OB8A 3WH5A 2NT0A 4BQ5A 4QLLA 1OT1A 3MSGA 1UG6A 1W1PA 3OGVA 1J0HA 5AY7A 3EDEA 3WDJA 1WE5A 3RM9A 2C8NA 2J78A 4E8CA 4UFHA 4HMCA 1VFMA 1V6YA 3AXIA 3BCFA 1JDAA 1TR1A 5A94A 1E4LA 2DQXA 4IPLA 3ZR5A 2WVSA 2CEQA 3CZEA 3B9AA 4PEEA 1CBGA 4OOUA 3I3DA 2PB1A 2WKLA 1EO7A 3MV11 4X0NA 2NSXA 5C71A 1KXQA 5A69A 4EAMA 1G5AA 2IXUA 3PZQA 5CSUA 3OLIA 5E0FA 1M03A 4AZHA 3BMWA 1QBAA 4H04A 1BYCA 2ZUNA 1JZ4A 1LJYA 3GDBA 3W25A 3TP4A 1W3LA 1GVYA 1UHVA 1HJWA 3VINA 3VD3A 2Q8XA 3VDAA 1E73M 5HDRA 1VFOA 1NH6A 3W27A 3WN6A 3UR7A 5JIPA 3WNLA 1E0WA 1ODUA 3RM8A 3PZVA 3W38A 2XM2A 2UY4A 3N11A 1JNEA 1UKTA 4P7LA 4AISA 3WD0A 1ECEA 4MJ2A 4LXFA 1UWUA 3L4WA 4V2XA 2F8QA 1OGGA 4JKKA 1NWRA 3W4RA 5DEZA 2WC4A 3F4VA 2WLYA 3MUAA 2X1IA 2WMJA 3VUPA 1J0JA 7A3HA 3EDKA 1E71M 2YBUA 1QNOA 4H8VA 1GJUA 3QHMA 4CN4A 3SCWA 4PRWA 3UETA 5HOSA 1PJ9A 1E4IA 5I79A 1B3ZA 4AMCA 1YQ2A 3FHAA 2WWDA 4PBGA 1CIUA 3MMDA 3IJ7A 2FHBA 1CGYA 1UKSA 4AIUA 3MMUA 3AYRA 1KXTA 2J77A 5DO8A 1UD8A 3FXYA 1TA3A 1FOBA 1UD2A 2XVGA 2V5CA 4C7DA 1H1NA 4HZ6A 4ATWA 2OWCA 1PX3A 3AXXA 1ZL1A 2WHJA 2WHLA 2G4FA 4PMZA 3PZNA 1ZBWA 4HU0A 3WEMA 3NIYA 3ZJKA 2BXYA 1CLXA 2ZXDA 1UWTA 2WK2A 1B31A 4AD0A 4PSRA 5BXTA 2AMGA 2A3EA 4AZCA 3ZT5A 3ARYA 3WL0A 3VIJA 1CXIA 2XGIA 2WMGA 1E5NA 2CESA 4CVUA 5BXPA 1UWQA 3EMZA 1H3GA 1V6UA 2ZWZA 3N18A 4PYSA 1HL8A 1CTNA 4IISA 2YA1A 1E40A 2GK1A 1JDCA 1HJUA 4JFWA 1V02A 4DUVA 1C7TA 2YJQA 5BRQA 1UKPA 4KRUA 1JI2A 4UTFA 3CZGA 3K4AA 2D20A 3T0DA 1MXDA 1BHGA 4JFUA 5A6MA 4HTYA 2VCAA 2MANA 2DEPA 1UR4A 3VDCA 1K6AA 1YHTA 4TOQA 5IDIA 1BF2A 2VX6A 3W81A 4OBSA 3VX0A 1VENA 4EANA 2O9TA 1JIBA 4MADA 1G94A 4AW7A 2CHOA 4AC1X 2JIWA 5KZ6A 4H7VA 4LPCA 5I78A 2VX7A 3SEPA 1JF5A 3T2PA 1A3HA 4GO8A 1J0ZA 3M7SA 3WH8A 2ZXBA 4F8XA 4FMVA 4AD3A 4CCCA 1VAHA 1JZ6A 3WH7A 1S46A 2WPGA 2W62A 3VM7A 4HA3A 3OZPA 1E0VA 3VIFA 2DH3A 3CHCA 1W9DM 2J7FA 3F5LA 1KGXA 5A8QA 2EO7A 2XYLA 3B9DA 3POHA 4QFUA 2WVUA 2DT0A 1E56A 3WF3A 3ARPA 3ARRA 3AMLA 2BXZA 3O2LA 4GXPA 1FH9A 1UKOA 1CZ1A 2YIHA 3VGGA 2J8GA 3O6AA 3WY1A 1OGBA 2DSVA 2DSWA 1I75A 3VOCA 4DWSD 2EPKX 1GZJA 2XIBA 1JI1A 3DHUA 2BHZA 1JDDA 3CZ8A 3WNOA 5E6YA 1UWSA 1ZBVA 1J0YA 1VBRA 1B9ZA 3RDKA 1HXJA 3AS3A 3N1AA 1HP5A 1E0XA 4WKFA 3SCPA 4ACYA 1E72M 1I1WA 1RPKA 5ABGA 2XVKA 5A8NA 4UQCA 2QF8A 3VIMA 2DT1A 4W7WA 3AMDA 4JKMA 4WIWA 1VBUA 3PTKA 4PTVA 3AI0A 3U7VA 3QOKA 3WF0A 4GI6A 2E3ZA 4D6EA 1WPCA 1VJSA 3ZJ7A 3WIJA 5A2AA 1P6WA 3GXMA 3N17A 1GHSA 1KBBA 4ZE4A 3WH9A 3SIMA 1EA9C 5M03A 3VILA 1DWHM 3BAXA 2XSBA 3LPPA 4MAVA 1V3JA 2WB5A 4Z2HA 4WKHA 2ZOXA 3WDQA 1QOXA 1GOMA 4B3KA 1KXVA 2WBKA 5LA0A 3ARQA 1OBAA 3BXWA 1UA3A 1VEOA 1E6ZA 2VZVA 3L4TA 3L4ZA 3K1DA 2J7DA 1CLVA 3A4WA 3KL0A 1BVZA 1LF1A 3W6MA 3VIPA 3WH6A 1BYDA 3TTQA 2WSPA 3MUY1 1TVNA 3NJ3A 1BGAA 4MDPA 1BLIA 4R5EA 2WZEA 3WDPP 1M01A 3U5UA 3DYMA 1W2VA 2YL9A 5GNXA 2BNJA 6A3HA 1B2YA 1XRVA 1B30A 1LG1A 1HVQA 1OD0A 1KBKA 4ZXLA 2J7CA 3AIVA 1ITXA 1ZU8A 4N0RA 5CGTA 3CLWA 1JGIA 1AQHA 2W5FA 4H41A 2ZXAA 1SFSA 1PX4A 4UFIA 3G6MA 3RILA 2J25A 2GK1B 1V08A 4UQ9A 3AZTA 1BQCA 2YLLA 3FN9A 4UCFA 2ZX9A 3ZT7A 4BQ2A 1PZ3A 2E9MA 1BAGA 1ISXA 1OD8A 2C7FA 4HMDA 2ZUUA 4ATDA 1PPIA 1RP9A 4GQQA 2WW5A 3WQVA 4TTGA 2EPMX 3VGHA 3VKKA 4HMEA 4AZBA 3F5KA 1EOKA 1CXLA 2IUZA 3L2LA 2WBGA 4U3AA 9CGTA 5CSYA 5TD4A 5D4YA 4CCDA 5CPSA 1NWTA 1NM9A 3GNOA 5GPRA 3E1F1 4YPJA 1FFQA 2BHYA 2GJPA 3JUGA 1FP9A 1PIFA 1V3LA 3NCOA 5EFFA 3W37A 1ZB5A 1PBGA 1IT0A 2OYLA 3FNDA 1V0LA 1XHGA 1LL6A 4GIAA 3VIGA 5D9NA 4PTXA 3VX1A 1FHLA 2F61A 1GQLA 4AZ6A 4DWSC 3ARZA 4PMOA 2PC8A 1WKYA 4NRRA 1US2A 2BY3A 3AIUA 3N9KA 1E4MM 1EDTA 3RPMA 1D7FA 3POCA 3NSMA 3CH9A 2CHNA 3OGSA 1W9BM 3N12A 2EXOA 4QP0A 3SCVA 4OKDA 2GUYA 3SUWA 2ZX7A 1K9TA 4V28A 1RD6A 3G6LA 2XFRA 4XUYA 4PCSA 3WQWA 1NOFA 2XVPA 3UG5A 3TTYA 1B90A 1LL4A 5GNZA 1UR9A 4B15A 3FHQA 3TONA 3L4VA 3WF2A 1Q6DA 2RGMA 3DC0A 1UR8A 4UR9A 3VPLA 1UA7A 3WMSA 1NQ6A 4HZ7A 2V3FA 3EBVA 2UY2A 2X8RA 1E4NA 5JBDA 3K46A 3L4YA 3T09A 5ABFA 3KWXA 1PX8A 2CXGA 2QPUA 1H09A 3NYDA 1UOKA 5KEZA 2CITA 3KL3A 3AFBA 4CUCA 4U2ZA 1HJQA 3VIKA 3WD1A 3APGA 4HOZA 5E6ZA 3WF4A 3VIOA 4MNJA 1XSJA 3K8MA 4YN5A 1JAKA 2XM1A 2BVDA 3VIIA 2F2HA 1H49A 3T0AA 1QNQA 1WZAA 3NDYA 2YL6A 1CWYA 4U2YA 5AC4A 3A47A 2Z1KA 1CXEA 1JFXA 3UEQA 4PCTA 4H8UA 1W1YA 1B0IA 1X6LA 4QCEA 3ZT6A 4ACZA 4J28A 5ECUA 2ZX8A 4AD1A 1E6PA 4QAWA 1VIWA 3VO0A 2VQUA 3CUJA 3WEOA 3ZQ9A 4LX4A 2XVLA 1EIBA 3BAIA 1US3A 6CGTA 4OJYA 1GUVA 5HPCA 4J3VA 4W86A 4PMDA 2VO5A 3GZAA 2G8ZA 2VCCA 5A6SA 4Y7EA 3T2QA 2VI0A 1XYFA 1OGSA 2OWXA 4V27A 5EBAA 4HZ8A 5GQBA 3ZMRA 3UR8A 1N82A 4PMYA 5JIWA 1LWHA 2Y24A 2EQDA 2J7HA 3ZSSA 4E8DA 1RH9A 1XV8A 2G3IA 2PBGA 2OSXA 2CCRA 4LYRA 3UG4A 1NOUA 2JE8A 3ZSTA 3AIBA 1Q6FA 4HOXA 2VZSA 1UQZA 2G3JA 3EDJA 3MUZ1 5I5RA 3CO4A 1GQKA 3ALGA 5A6KA 3T0BA 1E15A 5IHRA 2PF0A 3M46A 3BSHA 2W4XA 3PZMA 5JBEA 1QHZA 4J3TA 3K4DA 4MTVA 1EO5A 1TG7A 4QDMA 2BS9A 1DWFM 1GJWA 3LPOA 4UOQA 4LYPA 4PN2A 1RP8A 2NT1A 4L4PA 1W3JA 4HA1A 3AZRA 3ZOAA 4J27A 3OLGA 3ARSA 3AICA 2PWGA 2DDXA 2BFGA 1GORA 