1FHVA

Crystal structure analysis of o-succinylbenzoate synthase from e. coli complexed with mg and osb
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
323
structure length
322
Chain Sequence
GSAMRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGREGWGEISPLPGFSQETWEEAQSVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILKLADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNPDYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQVRRWPGSTLPVVEVDALERLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activity in the enolase superfamily: structure of o-succinylbenzoate synthase from Escherichia coli in complex with Mg2+ and o-succinylbenzoate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords O-SUCCINYLBENZOATE SYNTHASE
total genus 106
structure length 322
sequence length 323
ec nomenclature ec 4.2.1.113: o-succinylbenzoate synthase.
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1fhvA01
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1fhvA02
2P0IA 1MNSA 3DFYA 2P3ZA 1TE6A 3I6EA 1RVKA 4HCLA 2GGGA 1ONEA 3MKCA 3RITA 3MZNA 3MSYA 1L8PA 3V3WA 3QLDA 3VCCA 1XPYA 3TQPA 2O56A 4H83A 4DX3A 1E9IA 1MRAA 1SJAA 3R10A 3OW1A 4YWSA 2XGZA 2AL2B 3FXGA 3PWGA 4H2HA 1WUFA 2P8CA 1DTNA 4GIRA 1IYXA 4X2PA 3BSMA 3R0KA 3SN0A 2AKZA 4Z1YA 3IJLA 3MY9A 1P48A 2HZGA 3KUMA 5FJTA 4IHCA 4IT1A 2ZC8A 3DG3A 3IK4A 2GDQA 3T4WA 4E4FA 5J04A 2OZ8A 4HPNA 3ZLHA 1F9CA 4H19A 3U9IA 4HNLA 3N4FA 3B97A 1ECQA 4G7FA 3U4FA 3ZVIA 4E6MA 2OZTA 4KT2A 3FVDA 1SJCA 3P0WA 3BJSA 3D46A 3TWAA 4ZA0A 2PTWA 2OKTA 3TWBA 4HNCA 2OLAA 1PDZA 2ONEA 5ENLA 4IL0A 4A3RA 3T9PA 3R25A 2P8BA 5FJUA 2XH7A 3UGVA 1R6WA 3EKGA 1TZZA 1W6TA 2PU1A 1BKHA 4IP4A 1FHVA 2QGYA 2PSNA 5FJOA 3V4BA 2QQ6A 2CHRA 2DW6A 2PTYA 2PGWA 2QVHA 3ZVHA 2QJMA 3RRAA 2XH4A 3STPA 4GYPC 1NELA 3CYJA 1KCZA 1NU5A 4J1OA 3UCDA 5EU9A 3GD6A 2MUCA 4E5TA 3TTEA 2NQLA 2HNEA 5BOFA 3DERA 4ROPA 4HYRA 4GMEA 4M6UA 4K8GA 1SJDA 1JPDX 3QTPA 3JZUA 3VA8A 4FI4A 1EC8A 2PODA 3CB3A 3H12A 1EC9A 4GISA 5BOEA 4GGHA 3N6JA 2XH0A 4JN8A 4JN7A 3S5SA 3QKEA 4ENLA 3I6TA 3NZGA 1ELSA 3TW9A 3ES8A 3V5FA 4IL2A 2P88A 3TJ4A 3GO2A 3VC5A 4H1ZA 3SJNA 3THUA 4FP1A 3IJIA 2HXUA 2GGHA 1XS2A 5IDZA 4G8TA 2AL1A 3MUCA 2PS2A 3VDGA 2OPJA 3R11A 1P43A 3CK5A 3DESA 3T6CA 2OZ3A 3R0UA 4HCHA 3OPSA 3H7VA 3TJIA 3Q45A 2PTXA 3DIPA 2QJNA 2MNRA 4E4UA 3OTRA 3UXLA 4GYPA 2HXTA 4M0XA 3GC2A 4DWDA 3PK7A 2GGJA 2DW7A 3IJQA 2POZA 2ZADA 3CAWA 2OQHA 4HN8A 3ZLGA 1OEPA 3HPFA 2OO6A 2PCEA 3VC6A 3RO6A 4ZCWA 3UJFA 1FHUA 3Q4DA 1WUEA 2PA6A 3P93A 3MQTA 2AKMA 2OVLA 3S47A 3CT2A 3NXLA 2QDDA 3RGTA 1JDFA 3TCSA 4DHGA 3RCYA 4K2SA 2PP3A 3ZLFA 3OP2A 3OZYA 4MMWA 3T8QA 3ENLA 4HCDA 3FV9A 2I5QA 4GFIA 1BQGA 2PP1A 3R1ZA 3I4KA 4MKSA 2GL5A 1EC7A 1MUCA 2PGEA 3SN1A 3PWIA 4KEMA 3K1GA 3UJSA 2GGIA 2XH2A 2QJJA 3SBFA 2RDXA 3H8AA 4IP5A 2PPGA 2GSHA 2OG9A 4DYEA 3OZMA 2OQYA 3VCNA 3H70A 4Z17A 4E8GA 3DEQA 2QDEA 3ZVHB 3V5CA 2PMQA 4EWJA 3MWCA 4J3ZA 4K1WA 3UJEA 4GGBA 2OX4A 1KD0A 1JPMA 3DG6A 1KKOA 3FYYA 4IZGA 2PU0A 6ENLA 4DXKA 2XSXA 2PTZA 4JHMA 1EBGA 1JCTA 2FKPA 3D47A 1TKKA 3EEZA 5FJPA 4A35A 2PP0A 3GY1A 3BOXA 3UCCA 3QN3A 3PFRA 4KPLA 1MDRA 3N6HA 3N4EA 3JW7A 3VFCA 3JVAA 3ES7A 3FJ4A 4F4RA 3DG7A 5FJRA 4A6GA 2GGEA 1YEYA 3DDMA 3SSZA 4KWSA 1SJBA 3SN4A 3UJRA 1KKRA 3NO1A 1MDLA 3QPEA 2OFJA 7ENLA 3DGBA 1PDYA 2AL2A 3DFHA 1R0MA 4MGGA 3RR1A 3NFUA 3UJ2A 2FYMA 3CXOA 3FCPA 3P3BA 3UXKA 3TOYA 1EBHA 4DN1A 3SQSA
chains in the Genus database with same CATH superfamily
2VZTA 4U4MA 4BURA 3WQVA 3LOTA 1KM2A 2CWNA 4UC5A 1ENUA 1LQ0A 1Q45A 1AH3A 4M5PA 3QQ0A 1YTKA 4G7EB 1D7FA 1GEHA 3V3WA 3HG5A 3TR9A 2E09A 1KC7A 1K3UA 3A5FA 3EMQA 2J62A 4FXJA 2D2HA 2AL2B 3WO8A 1SW3A 2JKEA 4HSHA 2DFAA 1R86A 4S3AA 1Z44A 1QI0A 1CX9A 2DVTA 1BD0A 2ZBTA 2JKAA 3KUMA 4JIRA 3MU7A 4GX9A 4ERGA 4TX8A 3DU0A 4LUYA 3AHVA 1CXHA 3U7VA 5JCMA 3HGJA 1IV8A 3L4TA 1DE6A 1XDIA 3QH2A 4ALDA 4V15A 1QI5A 4Q32A 1SFSA 2WKLA 4EPEC 1J18A 3I6RA 2YFNA 1SO4A 3IK2A 3H2NA 3G6MA 2X1IA 4ILSA 1UC5A 3K4WA 3GTIA 3GYEA 5DFAA 1IXPA 2VMFA 4D8ZA 3HRDC 1Y7VA 3E0IA 1ZAHA 3V1HA 3UWEA 5LGZA 3AYRA 3UGVA 3BAWA 3PBWA 1XHGA 1FHVA 1EZ2A 5LXEA 4DJFA 3DFOA 3V18A 4EQWA 1GJPA 2V5DA 3CYJA 2V8ZA 1EYEA 1RPXA 1NF7A 2NX1A 1J11A 1UHVA 3GNRA 3DERA 3CXBA 4QJ5B 5I6SA 3L5MA 3Q65A 4ZB2A 3NAVA 2NX3A 2R1LA 2WSYA 3PG9A 3W75A 1JCMP 3VZYA 4CGTA 2NPXA 2FTWA 3RN6A 5FESA 3OGRA 4DUWA 4NZ3A 4F79A 1XW8A 2V3DA 3L4XA 1T7LA 3O07A 2ISDA 1X96A 2ZX8A 2BY2A 2R94A 3R2GA 4FR1A 4U31A 4L56A 1J9YA 3TAOA 1I45A 1UH3A 3WF0A 3SECA 4DZHA 3L4VA 2PDYA 2A2IA 4O57A 3TW9A 1R9YA 3H2MA 3LQLA 1LUCB 4AYGA 5BROA 3BMXA 5M03A 1XLEA 1TWSA 2GUBA 4AVNA 2BV9A 1DJQA 3RILA 4CQDA 4QFUA 1L6SA 4CD4A 3VABA 2GWGA 3ARPA 3KLKA 1ZBKA 1BKSA 3CMGA 3ID7A 4B91A 4ZE5A 4Q6JA 3DESA 3OBAA 1KR0A 3QOMA 3H7VA 4ZQCA 1Q8AA 2DZBA 3EB4A 3S6OA 4JHOA 2HBXA 2MNRA 3U2CA 1O5XA 3C3UA 5AYBA 2HXTA 3TUUA 3LGGA 1KTNA 5HANA 6REQA 4CU6A 5IRPA 2IW0A 4MB3A 1E72M 3WH7A 3L66A 4H9ZA 3R07C 4ZXLA 1CYGA 3VAVA 3B05A 3TKFA 4LVAA 4POCA 1N2VA 1DEDA 1S5MA 2CESA 4KS0A 3MCNA 2G3FA 3BO9A 4H2CA 3MJMA 3L7RA 4P7RA 3W1TA 3BOLA 4L9XA 2NUWA 4JR5A 3R5EA 4XZNX 4MADA 3WMCA 3PTMA 2DSWA 1XCWA 1CXEA 4NAEA 1R87A 