1FHVA

Crystal structure analysis of o-succinylbenzoate synthase from e. coli complexed with mg and osb
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
323
structure length
322
Chain Sequence
b'GSAMRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGREGWGEISPLPGFSQETWEEAQSVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILKLADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNPDYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQVRRWPGSTLPVVEVDALERLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-SUCCINYLBENZOATE SYNTHASE
publication title Evolution of enzymatic activity in the enolase superfamily: structure of o-succinylbenzoate synthase from Escherichia coli in complex with Mg2+ and o-succinylbenzoate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 106
structure length 322
sequence length 323
ec nomenclature ec 4.2.1.113: o-succinylbenzoate synthase.
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1fhvA01
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1fhvA02
1KCZA 3D46A 2PCEA 4E6MA 2AL2B 3R25A 2P8BA 2AL2A 1R6WA 3OTRA 3UJSA 2QJMA 3VCNA 3IJLA 3MKCA 3GY1A 4DWDA 7ENLA 3FYYA 1KKRA 1DTNA 3I6TA 3PK7A 3SN4A 3JZUA 4GISA 3NFUA 2AKMA 3H70A 4Z1YA 6ENLA 3ZVIA 2OKTA 3ES7A 4DHGA 2P88A 3R0KA 3P3BA 4E4FA 2OX4A 1EC8A 5FJPA 4Z17A 2POZA 2XH2A 5IDZA 1KD0A 2GGEA 2CHRA 3RCYA 2GDQA 4HCLA 1TE6A 3T8QA 1NELA 1WUFA 5FJRA 1W6TA 2QGYA 2PA6A 4JHMA 4GMEA 4DXKA 3B97A 3PWGA 5FJTA 2PU1A 3ZVHB 4IP4A 4K1WA 1FHUA 1R0MA 3ZVHA 3MUCA 3H12A 3STPA 3TTEA 2P8CA 3CXOA 2MNRA 3FV9A 2QJJA 3DG6A 1OEPA 2OO6A 3IJIA 1TKKA 3R0UA 2OZ8A 3SN0A 2MUCA 2OLAA 4ROPA 2XSXA 3CK5A 2GL5A 2NQLA 3VDGA 4E5TA 3UJ2A 4DN1A 3OPSA 4KWSA 3OZYA 2HXUA 3D47A 3OP2A 4A6GA 1PDZA 2PTZA 4GGHA 3FCPA 3FVDA 4DX3A 2OVLA 1SJDA 3ZLHA 2ONEA 4E4UA 3TQPA 1F9CA 4HPNA 3H8AA 3UJFA 2PTWA 3UXLA 3ES8A 3CAWA 4X2PA 1MDRA 2I5QA 4JN8A 2PU0A 3OZMA 1SJBA 1JDFA 3NZGA 3V3WA 3U4FA 3IK4A 3V4BA 3MZNA 4E8GA 2OQHA 4HYRA 3DDMA 4KPLA 4GYPC 2QVHA 