1MFUA 3MO4A 2JIEA 5CG0A 5ABEA 2XVNA 4RE4A 2D22A 2BY1A 2D1ZA 4QCFA 1J12A 3RCNA 4AWEA 5CJ5A 1KCKA 2Y5EA 4W84A 2QHAA 2E8YA 3DYOA 2WHMA 4TUFA 1QBBA 1XCWA 3RMEA 4W7VA 4MAZA 1EDGA 3CUGA 4U5IA 3WELA 1V3MA 4Z2JA 1W2PA 4XV0A 4MNLA 1DEDA 3PHAA 2WSKA 2W92A 5I77A 1GNXA 1UYQA 5I0DA 3KZSA 4LGXA 4B16A 3ECQA 2J7BA 2Z1SA 2FHCA 4AZGA 1E43A 5FOOA 2DT2A 1DWAM 5IXEA 2WZHA 1KWGA 3N15A 2FH6A 4UFJA 3I3BA 1GW1A 2D0HA 5FKYA 2OYKA 3T2OA 1BGGA 3BAKA 2WXDM 2VOTA 3NSNA 5CLTA 2VNCA 3IK2A 3L4XA 1PIGA 2FHFA 1QVBA 4AIOA 2WVTA 4J7RA 3GYCA 3MS8A 3OZOA 1LLOA 1JYWA 2VZTA 5A1AA 5D9PA 2BVTA 3WBAA 4AZ5A 5A8OA 1NWUA 4PUDA 4UZSA 2VVNA 4FLQA 1B3YA 3GBDA 1DTUA 2E40A 3SURA 2A3CA 4GZIA 4FF5A 4D6IA 2OSWA 4P8WA 4PMXA 3KL5A 3WDRA 2VURA 4NF7A 3AZSA 1LG2A 3GH4A 1IZJA 1QNSA 5A6BD 1BSIA 4W8AA 4DWSB 1E6NA 4WKAA 3PZIA 1V0KA 1J01A 1DWIM 4M24A 3S2CA 1UD4A 1W91A 4DM1A 1UUQA 1H11A 3WFLA 4U33A 4GI9A 4JL2A 4BA0A 2PWFA 3ARTA 4CU6A 3TA9A 3CMGA 4AZ7A 2ZE0A 1HP4A 2QV4A 2D0GA 1GQIA 1D2KA 3ALFA 1VB9A 1QHOA 5A2BA 4UNIA 2WC7A 4AY1A 1GHRA 4J3UA 5AYBA 2FDMA 2ZICA 1KGWA 2FGZA 4D6DA 2XPKA 2EPOA 5LA2A 1WDQA 4ZENA 1QPKA 4AD4A 3L2MA 1Q4NX 4H8HA 3W0KA 1OT2A 2PWHA 3BGAA 1XSKA 3N13A 2W91A 4NRSA 4TTUA 1Q6GA 3A3HA 3RO8A 3S6TA 4Z2IA 1UR1A 4NI3A 5M3WA 4GQRA 3WEZA 4D6JA 4XX6A 4QLJA 1MQRA 1M53A 2EEXA 4EK7A 1ESWA 2FGLA 1GCYA 1J9YA 1UD3A 4HA4A 2WMFA 3HN3A 5A6AA 2WYSA 1XH0A 2CKSA 2HISA 1QNPA 5CQ1A 3VMOA 3ZR6A 3AISA 2VCBA 3CIVA 1C8YA 3PTMA 5ABFB 5DFAA 5I6SA 2CNCA 5BXSA 1UQYA 1JZ2A 4M56A 2GDUA 4JZ5A 4ATLA 1VFFA 2V38A 3SCQA 1C7SA 4LQ1A 1JXKA 3OA5A 4CN6A 1WDRA 5E0CA 1CEOA 1X1NA 5E09A 1OIFA 2BVYA 2IXVA 1TA3B 1CGTA 3VGEA 4PTMA 1E6RA 1WAWA 3WUBA 1W9XA 1MW0A 1C92A 3KEHA 2W66A 3AIQA 2WCAA 1BFNA 1VF8A 4W8BA 1E55A 2YBTA 4P7QA 2GDVA 4A3HA 1WCGA 4W8LA 2WKGA 3EDFA 2BHUA 1CGXA 3AMGA 2W67A 2VJXA 3GXDA 1XGZA 1V6VA 1I1XA 4P7RA 1QI0A 3LPFA 4U5KA 1BTCA 1PEZA 2V5DA 1KR1A 3NSXA 4UFLA 1B3VA 1U33A 1UD6A 4MPKA 1K9FA 1XC6A 2VVSA 1E6XM 1OWQA 1SMAA 1D3CA 3FAXA 5IFPA 2WM0A 4OUEA 3CUHA 3W53A 3CZLA 3AIEA 4XZBA 1E6SM 2E9BA 2Y2WA 5FD0A 2JFEX 2J4GA 1SR0A 3WNNA 4X0VA 4XB3A 1R7OA 4AD5A 4AIEA 1W9VA 2A3HA 3AJ7A 2A3AA 4JCLA 4ZFMA 4A4AA 1J10A 1R7AA 1V3IA 4X9YA 3CPUA 4D6FA 4TVUA 3VTRA 2ESCA 1KXHA 3SUSA 4OIFA 1CGUA 2VT0A 3VDBA 2EPLX 5BCAA 4WK9A 5CLWA 1M04A 4Z2GA 3UCQA 4GZJA 3CBWA 3WSUA 3ARXA 1GPFA 3WL1A 4J3XA 2ZWYA 2J79A 1JZ5A 1CXKA 1XD1A 4JL1A 2NW0A 3DECA 3OIHA 1H0GA 4MDOA 2ZUSA 2O9RA 3MANA 1NOWA 3ZO9A 4AZIA 4E4PA 3O9NA 1J11A 1BYAA 3WBEA 4MJ4A 4UOJA 3QR3A 4N42A 1U30A 1HN1A 3IJ9A 1W9PA 1XYZA 2VTFA 1Q6EA 4JCMA 3AIWA 1GVIA 1G9HA 3GXFA 2V3EA 1E5JA 3BAYA 3KE0A 3VNZA 2YA2A 4U3CA 1KCLA 3PZOA 1QI2A 4A3YA 4F79A 1KB3A 1J18A 3IAQA 5HNNA 2DIJA 2OSYA 4AXNA 1CENA 2B31A 3GNPA 4EKJA 3OBAA 1UH3A 1CECA 3GTNA 4CD6A 8A3HA 3VD7A 1KQYA 3SCRA 4W89A 2A3BA 4IPNB 4CVWA 3CUFA 4XZWA 1V0NA 2XFYA 2Y8VA 4E2OA 2VQTA 3BC9A 1XH2A 2X0YA 3NUKA 2BY2A 2PBOA 3WMBA 4PMQA 1H41A 1V03A 4PUEA 2C0HA 2JALA 1AVAA 3VD4A 1W3KA 2JEPA 2CYGA 4W5UA 3MSDA 1HF6A 7CGTA 4WJXA 5I2UA 1W3HA 4H2CA 3W82A 3WQ6A 2WHKA 1ISYA 3WD3A 5EFDA 5BXRA 4OOZA 2W63A 4OBRA 4B9ZA 2D3NA 2YKKA 1EHNA 2E4TA 2CBVA 3AROA 4KH2A 5FCZA 1NP0A 3AQUA 5M5DA 3ZIZA 1BG9A 1H5VA 3EMCA 1EQCA 2V3GA 3WUGA 2XHYA 4D71A 4BQ3A 2QLYA 1HVXA 3LMYA 4NSBA 4WSJA 2E0PA 3MKKA 2WVVB 1U2YA 1JD7A 2FH8A 2OWWA 1F4AA 4TX8A 4HOWA 2VRJA 4YHEA 1PZ2A 2DIEA 1WZKA 1OSEA 5A6JA 1JL8A 1HJVA 5LA1A 1F4HA 3K8KA 2VUYA 1VFUA 3PZTA 4JHZA 1MVYA 5E70A 1CDGA 3U7BA 4D6GA 2O9OA 1WB0A 4UFMA 3THCA 1G1YA 3AS1A 2VZOA 1QI3A 1WDSA 1ISVA 1V0MA 4CU7A 3D3AA 4M82A 1ZS2A 3BAWA 3A4AA 2TAAA 4CD7A 4W85A 3BLPX 2GFTA 4R27A 4RE3A 4HU8A 1QW8A 5IFTA 1Q6CA 4FLRA 1MW3A 4PMNA 1JFHA 1XCXA 2DGAA 1OIMA 3PZGA 4MB1A 3GBEA 3GXIA 4S3KA 3MV01 5DMYA 2VX4A 4B3LA 1ISWA 4MB5A 4W87A 1VRXA 1UH2A 4GPNA 2CBJA 2XTKA 4IUGA 8CGTA 5HXMA 3W26A 3D5HA 4S3JA 3B9EA 1K9EA 1EGZA 3TTOA 1MQPA 4L4OA 2V3DA 5D8WA 1LWJA 4WF7A 1M7XA 1G0CA 2VR4A 4KGJA 3WKZA 1LQ0A 4MB3A 4J3WA 3FW6A 2CERA 3UERA 3CTTA 1CGWA 4C7GA 3BSGA 4WLCA 2D23A 3GM8A 3BMVA 4CCEA 1ZJAA 2CPUA 1Z32X 5DF0A 1HJSA 3OGRA 1IV8A 2D2OA 4DM2A 1E3XA 3VMNA 4AYSA 4Z2LA 4MNKA 2YA0A 2YDRA 1EQPA 1QW9A 3U5YA 1JNDA 5D9OA 1MXGA 3IANA 5DT5A 1W32A 3MUIA 1VJZA 2ZX6A 3WNKA 3VD5A 1ZJBA 3LPGA 4K68A 3WQ5A 1AMYA 5EMYA 3WQ4A 1HKMA 3UG3A 2PWDA 4AD2A 2EPNA 3AOFA 1C90A 2WMKA 2YDQA 2G41A 2UWFA 2J47A 3RJYA 3HJEA 1EOMA 1FFRA 4CKQA 1MFVA 5JUVA 1NARA 1CXFA 5C8BB 5CXPA 4KMQA 2YLAA 2WLZA 3BCDA 2J8FA 3AHYA 1UD5A 1DHKA 4PMVA 4CD5A 4F9DA 1L0PA 3THDA 3CHFA 3A6OA 1TUXA 3RIKA 1CNVA 4JKLA 2XG9A 3PBGA 1FHDA 3WDHA 1H2JA 3OLEA 2XSAA 1HKIA 4PSPA 2CBUA 2VMFA 3J7HA 3IAPA 1MW2A 1TMQA 2ZUTA 2CKRA 4UQAA 1EHAA 2G3MA 4UFKA 3TOPA 1MW1A 4Z2KA 2G3NA 4W88A 1HT6A 2RGLA 5CPTA 5BYWA 1WO2A 2VX5A 4ZXOA 1B3XA 3VIHA 3VGDA 1UH4A 3AS0A 2D24A 1XH1A 1J0IA 2CETA 3PN8A 3HU7A 1GOIA 2DT3A 3WD2A 2X0HA 4QLKA 1QI5A 5GNYA 4W93A 3WNMA 4GZEA 1HL9A 2BV9A 1WZMA 2OLHA 1VEMA 3AMKA 2JF6A 3FY1A 3WDIA 2UY5A 1E3ZA 3NDZA 5JBFA 