1KFWA 4HZ8A 1OX4A 3B8WA 4B3KA 1JQVA 2NSXA 2AQWA 3KLLA 3QZEA 1TMLA 3TSMA 5KZDA 2ASHA 3TDFA 4HBKA 2GVJA 3M07A 1R5YA 2WJDA 4OBTA 3TZFA 5I06A 3NDZA 2QUTA 2XVLA 3OG2A 5C9UA 1ZLPA 2NVCA 1MYRA 2WCGA 4UTUA 1XC6A 2QAFA 3RPMA 3O05A 2QCGA 3LB0A 1Z8AA 1L6YA 3CLWA 1VCFA 1KBKA 2GLKA 4WY0F 1JVNA 3WUGA 1CGWA 2PGFA 4MZYA 4AF0B 4XBSA 4F2TA 2F5ZA 3ZZ1A 3M64A 1SZFA 3SCUA 4XD6A 1GOXA 3P62A 2ZZCA 3DG6A 2QS8A 2J8GA 2SFPA 3TSDA 1PYFA 4L61A 2GQ3A 1WX0A 4IXXA 1EBGA 1SW7A 1OM0A 2Z7KA 4UTWA 1JCLA 3ARQA 5HR6A 2ZICA 5FJPA 1ODZA 2ZA1A 2RGLA 5EBAA 3WDHA 4AVOA 2TPRA 3CAQA 4UCGA 3QN3A 3AQUA 4PGLA 5JCLA 4MB4A 4MAZA 5REQB 1NDZA 3VFCA 1LVLA 3C5QA 3PHAA 3GE7A 4O53A 3WQ5A 2CBJA 4KWSA 3E0LA 5E0CA 2QCMA 3LEPA 1YQ2A 1EHAA 1FWWA 1G0CA 4MHBA 2PLMA 3TN5A 4GZ7A 1S2UA 2QPXA 1PIGA 1NFBA 2E5DA 2BC0A 1SVDA 2E8YA 4TV5A 1PX4A 3AMLA 2FJUB 3GH4A 3HOJA 3PSWA 4Q4SA 1D7YA 3LSCA 2V5BA 2A6NA 2Z1XA 1UKTA 5FF4A 5DELA 3WBXA 4FXRA 3CHEA 3FHAA 3W83A 1OZMA 4DN1A 1DOSA 2Y4SA 1ZX9A 4B16A 2OX1A 2E9MA 3W2UA 4FX6M 3QKZA 3QY7A 2XPKA 4L64A 1SB3B 3I68A 1WKFA 2DT3A 4UOJA 4IPIA 3QLDA 2ZZ7A 4KCUA 2CBVA 2VR4A 2QCEA 4WOZA 3R10A 4AWSA 4RXGA 2WSPA 1WV2A 1OF6A 3FXGA 5BYWA 1CLKA 1N55A 2INZA 5B7ZA 4UIOA 4CNNA 2RFGA 3L5OA 4D6CA 4MIMA 4KEZA 2PWDA 1H6VA 1RV8A 7ODCA 1WYIA 5M2FX 1LL7A 2GDQA 1X39A 1E73M 1F9CA 1EGMA 2VELA 4QS6A 2WKJA 1OIMA 4ADWA 1MO0A 2QUVA 3WH9A 5IBXA 4CU8A 1TZ9A 3P61A 4HYWA 3LBCA 2V5KA 1GZGA 4E2VA 3CGDA 2WSRA 4NILA 1M6IA 3VIFA 3RM4A 4PL1A 4XO6A 1IZCA 1HL8A 5M3WA 1OJTA 5U1OA 3ABXA 3RNMA 5C9XA 1RCQA 4C6JA 3WNPA 3VUPA 4WRHA 3I3EA 2HTMA 2J7EA 3H2FA 4J27A 4FO4A 4QBXA 1OCNA 4QE1A 4CQAA 5D30A 3U2OA 2O9PA 5C5YA 3EKLA 2BY3A 2F61A 3VE9A 5FJOA 4F9JA 2I9EA 2QQ6A 1X98A 2PDIA 5C71A 3EBVA 2FVMA 3SJ3A 1J6PA 1MW1A 4ZQOA 3GQYA 1VFUA 2VZOA 4S1FA 5EU9A 5HK4A 2ABAA 3TTEA 2HNEA 4LCRA 1KM6A 5BOFA 2C14A 2JK2A 3B9NA 3HQPA 4HYRA 4YHEA 1FWEC 4DWSB 1PIFA 2ZIDA 3ZIZA 3S46A 1MVYA 3QV8A 3WH6A 5A8OA 2AAAA 4JFWA 3NPUA 1DL3A 1UR1A 4X0NA 1R3SA 4YTQA 4L7ZA 3N73A 5BOEA 1XKJA 1X6LA 2VFFA 4AD2A 2POTA 1OK6A 4IMEA 5G4WA 1OWQA 4GE8A 5BCAA 2HDJA 2WVTA 3HGSA 3OO2A 3LPGA 2XINA 2PFHA 2D22A 4H3DA 3ZR4A 1OZQA 3AZRA 3WDRA 1XISA 1OFPA 2VFIA 3OU8A 4F8XA 3ATZA 1WBHA 3F2BA 5IDZA 2AL1A 3HN3A 1JRCA 2E9LA 1REQA 3C0QA 4KRTA 1P43A 3AU2A 1LORA 1LRQA 5HMFA 3B0VC 4GNJA 4JEQA 4GUFA 3FA3A 2JEPA 4LS2A 3IGHX 4GA8A 4LFYA 1UJQA 1J0JA 3Q45A 4OOZA 4B3ZA 3AJXA 1H51A 2QJNA 3NQ6A 1EJXC 1TPUA 2Y8VA 4G9PA 1AH4A 3LI0A 3YPIA 1PEZA 1FO4A 4ORMA 1E43A 5F2LA 3DC0A 3LRLA 3DC8A 5D33A 2OQHA 4GVIA 3VFLA 4YU1A 1OEPA 3EB3A 1JD7A 2V5JA 2OO6A 1UKSA 1R8LA 2ZZ1A 5LNVA 3F5LA 3GG1A 1NWTA 4A8LA 1VF8A 2F84A 3ORWA 3QY8A 1BYAA 3LTSA 1JGMA 2OCZA 1ZP4A 1W54A 3P67A 1OFQA 3E1F1 3K13A 1F61A 1C8VA 4LVBA 2VWSA 5IFPA 1GEUA 3KAOA 1BWVA 1LG2A 3EWWA 1QOXA 1TWIA 1TMQA 2VEFA 3MUY1 5FSDC 1W1B1 3F7JA 7A3HA 1F2JA 3AIVA 2XFRA 1NAL1 1H2JA 2GJRA 2ZX5A 2C19A 1EQCA 3VE7A 4XKYB 3WK2A 3EDJA 5GQBA 3V16A 1O66A 2E5AA 4QDPA 2X1SA 3BAIA 4ADTA 3UXDA 3TK7A 1AJZA 4HNOA 2ZXDA 1LYXA 2FHCA 1HKIA 1YHTA 3THQA 4M6QA 5E09A 3PZOA 5I79A 1XRSA 3H70A 1A5OC 1QR7A 1X2HA 3PTDA 1KCXA 1QATA 4QRNA 4H7VA 4H4XA 2PD5A 1OB0A 3VIKA 3KVKA 3WNLA 6REQB 1LLWA 2YBUA 3GWQA 1E51A 2R6OA 4AWEA 1QK2A 3P2VA 2R1MA 1K4GA 1F76A 5LXXA 1M65A 1VS1A 2Z6JA 1C7SA 2EPOA 3K4AA 3GTFA 3IRSA 2VGFA 1E6ZA 3GDRA 5G1YA 3NDOA 4ZOBA 3NG3A 4JCLA 3GY1A 5TIMA 4WVXA 1W1ZA 2JGQA 3GVVA 1UPMB 2WHKA 1AH0A 1T8QA 3ES7A 3LV6A 4N4PA 2PDCA 4F0MA 3VNZA 1US0A 3W1PA 4GK8A 4Q4QA 3A9BA 3RX4A 1KB3A 5FJJA 1H49A 3MBDA 4IMDA 5D2YA 1NHRA 2ZXAA 4LPCA 4Z2KA 4HOZA 1YW1A 5I03A 4PL2A 3FN9A 3GKFA 4RE2A 2BXYA 1W3TA 3PZQA 1HL9A 2DH3A 2Q6ZA 4D6IA 4DBDA 2FYMA 1TTPA 2GOKA 2C3ZA 3QHOA 4H9XA 1A4MA 1GTEA 1Q3NA 3IJ9A 3W7OA 4AZBA 4RPPA 4MTVA 4IXHA 4EWND 4H4SA 2VCBA 5EMKA 1BRLA 3S1XA 3L65A 3BTNA 2CYGA 3H2EA 4LV4A 2DIEA 2A3BA 2Z6IA 4Z0SA 5C2XA 4CCZA 1IEVA 2BTMA 1VJSA 1IEQA 4Z1CA 1UWRA 2HVMA 3B8IA 1MRAA 3W01A 1CT5A 3GIQA 5G2HA 1JZ7A 1QNVA 4AVFA 1V6XA 1V7AA 4AQLA 4LA1A 3W27A 3A3XA 3RIKA 3AIEA 2P8CA 4NKCA 3E2VA 1EJSC 2Y5JA 1M68A 3QGAC 4Z1BA 5HNUA 3VU2A 4LQ1A 1IZJA 1HO4A 3LHWA 5EMJA 4W7WA 1EL3A 1TCMA 5J04A 2OZ8A 2CXGA 4YWOA 1S2TA 1AFSA 4WKHA 1QNQA 1ZBWA 4RDYA 3BAYA 3TYBA 1IEIA 5EMMA 3DENA 3GFXA 1XYBA 5BW6A 1HW6A 3SY1A 3U4FA 3LS9A 2ZUTA 2YCKX 1XLAA 1UC4A 3WJWA 2YL5A 3KM8A 3SRDA 3MMWA 1FP8A 1H50A 1NP2A 3GNOA 3KBJA 4DAFA 1Q8JA 4DNMA 3H24A 4J3WA 4AMAA 3R25A 3Q67A 2V2DA 5A2AA 4FR6A 1ADSA 1QMLA 4N9EA 2F9RA 4M19A 1FHLA 4O8AA 5FAGA 2PDLA 3CAKA 3U7BA 1PTAA 4GQRA 2AAMA 4KETA 4N7QA 2J7FA 2DW6A 1XIEA 2PGWA 4QLLA 1XBVA 1XH1A 2EPHA 1F8IA 1B9ZA 4EACA 1IWPA 1TIWA 2X0YA 4BR1A 1F6YA 4BQ5A 1PBGA 1TO3A 1FH9A 4QX4A 4XTIA 3OYZA 5CLTA 1QPNA 1OGBA 1FWIC 1BGGA 5EY5A 5LA0A 5HNNA 4A05A 3GC5A 2GDUA 4LY4A 4W8AA 4CD7A 2VRQA 3QTPA 4DJEC 4EXQA 4HYVA 3W37A 3PJTA 1RHCA 3GXTA 4RK8A 5BRBA 3AHXA 4JTEA 2NLIA 2YA2A 4ZOCA 3V75A 1UBPC 1TMHA 2QXWA 4H01A 4BZYA 2I17A 3V5FA 3N34A 2ON3A 1OFOA 4A21A 1L6GA 4JTAA 1SO6A 3BLLA 1VFOA 4BY3A 3CL7A 4KRUA 3OBKA 2QCDA 3VKBA 1F07A 2FB3A 3SUTA 5AECA 3AIUA 3UVIA 2ZUSA 4FNPA 4FNTA 3THAA 3M0XA 1G5AA 2Y7EA 4C1KA 2ZWZA 2WQDA 3TP4A 2PBOA 3GTNA 1A3XA 1CCWB 1ZY8A 3VZXA 1X8FA 1M1BA 2OXNA 