3GC2A 3JW7A 2GGIA 1JPMA 1ECQA 3UCCA 1MRAA 4G7FA 2GSHA 2GGHA 3P0WA 3SJNA 2GGGA 4GYPA 4HNCA 3H7VA 4MMWA 3R10A 2RDXA 1FHVA 2PGWA 1EBGA 2ZADA 4EWJA 3V5FA 4MGGA 3DG7A 4JN7A 2QDDA 4K2SA 3TW9A 3R1ZA 2OZTA 5BOEA 3PWIA 4FI4A 1BKHA 2QDEA 1TZZA 2O56A 2OQYA 3T6CA 4H83A 3RO6A 4ENLA 1EC7A 1IYXA 2OG9A 3MSYA 3DESA 4IL0A 3RR1A 3FJ4A 3GO2A 2PMQA 4M0XA 4ZCWA 1XS2A 4M6UA 2PP0A 3DERA 3TOYA 2OPJA 3RGTA 3RRAA 3UXKA 3K1GA 3DEQA 4A3RA 3TJ4A 1YEYA 2DW6A 3DG3A 3DGBA 4IP5A 3QLDA 2QQ6A 3KUMA 3OW1A 3MY9A 3N6JA 3TJIA 4J3ZA 2AKZA 3DFYA 5FJUA 2FYMA 2DW7A 2PODA 4H19A 3I4KA 4IL2A 2PPGA 3QKEA 3N4EA 3DIPA 1JPDX 1SJAA 3ENLA 4H1ZA 2PP1A 3NXLA 2P3ZA 3QTPA 3VCCA 1EBHA 2ZC8A 3CT2A 4GGBA 2AL1A 3BOXA 3IJQA 1KKOA 2OZ3A 1SJCA 3TWAA 4HCHA 3THUA 1WUEA 3Q45A 3P93A 2PP3A 3ZLFA 3RITA 1L8PA 3TWBA 5J04A 3MQTA 4HN8A 5BOFA 2OFJA 2PTXA 2QJNA 2PS2A 1E9IA 1P48A 3GD6A 3QPEA 3SBFA 5ENLA 3HPFA 1MNSA 3ZLGA 3U9IA 1ELSA 3JVAA 4HCDA 4IT1A 3VA8A 1EC9A 3S47A 3N4FA 2HNEA 3PFRA 4MKSA 3MWCA 3TCSA 3CYJA 3DFHA 3R11A 1NU5A 2PSNA 1ONEA 3FXGA 4YWSA 2PTYA 3VFCA 3Q4DA 4KT2A 4F4RA 2PGEA 1PDYA 3EKGA 2XGZA 3UGVA 3T9PA 4ZA0A 2GGJA 4DYEA 3UJRA 5FJOA 2XH7A 1MDLA 2FKPA 5EU9A 2P0IA 3BJSA 1MUCA 1RVKA 3UCDA 3SN1A 2XH4A 1P43A 4A35A 4J1OA 3I6EA 4HNLA 4GIRA 3V5CA 1BQGA 3SQSA 1JCTA 3SSZA 2HXTA 1XPYA 3VC5A 3T4WA 3EEZA 4K8GA 2XH0A 3S5SA 3BSMA 4KEMA 4IHCA 4FP1A 4GFIA 4H2HA 3CB3A 3NO1A 3VC6A 4IZGA 3QN3A 3UJEA 3N6HA 4G8TA 2HZGA
chains in the Genus database with same CATH superfamily
4AZ6A 1M65A 3PZVA 4LJ3A 4AW7A 1Q7ZA 1MYRA 3PC0A 2XIOA 1GPWA 3EA1A 2AL2A 1EIBA 2W0HA 2CXEA 1KB3A 1D3CA 3TP4A 2QJMA 4AG0A 5TNVA 3L12A 5E1QA 3GY1A 1N2VA 1I4NA 3IANA 2VFFA 4M6VA 3S6DA 2FTWA 3ABXA 4J3UA 2ZDRA 1IF2A 5CPNA 3ANUA 3P61A 3CM4A 1W2VA 2QV5A 3HPXA 4Z1DA 3SECA 2KZHA 2BY0A 4FXFA 2Y6ZA 2WZIA 3TNOA 2Z1VA 3PY2A 4OV4A 2H9AA 3IRSA 4Q8UA 1WV2A 3DGRA 4IH3A 4Q8PA 1R7AA 1RJRA 4NASA 1Z8AA 5HQLA 2DQWA 4X0VA 4FIRA 4PCFA 5DQPA 4ZQCA 3VU2A 4H9ZA 4REQA 1E1FA 5LIXX 4LY8A 1KXHA 1VBGA 1UCWA 1FEAA 1JXKA 1H61A 2J8GA 