7TAAA 4ACZB 4P7OA 1TVPA 4CU8A 1FH7A 2XIIA 1KFWA 2CBIA 4UOZA 1V6XA 2YL5A 1JZ7A 3DHPA 4AEEA 2J7EA 4UQBA 1JXJA 5AC5A 3VGBA 1OM0A 1JYXA 1WP6A 1TCMA 5D9MA 2EJ1A 1HIZA 3AYSA 4IM4A 3M07A 4KGLA 5LYRA 1KQZA 1V3KA 4RL3A 2Y8KA 5HBFA 4DWSA 4W5ZA 1SMDA 2WZIA 2XUCA 1GQJA 1CYGA 1AQMA 4JFTA 2DSZA 5A2CA 4KRTA 1GOWA 3FAWA 3L4UA 3OLDA 4CD4A 2YDSA 4BF7A 1UZ1A 2EBNA 5EB8A 1ODZA 1HKJA 3PTQA 1EH9A 1W9UA 2WCSA 1TZ7A 3RM4A 5A6BA 4YHGA 1OCQA 3DYPA 4UQDA 4FK9A 4D1JA 3I3EA 5I3DA 3CZJA 2GSJA 4PMUA 1E9LA 5CPQA 4M80A 1QI4A 3W6LA 1JYVA 4P8UA 2AOSA 5A95A 3QHOA 5FL0A 2ZUMA 3GH7A 3ZJ8A 1KGUA 2JF7A 2XJ7A 4LYQA 1QNRA 3AIRA 2YOCA 2UY3A 4M8UA 1HNYA 2WMIA 3CZKA 4GI8A 4D6HA 2ZUVA 3CUIA 1CPUA 2JEQA 3BAJA 1K9DA 1FP8A 3WUEA 3PZUA 2WVVA 3ARWA 3N04A 1WDPA 3II1A 1OB0A 1DWJM 3WUFA 1J0KA 4MNMA 1BYBA 2WANA 4WSKA 5AYIA 2XGBA 1C3FA 4URIA 1IZKA 1UZ4A 1V3HA 3AHZA 4BZYA 1WNOA 4M29A 4HPHA 3IJ8A 3SUTA 2BY0A 3AS2A 2D0FA 2O92A 3OG2A 1UR2A 1G01A 2DSKA 2CIPA 1Y7VA 1CGVA 1TE1A 3AXHA 4P7NA 1BPLB 1R85A 2DSUA 3W28A 3WD4A 2VRKA 3EYPA 2WMHA 3AHTA 4TX6A 5D8ZA 3AHXA 3PZ9A 2GVYA 4JIEA 2VR5A 5E9AA 1UWIA 1JZ8A 1ZBCA 4BS0A 2X09A 1V6WA 3SUVA 4D72A 4M1RA 2PWEA 4TVCA 3T08A 1R86A 2J75A 2AAAA 4BCEA 1CXHA 2XFFA 1NWSA 2WAGA 1L8NA 3VDHA 4TXEA 4ZEPA 2WNWA 1W1VA 3WNPA 2E9LA 3EDDA 3F5JA 1ZBKA 1SYTA 3VNYA 1GONA 3VM5A 4ML4A 1JAEA 2GJXA 4Q22A 4RE2A 1A47A 5I23A 2X05A 2OYMA 4GINA 3QGVA 5F7UA 4HP5A 2GJXB 4B9YA 5A6LA 4JFVA 3ARUA 2XWDA 4Q7NA 1JZ3A 1BG4A 2WC3A 4JHOA 4UQEA 4GO9A 1ITCA 4ZE5A 4UZUA 5FIPA 2QPSA 3CGTA 2O9PA 3WMCA 1HX0A 2QMKA 3M6DA 1JD9A 2WCGA 1PAMA 1MWOA 2HVMA 3GH5A 4U31A 3SCSA 1H0IA 1H4PA 5A8MA 5ABHA 4CN1A 5I24A 2QMJA 5M17A 2J74A 4HPGA 3A4XA 1UKQA 4EE9A 3W29A 2Y4SA 3UESA 4D1IA 1HJXA 5CZKA 1XSIA 1R87A 2ZUWA 2W61A 3AHVA 4OZOA 4P8VA 3SUUA 5IHSA 1OINA 4F66A 2J62A 4CD8A 3K8LA 1QHPA 2PI6A 2YL8A 1JG9A 5BRPA 3ZM8A 1O7AA 6TAAA 1UR0A 4AEFA 1GOQA 3ARVA 3SCOA 1KWKA 3BLKA 5DT7A 1LL7A 2J7GA 3SCTA 2ZXQA 2VL4A 3CMJA 3MMWA 3WENA 4AZCB 3U57A 3WF1A 1DP0A 2GJRA 3B8SA 4NZCA
chains in the Genus database with same CATH superfamily
3H2OA 1DPMA 3PBYA 3KP0A 1W1TA 1B1YA 2I9EA 2VC9A 1S2TA 3DCPA 3VU2A 3CU2A 2Y1HA 2VWTA 3K2GA 1EXPA 1WV2A 5BROA 2E8ZA 3AMCA 4PUWA 4F9JA 3ISIX 1YIXA 2P3ZA 3N6HA 3BH4A 2A1YA 3DU0A 5I3IA 2DIKA 1V8EA 1DJNA 2A6LA 1Q7MA 1MYRA 1C91A 5FL1A 4WX2A 2Z1XA 1B54A 2DUXA 4WGXA 5F1UA 3A5FA 4DBUA 3SBFA 4QROA 1OC7A 4D6CA 1YPXA 4CLMA 2F6KA 1GOKA 1LCOA 1XLFA 4DUXA 1LOQA 1EGMA 4JS3A 1TTQA 4PMRA 3S46A 5LIWX 3N6QA 1M6JA 3SZ8A 1R3TA 3BZJA 3V0UA 2HPMA 1GVQA 4NAFA 4FLOA 3SCUA 5MKGB 3UZYA 4P8XA 3NQAA 1ZAHA 4M81A 3TTSA 1XBYA 3WQEA 2VFDA 3MSGA 4PUUA 1O5KA 3EDEA 4HMNA 4IPIA 4H3DA 5FEZA 4G1NA 4HMCA 3URAA 2W9MA 3WLIA 3ELFA 4IQDA 3GC4A 3PVFA 1OFOA 3NEHA 4KPLA 2WVSA 2OFJA 1AJ0A 4B91A 1CBGA 2Q71A 4O1BA 4YNGA 2WKLA 3MV11 4JTUA 3FGCA 3RO6A 4H1ZA 3DH7A 1KXQA 4E38A 2IQDA 4EAMA 3CQ0A 3W7RA 4AZHA 5LNUA 4JQ1A 3BOFA 4J5NA 2R1PA 4UTKA 1JZ4A 3CQHA 1W3LA 3NWRA 4JDBA 4K1GA 3ME3A 3NZ1A 1VRDA 3LLXA 2PFHA 3FVMA 3LTPA 3WN6A 3EB3A 1WQ5A 4YXGA 3WNLA 3RM8A 3H2NA 5HJYA 2XM2A 3QC0A 3LXCA 1JNEA 1UKTA 3DAQA 3BLDA 3GTXA 2OXNA 4LXFA 3L4WA 3L5MA 1OGGA 5G2IA 2YX0A 1RK6A 5DEZA 4CNUA 5DCEA 1W5PA 3E38A 2WMJA 3IJIA 3RNDA 3AALA 1YXCA 4DELA 3EB4A 2Y0FA 1E71M 4C90A 3FJLA 2YBUA 3CWHA 3VC6A 3M0KA 3SCWA 4HJFA 4PRWA 1XDMA 1YEYA 3W7EA 3FHAA 2DZPA 4AWSA 1RJPA 5AHFA 3H22A 2A4AA 4GYPC 5CGQA 4NQ1A 3MMUA 3AYRA 2Z00A 1KXTA 1I2RA 4LANA 5DO8A 1PYMA 3KVMA 3HPZA 1XFCA 2V5CA 4C7DA 1H1NA 3AO0A 3T07A 4RK8A 4HZ6A 1VKFA 2OWCA 1ZL1A 2WHJA 2WHLA 1ZBWA 4HU0A 1W5OA 4C1NB 4HPJA 3M6YA 3ZJKA 1XLLA 3G5EA 5IRPA 3UVIA 1P5BA 1EJXC 1H61A 4B5SA 3RYSA 2QGYA 2AMGA 4AZCA 4W4QA 4XBKA 2ISDA 2QXWA 1F74A 1IWBA 2H3BA 1QWGA 4PUNA 2PLMA 4BY3A 1BRLB 3KCJA 4AHPA 4Q4OA 1JUKA 1UWQA 4KWVA 3NVDA 1LZOA 2ZWZA 4IISA 4LUSA 1RQEA 3MI6A 1E40A 2QCLA 4JTDA 1X6UA 3IWPA 3FKKA 3IEBA 3G1VA 3SJNA 1TVLA 5BRQA 4KRUA 4UTFA 1YKWA 1WBJA 5C5YA 4BWLC 2D20A 1HKVA 3DHDA 4KIRA 3MMTA 5MKGA 3H7RA 3F4CA 2DEPA 1K6AA 3UYCA 4I7VA 1YHTA 5L9FA 5IDIA 1Z3NA 1BF2A 4HSNA 3W81A 4OBSA 4N9BA 2O9TA 3GR4A 4IP5A 3IJQA 3MWCA 4AW7A 2CHOA 6ALDA 2JIWA 4Q7IA 3KDOA 3O63A 2EKCA 4GVGA 2EG7A 2NLYA 3SEPA 1JF5A 1A3HA 1JDFA 4GO8A 1J0ZA 1AQFA 3GXTA 4AWTA 4OECA 3PY2A 1GT8A 4CCCA 1VAHA 4DO6A 1JZ6A 1K4GA 3WH7A 1O94A 3CIXA 5HUPA 3QFWA 4K37A 1E0VA 3VIFA 4Q4KA 2PCEA 1W9DM 5EYWA 1XS2A 4LVGA 4E3TA 3E49A 4IGSA 1FWGC 3H4XA 1E56A 2V5LA 3BLIA 3ARPA 5CPNA 2YFOA 1KNWA 1ZP4A 2WOQA 3AYVA 3W1AA 4QM1A 2DSVA 2DSWA 3MSYA 3HPSA 1JDDA 2A6NA 1ZBVA 4G7EA 2FLIA 4C1KA 1ADSA 4RUBA 3N1AA 4GNKB 1F8MA 1HP5A 2WSQA 4ZR8A 2EHHA 1OFRA 4WKFA 1L6YA 4LAUA 4FXRA 3C2YA 4ADSA 1VBUA 3WLKX 3PTKA 1MI3A 3WF0A 1PDZA 2E3ZA 3FDKA 3QPEA 4XZ9A 1HGWA 4UTTA 2QUNA 3BJTA 2NQHA 2OOGA 3CWOX 3N17A 1GHSA 2F6UA 3EPMA 4IL0A 1LLZA 1EA9C 5M03A 4TX9A 4MAVA 2WJZA 4ZSTA 1YDYA 4EXBA 4IFKA 1U83A 1O5XA 4IXXA 1AJ2A 3T8QA 3BXWA 1UA3A 2VZVA 1RLDA 3QN3A 3GE7A 4OV4A 1KTCA 3S5ZA 3H6OA 4JTSA 3A4WA 4NNCA 