3GC4A 3HFYA 1FRBA 3V36A 5F7UA 1PJ9A 1GVQA 5TD4A 2H9AA 1EXPA 2J47A 2PTXA 1R9XA 2NZLA 2BB0A 4EANA 4MVAA 1PSCA 5B7YA 1XLFA 3AXXA 1E6PA 4WQ6A 3MSDA 1W3LA 1ZK7A 1R3QA 2VQUA 1M41A 1A5KC 4Y90A 3W2JA 3RO8A 4WSJA 4LS0A 1UMLA 3GVWA 3NQGA 1WDWA 2O92A 1EX1A 2B31A 1XGZA 2PBGA 3WF1A 4B9YA 1FECA 2W27A 2J27A 2QDDA 3G1AA 3FYPA 1EJTC 1R3VA 1T96A 4RE4A 3FY1A 1FBAA 2NXGA 2F6XA 2VTFA 3PZMA 3IV3A 3GHRA 5EMYA 3NVVB 3RDKA 3AALA 2RUSA 4PULA 1NOFA 4YCPA 1WDPA 1CZ1A 2ALRA 1E0VA 5K9CA 4H4TA 4L4OA 3PWIA 1GQIA 2J66A 1JULA 4AUBA 3LXAA 2BGSA 2DPEA 3DI0A 4JTGA 2NT0A 2QCDB 4WLCA 1MQPA 3TTQA 2OQLA 3E38A 2FJKA 4ACZA 1CXKA 2VT0A 2ZVIA 3WF4A 3CWNA 2W91A 4H9VA 3LPOA 3VDCA 4J28A 2A7PA 3TTSA 1P0NA 4D6JA 2C1HA 3UZZA 2WOQA 4DZ5A 3HG4A 4UFKA 3LUTA 1JYXA 5FMHA 4EM4A 4LANA 1KD0A 1JGIA 2VOMA 2IMRA 3RX2A 1A0CA 1PTGA 1CLVA 2DVUA 2YDAA 4DXKA 3RM8A 3AN1A 4KFOA 4J3SA 2WPBA 1HKJA 1DXLA 1P1XA 2A3LA 1S2VA 4F9DA 2E8ZA 3BOXA 4KPLA 4RZ4A 3UGRA 5G5GB 2DP3A 2D20A 1GG0A 3G6LA 2WNNA 2V81A 1UMYA 3FEMA 5LIYX 8TIMA 5LNUA 1B30A 1DJZA 3FJ4A 1MEWA 4IQEA 5KITA 4F4RA 2GFTA 3UA4A 3B40A 1GEQA 2ZDSA 3BCDA 3R6IA 1KKRA 1KQYA 3BANA 4DBSA 2ALDA 4AFYA 1XHCA 3L5AA 1TTJA 3EGJA 1DTUA 4XX6A 1DWAM 3CASA 5AHLA 4UXDA 4EQRA 4AY8A 2AL2A 1M03A 4GI9A 1JYNA 3AS2A 3W72A 5JCIA 3NFUA 1XYCA 4UR8A 1ISVA 4FNQA 4TX9A 1VJIA 3VIGA 4S39A 1FDJA 3GU1A 5DT5A 3HV8A 1E0WA 1TVLA 3NL5A 1MOKA 4HCLA 1T0OA 2QJGA 4CKQA 3MSYA 5LHFA 2JK6A 1YDNA 5EFFA 3P8JA 2AMXA 5CEWA 5CG0A 4B4FA 5A8NA 3TLLA 1E9IA 2EG8A 2AQOA 2J7GA 3BCFA 3PBMA 4YWSA 5I09A 3IVTA 4C6EA 3N2TA 1T99A 3B8SA 5EMLA 2J7DA 2YGYA 4GIYA 1W56A 3IV8A 3ME3A 1CTNA 4GZJA 2XIBA 4XSLA 4JY9A 2WPEA 4J40A 2RH9A 5JCNA 4GXPA 1UZHA 2GOUA 3S5ZA 3BJTA 3CHVA 3KEHA 2W0UA 2YCLA 3O16A 3WF2A 3MDWA 3SY5A 4WGXA 3PPFA 4Y8EA 4A3YA 2XZ9A 1A4LA 3KRUA 1RJQA 5MKGA 3LD5A 2ZUUA 4CN4A 3WLNA 1S2CA 2VEMA 4LALA 2TSYA 2YR1A 3PM6A 4JTJA 2YW4A 4NZJA 2W5FA 1D2KA 3P0WA 1V97A 4LU0A 3D46A 4J56A 3R94A 3PUEA 5A6TC 4MLJA 2OLAA 5MKGB 1PDZA 2H8XA 3DHPA 3T9PA 1GUVA 1OFRA 4GCXA 2X0HA 2ZRWA 4O1FA 3H23A 4MM1A 5HWMA 4Z2JA 4YPJA 2WMKA 3G8EA 1RP9A 2F2KA 2PSNA 2CHRA 4NNAA 3STEA 1P5BA 4TO8A 4FSAA 3ZT7A 1Z42A 4IPLA 1N63C 3W7KA 3LMYA 3LENA 2C3CA 5T91A 3CUFA 2X8RA 4NQ1A 1CECA 2Z7GA 1GOWA 4QJ4B 5HDRA 5IDIA 4MLRA 1LUCA 1VEPA 2G4FA 1F3PA 1KN0A 2VXNA 4A4AA 2OODA 1ZKQA 4G2DA 3PPGA 3O6AA 5D03A 1MEIA 4S3DA 4U2ZA 4X2RA 1U5HA 1LG1A 1TR1A 4M6UA 1VFFA 3NR0A 2VX7A 2YLLA 4NHVA 1VYSX 3QRHA 4GUHA 2WZEA 2QDHA 4GISA 4IMFA 5D37A 4F66A 2A85A 2WM0A 1ZJBA 1J0ZA 3DBPA 4JN8A 4XV0A 1NM9A 2OTDA 3H4GA 1F3EA 2V82A 5CJ5A 4X3ZA 1J2WA 2FFCA 2ODOA 4H6QA 4RNHA 4YJ5A 3VNKA 3UZYA 2VOTA 5ER0A 1DQUA 2ZFAA 1LLZA 4V1XA 3SJNA 1U33A 2DJXA 3DN5A 2OSYA 1Q13A 3ARTA 3WFZA 3E74A 2UWFA 1F8WA 4JL2A 2C1IA 3MUCA 2QW5A 1FCQA 3ETRB 2E1DA 3GDMA 4Z42C 4PEKA 2PZNA 1HP5A 3QF0A 1PZ0A 3PVFA 1XUUA 1GRBA 3FEQA 3STFA 3OA3A 3OPSA 4E8DA 4BEUA 3UPMA 4R7WA 4GYKA 1V6UA 1FTXA 1DQWA 2GVGA 3GC2A 1LT7A 5AZ1A 2DW7A 2POZA 2DSVA 1LROA 4LAOA 5FL0A 1F7BA 3N14A 4PZVA 3B0UX 2Y2WA 1D3CA 3USBA 4L1XA 3CC1A 3T05A 3QFBA 3S9IA 4FK9A 3NM3A 3AHYA 1F5ZA 3DCPA 3GSMA 1RH9A 3KOFA 3SY8A 5CG7A 2X2GA 1W3HA 2PP3A 3W7LA 4LSBA 3AAMA 2E25A 3R12A 1IWBA 3AMCA 2A3HA 3KS5A 1XIBA 3P7YA 1L2QA 1I4NA 2GH5A 3SURA 5HA7A 3TXZA 1M6JA 1WB0A 4BK9A 3SEPA 2PGEA 3MSRA 1J0YA 2CIPA 3BG3A 1BTCA 2ZX6A 1R7AA 4QSFA 4GKTA 2W4XA 3O0KA 1WKDA 2JALA 2OLHA 4TVCA 2E5CA 4RNFA 1NIUA 3MB9A 1TPH1 3DK9A 1SU5A 3S0CA 3BLFA 2VFEA 4P7OA 3FG2P 4JGDA 1VJZA 4JTSA 1AMKA 3NL3A 4LCQA 1YX1A 4AZ6A 3EEGA 2E0PA 2BHYA 1GRAA 1HQTA 2FZ8A 4V33A 4YNGA 2CERA 3M47A 2GR0A 1V79A 1PVNA 1E4IA 4ZOAA 4W5ZA 2TMDA 4EQSA 3URBA 1HT6A 2VVNA 5BOOA 2R91A 4EVZA 4IGMA 3UFYA 1SM9A 2VD8A 4W89A 4GWEA 2PTZA 4JHMA 3E2SA 2X7WA 1TELA 4S2CA 2VDHA 4G56A 1XIMA 1IIGA 1JI1A 2Y6ZA 3N9RA 1JXKA 3RMEA 1SFJA 4FA3A 4UMBA 2BVWA 1ZY9A 5HOSA 3VVGA 1KW1A 1JAKA 3JVAA 4QCEA 2VQTA 1RY0A 3H4XA 2TAAA 4PCSA 3QVQA 1OCQA 3W88A 4AZIA 4DYKA 3OLIA 2B7PA 3WLOA 1RR2A 5DMMA 1BXCA 3WUFA 1TV4A 1K7XA 3E9AA 4GOAA 5AHEA 1EKOA 4ZB0A 3C86A 3EOOA 3ALFA 3VGFA 4ZZ9A 2CFFA 1KR1A 5LKYA 5FD0A 2DZXA 4MY1A 2VUYA 3JRKA 3MKKA 4WCJA 1PDYA 4LNCA 1EF2A 3BQ6A 1V6WA 1FFVC 5AKQA 1VH7A 2QZRA 1LP6A 4H4RA 3T42A 1H61A 4GJJA 3DOPA 4IP7A 4JQ4A 5BXRA 1GOOA 4UFJA 1UOKA 4ZTYA 2Z2AA 4Q8NA 3SUSA 5AC6A 3GUWA 4IPNB 1FCVA 1I1XA 3DFYA 4UQAA 3N13A 2D2GA 3KBNA 3ELFA 2ATSA 3H7RA 4I9JA 4HNTA 2GWNA 3RITA 3KCLA 2ZRZA 3VGEA 3L4WA 3FHQA 5K4XA 4OUEA 2NXHA 1S5TA 1LJYA 2PCQA 4GG9A 1D8CA 2BHUA 4TTGA 4UUIA 3C0LA 9XIMA 4B2DA 3O8AA 1Q2RA 3EKZA 2C91A 5D04C 3WFLA 4NP7A 2H9AB 1RLCL 4QCFA 5HUOA 4PSRA 4ZBCA 3B9AA 3W7PA 4OIFA 3UY8A 5JH2A 1P48A 1TVNA 4H4VA 1EBDA 1FCUA 2ZC8A 3S2LA 2GVEA 1TRIA 2J7CA 3A13A 5FKYA 1UH4A 4PUUA 3ZLHA 4AISA 3KRSA 4QITA 3U9IA 3LPFA 3M5ZA 4HNLA 1G4TA 4MDPA 3ZR5A 4M81A 2FGBA 3RM9A 2VVSA 1GVEA 4W7VA 2DSUA 2WANA 2GR3A 4GYJA 4H9YA 2Z29A 1SJCA 1OGGA 2AGTA 3K1DA 4O13A 2ZOXA 1JF6A 2WM1A 3WLPA 3E5PA 4H4IA 2YA1A 2WNQA 1GG1A 2C71A 1JUKA 3FSTA 4TVDA 4CEUC 3LLFA 4A3RA 1OHLA 5I78A 1GKQA 3UWQA 3UNDA 2ZUMA 1V3HA 4MFEA 5DMLA 5EFDA 3A3WA 3NOYA 4QQUA 3TCEA 3TVAA 1XP3A 2BHZA 1M9HA 4XWUA 4GQ0A 3AHZA 4BQ2A 2FZDA 2J4GA 3ZVHA 1UWIA 4EPDC 3CPUA 4D2JA 1AZ2A 4TMCA 1HTIA 4QXIA 2J6XA 1H3GA 4APNA 3VZZA 4FALA 1XYLA 2XIJA 2YL9A 2FVLA 1Y65A 4CN6A 5AN7A 1RBAA 5DEZA 4PA8A 1S1PA 1M01A 2CHOA 1BHGA 1LRNA 2PODA 4RZ5A 1K9EA 1A5CA 3CB3A 1TV3A 2YA0A 1LTDA 5GJPA 3HPXA 1JUBA 1BG9A 3NUKA 2WPGA 2YLAA 2FMOA 4A8RA 1MW3A 2FZNA 5AHNA 1DXFA 2B0MA 3S5SA 4NZ5A 3QV7A 4WY0A 5FF2A 3NZGA 1YDOA 4PUJA 4N2YA 2OU4A 1VBUA 1XWYA 3CIVA 3RHGA 5FEWA 1UROA 3URHA 3H26A 1EA9C 4ZO8A 5I2UA 3UVAA 3ITOA 4P7QA 2C3DA 1CDGA 5FI8A 3WZ0E 3G0SA 2HWGA 4IX2A 3PULA 4LCSA 2Q71A 3HBLA 2X1TA 5RUBA 4RNIA 3GRSA 1BGAA 3CUZA 4Q7BA 2R1PA 2ZCGA 3KOYA 4UOZA 3PUOA 4C7GA 1IEWA 4TOQA 1NJJA 4JTQA 1IWAA 3T81A 4W86A 3A4JA 2ZADA 4U28A 4AXNA 1OSEA 4NSBA 1BTMA 3VC6A 2X0SA 2J8TA 3ANVA 2CZDA 3EF6A 5CZJA 4J9JA 1X2GA 2ATMA 3E02A 4HTBA 4DO5A 3SQMA 4XG1A 1FY6A 3S47A 1GONA 4HSOA 8RUCA 3NEVA 1WDQA 2GJLA 3BJFA 3WQ6A 4H50A 3OZYA 3T8QA 4O0ZA 1XFCA 2Z28A 3A21A 4AF0A 2XWEA 4AB4A 2EPLX 2O7QA 2NLYA 4LW7A 3W1RA 1JXJA 2TRSA 2C16A 2G3NA 3DHFA 5I3KA 1EC7A 1TUFA 2Z1WA 3KL0A 3AM9A 2VCCA 3C2YA 3LXCA 4UTWC 4W85A 2HJPA 4TUFA 2W55A 2GGIA 1ZSXA 4IP5A 4FIQA 1KWKA 1GK8A 5K4ZA 3I10A 3P14A 2QKFA 2WJZA 1V0KA 4L4LA 2EJ1A 4C6IA 2Q3RA 3B8VA 3CWHA 4EWJA 1U2YA 1EXBA 4WIWA 2VYOA 3WQ4A 1Y5WA 3NYDA 2P3EA 1M3UA 1HUVA 4C7FA 1DWIM 3QFWA 1U83A 1OC7A 2GSJA 3WLIA 1BWCA 4IFRA 3F5KA 4DNAA 1Q6EA 2PDHA 2G3MA 4C6DA 5A95A 3VNMA 3D3AA 2BBFA 3WQ8A 5F1UA 5CGTA 3L9CA 3LM7A 1OFAA 1XJBA 4LRSA 9XIAA 3E0VA 4B5VA 3ZO9A 3UCCA 1V02A 4FEZA 2W62A 1F8MA 3EDEA 3N4EA 4ZSTA 2V3BA 2PLKA 4AW7A 3IJ8A 2WK2A 3SIZA 3CBWA 2CZFA 2J75A 4PB3A 3T0DA 4J35A 1AL8A 2XHYA 2ISFA 3AXKA 2WCSA 2PB1A 4WKFA 3CNYA 3ICJA 1KM3A 4QP0A 1KXVA 3DGBA 4WOQA 2RJHA 3EA1A 1YE4A 4OBRA 4MGGA 4GVFA 5T9CE 3C56A 2Q8LA 2PWVA 4L65A 1AQFA 3KVLA 1FWSA 3HQ1A 1FWDC 4RNJA 3ZM8A 2W3SA 3MPGA 2VCAA 3SZ8A 1YPIA 1TTIA 1WBJA 1MSSA 1E3XA 4X9SA 2Q8XA 4LNYA 3HF3A 3GHUA 1K70A 5L6UA 1TYTA 1C8YA 1WQ5A 4FMVA 3VGGA 1TYGA 1XR2A 4PMYA 3LU2A 2EQ6A 1TWZA 3M0VA 3PWGA 1WE5A 4LVFA 3P84A 2IPWA 1DTNA 4FPSA 3Q58A 1NP0A 1I0BA 4W88A 1TJPA 1YDVA 3Q2DA 2BVTA 3BW2A 3MY9A 4RDWA 2QF8A 2NQJA 4NG3A 1FFRA 4P2VA 2B7QA 1E1FA 3SR6B 3IK4A 1QW8A 3T4WA 4E4FA 1FUYA 7CGTA 1WOBA 5CBJA 1PAMA 4J3UA 4AEOA 2WVVA 2WSKA 4UFMA 2Q02A 3KOWA 5E93A 3F4NA 3H2AA 4OKDA 4OV9A 2Y63A 5A6MA 4ASTA 1SMAA 3K46A 1LCOA 3TN6A 3FKRA 4O1DA 1JPKA 1UR2A 1B4KA 1IGWA 3WLRA 4RX0A 3QR3A 2P76A 4H9UA 4GABA 2GR1A 3NSXA 2E5BA 2BY0A 1SZGA 2ZXBA 2BXZA 2FZBA 5LIXX 2FDMA 5F4SA 1JZ6A 1GT8A 1IXOA 3EXTA 2PF0A 1Q4NX 3GVGA 3QYQA 6XIMA 3CTTA 3ITVA 1I8JA 4XKYA 3T2QA 4GI6A 4O10A 2VZUA 5HJLA 3MI6A 4L6OA 3WEOA 5A6JA 1X1NA 4UQ9A 3VNDA 3UA3A 3T7VA 4EX4A 1V6YA 5EBKA 3WJZA 3OLEA 4HA3A 4ICMA 4NXSA 4FF7A 3LXBA 4I6VA 2XM1A 1E6QM 5LYRA 1ADOA 5LGXA 1ISYA 1JOAA 1BLIA 1QDSA 1UR4A 4YTUA 1VBHA 3AZSA 1B5TA 2BASA 1R30A 4FX8A 1YBQA 3VA8A 4UB9A 1VFLA 4FI4A 2VENA 4JFVA 3CQKA 2J7BA 3H12A 5GVJA 3U48A 3CUHA 3NCOA 2QV5A 2D3LA 3FGCB 2QDGA 1KBLA 2XDFA 3QW3A 5FJIA 3RNDA 3KTSA 1XLDA 3ARYA 3D5HA 4DZIA 1PKYA 1ELSA 1TJ0A 5F1VA 3MP5A 2NXIA 1N62C 1ZHAA 2OGJA 1XIDA 3VC5A 3BK0A 2ZZBA 3L5LA 3THUA 2UV8G 2GK1A 2ICSA 3HV9A 4TIMA 4DO6A 4H4ZA 3H2OA 2ZKMX 2HXUA 3LNPA 1DJXA 3VOGA 2JQXA 2J9YA 2CPUA 2OYMA 3WQGA 4MAVA 1MFVA 3C2EA 3L4YA 4XZWA 1S3HA 1NOWA 5A1AA 4L6DA 3QEZA 3VD5A 3F2CA 2HS6A 1BF2A 4P7NA 1H7NA 4HCHA 3QMSA 3CPGA 2P0OA 2GQ9A 1QI2A 5AC7A 1OD0A 5XIMA 3M0YA 3PUDA 1U5JA 2EPMX 4JKMA 4ZOHB 4M0XA 2QNEA 1BXBA 3VCRA 4Z08A 2PTDA 2C79A 2GGJA 4O54A 5F4WA 4PTWA 4MFDA 3RRXA 2ZZ6A 3UW6A 5A2CA 1GVRA 4NZCA 2YB4A 3W7HA 1ZENA 1ONFA 3N9KA 3QZ6A 2HQAA 4CCCA 3PZUA 1Q6LA 3M46A 3TJLA 2V63A 1WDRA 1E3ZA 1DPMA 1XLGA 1S5VA 4JFTA 3M0HA 4A2RA 4JDYA 1IHIA 2XJ7A 1EO7A 1QW9A 4YYCA 1W1PA 5JBDA 3TEVA 2EO7A 4JYEA 1KGXA 4LUSA 3FAXA 2G8ZA 3SCOA 1XYMA 1Z9AA 1EJVC 2I5QA 3VM5A 1ZCOA 2YCJA 4PB5A 3DFNA 2VDGA 4DXXA 3G1FA 1LWJA 5I7GA 4JOMA 4IUGA 5E70A 2DY3A 1RCXB 4JDBA 5D9MA 3MMDA 2OOGA 3B9EA 5HULA 3W85A 1KLYA 1SSDA 1FEAA 1DJYA 2XGIA 2YKKA 4IF2A 3RLHA 4A22A 2J3NA 1VAHA 4DF2A 3DHDA 5KSWA 5H8PA 3KP1A 3CV7A 5C6MA 2CBUA 5CPMA 4AIEA 4H8NA 1Z7AA 4NF7A 3VM7A 2A0NA 4C6QA 4MDOA 2H90A 4ZQNA 3I7QA 2OX4A 5AB3A 5HJYA 1JRBA 1K6AA 3AS3A 1C7TA 4JTFA 3POCA 2XSXA 1UWAA 4PMUA 2W67A 1R85A 1WXJA 4AZGA 1ISWA 2ZZ0A 5EL1A 1E4NA 1Q4WA 3UP8A 3EYPA 1WZLA 4WR3A 4QAIA 2R1KA 3LSBA 2VX4A 4MNKA 2NQ9A 3PFRA 2CHNA 5ABHA 1WZAA 4Z1AA 2VHLA 1EHNA 1W3IA 2OO0A 3VDAA 2HBVA 1ALDA 3PZGA 1XD0A 1Y5XA 4FLQA 1ZQ5A 4RLIA 5FJRA 3CM4A 1NWRA 1TA3A 5JBFA 5D2VA 1KV8A 3T2PA 1K8XA 2HK1A 1A0EA 5CGQA 2UY4A 4QDWA 1A3WA 1VBJA 4R53A 4Q7IA 7PTDA 2WWDA 3LHZA 5HINA 5G5IA 1PIIA 3NGJA 2VJXA 4HTYA 3THCA 1V3MA 2VURA 4E38A 2F6UA 1AODA 3R8HA 4KWOA 3O3RA 3LTPA 3DFSA 4ZQMA 4D1IA 4GY1A 3GTXA 3NIYA 5DX7A 2BZNA 3TAKA 4REQA 3GR8A 5TQLA 4GD0A 2ESCA 4QLKA 3S6DA 4N6EA 2G37A 2XU2A 3VNJA 4C5YA 1MI3A 2YPIA 3UZJA 4CNPA 1UP2A 1P6CA 1W1IE 4Q4KA 4YMZA 1Q1RA 1QNPA 1QNRA 1LQ2A 1K03A 3SFWA 4HK6A 1K8YA 1Z32X 1L9WA 3DKJA 3ATYA 3SN0A 1TX0A 4XO7A 5DQPA 2DIJA 4RW3A 3R13A 2G0WA 4CD8A 3CUXA 3IUHA 3AS0A 1PE1A 2PLCA 4HPNA 5A69A 1F73A 3TQKA 1WDSA 3AXHA 5HNRA 1EQPA 3UWVA 4F40A 2B7NA 3TU9A 3S2CA 2IKIA 4JTKA 3V5OA 3RU6A 3FDKA 2NVAA 1V0LA 3NZRA 4HMNA 1PWLA 3RX3A 2V2CA 1AA1B 4YVXA 