3PBMA 1S3HA 3WLRA 3V4BA 3T78A 2IPWA 4YYFA 1XGDA 3A12A 1BGAA 3WMLA 2PDHA 1BLIA 3K5XA 4R5EA 1B2YA 3LSBA 1DXFA 1KBKA 4LF1A 4ZXLA 4ILSA 4ZMGA 3GDTA 3GR8A 4OTKA 1XLHA 2VHLA 2C14A 4GG9A 4UFIA 3TSBA 4N6FA 2OJPA 1XQKA 3AZTA 2YLLA 5DRIA 4TMBA 4BQ2A 2ISWA 2VOMA 1ISXA 1FWDC 1OD8A 4HNLA 4K8GA 1GVRA 4WQ6A 4M3PA 3T4WA 4IWWA 4GNVA 2ZUUA 2ZRWA 2NUXA 1RP9A 4GQQA 2HVOA 2WW5A 4TTGA 4H9UA 2HK1A 3VGHA 4HCLA 3VKKA 1EOKA 1M7OA 1IYXA 2IUZA 2WBGA 4Q4SA 9CGTA 5FESA 3H26A 5D05A 3GVQA 1NWTA 3LCGA 4I90A 2VC5A 1YMYA 3DENA 1P0DA 3R0UA 1FFQA 1PIFA 3LUTA 3RMJA 3W37A 1MUCA 1IT0A 4GIAA 4B4FA 2CXEA 2PZNA 3VX1A 5CC6A 3W1TA 3D3FA 4AZ6A 3CS2A 4DWSC 1QT1A 1CLKA 3TLLA 4IOTA 5HQEA 1EJRC 2E28A 5JMUA 3WQPA 4DX3A 4W9TA 3KLLA 1E4MM 1E1CB 4MWAD 4JTGA 3OGSA 1W9BM 2C15A 4GUIA 5E93A 2ZX7A 3OP2A 3GW0A 3RRXA 2XFRA 1UBPC 1ELSA 2XVPA 2HMCA 1B90A 3PAOA 4F0LA 3A13A 3ANUA 3FHQA 3SSZA 2BOEX 1Q6DA 1R3YA 3DC0A 4GY0A 3GC5A 3G8EA 4HZ7A 4QIUA 4CQ9A 2UY2A 2OR2A 2PP1A 4V15A 4WZHA 2X8RA 2Y8UA 2CLPA 3H2MA 2FPYA 3KWXA 2QPUA 1H09A 1UOKA 3WQCA 4CUCA 1XIFA 2Z29A 3APGA 5I06A 3UBPC 3WF4A 4JX4A 2XH2A 3I7SA 1W1A1 2F2HA 4MF4A 1J96A 1NF7A 1WZAA 2YL6A 1CWYA 3BZGA 5EY5A 2BGQA 3DOPA 4H8UA 1W1YA 4QCEA 4QX4A 2ZQ0A 3NL3A 4AD1A 3LTYA 4US6A 4C6CA 4M1BA 1T5AA 2CLMA 4FB7A 2OMAA 4LX4A 2V8ZA 1US3A 4ZB2A 1W1B1 2ZA1A 5HPCA 4W86A 4I3GA 4S1FA 2VO5A 3GZAA 2G8ZA 1IQ8A 4UCGA 2VCCA 5A6SA 3T2QA 2QR6A 2HXTA 1HL2A 2VI0A 4TU1A 4GUHA 4V27A 4UTIA 3HURA 5EBAA 4LVFA 3ZMRA 4C6IA 1WKFA 1LWHA 1BF6A 2NLIA 4ZOCA 4C6QA 3SB0A 2OSXA 3UG4A 1TWZA 3GG0A 1UMYA 2JE8A 2HDJA 2VZSA 1OFDA 2X7VA 3WBWA 3EDJA 2BXVA 4LBSA 3CO4A 1QATA 1FY6A 1SPQA 4R3UA 3T0BA 3UJSA 4K36A 4GE8A 4PRRA 4YCOA 4MTVA 1EO5A 4ORIA 1P0KA 1H1ZA 4S3AA 2F2KA 2VKZG 4UOQA 5I7GA 4PN2A 2X16A 4KWOA 4HA1A 4UTWC 4KEUA 2OT0A 2HVNA 3AICA 4B2DA 3IK4A 2VDHA 2REQB 4GXMA 2CZ5A 1FWBC 3DESA 4I8DA 1J12A 1Y8BA 1KFBA 2PEVA 4Z1BA 2FMOA 4AWEA 3B0XA 4WD0A 1QOQA 2XU2A 3I4EA 5HINA 4Q4RA 3DYOA 5K9XA 3UXDA 1QBBA 2CC0A 3H4WA 1PVNA 4W7VA 3CQIA 5D2WA 3IRSA 1V3MA 4Z2JA 4ZGYA 4XV0A 5FF0A 4MNLA 3PNZA 3F4DA 2PGWA 3AAMA 1BWVA 1H7WA 2W92A 3R8HA 5I0DA 3HGJA 3FJ4A 3ECQA 2J7BA 1KRBC 1UC4A 2Z1SA 5C2CA 4CQBA 1H60A 4AAJA 1YXDA 5FOOA 2XFWA 4S3FA 1TIMA 1KWGA 2P0OA 3QKZA 1SSDA 1GW1A 5FKYA 1TB3A 2Y5SA 1ECQA 2VOTA 1W31A 3OU8A 3W85A 5CLTA 2VNCA 2PDFA 2FHFA 3GKAA 3CV2A 4FNQA 2CLHA 3GYCA 4NZ5A 1IIGA 4MHBA 2VZTA 2NQLA 1RQHA 2BVTA 4AZ5A 3W72A 4UZSA 4FLQA 3HQNA 3E96A 3GBDA 2VFIA 3NM3A 1K1DA 4YS1A 3C8FA 1XIDA 1DTUA 4HVXA 6TIMA 2A3CA 3KTXA 2J6VA 4GZIA 4FF5A 4D6IA 2OSWA 1W8GA 3REQB 3KL5A 5KZEA 3G0XA 2ZZ1A 2QGHA 1IZJA 2OZ8A 4DWSB 4H19A 1DWIM 4Y96A 2XN1A 4DM1A 1UUQA 1H11A 1GWJA 2PD9A 1PB0A 3PBUA 4RJEA 3SM0A 5AN7A 4JL2A 5E1QA 3ARTA 3BLLA 4HBKA 2ZE0A 4ZA0A 4H9ZA 5C7HA 3LBMA 2HSAA 2AGTA 3KUMA 5DY3A 2OZTA 3MHGA 5D38A 1HG3A 2FMNA 5D33A 2OLSA 2QCNA 3UXIA 1F3XA 1GHRA 5FEPA 4PGLA 5DMNA 1KGWA 1AW5A 1SVDA 1JPMA 1UC5A 2PU0A 2EPOA 2UV8G 5LA2A 2YXGA 1Q4NX 5K2ZA 4AH7A 4MFDA 3N13A 2BX7A 2W91A 1Q6GA 3S6TA 3EOUA 5KTLA 5HA7A 5HMEA 4OE7A 1K7XA 4GQRA 4A2RA 3WEZA 3O7UA 3FGCB 1KC7A 3VC5A 2TODA 4EK7A 1ESWA 2PDWA 1K77A 4KKXA 2ISVA 3E74A 1XH0A 2CKSA 5CQ1A 3W7LA 3AISA 2PLJA 2H3DA 4ZOEA 4XD4A 5BXSA 4MWAA 3QR0A 2HWGA 5BW6A 4JDYA 1JZ2A 3JU2A 1FCVA 2FZBA 4JZ5A 1P6BA 3RUBL 2V38A 4ZSUA 1C7SA 1ZALA 3GS6A 1G69A 1JXKA 4XKMA 2Z0IA 1FWJC 2V2HA 5CPLA 5BWAA 2CLLA 4UXDA 4N4QA 4PL2A 2BVYA 3ORWA 4IMCA 1UZHA 2GYIA 5LNSA 4PTMA 3DFPA 2HXUA 4Q8PA 1E6RA 2I5GA 1C92A 3KEHA 3ZWTA 3AIQA 2WCAA 2OPJA 3VA8A 2D2GA 1Z44A 2WKGA 2BHUA 3MP3A 1R0MA 1OZMA 1RBAA 1XGZA 1I1XA 1R3WA 4P7RA 3LPFA 1VHNA 4NJKA 2D73A 3EWWA 1XC6A 2VVSA 1OWQA 3FAXA 5IFPA 4QGCA 2ACQA 4AIBA 1BKSA 4GFSA 5DBUA 3NQEA 4K8HA 2ATSA 3IJDA 3TW9A 1PWLA 1SR0A 2J4GA 4LUTA 2A3HA 3AJ7A 2A3AA 1R7AA 1V3IA 1TTPA 3WJYA 3SUSA 4OIFA 2G5WA 1CGUA 1FVPA 3KVJA 1OX5A 3VDBA 1VS1A 2EPLX 4WUIA 5BCAA 1G4TA 1W17A 3B0YA 4WK9A 4IIHA 1F9CA 4IFOA 2C91A 4GZJA 3Q65A 1PUDA 3RHGA 2E09A 3GXNA 5DANA 1Q13A 2ZWYA 4XTIA 4LAKA 5A8GA 1RA0A 2NW0A 1IEXA 5FAJA 1H0GA 1L6GA 4MDOA 3N14A 4QJ3B 2ZUSA 3NEVA 5LXXA 5FEXA 3MCOA 3BG9A 4QG9A 3EXTA 3M44A 3S0CA 4AY8A 4E4PA 3NGJA 4GIEA 4UOJA 3QR3A 4Z1CA 1KRAC 4KF1A 3WG6A 1U30A 3MVIA 4GGHA 3QGAC 1VR6A 4R7JA 1OADA 3TYAA 2V3EA 1UBSA 1XPGA 3VNZA 3KE0A 3M0JA 2GZXA 3S1VA 3GHTA 3P61A 3QMSA 4U3CA 1XDLA 1IE7C 4JTKA 1K4HA 1F3WA 3IAQA 1RA5A 3A4JA 1OCBA 2GGGA 1UH3A 3GTNA 1F6PA 3VKCA 4CD6A 3VD7A 3SCRA 1I45A 2YSWA 4CVWA 3CUFA 3OBEA 4B5VA 3E0LA 3BC9A 1XH2A 1RJRA 3LEPA 5JH2A 1XIEA 3KAOA 3NUKA 4H4IA 3PULA 4XKYA 4E4FA 2XN0A 4JIRA 4LS0A 3RU6A 3INPA 5A5WA 4O16A 1TZZA 3NL6A 3IV3A 2JEPA 2CYGA 4NJGA 2DZSA 3Q2DA 2P53A 3GG7A 3MSDA 4W5UA 1VD6A 3WLTA 1EIXA 2CZDA 3GB6A 4H2CA 4OHQA 2ZZ4A 3HFTA 5CAHA 3RCMA 3VZXA 2W63A 4ZQPA 4B9ZA 1X1ZA 2Z2BA 4AHOA 2DVXA 1EHNA 4RZ4A 2ACSA 3RPDA 1B4EA 1QPNA 3DG6A 2V3GA 2XHYA 5HK4A 1HVXA 1GZGA 3W7PA 1QRQA 4FX7A 3NQMA 1OJXA 4IGNA 3UGRA 2ZTKA 3HPFA 3M5XA 4NSBA 4LTSA 4Y9AA 1JD7A 2FH8A 4GA8A 2VRJA 