4UTLA 2RABA 3KLJA 4PCNA 4ZA0A 1DQXA 5I5RA 2QGHA 5BXPA 2YSWA 3CS2A 5MHBA 4US5D 2WPFA 4MWAB 2YVGA 5A6SA 3N2BA 3W81A 4PC8A 3W76A 4U3AA 4F0KA 2I57A 4PUKA 2D0GA 2YBTA 2WOWA 3WJYA 1A5SA 3W86A 3NL2A 3UWYA 4B5UA 3LPPA 1XIFA 1AVAA 3N9SA 1CNVA 5L9FA 3GIPA 3BC9A 2R82A 3UR2A 4EKJA 1NU5A 2O0TA 2MUCA 3E12A 2VC6A 2NQLA 3DUGA 1EGZA 2EGZA 5FIPA 4ROPA 1X1OA 1KQZA 4R5EA 4PBGA 3FAWA 3RG6A 1CXIA 2Y89A 1TZ7A 4Q4OA 4S23A 1E5NA 4GJIA 2BY1A 3QR0A 3H53A 3NZ1A 1JPHA 4QLJA 1HFBA 1BWLA 4A3QA 4WJXA 2YVFA 4PMOA 2QYGA 4MYAA 1W17A 4Y9OA 4QM1A 3BV7A 5EYWA 2QR6A 1RPKA 1BWKA 5HXMA 3CAVA 4NAFB 1XINA 3PF3A 2V5CA 4ENLA 3D3FA 1J6OA 2Z0IA 3G1SA 4H1ZA 4NX5A 3V1PA 2QJIA 3G3MA 3PAJA 3NJ3A 3MYPA 1RSCA 4A29A 2FDSA 3ZT5A 3L8KA 1N60C 3S5NA 5FL1A 4KMQA 3EWCA 4ICCX 5BRQA 4K7YA 4Q8PA 4NI8A 1OGSA 3SADA 4PRRA 2VFHA 2PI6A 3GLCA 4U2YA 4C6KA 4I6KA 4KCVA 4XUGA 3CLMA 3B9JB 4W5UA 1W9UA 1X6NA 4JL1A 4GIAA 3CO8A 5DXYA 3KFTA 1TFVA 3CQ0A 4DI9A 3ZWSA 4GYPA 1FKXA 1NSJA 1HF6A 1QWKA 4UQBA 5I3DA 2EEXA 5A6LA 1OYBA 1SR9A 3B4UA 2PWGA 3F4DA 3BARA 1X38A 3UCQA 1XLCA 4UMCA 4QDMA 2PCEA 1VDVA 4P8UA 2CU0A 3GAYA 3G18A 5F2IA 3T8LA 4Q8OA 3QQWA 4GZEA 3EOSA 4GZIA 5EA9A 2X8GA 4YTTA 3NM1A 4K3ZA 4GO8A 2IPJA 2E1WA 1F4AA 3COTA 3WDIA 4BA0A 2ISSA 3SCNA 4FNRA 3PBGA 5FF0A 1S2AA 3LHYA 4EPBC 3NQ8A 4GBDA 3XINA 3FK4A 4H7ZA 4K2SA 1R2RA 4PMVA 4M6PA 4MMWA 4BFAA 3C0SA 2HPMA 1TPEA 3KOZA 4WJ8A 2NV1A 3M0IA 4JIHA 3KCJA 4URIA 4UNKA 1JFHA 3DECA 5I24A 1DWJM 1MUCA 3EWBX 4S38A 1TSIA 5HMDA 2Z2BA 2C13A 2XVPA 2ZTJA 4JTIA 4E2DA 4KGLA 2D2OA 3CO4A 3UJSA 4WXZA 2RDXA 1E1CB 2RJGA 5AOUA 3QM3A 4BI5A 2J6VA 3IGXA 1XSKA 3WQEA 3DYOA 5K3VA 1PTDA 3GM8A 3GG0A 1K1DA 5DBUA 3KBSA 3WN6A 1JIBA 2QCFA 3W1QA 2CLPA 1W5QA 3INPA 4JQ1A 3TV8A 3CU2A 4IFOA 4AX7A 3T2OA 5CKSA 1AW2A 1G4PA 2VEKA 4O1AA 4G5DA 1J79A 4LAZA 3W87A 2J13A 4OUIA 1JG9A 4FNSA 1QOQA 2OOFA 1H1YA 4JNZA 1ZRQA 5A8QA 1LL6A 5A2BA 2Y8KA 1VBRA 4U5IA 4UQEA 3VTRA 4DJDC 1W9BM 3PG8A 1ME7A 4MNJA 3MHGA 3A12A 3SCSA 3NZQA 3GW0A 1T5AA 1GERA 4UFLA 4HNVA 2ACQA 3GFZA 1BQCA 3CGBA 3NL6A 5HNTA 2I14A 4D6DA 2ZRUA 3QTGA 4A2SA 4KF1A 4HN4A 3CMJA 5ABFA 1MDLA 1IF2A 1PS9A 1M7PA 2EXOA 4O11A 3IANA 3KX6A 3VI2A 4H41A 4LGXA 5FOOA 1VLWA 2OKOA 1QK0A 1RQHA 3NVDA 4D9PA 1MZRA 1C8QA 1VYRA 3PJUA 5HQLA 3R79A 4S3BA 1XLBA 2QPUA 1DIOA 3BLOA 4LC8A 3I3DA 2R14A 1GNXA 1ZFJA 3GRIA 3L0GA 4ECLA 5LNSA 5HMEA 1DORA 2YCEA 3N12A 3SCRA 3GXNA 2GJXB 3W9ZA 1V08A 1M7OA 4IQJA 2FGZA 1K9FA 4NJKA 1XLLA 4EE9A 2F8QA 3ARWA 3IJ6A 4TQTA 4OHQA 3GVQA 3QGKC 3CEUA 4PUEA 2INFA 1JDAA 2W6RA 2WHJA 3AIRA 1BVZA 3KDOA 5G1MA 1GZ1A 4X2PA 3AIQA 5TNVA 3VD9A 1TB3A 3AI0A 1WZKA 1GKPA 3REQB 4PH6A 4GQBA 2OMAA 4GACA 2PE4A 3S5OA 3KBWA 1X7FA 2H3DA 5C9WA 4RZBA 5D8WA 2WMGA 1ZXIC 2VD9A 3BW3A 4E6MA 1UW9A 3MC5A 4KT2A 3U57A 1PHWA 5H91A 4WXYA 1NVMA 2CXEA 1OCBA 3TWBA 4HNCA 5C54A 5G5HB 3LX9A 3RK8A 3WSUA 3BG5A 3PP7A 4ZODA 3SCPA 3NA8A 1XG4A 3VKKA 3ARSA 5CZSA 1LOQA 4H6RA 2BLEA 5HPCA 1UASA 4LF1A 5D8ZA 5C55A 3GKAA 5FS7A 2WVSA 3ABOA 1KA9F 1C90A 4HNUA 5HR7A 2ZZ5A 1QPQA 4XBKA 1TE1A 3AYTA 1JZ2A 3GFYA 3BV4A 3W6YA 1JYWA 3P82A 4BF7A 3ZXWA 2C18A 2XZ7A 4J1OA 2RDTA 3PZ9A 5EGRA 1JEHA 1SZNA 1TREA 3W7EA 1JCXA 3RXZA 3BOFA 3DGZA 1G1YA 7XIMA 2D23A 1N8IA 1ISXA 3TQVA 1SQ7A 1EC8A 3D6NA 4WX2A 4ONVA 3JU2A 1TV2A 4ML9A 2J25A 4CLMA 4PFHA 1E15A 4DAIA 2XH0A 4JN7A 2BSLA 1P6BA 3QKEA 3ARUA 1RBOB 3GX9A 1EIBA 1KCLA 3UR8A 1HKVA 4IL2A 1B3XA 4XTDA 2GQWA 1FWJC 2JGYA 3TMLA 3S4TA 4WK9A 3S8HA 2VFDA 3CL6A 3UBPC 4QE4A 1WA3A 3AHTA 5HMSA 3BAJA 1J5SA 3N3TA 1QBBA 3B0YA 3N17A 3S83A 3THDA 1PZ2A 1V8EA 3CZLA 1LPFA 1D8WA 1ME9A 3T6CA 3T09A 3B04A 1DVJA 3WLSA 5I02A 3JUGA 4LUTA 3WBWA 1DP0A 1UOZA 1R9ZA 3WL1A 1XIJA 3APYA 3MUAA 1PKNA 1XSJA 4E4UA 3WK0A 2V6AA 1GKRA 2BGQA 5KZEA 3ITLA 4PODA 1UWQA 3ZLGA 3M0KA 4FAMA 1HN1A 3HPFA 4INFA 1IXQA 1K8ZA 4CU7A 2GVYA 2VR5A 1KFLA 1MO9A 2PWFA 1FHUA 2YIHA 2YZRA 3KTCA 3P93A 2J88A 1GV4A 4AD5A 3W22A 4WDTA 5DCDA 4BQ3A 3NXLA 3L21A 1BYCA 2DZAA 2ZC1A 5D32A 1ZGDA 3RGTA 3LRKA 3HMJG 3RCYA 1ZNNA 3T0CA 5AYXA 1OINA 5F4XA 4B90A 3ENLA 3C3NA 1SMDA 3B8DA 4EXAA 4MYXA 1TR9A 2JIWA 1DXIA 4FB7A 5DO8A 1Q6QA 2PP1A 3II1A 3R1ZA 1ADDA 3W26A 4M56A 3PZVA 4QNEA 4DI8A 2X09A 3DK8A 3KS6A 4PMNA 2PC4A 4IM4A 2YXGA 2ZX7A 3A7AA 1A5LC 4ZEPA 3CTLA 1B3YA 4C6PA 4LUIA 4IGSA 2QAEA 3WQFA 1UYQA 3OZMA 3PJXA 1V6VA 3CT7A 3KOXA 1AD4A 2Z4GA 1A5NC 1NARA 3FOKA 1YKWA 1DHKA 3AUJA 3LMZA 5DT7A 2E40A 4PN2A 2VEPA 1NFPA 1G7UA 3RFAA 4B5SA 4BI7A 5CC6A 5CPNA 1GETA 3W1NA 1MUMA 3FYYA 3NQAA 3WBAA 3G3DA 1T40A 1QW7A 3VIHA 2WV8A 6ENLA 3ANUA 2V9DA 3GRTA 2IKHA 1C93A 2WQPA 3D47A 1AG1O 3NPXA 4F0LA 5CC7A 4PUNA 1A80A 4OECA 1K8CA 5BWFA 2XM2A 2FHFA 4QAWA 3F1QA 3LHUA 1HJVA 3WQOA 3BMWA 3SQLA 3T0BA 4Y96A 3N6HA 4KWVA 4YS1A 1EOMA 3AXIA 4NIRA 2OT1A 2TPSA 2VZVA 3DDMA 3LGEA 3TNBA 4X61A 3W82A 4K68A 3IJDA 2V3AA 3LTYA 3NO1A 1BPLB 1WZMA 3EA3A 3P80A 1JNDA 3QFEA 2P53A 8XIMA 2B81A 3AROA 1NF0A 1EWDA 5FF7A 4KWWA 4P8XA 4QROA 5JRBA 3BLDA 3ZQ9A 1N7KA 2PD9A 2WC3A 1SUXA 4F0RA 4XZMX 2RHGA 2NQZA 3GDTA 4NY2A 3TE9A 3I65A 1Z48A 1SW0A 3BLPX 3QPZA 3V7PA 1P4CA 4D6GA 3VIMA 4YIWA 1CGTA 1JJKA 4WEVX 3G8RA 2EQ8A 3SGGA 3CIWA 3I6EA 4JHZA 2X99A 1NY1A 2NUXA 4BF5A 4Z2LA 1ONEA 2Z26A 1LRTA 1H0GA 3MKCA 3EX4A 4NJGA 4I9TA 3WEMA 2BCPA 2D73A 3CGEA 2EAWA 5LHEA 4Z1DA 2PLJA 2XN2A 3VCCA 1KFKA 2V6OA 1LF1A 3VK5A 3CGTA 5AC5A 3M0ZA 1KBBA 5AYIA 4TXEA 4ROQA 1EA0A 3GD3A 2VKZG 1ZPTA 3CYVA 4PUMA 3PBVA 2QUMA 3KWXA 1UBSA 2AKZA 3VILA 4MKNA 1GOIA 1BFNA 2PAJA 3GVRA 5LNRA 1W5NA 1DIKA 4RDZA 4K8HA 3CB8A 5I3HA 4C60A 2J7HA 3HJZA 1XX1A 1EZWA 1FWAC 1RBLA 2Y5EA 1E1EA 1ZJIA 4RUBA 1GPFA 4J7RA 4DWSC 4HHLA 1PKMA 3UEQA 3SM0A 4CQCA 1MZHA 4DVOA 2P1FA 1JYVA 1QOPA 4XQ6A 4IMGA 1QWGA 2W92A 5ENLA 4IL0A 1TIMA 3VO0A 3KW3A 3LG3A 2G50A 5G2IA 1B1YA 1H41A 4IJRA 3SCWA 1G01A 2DZWA 4GXMA 2PU1A 1BKHA 1MXGA 5ECVA 2QGYA 2R24A 3U5UA 1UQZA 4LXFA 1GRTA 2PWUA 4C6LA 3O2LA 1EFZA 2PGRA 3T1GA 3NPWA 2A3AA 4NNCA 2AGKA 3T0AA 2WB5A 1S39A 3ZSSA 4WSHA 4C1LA 3WK1A 3OQEA 4XAGA 4PTVA 3Q94A 1HKKA 1OYCA 5TF0A 1HNYA 3H7UA 3LERA 1KBIA 1X6UA 2GR2A 5C2CA 3KDNA 4LAMA 5TAOA 1H62A 2DZTA 2OEJA 4JYFA 4FXSA 2Y85A 5A6BD 3N6JA 4LBSA 4HB7A 1J10A 5IOBA 1VB9A 3LGDA 1UB3A 1YADA 2CLIA 3NYZA 3KZPA 4BWLC 3ARVA 3AC0A 2CKSA 3LHTA 3FLUA 4RE0A 3TLQA 4XB3A 3HPZA 4JNYA 1I2NA 1D7KA 1O7AA 3BW4A 1OQFA 2W3ZA 1GVFA 1REQB 2GJNA 3FJ6A 4UTJA 3URAA 2C6QA 5JU6A 3FJLA 3CWOX 4UNLA 2Y1HA 7TIMA 1TRDA 2PS2A 4ZOEA 1O4UA 1JEZA 3TYZA 1KRAC 1ICQA 3GG8A 1W9VA 1RAKA 4J57A 3ARRA 1WKYA 1UPPA 1YXYA 4O28A 5K9DA 3UXLA 3NTYA 1GW9A 3ITXA 3PK7A 1DXEA 3SGZA 1S38A 3FA4A 2NV9A 2GYIA 3WQWA 3N1AA 3IUIA 1CGYA 4NRRA 3NRZB 4NJHA 3CUJA 4X63A 4UCFA 3AOFA 4MG4A 2BXVA 2PA6A 4EPKA 2CW6A 2HV5A 1ONRA 4CNSA 4M7SA 4K8EA 3CHCA 1UJPA 1Q66A 4PCTA 5HWNA 1JPIA 2EPNA 3W1AA 1JDFA 4W84A 3MA8A 4CQBA 4N9DA 3MW7A 2BVYA 3AWOA 3WF3A 2VL4A 5DCBA 2UY2A 2Y7DA 3F4CA 2V67A 4YVPA 1TPWA 1IGSA 3NSMA 4FOKA 1B2YA 2PDGA 5BZAA 3GXMA 4JIIX 2YBVA 3ITTA 4CEXC 2CLOA 4HA1A 1A49A 4Z0JA 3TFCA 4I7UA 4UTMA 5AC8A 2QJJA 1YPXA 1XDMA 4QHRA 3T0TA 4B4HA 1R3TA 3G0XA 4N9BA 3W2KA 3ZT6A 3L4UA 3NQEA 3LCHA 2PRLA 3MJYA 4J3TA 1Q63A 1UZ1A 3V5CA 4C7DA 3WY1A 3E6EA 4HT3A 4QTGA 5HPOA 3NNTA 2PRMA 3G24A 4MZ8A 1W37A 4L1GA 3ZJ6A 3MO4A 2FKPA 4WZHA 3UG8A 4HGXA 4DF1A 4LBRA 2G96A 3W0KA 1XV8A 2DUXA 2O9RA 3SRFA 2CLKA 2IXVA 2IPFA 4I3GA 4L1WA 3AYSA 7REQB 3WLQA 1DHPA 1V3KA 2WCAA 1VD6A 1MDRA 1H2IA 4IG2B 2ZWYA 3WD4A 5FCZA 2VRJA 4G7EA 5T9BG 4UQCA 4DBUA 2GGEA 1H1ZA 4UOQA 4NEVA 5CSYA 2DIKA 1XANA 3CQIA 2ZUWA 4XIAA 1K77A 4K8DA 3M0JA 1DJWA 2J9XA 3KRZA 3WNKA 1H5VA 4XK2A 3FFSA 5A6AA 3LQGA 1Q7QA 2I5IA 2QF7A 4EP8C 2D0HA 3KXQA 3UZWA 4C90A 1JCYA 3CXOA 4IMAA 3VXGA 1B3WA 3SFKA 3ONBA 4DJFD 5K7JA 3VX0A 1X97A 3OHMB 1E5JA 1AQHA 3TYUA 3GB6A 4BS0A 1FA2A 3MO7A 3ERPA 2P3ZA 3VPLA 5E9XA 2XFWA 4M3PA 2NT1A 3CQHA 1UR8A 3MZNA 5A94A 3BL3A 4JFUA 3STGA 4AXKA 3PR2A 3QC0A 1T6MA 3G5EA 3GS6A 4AZHA 2RKXA 4L9YA 4WF7A 2VR2A 4LB4A 4FNUA 4GY0A 2V38A 2YJQA 3DZ1A 1DJGA 3QR1A 4M1BA 3WLJA 1QBAA 1ZB5A 4JIEA 2WMJA 3DH7A 1HZYA 1PO9A 2GPTA 3R58A 4TX6A 4JS3A 4EOUA 1OCJA 3B97A 3H21A 1ECQA 2CBIA 1ZS2A 1U1UA 1UUMA 1ONXA 1PUDA 3IACA 4M24A 1ONWA 4ZQPA 2WAGA 1QT1A 1WXZA 5AHMA 2FZMA 3LCLA 2EQDA 2NSOA 2G97A 1A5MC 4OZOA 1J0HA 3T44A 4FOJA 4AY7A 5EKYA 1HJQA 3HFTA 2FPYA 1DIEA 3G1RA 3WYZA 5I0DA 3WLHA 4XKMA 1T41A 2E4TA 1TA3B 2DJLA 2HVOA 1TG7A 3H55A 2CLLA 3IWPA 4KERA 2V68A 3GXIA 3ZSTA 2FGLA 2OZ0A 1EP2A 3IRDA 4JCMA 3VKDA 2ACUA 1W5MA 3QC3A 4B2DD 2QJMA 1G94A 2DZPA 3VD3A 3O7UA 1VFHA 1YE6A 2YXXA 5IXEA 2WKGA 4Z2HA 3AISA 3HQNA 2OR2A 1XL9A 1K9DA 4MPQA 1EF3A 1X8CA 3NQFA 2PDJA 3TQ0A 1JPDX 2HEJA 4AZCB 3GBEA 4JDRA 4ML4A 1H7RA 1MRQA 2Z25A 3O9NA 1W31A 3XISA 3FS2A 4W8LA 6CGTA 4UZSA 3K5XA 1IT8A 1OVDA 4ATLA 4IGNA 3EPMA 4M1RA 2HK0A 3UG4A 1K9TA 5AVNA 2VP8A 1XIGA 3UF9A 5H8MA 2RAGA 1EUAA 4BWLA 1F74A 3KTXA 2P88A 2BWGA 3QSRA 3N2XA 4MB1A 1DWFM 5KINA 3T07A 5DANA 4AYSA 1FP9A 1AD1A 1OX5A 4G8TA 4O8RA 3HB9A 2X05A 3BURA 2OPJA 3H22A 4J4KA 4NAEB 3C61A 3OA5A 3CK5A 2OSWA 4Y2WA 1A5UA 1BSIA 4DJDD 3SAZA 3SRHA 3DIPA 1CB7B 4BHYA 1WXYA 1LWIA 4LUTB 3W1MA 3W84A 4DNHA 4PUDA 1TUXA 2CZ5A 3H54A 3F5JA 4XVDA 2EG6A 3M16A 2V69A 3VIIA 3C8FA 3RJXA 2G5WA 3UY7A 4EMJA 3RO6A 2ZRXA 3UJFA 3LBOA 5DXXA 5C0QA 2QHAA 4QEHA 3NQMA 5CSSA 2WMIB 3EXSA 2FVKA 4HA4A 1N8FA 4QG9A 2WLZA 4DBEA 1CW2A 3CT2A 1J2BA 2FPVA 2BC1A 1P7TA 1AOGA 4NVTA 2YCLB 2XGBA 1EP1A 4GINA 3TW6A 9CGTA 1Q1WA 1XI3A 3FV9A 3P0XA 2WMFA 1R2SA 2HNHA 4AD0A 2ACSA 4PEEA 3I4KA 3TC3A 4MKSA 2GL5A 4O52A 2YDQA 4WUIA 4C6MA 1U30A 3N15A 4Q8WA 4KEMA 1VPQA 5KVHA 2WZTA 3BE7A 2DVXA 1E9ZB 3H8AA 1B90A 3DKLA 4ZE4A 2CNCA 3AO0A 3BUVA 4JTHA 4TMBA 3EWXA 4R7OA 1GQJA 3EOUA 1OBAA 2OQYA 5HUPA 2L5HA 3MWAA 4GUIA 4I8DA 5IHRA 1BF6A 3EA2A 5ABGA 2ZA3A 1P1MA 2Q8ZA 2QDEA 3F4WA 5D02A 4JTTA 3G1DA 1W32A 3SIMA 1PHQA 1WDDA 1FX6A 3KWSA 4IJBA 3KBMA 4UFIA 3RR4A 5FAJA 4LT9A 1W3KA 3ZS4A 5DMNA 3OLGA 4O1CA 4XZ9A 4B5NA 3VIOA 1UP0A 3B0XA 2DT1A 1XXXA 1DIDA 4LB3A 4A35A 1UP3A 4NXKA 4MJ2A 3MUIA 2ZRVA 2NVKX 3O1NA 4ATWA 2O4MA 2XVNA 1V6TA 4DRSA 1TPC1 2OEMA 3B03A 3N29A 3N19B 3TC7A 3DG7A 3UPBA 3UT0A 3BWWA 5H2ZA 3HJEA 3MTWA 1YEYA 4R85A 1NEYA 3BSGA 2DH2A 1GXFA 4HSNA 1WOAA 3BSHA 1RA5A 4L6HA 3WDQA 4HMDA 1S7MA 1PCKA 1GOKA 2WWCA 3QPEA 1YIXA 1POKA 2HVNA 6TAAA 1N5WC 3RYSA 3WUEA 1H7OA 1LL4A 3GDLA 2HPIA 3EX2A 4PCFA 3H4KA 3HMCA 2VO5A 3UJ2A 3GYCA 3FCPA 1I60A 3NQ2A 2IXUA 1UWUA 2F38A 3CHDA 1UD8A 4GJ1A 4DJED 4D8LA 3DJJA 