4YHEA 3VNKA 2V30A 5A6JA 1JL8A 2BOGX 3K8KA 2RDWA 3M41A 2PDIA 3ITCA 5CBJA 3UFYA 4ASTA 3GKFA 2O9OA 1WB0A 4S3CA 1TJ0A 2HBXA 2VZOA 1F7BA 3GUGA 1OVDA 2QJNA 4CU7A 1P0EA 3BAWA 3IVUA 4S2CA 4CD7A 2Y7DA 4R27A 4RE3A 4A35A 1PDYA 5IFTA 4FLRA 4Z0SA 1TWSA 4O14A 1OIMA 3VOJA 4XIAA 3VCCA 2PLCA 2CZFA 4FAMA 5DMYA 1ISWA 3IARA 4MB5A 1VRXA 1MDLA 1X97A 4Z1AA 1XYBA 8CGTA 1SJCA 4O0KA 3B9EA 1Q3NA 3TN6A 3MDUA 4NZFA 4R53A 4WF7A 1M7XA 1YBQA 3R58A 3TXVA 5C7VA 1G0CA 2VR4A 3V5CA 4J3WA 3W7HA 5DRCA 3HG3A 4QAIA 4FR6A 3LLFA 3S1XA 5I09A 2P8CA 4CNPA 3KW3A 1IV8A 3TEVA 3FIGA 4DM2A 3VMNA 3D46A 2TMDA 1BRLA 3K13A 3W7DA 1EQPA 3LDVA 1AZ2A 4YTRA 3NO5A 5D9OA 1MXGA 5KZMA 4GIRA 4DIAA 3QRHA 2NX9A 3P93A 5FSDC 3P8JA 4FNRA 1AMYA 3OVQA 4JPGA 2ZBTA 1HKMA 4ZO9A 3W84A 2H8ZA 1C90A 3EOLA 3IVTA 4WR3A 5BMWA 1EGVA 1SZNA 3ITTA 1NARA 1CXFA 5IBXC 4KMQA 3RK8A 2WLZA 4IIFA 1O5RA 3QTPA 4PMVA 4CD5A 3C5QA 5DXXA 1UZDA 1JJKA 2NVCA 4DQWA 1DORA 1A4LA 4KWSA 3R5EA 3M0XA 1VFSA 4JKLA 2GQ8A 4C6NA 4ZQNA 3WDHA 4U4MA 3REQA 4XZNX 2XN2A 2C3ZA 3SRDA 3LGGA 3T40A 3VCNA 1HKIA 2ZUTA 3TW7A 3PB2A 1EHAA 4UFKA 3BURA 3GNNA 3R2GA 1MW1A 2QKFA 4F4RA 1UP2A 1HT6A 1RQBA 3VGDA 2D24A 1J0IA 4EIVA 2CETA 2R24A 2DT3A 8XIMA 2X0HA 2YYUA 3B06A 1EF3A 4WOZA 1Q4WA 1J2WA 5C55A 3JW7A 3W7MA 5LNRA 1WZMA 3FY1A 2A7RA 3UJRA 3WDIA 2UY5A 3NDZA 5JBFA 1RAKA 1RCXB 1XM3A 1TVPA 4O0QA 4X3ZA 1ZP3A 4CU8A 1S2VA 4O8AA 1KV5A 4DB7A 1JCNA 1V6XA 4WJ8A 3BWWA 1TPB1 3DHPA 3S1WA 4HGXA 1IF2A 5AC5A 4GUGA 1FWTA 4Y9PA 2X1RA 5AC7A 3URNA 2PE4A 2F38A 3M07A 4IGMA 2OLAA 4FSAA 2D2JA 3UPMA 2Y8KA 5PTDA 5HQMA 7ODCA 1AA1B 4CQAA 2OO6A 3T8LA 1TO3A 1YE4A 4GH1A 2WZIA 2XUCA 1KM4A 3KBMA 5H91A 1GQJA 1CYGA 1AQMA 2R1MA 3EXRA 2NV1A 1GOWA 3EX2A 5XINA 4I7UA 3L4UA 3ZFHA 2JK2A 3DUGA 1RVKA 1G7UA 1XBVA 2WCSA 4EVZA 1OCQA 1FDJA 4D1JA 3ZYZA 3CZJA 1NQKA 2YCIX 1OF6A 3B40A 1JYVA 3ZR4A 2I16A 5A95A 5FL0A 2V67A 2NXGA 3BLEA 4DF1A 4WHBA 3CTLA 3UZXA 4C91A 5CZSA 4JHMA 4M8UA 1HNYA 2WMIA 1PKMA 2NX1A 3CZKA 4IJCA 4GI8A 3NPUA 3BICA 3RFAA 4ZQOA 1I4NA 3CUIA 3B9OA 1CPUA 1BVWA 3BAJA 1K9DA 1FP8A 1P1MA 2WVVA 2PZ0A 4BJHA 5LKYA 1XRSA 1J0KA 2CLKA 5M2FX 1EP1A 1C3FA 4URIA 1T0OA 3AHZA 3DBNA 4HPHA 4JIIX 1K7FA 4ROPA 1KKOA 2XIOA 1UR2A 1J79A 2DSKA 1ZFJA 1Y7VA 3AXHA 4GWEA 3NVTA 4HNUA 1R85A 2DSUA 1R30A 2OEKA 3Q67A 2WMHA 2P8BA 4TX6A 1MZRA 4JIEA 4IF2A 1UWIA 4PCPA 3I68A 1PKYA 2B7NA 3SUVA 3E02A 4XAGA 2AAAA 2XFFA 5DLCA 4TXEA 3WNPA 2E9LA 3EDDA 3N2TA 1XLCA 3N2OA 3EWZA 4IIBA 4AU0A 1JVNA 2OODA 3B9NA 1EA0A 4Q22A 5I23A 2GJXB 2Z26A 5KMYA 1OFAA 4JFVA 3ARUA 5KINA 4C5YA 4Q7NA 1BG4A 3TCSA 4JHOA 4NI8A 1EEXA 2IPFA 1UUMA 3DGBA 3NGFA 5DN1A 2F6XA 1DYSA 4O1CA 1HX0A 3GVGA 5FI8A 5HAOA 1B4KA 1EXBA 1H62A 4CQCA 2WCGA 4JQ3A 1AW2A 2CLEA 4ZB5A 1B3OA 1XFBA 1QU4A 2WZTA 3WLHA 1UKQA 4D8LA 3DFYA 4EE9A 3W29A 1BSLA 2J9ZA 3NZQA 5CZKA 5HR6A 3F03K 3PS7A 1JCMP 2YB4A 3AHVA 1O12A 4P8VA 1ML1A 4F66A 3K8LA 4PFMA 4X60A 1JG9A 1O7AA 1UR0A 3PUDA 3WQDA 2Z24A 4CEXC 4AEFA 2IKJA 1H7PA 4M0XA 1BD0A 2A7NA 4B5UA 5HUOA 3MP5A 1C9WA 1RVGA 3WENA 4S23A 3MMWA 3NNTA 3U2OA 3U57A 1DJGA 2GJRA 3B8SA 1V02E 3H7VA 3GG8A 4PE8A 3S2MA 1C8QA 3VZZA 1EDQA 1KD0A 4DO5A 3B04A 1ONWA 1FA2A 1B3WA 4L4LA 3HOJA 1E70M 1KR0A 1XWYA 3W01A 1XC4A 2OQHA 3DXIA 5AYYA 2E6AA 3EMQA 3W00A 1C93A 1OHLA 4ZZ9A 1U5HA 4CGTA 1X8CA 1MQQA 2D3LA 1E9YB 2V0TA 4BQ4A 3CV6A 2Y7GA 1QXLA 4HYRA 3FVDA 2DPEA 5GJNA 3PSVA 4IIDA 3UZJA 2QVHA 1YTDA 4YYCA 3ITVA 3KHJA 1C8XA 3THQA 5C70A 5T9CE 5AHMA 4ZO7A 4PCNA 3WCZA 3MPGA 4LB3A 4GFIA 3TJLA 1TFVA 3VVGA 5A8PA 4IMFA 1FBAA 2VUNA 1NSJA 3BGGA 3VGFA 2AL2A 4G56A 2E6YA 4IP7A 5HANA 3DN5A 2NT0A 4QLLA 1UG6A 1W1PA 3OGVA 4UTJA 1J0HA 4NXKA 4H00A 2O56A 5TNVA 3RM9A 2C8NA 4K8EA 4XQ6A 4JX6A 3LBOA 4UFHA 1UP0A 3BCFA 1JDAA 4BHYA 1YE6A 3WLMA 1PE1A 2DQXA 3PBWA 4R33A 2CEQA 3B9AA 4LV4A 1O60A 4PB4A 5LHFA 3PK7A 1VBJA 4IFRA 3I3DA 2PB1A 4X0NA 2NSXA 4GVHA 5K4ZA 1US0A 1G5AA 3PZQA 1M03A 5AZ1A 2B81A 3BMWA 4H04A 1BYCA 3G1XA 4RDYA 1LJYA 3GDBA 1TRIA 5KZDA 3UF9A 4LOCA 3UR5A 2Q8XA 3KXQA 3F7JA 3KBVA 1ALDA 5U4NA 1KM2A 3E9AA 2V68A 5H1WA 3TN5A 2SFPA 4DYJA 3ES7A 5EMUA 3GAKA 3UR7A 3RCYA 1SW0A 3ITXA 3BPWA 3W38A 4B92A 5B7ZA 2GSHA 4P7LA 4AISA 2VFGA 4MJ2A 4H9YA 1ONEA 4WSHA 4JKKA 2HQAA 3WJZA 2NWSA 3F4VA 3IV8A 3VKBA 2X1IA 1UB3A 3F4NA 4MKSA 2QCDB 3CXOA 3PWIA 3CPGA 1TMHA 2FDSA 1LP6A 2Y85A 4QDPA 2Z28A 4Q4MA 1WUFA 3PPFA 3IVSA 4CN4A 4G6CA 1TPEA 5I79A 1E4IA 1YQ2A 3NQ2A 3VZYA 4J9JA 4WEVX 3LXBA 3MMDA 2JKPA 3EPNA 4AIUA 2P76A 4H9VA 2J77A 3QKEA 1DV7A 4WOQA 3PB0A 4Y6GA 1FOBA 1UD2A 2Z25A 3KOFA 4ATWA 4Q8WA 5E5CA 3CUZA 3IGHX 3WEMA 3GHSA 1K8CA 3E2SA 2BXYA 2V5BA 3R79A 4OBTA 4QEHA 1ZTVA 1CLXA 2ZXDA 3WLSA 3ZT5A 5K3VA 3ARYA 3WL0A 3VIJA 1CXIA 3AXKA 1UJQA 1JPHA 3LXAA 4HHLA 1QMLA 3R7MA 3RLHA 1VBHA 1H1YA 2ZA3A 1M5WA 4CVUA 1HL8A 4DXKA 2GK1A 2CLFA 1JDCA 4JFWA 5K4XA 1HZYA 3GWQA 4DUVA 3VOFA 3D0CA 2EGZA 1XIMA 3LHVA 3WQGA 1RPXA 3CZGA 1DIDA 4DBWA 2HS8A 3T0DA 4LUYA 1JRBA 4JFUA 3W88A 5A6MA 2PA6A 2B7PA 3BLOA 3VNMA 1GG1A 4JGDA 4CQDA 3VDCA 4M7TA 1RHCA 3LM7A 4Y9OA 3BCJA 4JTJA 4PRTA 3VX0A 1JIBA 1HGYA 3KDNA 1G94A 1N55A 4RV8A 4NZ4A 2FZMA 2PWUA 4OT7A 4N2YA 5DXYA 1P0BA 1R9ZA 1A3WA 1P4CA 4A8LA 4RDZA 2PTDA 4JN6A 3HV9A 1TV4A 3R25A 4KESA 4GMEA 1NU5A 3CQJA 4FNPA 1TX2A 4GJIA 3N2BA 1X98A 3W87A 2VD8A 5B7YA 4HU4A 1S46A 3LNMA 2W62A 3ZVHB 2V69A 1KGXA 4GZ7A 4C6MA 1G4SA 1LQAA 1MDRA 5A8QA 2VGIA 2XYLA 3POHA 2VGGA 3WF3A 3HBLA 4RE0A 3DI1A 1FH9A 2YIHA 4XG1A 1SM9A 2J8GA 3O6AA 1I75A 4DWSD 4ML9A 2EPKX 1GZJA 1JI1A 3UXLA 1J0YA 1OCJA 4JEQA 1HXJA 3SGGA 3AS3A 1E0XA 1GEHA 3SCPA 1E72M 1I1WA 1KA9F 1RPKA 2QF8A 1QR7A 3B8DA 4MLRA 4WIWA 4H6QA 1XYMA 4R85A 4PTVA 1KM1A 1RD5A 3QOKA 4D6EA 3EEZA 3FCPA 3BOLA 3WIJA 5A2AA 3W7JA 3TCEA 1P6WA 3S1GA 3C4UA 4G7FA 3WH9A 4MWAC 1V3JA 4Z2HA 3WDQA 1KXVA 3UPWA 4KEZA 3FKRA 3GRIA 3APTA 1OBAA 4E4UA 1BXNA 3L4ZA 3K1DA 3Q58A 1W6TA 1CLVA 2GVJA 1AK5A 3UZZA 3WH6A 1BYDA 3IIPA 2WSPA 3VNIA 3LHUA 4TQTA 1L2UA 1Y65A 1WDWA 5AVHA 4IT1A 2ACRA 3STEA 4MDPA 1GJPA 3DYMA 2YL9A 5GNXA 2BNJA 4HB7A 1VH7A 1H7XA 3EXSA 5C6MA 1OD0A 3HF3A 2PWVA 2J7CA 3AJXA 3WK1A 5E9XA 4N0RA 1ADOA 3B4UA 2QDEA 2ZXAA 1LYXA 1XLGA 2QUMA 3UNDA 4I5RA 1TRDA 3G6MA 3RILA 2GK1B 2NZLA 1BQCA 4AX7A 2ZX9A 3ZT7A 3E0VA 2Z1WA 2YW4A 1BAGA 1ICPA 3L0KA 3N2XA 1XJBA 2C7FA 3MY9A 5HATA 3IIVA 1DXEA 3DERA 4ATDA 4MIMA 1PPIA 3N73A 3JZEA 1Q66A 4ICNA 2RKXA 4XZMX 1GW9A 3M7WA 3EWCA 3NQ6A 4HMEA 4MYAA 3F5KA 2P3EA 3L2LA 5TD4A 4EX4A 4Y9MA 3NQ7A 3T0TA 3APYA 5CPSA 4CCDA 4NNAA 1UJPA 1FWNA 3DFNA 4YPJA 4DYKA 1HO1A 1FP9A 2A0NA 2E1WA 1UIOA 1PBGA 2OYLA 3KOWA 1V0LA 3ITLA 2F61A 3NM1A 1GQLA 4G2DA 1WKYA 3QLLA 2YCLA 1K8ZA 3N9KA 4RX0A 4A8IA 4HNTA 3RPMA 3QQ1A 1L2QA 3NSMA 3W70A 3CH9A 1ZNNA 3OPSA 3STPA 2WNZA 1SW7A 2EXOA 2PPGA 4OKDA 2WO5A 1RD6A 3G6LA 4HCDA 2GWGA 3L2IA 2YGYA 5BOOA 1RXOB 3C52A 3VI2A 3L4VA 3SRFA 3WF2A 4NHVA 3GUWA 1UR8A 3PR2A 4YVXA 4A21A 1NVMA 4I5UA 1NQ6A 3EX4A 1YDNA 2DW7A 3QSTA 2OO0A 3K46A 4RZ6A 2OEJA 3TOYA 2PGFA 3AFBA 2IMRA 3A5VA 2EF9A 3JS3A 3VAVA 3HPAA 4K38A 3UWVA 4MNJA 3K8MA 1JAKA 3ZLGA 2PDCA 2BVDA 3VIIA 1VYPX 2ZA2A 2O55A 4HYWA 1R5YA 3NDYA 1FWFC 4U2YA 3VFCA 4Z17A 1NDZA 2Z1KA 1CXEA 3UEQA 5AOUA 3LTSA 4B3ZA 4ACZA 5ECUA 4R9XA 1T40A 1TV8A 1TSIA 2VM8A 1WOBA 3PTDA 3CUJA 3EEGA 2DZUA 3BQ5A 3L5LA 4PH6A 4PFHA 3LENA 3BAIA 4LVDA 1VPXA 4PMDA 4Y8FA 2HE8A 4HHMA 1M7JA 1S5MA 1NDVA 2E7FA 3HV8A 4GY7A 5AC8A 3TSDA 3V0SA 4HZ8A 4N9EA 5C9WA 2BG5A 5JIWA 3RXZA 2YYTA 3BMXA 4E8DA 1RH9A 1XV8A 1GOXA 3QF0A 3H21A 3AIBA 4C60A 4HOXA 4O12A 2TSYA 2Q01A 4NJJA 4BKNA 3MUZ1 1GQKA 4JTRA 1X38A 3ALGA 3GDRA 1KFKA 2NUWA 1OQFA 3LBCA 2PF0A 2W4XA 3PZMA 5JBEA 3ZVHA 4QDMA 2AL1A 4RDWA 1YDOA 4B4HA 1YX1A 1GJWA 3BJSA 1NTHA 2X42A 3ZOAA 1VPQA 3EOEA 4GQ0A 4TO8A 4J27A 3TMQA 1MNZA 2QPXA 2DDXA 2BFGA 5DBTA 3LM3A 1PCKA 4LUSB 1TPUA 4UTWA 4RE4A 3E0FA 4NY2A 1DIOA 2D1ZA 3R13A 5TQLA 1UOZA 5CJ5A 2Y5EA 5AECA 4J40A 5AB3A 4TUFA 2V6AA 4JNMA 3RMEA 2FFCA 4NKCA 3DFOA 1OK4A 3P3BA 1LT7A 3CUGA 1TYGA 4HPXA 4U5IA 5J04A 2EG6A 2AKZA 1DEDA 3PHAA 2WSKA 2PDUA 1Y0EA 3KZSA 4Y9NA 4LGXA 5GVJA 4RPQA 2VC6A 2QVNA 5EMLA 1EBHA 1K03A 1P0NA 3TQPA 3L67A 5D2YA 3ATZA 2WZHA 3N15A 4O10A 1V4YA 3MW7A 4JNZA 3T2OA 3FA3A 1U1HA 2XSXA 1EZWA 1G4EA 3IK2A 5BU9A 4AIOA 2A5HA 4HKPA 2P0IA 4C6KA 4ECLA 4HNNA 1XBZA 2BODX 3WBAA 1TUFA 1TV3A 1S2WA 3SURA 3EB2A 3SY8A 3VDGA 1E0UA 3HQ1A 4P8WA 1KCZA 3SFWA 2VURA 3QY6A 3E6EA 4NF7A 4HA0A 1LG2A 3GH4A 3HFYA 5A6BD 4W8AA 3AU2A 5REQA 1XIIA 4WKAA 1V0KA 1J01A 1GGOA 4M24A 2OCZA 4O17A 4ADTA 2B7OA 3WFLA 4JEJA 4U33A 4QE5A 4GI9A 4LU0A 1WXZA 2PWFA 1XLDA 5F2GA 2QV4A 1G7VA 4XWUA 1VB9A 3I6EA 5A2BA 3O0KA 5JH1A 9RUBA 4J3UA 5AYBA 2FDMA 3OVPA 3MJYA 5AHNA 2FGZA 1WKDA 1F5ZA 2XPKA 3SW6A 4AD4A 3L2MA 1OT2A 1I8JA 2PGEA 4A8RA 1QASA 5HMDA 1LROA 3S6DA 3QPYA 4FZIA 2PP0A 4JTQA 3RX2A 3S4TA 3M9YA 4D6JA 2VEFA 4H7ZA 2QJIA 4E2BA 2FGLA 3KBNA 4RW3A 4EAYA 5KETA 4HQVA 3CB8A 3JZUA 1M68A 1UD3A 3HN3A 5A6AA 1JUEA 3DKLA 3VMOA 4MWAB 3CIVA 3VOHA 3PTMA 1C8YA 1QO5A 1K6WA 2CNCA 2ON3A 5CPMA 1UQYA 1Q65A 2F9RA 3W1PA 1CI1A 3LLDA 4ATLA 3WK3A 3N2CA 4LQ1A 2FIQA 3ABZA 2GVEA 3W1QA 2CHRA 1X1NA 2DP3A 3KM8A 2Z4GA 3UA4A 2REQA 4UNLA 3UD6A 1N8IA 4BR1A 3VCRA 4O4WA 3CYVA 1WAWA 4RLIA 3WJXA 3PJXA 3WUBA 4E2VA 1EZ2A 1MW0A 4I8YA 2POZA 1QWKA 3UNTA 2YBTA 4P7QA 1LBFA 2BOFX 4L6HA 4O28A 1IGWA 4E8GA 4TIMA 1Z89A 1HUVA 3EDFA 3WLOA 4DBSA 1RCQA 2VJXA 4DPPA 4IG2B 2HROA 4UTHA 1V6VA 4GC3A 2V5KA 4U5KA 1PEZA 2V5DA 5M1TA 1B3VA 4IIGA 1E6XM 1VBGA 4XAPA 1D3CA 3RITA 2WM0A 3G24A 1QDSA 4M6VA 3W53A 5LHEA 2DVUA 1V77A 2G37A 2KX9A 3BTNA 4L64A 1EEPA 3W74A 1GVEA 2Y2WA 5FD0A 2JFEX 5CZ0A 3DEQA 4LAOA 1PHQA 4XB3A 3DKJA 3L5AA 1QPOA 3RLUA 4X9YA 3KZPA 4FNSA 1TMLA 3VTRA 5AHIA 4DXVA 1KXHA 2HZGA 1R46A 2VT0A 1RBOB 4ZCWA 1SO6A 1ZAIA 5CLWA 1M04A 3P67A 3CT2A 1TPC1 2PDJA 3CBWA 4RZ5A 3WL1A 4J3XA 2J79A 1JZ5A 3CAVA 2DUAA 3NQVA 1CXKA 4UMAA 1UASA 4EP8C 5LXEA 3OIHA 1XI3A 1G67A 4M19A 2O9RA 4WDWA 4YLWA 3G22A 1NOWA 4OV9A 3ZO9A 2I9UA 1OEPA 1GZ1A 1BYAA 1S5TA 4FS9A 3WBEA 2GOUA 1VFTA 4N42A 3NZGA 3EWXA 3IJ9A 2JBMA 3ZZ1A 4LRSA 1W9PA 