1HX0A 3HPSA 4HVXA 1Q6RA 3M6DA 2DEPA 4EMWA 3NVWB 3GU9A 5F2MA 3B9OA 1FH8A 1R7OA 3OIHA 5HQEA 4JIPA 1XPYA 1JZ5A 4KBXA 3UU0A 3MP4A 5C2GA 1QPKA 4IH3A 2Y62A 4JEJA 1NWSA 2BOGX 1DWHM 2B7OA 1ZAIA 4KW2A 1ZJHA 3OQ8A 2F6KA 2DORA 4UMAA 3HA1A 4Z1YA 1V7YA 1WP6A 3IJLA 2D0FA 2XTKA 2HZGA 1C3FA 2WO5A 5CPSA 3TOPA 3DG3A 2HE5A 3BAKA 3LM3A 4RCXA 3DFPA 3T55A 4D8AA 3O6YX 4XD5A 2ZE0A 1P6WA 4IJCA 2AOSA 4IIEA 1NWUA 1W9DM 4GI8A 4K38A 4RZ6A 2X1RA 4Q8UA 1UCWA 3KVJA 5BU6A 1KM4A 1ZL1A 3NZPA 1J5TA 1EJ7L 3FVDA 4R9OA 3DBNA 1W3NA 2EQ7A 3GTHA 2W3RA 4O4VA 1YPFA 6A3HA 3ONCA 5D09A 1XRTA 4HK5A 5JXQA 3BH4A 1RK6A 2XN0A 1R3WA 2WSQA 3VNYA 3XIMA 4IGHA 3B0PA 4Q6XA 1OC6A 2R8WA 3A5VA 3RJYA 5FJUA 1XH2A 1W91A 4HMEA 3VGHA 1W6TA 5KEZA 2A3EA 1FWGC 4DUXA 3R7MA 3OYXA 2PTYA 1Q7MA 5JH1A 2PUZA 3GNDA 4EQXA 2IUZA 1UH2A 1M5WA 1ZJAA 4Q4PA 4O4WA 3VIPA 3VOCA 2G95A 4MWAD 4MZ1A 4DUOA 4HOWA 4G1KA 1RCOB 4HHMA 4MPKA 2QAPA 3WCZA 2X2YA 2VRKA 4IOTA 5HBFA 5G4HC 3QMTA 1KFJA 4NZ1A 3TN4A 4I5XA 2Q09A 2Y70A 2CEQA 1WO2A 3AXMA 4O19A 1N61C 2EPKX 2UY5A 3I3BA 4AC7C 1E1CA 3VX1A 1GGOA 1V3IA 3ES8A 2DSKA 1E6XM 3EPNA 4XAPA 3S9ZA 3V0UA 3L2IA 3S1VA 4MOZA 4JNMA 4N42A 1CB2A 4LYPA 3IAQA 4LYQA 3PZTA 4YTSA 3PSVA 3ABSA 1JQXA 3WH5A 3WD0A 1TV8A 4LH8A 1MNZA 4Y6GA 3R11A 2WJFA 2YCIX 3DYMA 1Q6FA 1VEMA 1AW5A 3G1HA 3VMNA 5A8GA 5IFTA 2BX7A 3VD4A 2V3FA 1FWBC 4NYUA 4DPPA 3WNOA 1GTHA 1RP8A 2JEQA 3RPDA 4G6CA 2YOCA 1FXQA 2XFFA 4YWIA 1GYLA 4PMRA 5GJMA 4Q8QA 1UD5A 3CAWA 2OEKA 3H4WA 3TR2A 2R1NA 4F2BA 1ZALA 4V1YA 1W5PA 4KWUA 1MXSA 1SZRA 3EWUA 3KVMA 3VOHA 1KGUA 2QEZA 4LBUA 3IJ7A 3W6MA 2ZDRA 3MQTA 2AKMA 1GCYA 4I9MA 3U2EA 3LY0A 2VI0A 3RAOA 1UWSA 2QVNA 3G1VA 5CAHA 2J79A 4AX6A 3E2RA 1E0XA 3L0NA 3S2NA 3ZLFA 9RUBA 4WJEA 1O1ZA 3KL3A 4ORIA 3A6OA 1DJNA 4GVHA 4NNBA 4W7UA 4JAWA 4GFIA 1HIZA 4JX5A 3WFAA 3C52A 4Z2GA 4HP5A 3WENA 4HNNA 2ZQ0A 5CAKA 3GNXA 1LLOA 3HW2A 1CENA 4ZXOA 5I3JA 4LAUA 3QHMA 3W7DA 1JAEA 5GRTA 1Q2SA 2BFGA 3R8GA 2W0HA 1AL7A 1Z89A 4I90A 2PPGA 5IBXC 4ZENA 1KFBA 2JBMA 2ZA2A 3LK6A 3TMQA 1CWYA 1XLJA 1KLZA 3SUUA 1BAGA 2VC7A 3CZ8A 5CZTA 3EB2A 1ME8A 2ANUA 2FQIA 3C0JA 1GJWA 4DEFA 2A5HA 1I2PA 2YB1A 5FEPA 4K1WA 2O55A 4GGBA 1FWHC 5CZ0A 5CC5A 3KZSA 2BODX 2YFOA 3PBUA 3N04A 3VOFA 4LX4A 3O0FA 2C7FA 2QCLA 2V3EA 2WMIA 1MW2A 5LIKX 4DWSA 1W3JA 1GORA 4S2BA 1H5YA 3SUVA 2DUAA 2VDIA 2XIOA 3OBEA 1XGEA 3U4AA 3PN8A 3F03K 3LADA 3GUGA 1TYPA 1NQKA 4E8CA 3MZ2A 2A21A 4QSHA 1MWOA 4ADUA 5KETA 3M4HA 4DF0A 4HKPA 5ECUA 2PDNA 3RF9A 4ZFCA 3AMGA 3C2RA 3EXRA 1C9DA 4K6AA 1RQEA 3O6CA 1YDYA 1LBMA 3ANYA 5DMYA 4HZ6A 1Q6OA 1Q5MA 1XBYA 3AWNA 2VGGA 2WHMA 3S6TA 2OFJA 1P0EA 1GWJA 3V0TA 1ZBCA 3SCVA 4AHQA 2XIMA 1QI4A 4F0HA 1R0MA 3BMVA 3QJAA 1WYGA 3MS8A 2NX9A 1VCVA 4MJZA 4MWAC 4YL2A 4KEUA 5CGMA 2OELA 1VQTA 1D3HA 2R9ZA 2J77A 2DZVA 1XBXA 3SQSA 4R88A 3USZA 1W1YA 3II4A 2YW3A 3WG6A 3WEZA 1QVBA 1TE6A 1JF5A 4E2OA 1E71M 1JCJA 3A7RA 4FLSA 4FLOA 4H9TA 2V0TA 3GXDA 1L8PA 2GRTA 1SR0A 1FQ0A 2Q3OA 1OG0A 5A5WA 3M7WA 1OJXA 1K7FA 2W54A 3HG3A 3POHA 1L2UA 1FFQA 3W7QA 5HWJA 1GQLA 4DXVA 1ZAJA 4WSKA 4PR4A 2PDUA 3WMLA 3UQNA 4TR9A 2OJPA 1E4MM 1US2A 4HU3A 1H7WA 3M5YA 4GIRA 3L2LA 1YXDA 2GZXA 3P60A 3R0KA 4O12A 1DJHA 2WBKA 5IHSA 4MB5A 4W8BA 1VFTA 2UY3A 5E0KA 3MI2A 3IS4A 2Z1KA 5JIWA 4H19A 3W00A 5C9RA 1JZ8A 3W6LA 3TYCA 5GNXA 3LA4A 4G7FA 2FPTA 1ZZMA 3WJXA 5D9OA 4I5UA 3S9YA 1FVPA 3BJSA 1FXPA 4DIAA 4GC4A 4KFNA 3DGRA 2FLIA 4GC3A 4O0QA 3IIOA 2XIIA 1J96A 3BICA 3T4CA 1LDCA 2WZIA 4CNTA 4N6FA 1QHZA 4LUJA 1I0DA 1G7VA 4JQ9A 5E9AA 2PDPA 3EKGA 1LBLA 2I1OA 3QY6A 4IP4A 4C6FA 3W24A 4HHHA 3AUOA 2KAUC 4IQLA 1J01A 4OFCA 1B3ZA 4EF9A 5H1WA 5G4EA 3A4WA 3M9YA 4O16A 4R34A 4GYPC 4I7VA 2DQXA 5ABFB 1RD6A 3PZIA 4FZIA 1DBTA 8A3HA 1KXQA 4ES4A 2PC8A 2QUNA 5JMUA 3NURA 6XIAA 4GMEA 4K8GA 1MEHA 3TIMA 2HS8A 4QJ3B 3QBUA 3E96A 3R8RA 1B3OA 3GK0A 4BI6A 4MUPA 3WL0A 3V35A 3G77A 4HJFA 2JF6A 4HZMA 4HIBA 1EC9A 8XIAA 4NI3A 4AHPA 1LBFA 3UZXA 1F3XA 4PTNA 3JZEA 5SWUA 1QPRA 5J5DA 3FIGA 5CPQA 4LV9A 4XSMA 3I6TA 2Z1BA 5E6YA 1QNSA 4XZHA 2BP1A 3IIPA 1F6KA 3P81A 4M82A 4Q8MA 3M0MA 4I7WA 4FF5A 4DYJA 4FP1A 3IJIA 4NYYA 1DV7A 4GUJA 2GGHA 4XD3A 4H6KA 3BDKA 3IAPA 1OADA 2UZ9A 3J7HA 1P0DA 3NSNA 2JKPA 1E6SM 3VDGA 4OVXA 5GJNA 1ZBVA 2A7RA 1OYAA 4IICA 1IEXA 5A8MA 3OGVA 3AIBA 3HO8A 4HMCA 3IUDA 4JTDA 1BXNA 3MI3A 1YTEA 3O0HA 3GDKA 3TJIA 4LS1A 5LNWA 4H7CA 3TSBA 1CEOA 3U6WA 3A47A 3QV9A 2E6DA 3VUSA 3WBEA 2YVJA 2A1YA 4AD4A 3BLKA 1TJ2A 3PPCA 3QLLA 3UESA 4WY0B 4UWMA 2YL6A 4JIQA 3MV11 3DYPA 4XVEA 3TH6A 4F48A 1EEXA 3C2VA 4OQVA 3B9DA 1KO0A 1C91A 4FX7A 2J9ZA 2QT3A 3LRMA 1KBJA 5CCZA 4R33A 3W73A 2VX6A 4CUCA 4Q4RA 2W61A 3TCSA 3VOIA 3EANA 1E6NA 1PZ3A 4KESA 1VGAA 1TQXA 3QGVA 3HIJA 4H8VA 2DSZA 2CKRA 3BLIA 3LDVA 4ZSUA 4H04A 5FACA 4XZLX 4HHPA 4G1NA 5DRCA 4JKLA 3FSUA 1KV5A 3CH0A 5PTDA 4QIUA 3SN1A 1NFGA 1DNCA 4B3LA 1U1HA 4V2XA 2YDRA 1QHPA 3WQCA 2O4QA 3LNMA 1VENA 3P8IA 3QYSA 1BG4A 4FLRA 2AAQA 1XD1A 5HATA 3R4IA 5LZLA 3ZOAA 1XQLA 1Y5VA 1HL2A 2HSAA 4N9CA 3AS1A 4P61A 3U5YA 1B4EA 1O60A 3RPTA 2WC4A 4DZAA 4ERAA 4BF9A 1V0MA 2XVKA 3N11A 4F0SA 2ZTKA 3BGAA 4DO7A 5D2TA 4PBFA 1LQAA 3AU6A 3WLLA 3N6QA 3UJEA 1W8SA 2HCVA 4JQ3A 3OIXA 4ZO7A 2EQ9A 1RJPA 4RV3A 3C4UA 1XLHA 1XF0A 2WMHA 3I7SA 