4QQUA 4UTTC 1XYZA 1PKNA 5I07A 3AIWA 1YXYA 1GVIA 1G9HA 4FALA 2P5NA 2PMQA 1P7TA 4L1GA 4LNYA 3BAYA 2VP8A 3FSUA 3MCMA 2YA2A 3LHZA 1F6KA 3N4FA 4FEZA 4ZVJA 5ENLA 3QQWA 4E5TA 1KB3A 1J18A 5HNNA 2DIJA 2OSYA 1CENA 3GNPA 4C6FA 3OBAA 5AVNA 4AY7A 3GAYA 1XIGA 3EA3A 4RNJA 2A3BA 4XZWA 4E2OA 5G1YA 1XLBA 2DFAA 5FJRA 2OKOA 1POKA 4PMQA 3IGSA 1H41A 2JALA 7REQB 3VD4A 1W3KA 1E9IA 3OIXA 3R1ZA 7CGTA 1AH4A 1J6PA 1W3HA 4NAEB 3N2MA 4H2HA 3RLVA 4A6GA 4ZBCA 3WD3A 3W2LA 1H7OA 3IPWA 3EPOA 4PEKA 2E4TA 4R88A 2GQ9A 2CBVA 3AQUA 2Q8LA 5M5DA 3W02A 3UWYA 3EMCA 1H5VA 4FXFA 1EQCA 3O8AA 2QLYA 3NO3A 2NVDA 4KCUA 3LMYA 1KFJA 2E0PA 1EJ7L 1T8XA 5TAOA 2WVVB 1RV8A 1F4AA 3MVTA 3V0TA 1PZ2A 3GHRA 3KLKA 1OSEA 1HJVA 1RSCA 2E5DA 1VFUA 2VUYA 4JHZA 3MBDA 3A21A 4J3ZA 5E70A 4DN1A 3U7BA 4D6GA 1N2VA 4PCFA 4C6EA 3L68A 3THCA 3ZLFA 2X2GA 4F0KA 1H7RA 3G1SA 5I03A 5IBXA 2RHGA 1ISVA 1V0MA 4Q33A 4Q8NA 4FOUA 1KFEA 2Y62A 3PC0A 2TAAA 3M0IA 4W85A 3P82A 2E68A 1DXIA 3MB9A 4HU8A 4PODA 3V36A 3P5ZA 3H4GA 3PZGA 3SN4A 3GBEA 1TTJA 3GXIA 5C2XA 1O1ZA 3MV01 2VX4A 3NAVA 4W87A 1UH2A 2CBJA 2XTKA 1WX0A 3W26A 2CWXA 4LFYA 3SN1A 4O4VA 1K9EA 3FSTA 3TTOA 1M7PA 3LI1A 1TPH1 4O19A 1LOSA 4ZL1A 4BI5A 3USBA 4KGJA 4EF8A 3TAOA 1W5NA 3B0PA 4UNKA 4MB3A 4XD3A 3MSRA 3UERA 3CTTA 1CGWA 4GJ1A 3BSGA 3GM8A 4HT3A 3BMVA 3FJNA 1Z32X 3ID7A 5DF0A 5D02A 1HJSA 3KOXA 4RXGA 2Y70A 1E3XA 5CZJA 1KBIA 1HW6A 3NZPA 2IPJA 1QW9A 3G77A 3U5YA 1JNDA 2ZC1A 4AX6A 2FJUB 1XLIA 3MUIA 1VJZA 2ZX6A 3TNOA 3COTA 2VFHA 3VD5A 5K7JA 1ZJBA 1JCYA 4K68A 5EMYA 5JU6A 3UG3A 4AD2A 1V93A 4S38A 5CZTA 5LIKX 2YDQA 1SUXA 2J47A 2QJGA 3PG8A 4AF0B 3RJYA 1SZGA 3HJEA 1FFRA 4CKQA 1JUBA 2JKAA 4WY0F 5CBIA 4US5D 5CXPA 1LUCA 1S5NA 2YLAA 3BCDA 3N29A 4QE1A 1DHKA 4V33A 3DFQA 1LBLA 3THDA 3CHFA 1D3GA 1EJVC 2TYSA 4LF2A 2HTMA 1RBLA 4REQB 3A6OA 4XUGA 1TUXA 3CAQA 4GK8A 3AWOA 3W1MA 4BI6A 4I9AA 3PBGA 3MHFA 2Y89A 3C0SA 3B0VC 3F2CA 3OLEA 2Z7KA 5LGZA 1QCWA 4PSPA 2QYGA 3J7HA 4CNNA 1QK2A 2CKRA 4UQAA 1FX6A 2F7FA 4KFOA 2ZZ3A 4Z2KA 4NZJA 4XBJA 4O0ZA 3TKFA 1FWAC 4I6VA 2R14A 2VX5A 5D03A 4O8RA 1AFSA 1B3XA 2YPIA 3AS0A 3BG5A 1LTDA 3GX9A 4QBXA 3HU7A 1FTXA 4IFKB 5FJJA 3S5OA 4JTTA 1QI5A 4IQLA 1B5TA 4KCTA 2PURA 3DFSA 4IMAA 5GNYA 4W93A 2DY3A 4O1DA 4UIOA 2A21A 3AMKA 4LALA 1JR1A 4YTTA 1A3XA 3UY8A 3TK7A 4XISA 4GGBA 2XIIA 4PTDA 5HMSA 1Q6RA 1KFWA 4UOZA 2YL5A 2FZNA 2C1IA 2Q3RA 3UWUA 1EPXA 4QHRA 3VFLA 3L66A 3BQ6A 1NFPA 4TV6A 2ONEA 1WP6A 1TCMA 5D9MA 3AYSA 1FDYA 4IM4A 1AH0A 3W2NA 4D2JA 1SJDA 2V9DA 3M0HA 4GACA 4DWSA 1GVFA 4W5ZA 3AUJA 1F07A 3TJ4A 3NQCA 1K3UA 1ZCOA 4J2MA 2CU0A 2PTZA 3OODA 3TYCA 4CD4A 1LLWA 1Y5WA 3MCNA 4IH3A 2C6QA 1HKJA 3FFSA 4ZB0A 3GDMA 1EH9A 2R82A 1TZ7A 1VIZA 5A6BA 1KW1A 3HG2A 4YMZA 4YHGA 2CLOA 3I3EA 4Q7BA 3A24A 4PMUA 1E9LA 5CPQA 1FWRA 4M80A 1QI4A 3KBJA 4IHCA 1W54A 2FJKA 4XO6A 5BZAA 4EACA 4K6AA 4P8UA 1IXOA 3QHOA 3GH7A 3ZJ8A 1KGUA 2FTWA 1QNRA 3AIRA 2YOCA 3URBA 4EF9A 4PUKA 3RF9A 2BSLA 3ABQA 4D6HA 2ZUVA 3OVRA 1IZCA 3R8GA 3MKVA 3WUEA 1ZSXA 3P5YA 3PZUA 3II1A 4ZQCA 1OB0A 3WUFA 4MJZA 3E0WA 1FCBA 2I1OA 3QFEA 4DI8A 5AYIA 5F2LA 4FIRA 1SR9A 3FDGA 5CBBA 4LYKA 4BZYA 2R91A 5LIXX 4M29A 3LHYA 4PL1A 3AS2A 2O92A 1PXGA 4L9YA 1G01A 3WLQA 2CIPA 1CGVA 3G2GA 4JYDA 1VCFA 2I7GA 3UP8A 3W28A 5IOBA 4DNMA 3QSRA 1N8WA 3HPXA 4NG3A 3EWBX 1XG3A 4DJDC 2VRKA 3MJMA 2WM1A 5D8ZA 3AHXA 4G8TA 3DZ1A 4K7VA 3WLLA 5E9AA 1ZBCA 2X09A 3JR2A 4D72A 2PWEA 4TVCA 4ZFCA 3SJ3A 2J75A 4DAIA 1EJWC 1Q8JA 4EPDC 3BVJA 2FTYA 5CPOA 2VDIA 3OVGA 3KCLA 4L6DA 3VNYA 1GONA 4ML4A 1FWEC 2NQ5A 2I17A 4HU3A 1JAEA 3WLNA 4RE2A 1A47A 3W75A 2VWSA 3WQFA 2OYMA 5F7UA 5A6LA 4LCRA 1BEUA 4DRSA 4JTFA 3PJUA 3S9IA 2J88A 2AAMA 3TAKA 5FEWA 4ZE5A 3TJXA 4DWDA 3CGTA 4QSFA 5F2MA 2P1FA 3ZXWA 3LG3A 4H01A 3QPZA 1Q7QA 1C29A 4V1YA 3SCSA 3LRMA 4O52A 1H0IA 5A8MA 5I24A 2BP1A 5M17A 3H55A 2FB3A 3LHTA 5CCZA 2CLIA 2QUTA 3UA3A 4Q3MA 1TJ1A 4L80A 4JYFA 1R87A 5AKQA 3TA6A 2W61A 4MOZA 4OZOA 4UTMA 3SUUA 1OINA 2QCGA 4XK2A 1EWDA 5BRPA 1MZHA 3EX6A 3KOZA 1UROA 3RAOA 3H70A 2PDXA 3BLKA 3W7GA 2UZ9A 1LL7A 2YZ5A 4DJEA 1GVSA 3QV7A 3CB3A 3GTIA 4Q4QA 5G4WA 1DP0A 1GOOA 3G1RA 3QYQA 1A5CA 1FKXA 5G4EA 1I2NA 1I9CB 3OQEA 4DF0A 3GNRA 4JAWA 3TLQA 1RJQA 1DWGM 1A5OC 3VD9A 2V82A 1JF6A 3BV7A 1T7LA 1FH8A 1K7EA 1ZY9A 4H6RA 3I10A 1QFEA 1CB7B 3B8WA 5BWFA 3VMPA 4IX2A 3QHNA 5D09A 2JQXA 5CJNA 3W6YA 3W7OA 4QEEA 2XWEA 4OFCA 1O6IA 3ERPA 4MVAA 3WQ8A 5BU6A 3CHDA 1E1EA 5F2IA 1ISZA 3MU7A 4DJFA 4CNOA 1JRCA 2VYOA 1IIHA 3LQGA 1K8XA 2WMIB 4HHHA 4DY1A 4W7UA 4C6OA 2FZDA 2ZX5A 2WNQA 4CNTA 1NP2A 3GIPA 3WBXA 4ONVA 2Q3OA 3VKJA 4QDWA 1ONRA 2QF7A 5CGMA 2FKPA 3WFZA 1JYNA 2YFNA 4JFSA 2VZUA 5FJIA 3W24A 1E6QM 4R9OA 3R12A 5BOEA 1R8LA 1X6NA 1E1FA 4DUWA 3O15A 3OB8A 4LUIA 3WH5A 3V5FA 4BQ5A 3OA3A 3LCHA 1Q5MA 5AY7A 4H6KA 4LJ3A 3WDJA 4NJIA 2EJAA 2HPIA 4MPQA 4XO7A 2ZVIA 4EPEC 1VFMA 4GHRA 3SQSA 1V6YA 2C71A 1ZUAX 1XYLA 2B7QA 2GSEA 1REQB 5HWJA 1T96A 2Y63A 3CZEA 1DJQA 3LNPA 1V7YA 1R3QA 3EWYA 1OF8A 2ZE3A 1WOAA 1O5QA 1EBGA 2BLEA 1EO7A 4GH3A 5C71A 