1XYZA 1NDAA 3W3OA 3EDFA 1F6PA 2X7VA 4MWAE 1JCTA 4L9ZA 1WKEA 1G69A 2Y8UA 4K7VA 1NOUA 3EDKA 2VFGA 1YBQB 2E6AA 4HJWA 4HPGA 3MDUA 1W8GA 3EMCA 2XFYA 3MYOA 1XBZA 4NZ4A 3A4XA 4K7ZA 4PUWA 4RR4A 3W7RA 3STCA 1Q7ZA 2E7FA 4GIEA 4HPJA 2PF8A 4D71A 2DUZA 1Y8BA 2CWXA 4TTUA 2FB2A 3SSZA 1SJBA 4Q4MA 2XVGA 3SN4A 1BEUA 3RLGA 2GDVA 5DY2A 5I00A 4FS9A 2D24A 1EIXA 2H3BA 1XSIA 1A5AA 1TQJA 4GR1A 1H7XA 3OODA 4XIMA 1O5QA 4EAYA 3UR5A 6ALDA 4KQNA 2WBGA 1HP4A 3BG9A 1UQYA 5FF3A 1C92A 2QPSA 4Q3MA 1VHCA 1AJ2A 4LVGA 4DLFA 1OIFA 3O63A 4JD4A 3S1WA 2INEA 1ITQA 4X22A 1YXCA 3NQVA 3PJWA 3HURA 1A53A 1MNSA 3GNPA 1F4HA 2F7FA 5CSRA 1VPYA 4UTIA 2W79A 1RVKA 1N82A 3CZKA 1QFEA 4C5ZA 1N8WA 4AC1X 3OB8A 2X8HA 2XN1A 1SFTA 3QSTA 2O56A 4H83A 3PWAA 3IGSA 4IWWA 1O6IA 1WAWA 2OGYA 4NL1A 1EPVA 3WUBA 1TV5A 3O6DA 2XGZA 1S1RA 4GXWA 5BMXA 3D0CA 4D6EA 4E3VA 3WMSA 1UD2A 1XLMA 4GRTA 1Y0EA 2CZVA 1W2VA 3TONA 4OU1A 5FS9A 1O12A 1SYTA 1SSGA 4OOUA 1EOKA 2WHLA 5D9NA 1UR9A 2FIQA 2E28A 1W0MA 4AWUA 1B9BA 4C6CA 4F2UA 4J3VA 4PCPA 5CBBA 2DGAA 1Z41A 3RCMA 3N4FA 1RK5A 3B3DA 4JTCA 3IVUA 1GVSA 4S3KA 1OT1A 4LVDA 2WP5A 2OZTA 1GVOA 5CSUA 1H63A 4RW5A 1MFUA 2BNJA 1G6CA 2OSXA 4OBSA 1KGWA 2VC5A 3OZOA 1YNQA 3W7NA 2WOIA 1H1NA 1PX8A 2ONEA 3VYLA 3SI9A 5LA2A 1XM3A 4AZCA 3GH5A 5BWAA 1VR6A 4GQGA 2YX0A 5JCKA 4US5A 3VIJA 3ALGA 1ZU8A 1EEPA 4DY1A 4DBWA 2YZ5A 1R6WA 3KL5A 2NUYA 4TVYA 2Z1SA 4QEEA 3FDGA 3QQ1A 1RVGA 4QR6A 4JQAA 3SCTA 3U8GA 1FWNA 1NELA 2CDUA 4RV8A 4LTSA 2GQ8A 5K2ZA 3E0WA 1EB3A 2A3CA 3MKVA 4XD4A 5FSEC 2D69A 3BVJA 4LC6A 4JICA 1XH0A 3UCDA 3UYCA 2FH8A 2CZEA 2Y7FA 1AJ0A 2ZX9A 3PUGA 3JS3A 4N4QA 4GLEA 1MW0A 1OG6A 3L12A 1DJIA 1ITXA 1B57A 3MCOA 4NJIA 4OJYA 2A4AA 2V5LA 1ECEA 4LAKA 5K9XA 4IQDA 4PRWA 4KRZA 1YNPA 2GSEA 5LSMA 4WGHA 2CC0A 2X50A 4PTDA 4GI4A 3TA6A 4AZ7A 3SO7A 5M5DA 4NU7A 4R7JA 1OY0A 3L0KA 4XAFA 5AFDA 1X7IA 2C1GA 3S1UA 1AQ0A 3CV1A 4Y7EA 5BMWA 2PDQA 1GSNA 2FH6A 5A6BA 3M6YA 4BQ4A 1PPIA 2VNCA 3LHVA 2A6LA 4MY8A 3MT1A 1K7EA 3MSGA 3L2MA 1LT8A 1TWDA 3URQA 3PTQA 2RGMA 1RUSA 5KZ6A 4ZFMA 3MANA 4MUZA 2XYLA 2XWDA 4GH1A 5CJMA 1FOBA 3PC0A 3WQDA 4CVUA 1ISZA 3CV6A 5LIWX 4EF8A 5CXPA 3GR4A 1UR0A 1XS2A 4R3UA 3C6CA 4LEQA 4Q22A 2I9UA 1V03A 2IS7A 3UD6A 1ESWA 1CGXA 1OF8A 3CZJA 1HKWA 2I56A 2OZ3A 3TJXA 4GCAA 3APGA 3ABRA 2NWRA 1UZDA 3TW7A 2WZHA 3PB2A 3W38A 4I5RA 3E2QA 4H4UA 3OTRA 5EBUA 3FA5A 5FEZA 1NQ6A 5C9ZA 1O68A 1R47A 1YTDA 4C1NB 3A23A 2DV0A 3G1XA 1JDDA 4DUVA 3IJQA 3G0UA 1QO2A 2PZ0A 3VOJA 1H09A 1JI2A 1V5XA 4O18A 3LXDA 3CUGA 1ZTVA 4CCEA 1W5OA 5I23A 3L4ZA 2JE8A 2QJHA 2CITA 3NVZB 4D1JA 3W29A 3ITYA 1W1TA 4S3EA 3EOEA 2ZE3A 2F2HA 5A8PA 4HA0A 4LEFA 1FH7A 1LOLA 3WMBA 1AW1A 1OFBA 3OC4A 2GJPA 2IQTA 1GESA 3OHIA 1ZP3A 4HCDA 1QJWA 1Q65A 1EUNA 2Y61A 2FZ9A 3LYEA 2X42A 1VIWA 3W7IA 2W9MA 1XC4A 5T26A 1AK5A 4HOXA 3UZ5A 5FA5A 3NWRA 2EHHA 1Z3NA 1W1VA 1QXLA 2Z1VA 2XH2A 2YQUA 4GHRA 2PEVA 1XPGA 1V02E 1S2WA 2DT0A 2P50A 4MWAA 1K6WA 1Q6GA 2OG9A 3WJSA 4DYEA 4Q8VA 4UBPC 4Y9NA 3DEQA 1FWRA 3ZVHB 3W28A 3MP3A 1L6WA 1HJXA 1PKLA 2A79A 1FWCC 5AVHA 1GHSA 3RMJA 3MWCA 3HGOA 4J3ZA 3IIZA 3IC9A 3EWDA 2CLEA 2VGBA 3DK4A 4LF2A 1JL8A 2XIQA 2OWXA 5D9PA 3HTWA 1JPMA 1SZEA 5HAOA 5CH9A 6TIMA 5HJXA 3SR7A 3GXFA 2PU0A 2DT2A 4Y8FA 1VBGA 4NASA 4FHAA 3GIYA 2E3TA 1CLXA 1TKKA 3EEZA 1RJRA 5ABTA 1RALA 1CXLA 4AY1A 4PE8A 2J74A 5CBIA 3MMTA 4Q7NA 3DAQA 3FW6A 4PBEA 1TPDA 3K8LA 2C15A 2Z00A 3M43A 1XG3A 4NUWA 4FOUA 2AMGA 4A6GA 3GU2A 1AMYA 2XSAA 2WPCA 3ZFHA 1R38A 3PB0A 3CPRA 1IT7A 2GJXA 3WQPA 4ZQRA 3FXYA 1ZMDA 1ZCCA 3WELA 1PZ1A 5BRPA 1HGWA 2YXOA 1KM0A 2ZXQA 1VRXA 1EDGA 3VGBA 2IPGA 4DO4A 2VX5A 1OX4B 4CCDA 2WNZA 3LCGA 1RXOB 1XKYA 2E77A 3P3BA 2WZMA 3QHNA 5XINA 2W63A 3S5YA 1VPXA 3BLEA 1XRFA 2PDMA 1TPFA 1V3JA 3PANA 2P0IA 4QGCA 3IGUA 4IFKB 1KNWA 2DZSA 3HQOA 1O95A 1XGDA 4AWTA 1UR3M 5CQ1A 1A3HA 1KTCA 4ADSA 1KFEA 4PFMA 4UTTC 2JFEX 3LBMA 4EMIA 4NRSA 1QI3A 4ZGYA 1OABA 4ZVJA 2UBPC 5KVIA 1SJAA 4KFPA 3AMKA 1SPQA 4P7LA 1CIUA 3OW1A 4CNOA 3T40A 3CQJA 4DJDA 4U33A 3K2GA 1OT2A 1PX3A 3E49A 4JX4A 3LV5A 4XUYA 3UETA 3EX3A 3NVYB 4KCWA 1GYMA 1VHNA 3F2DA 2P10A 1J93A 1VCGA 5KTLA 1QTWA 3LCFA 1S46A 1B31A 3K8MA 5FJTA 2LLEA 4IT1A 1L8NA 3IIVA 3O06A 2MANA 1P7TB 1E56A 1E9LA 3PFMA 3BGJA 5LA1A 4TVWA 4JYDA 1UKPA 2DQWA 4I9AA 4REQB 3B06A 4LIIA 3FVMA 1CXFA 2CCRA 2WW5A 3QZAA 1PB0A 1K4HA 1TJRA 4UFHA 1FHDA 4OGZA 3M5XA 1PXGA 4GFSA 4H6EA 3MMUA 3NS1B 3L68A 3PNZA 1XUZA 2VC9A 3NDYA 5CC3A 1KFCA 1TX2A 2XH7A 1TZZA 2REQA 3GHSA 3TZNA 3BZJA 2PDKA 4JKKA 4EM3A 3W7CA 2KX9A 1JZ3A 4ZO9A 4UTTA 3AZTA 3PTKA 2DDXA 3U3HA 5A6KA 3H6OA 1UKQA 1QCWA 4YLWA 3W7MA 2PDFA 4L80A 2Z27A 5AY7A 4MF4A 1TCDA 3CMFA 2GQAA 1JRPA 4JTRA 1DE5A 1E0TA 3DGHA 1UUOA 5REQA 1V3LA 4RXFA 3JZUA 1J4EA 4Z2IA 4AAJA 3IIXA 1GRFA 3CZEA 2ISWA 1IR1A 4IIGA 4NAFA 1T8XA 4UQDA 4B9ZA 2O7SA 2FTPA 3CL8A 2OWWA 1VFMA 2E67A 2HROA 1FWTA 3S42A 4QG6A 3VKCA 2Y7GA 4S3GA 1XCXA 1PV8A 4KCTA 5H6HA 3A9IA 1STZA 3GAKA 4TV6A 1HVXA 1S5NA 4FIRA 4MKVA 3TYDA 1B54A 4AHOA 3AMZA 1QUMA 1YNYA 4EXBA 5LIUX 3L67A 4B15A 3PS7A 1BYBA 4CD5A 3KRBA 1RM6B 3LCXA 1XLKA 1I1WA 5B80A 1M7XA 3CIXA 4LRTA 3NXFA 3OJGA 1XQKA 3WBYA 3UPWA 3NO5A 2W66A 3TA9A 5EB8A 4CQ8A 1EO5A 1IT0A 5M1TA 2WNWA 3CEPA 4BCEA 3HG2A 4DWDA 1V59A