4FNUA 4UC5A 2NV2A 2IXUA 5CSUA 5E0FA 1QBAA 3KTSA 3PWAA 5F4XA 4PTNA 2ZUNA 3HGSA 1A5UA 2X1SA 1ADDA 1TCDA 2D69A 3VINA 3VD3A 2H9AA 3VDAA 4GKTA 3NPWA 5HDRA 4F2BA 1VFOA 3WJWA 1NH6A 2ZRZA 4I9JA 5HJXA 3W27A 1S5VA 2OQYA 4L4MA 3P2VA 4AYGA 5JIPA 1IEQA 2CWNA 3O6DA 1E0WA 1OY0A 1ODUA 4C6PA 3PZVA 2UY4A 1EFZA 1S3TC 7PTDA 3WD0A 3T55A 1UWUA 5FSEC 2F8QA 1WAUA 3PJTA 1NWRA 2I5IA 1K70A 2NX3A 3WK0A 7A3HA 2HV5A 2Y6ZA 4GVFA 1QNOA 1MEHA 3QHMA 4GUJA 3L7RA 5XIMA 5HOSA 1UPPA 2EKGA 1PJ9A 1B3ZA 1ZLPA 2ZZ2A 3C0QA 4MLJA 1SJBA 1YYAA 2PCQA 2V2DA 3IJ7A 3VK5A 3SO7A 2X1UA 3BUVA 4FXSA 3TC3A 1S39A 4XTDA 3FXYA 4FF7A 5LNWA 2NQZA 1T6MA 4PMZA 3PZNA 5L6UA 1LRTA 1XLMA 2Y61A 2GVLA 2QEZA 3NIYA 4RXFA 1IXQA 2KAUC 3V1PA 3AUOA 4UBPC 3B05A 4L7ZA 4Y2WA 3OZYA 1B31A 3NZRA 4AD0A 4PSRA 2PUZA 3QC3A 3IRDA 2A3EA 4X63A 4POCA 1S2CA 4AC7C 2XGIA 1AL8A 2WMGA 1E5NA 4GD0A 3PAJA 3BW2A 3C2VA 3MP4A 1V6UA 4PYSA 4PBFA 1CTNA 2YA1A 2GQ3A 1V02A 1GPWA 1C7TA 2YJQA 5DX7A 4KERA 4FA3A 1UKPA 1JI2A 3OZMA 2FQIA 3K4AA 3LA4A 4ENLA 4BF5A 1QJWA 1PSCA 1BHGA 1T41A 3LZ5A 4S2BA 4HTYA 2MANA 3ZS4A 4J4KA 1D8WA 4A05A 3OTRA 2QCEA 4LS2A 2AMXA 1FHVA 3S5YA 2VX6A 4R34A 2G4JA 3EGJA 1VENA 4EANA 3SECA 3UU0A 4INFA 3ANVA 4GOAA 4MADA 1BWKA 1IT8A 4H7VA 4LPCA 2DVTA 3DX5A 3T44A 5I78A 5AHLA 3W1RA 1KO0A 5I3KA 1A5NC 4O1AA 4JD4A 1Q63A 3T2PA 4PZVA 1ENUA 4WDTA 3UQNA 4MZYA 3FS2A 3WH8A 2QAPA 2ZXBA 4AD3A 1YADA 2J9YA 4QISA 3RR4A 3GG1A 4O11A 3M16A 4HA3A 3OZPA 3XIMA 1A5AA 4AUBA 2DH3A 2J7FA 1NDWA 1V79A 3GNXA 4NZ3A 4JQ2A 4QFUA 1I0DA 4IIEA 3AMLA 1K8YA 2BXZA 2O7QA 2I56A 1CZ1A 3VGGA 3WY1A 3DFTA 2XIBA 3CZ8A 1UWSA 2Z27A 1B9ZA 1XDJA 3RDKA 2H6RA 1Q8AA 1XXXA 4WY0B 3BE7A 1AH3A 4ACYA 2BASA 5ABGA 2XVKA 1HFBA 5A8NA 1HTIA 3VIMA 3NOYA 1Y5XA 4MKNA 3AMDA 2ICSA 3MKCA 3H24A 3CEUA 3U7VA 4LRTA 1J4EA 4KEVA 3TYUA 2A7PA 4MGGA 3TH6A 4K2SA 2L5HA 1KBBA 4ZE4A 1ME9A 2GWNA 2OX4A 3SIMA 1XIJA 3VILA 3R0KA 2P10A 4RW5A 4ORMA 2Q8ZA 2ZOXA 5BRBA 1GOMA 2XIMA 1TJ2A 2WBKA 3RGTA 5LA0A 1Z41A 1VEOA 1E6ZA 1WKEA 5EMJA 3U2CA 2IQ0A 1EUAA 4ERIA 3UZWA 1XLKA 2BBFA 2J7DA 4LCQA 3KL0A 1SGJA 3GQYA 1AL7A 2WQPA 3TTQA 1FWWA 3MUY1 1TVNA 3T1GA 3NJ3A 3TYDA 4PULA 1WDDA 2WZEA 3WDPP 3U5UA 1X1OA 1W2VA 6A3HA 5U7SA 1LG1A 1HVQA 4GCAA 4A8NA 5CGTA 1AQHA 2W5FA 4MM1A 3S2JA 1SFSA 3QZ6A 4HNCA 2G97A 3U6WA 1PX4A 2PTXA 1SU5A 4YVPA 3M4HA 4C6BA 4UCFA 5CH9A 1PZ3A 2E9MA 4QNWA 2E25A 2QV5A 4QNEA 3HTWA 3NQ8A 1B57A 3WQVA 2EPMX 1AUSL 3U8GA 4L9ZA 5CSYA 1XR2A 3B8UA 5HWNA 3GDLA 2R6OA 3ITGA 2YCJA 4LAZA 4MY1A 1NM9A 3TR9A 3GW3A 1SO4A 3JUGA 1V3LA 2QIWA 1ZB5A 1FCUA 3FNDA 1XHGA 2ZADA 4UWMA 4ZQRA 1LL6A 4JTAA 4PTXA 2QS8A 1FHLA 3E5BA 3ARZA 1SQ7A 4PMOA 1ZPTA 2PC8A 3LB0A 1Q6LA 1X8FA 2BY3A 3TROA 4HHPA 3OYZA 2ZVRA 3POCA 1VLIA 2ZDSA 2CHNA 4XKYB 3N12A 4QP0A 3SCVA 2YCEA 2GUYA 3SUWA 1K9TA 1MXSA 4V28A 3LYEA 2PS2A 4RNFA 1XYCA 1X7FA 4KWWA 1OX4A 4XUYA 3JVAA 4PCSA 3WQWA 1NOFA 3TTYA 1LL4A 3PFMA 5FA5A 5GNZA 2HJPA 2ASHA 3RG6A 3TONA 1A5KC 1DVJA 1VHCA 1TELA 1AD4A 2GGIA 3VPLA 2ZRVA 1UA7A 3GFZA 3WMSA 4N9CA 2IS7A 3RLGA 3OOQA 2FGBA 3T09A 4RV3A 5ABFA 1PX8A 3NYDA 5KEZA 1XG4A 3MUXA 3KL3A 4U2ZA 1HJQA 3FX4A 4ZOAA 3VIKA 1PCWA 2I14A 3UWZA 3CV1A 4C6DA 5E6ZA 1C9DA 3BANA 1XSJA 1PTDA 4YN5A 4DVOA 1O66A 1H49A 4GI4A 3T0AA 1QNQA 1MEIA 5AC4A 2XDFA 3ABOA 4Z08A 3A47A 1XF0A 3NPVA 1V6TA 1JFXA 4C1NA 1X6LA 2HK0A 1S1RA 1TR9A 4J28A 2O7SA 2V2CA 2ZX8A 4GYPA 4JX5A 4MKVA 1E6PA 4Q8UA 4QAWA 3OW1A 3VO0A 2VQUA 1KCXA 3P0WA 3WEOA 3ZQ9A 3C8NA 3ABRA 5DCBA 1MNSA 2XVLA 6CGTA 4DJFC 1TPWA 4J3VA 5EBUA 5C9UA 2YW3A 1DIKA 2O4MA 5T91A 3OO2A 1NF0A 2PTWA 3IUHA 5GQBA 4DUOA 3UR8A 1U22A 4A29A 1N82A 4PMYA 3ZSSA 2A2IA 5T8GA 5JQ9A 4LYRA 2CCRA 3B03A 1WBHA 3L23A 4Y8EA 2W0UA 1Q6FA 2PDQA 2G3JA 4UR7A 4HZMA 3BV4A 4EOUA 2WSYA 1RLCL 1D9EA 4AG0A 2C1GA 5FF2A 4XD6A 4C1LA 1E15A 5IHRA 2PD5A 5CSSA 2NWRA 4LS1A 1QHZA 4J3TA 3B8TA 4Q8QA 1SJAA 4LEQA 3HIJA 3QGKC 1OFQA 3LPOA 1C8VA 3NL5A 2NT1A 4L4PA 1VJIA 4GJJA 2QQ6A 1W3JA 5DELA 3OLGA 1X39A 3CK5A 5D04C 1GORA 1R3VA 1YTEA 3XINA 5HWMA 1MFUA 3MO4A 4DBDA 5CG7A 2JIEA 5CG0A 3WFAA 3SR7A 1DE5A 1W37A 1KCKA 3LK6A 4W84A 2BB0A 2QHAA 2A3LA 2DZWA 2E8YA 2WHMA 5G2HA 4DZHA 1XCWA 4YCPA 4MAZA 1DQWA 1EDGA 1LT8A 1BQGA 1W2PA 3G3MA 4PC8A 2VEMA 1GNXA 4IUOA 1R2SA 2FHCA 4AZGA 1E43A 2PDPA 2DT2A 5IXEA 1R47A 2FH6A 1ZJHA 2D0HA 2OYKA 1W5QA 5I3GA 3SY1A 3NQBA 3U48A 3BAKA 4ES4A 3GYEA 3SGUA 3CJPA 1DBTA 3L4XA 1PIGA 4M6UA 4MY9A 4DO4A 3W2MA 2WVTA 1JEZA 3IGUA 3MS8A 3R4IA 1JCXA 3OZOA 1AW1A 4NX5A 1EX1A 1M65A 4H9XA 4WDUA 5A1AA 5D9PA 1HO4A 1D3HA 1NWUA 4CEUC 4H6EA 4PUDA 1CX9A 2VVNA 1Q6QA 2VENA 1B3YA 3C3NA 2H9AB 1XKYA 2IPGA 2QDDA 1THFD 4F3HA 4K3ZA 3UJ2A 4QJ4B 3UXAA 3SADA 1TV5A 4FXJA 3BGJA 1LUCB 5TF0A 2FTPA 4NILA 3SSJA 3VUSA 5KSWA 1BSIA 3UWEA 1E6NA 2YR1A 1UD4A 3W86A 2RFGA 1MUMA 2OKTA 4S3BA 2WKJA 3TIMA 4BA0A 4ZO8A 3CMGA 4MFEA 3B3DA 2DV0A 1HP4A 2D0GA 1GQIA 1D2KA 4JBRA 4HIBA 4KRZA 4JTEA 1QHOA 5IM51 1BKHA 4UNIA 3TZNA 3TYZA 1OFEA 1YPFA 1Q7ZA 2Z2UA 1SZEA 6XIMA 4D6DA 1PV8A 1WDQA 4ZENA 2ZFAA 3TQVA 5CJMA