2J7GA 1UG6A 4FF5A 5CSYA 4IJRA 4FOKA 3EANA 4P8XA 3WQEA 2A7NA 3TMQA 4K7YA 4C5YA 5CC5A 1NDWA 3SCQA 4YTTA 3G6MA 3UNTA 1M68A 5KETA 3WLIA 2EPMX 3TN4A 3W81A 2VOTA 5A6BD 3TC3A 1FKXA 1THFD 3IJ7A 3BLKA 4H8VA 2GJLA 2VUYA 1PYFA 4HP5A 1FFRA 3EF6A 2OLAA 4H6EA 1JIBA 2A3LA 4BS0A 1FO4A 4LUSB 1J0KA 4AUBA 2CC0A 4AX7A 2ACRA 4ERGA 2C0HA 1LVLA 1H2JA 4ZQPA 3FA4A 4NZ4A 3S9ZA 1J11A 2VCBA 5E09A 1ZGDA 2PTZA 5TBOA 3O63A 4JIPA 1GORA 3UEQA 1XINA 4N4PA 3VIOA 1SW7A 2ZWYA 4QE4A 2ZZCA 2XU2A 3BSGA 4KIEA 1EPXA 1UP3A 4FK9A 4KMQA 2BOFX 2QCFA 2YL6A 4M52A 2B7QA 2G95A 2GJXB 2Y2WA 4FMVA 3RU8X 2PDPA 3TK7A 4E2OA 2YZRA 2R8WA 4DEFA 4A8LA 4B5NA 2X99A 3WQCA 2AMGA 3SW6A 4AD0A 1PTGA 4Z1BA 2IUZA 1KM6A 2H9AB 3O9NA 1PJ9A 1R7OA 2XUCA 1SFTA 1DQWA 3PPFA 4RDYA 5IOBA 2VFEA 1OFPA 1WXZA 2GGGA 1ZCCA 4HHHA 4YWOA 3HOJA 4ROQA 1GETA 4GZIA 2WWCA 2X16A 3DX5A 3W1MA 1S38A 2ZUVA 2GVGA 4LC6A 4DZIA 3TW9A 3AWOA 4MWAA 1JD9A 1F7BA 5G5GB 3CMGA 2ABAA 5DCBA 4CCEA 1O1ZA 4AQLA 4MIMA 4S3FA 4HMCA 1ZMDA 4EXQA 4D6DA 3ONBA 1E1CA 1SMAA 2O4QA 3LBMA 3Q6JA 2PDMA 3TYBA 4UNKA 5FF3A 4IL0A 3H7RA 1QDSA 4V2XA 1T8XA 1M53A 4Z2KA 3WEMA 4B5XA 3LHTA 3NOEA 3IIOA 4UB9A 2H6RA 2UWFA 3LM3A 4AHQA 2W55A 1E43A 4GJIA 1NARA 3DYMA 1DJWA 1GSNA 4GJJA 3OODA 2FTYA 4LTSA 2QAEA 3DFOA 1GZ1A 1LTDA 2CLPA 4QE5A 1JXJA 1W9DM 2DIJA 5I09A 1XH2A 2WLZA 3SY1A 1CGVA 4EK7A 2VX6A 4QLLA 1SQ7A 3BE7A 1FWEC 4GNVA 3IVUA 1T96A 3G18A 2YL9A 4ZXOA 4Z2JA 3SUTA 1NIUA 4LNYA 2WC4A 3URNA 1UZHA 1MWOA 3BVJA 1TPH1 3ZYZA 1QATA 1TA3A 1S5TA 3PUOA 2C18A 2E5AA 4FX8A 4M80A 3W53A 3E6EA 3QTPA 5AHFA 3RAOA 4IF2A 3SM0A 1US0A 4GXPA 1EJVC 1XLIA 4JTDA 4GGBA 2FJUB 2HK1A 1JRPA 4LEQA 1KKOA 3FK4A 1IXQA 3VO0A 3NQFA 5LZLA 4NEWA 3PNUA 1BLIA 1G67A 2BHZA 2F2HA 3LPFA 1VPYA 3LYEA 3TTYA 1E6QM 2MANA 2YL8A 4CU6A 5BOFA 3B9NA 4WGHA 1B30A 1LUCA 1AJ2A 1UD8A 1PWLA 5EA9A 3UVIA 4JQ1A 2F7FA 4YJ5A 4UTTA 2VZOA 1DP0A 4NJHA 1TMLA 3A7AA 1DIEA 1PCKA 3VM7A 1W0MA 4LW7A 4MWAB 1IEQA 4JL1A 3BGJA 3E12A 3LHUA 5K9XA 5CSUA 3DH9A 2WPGA 3KVMA 4D6EA 1ZJBA 1E1CB 3S47A 4BKNA 2EQ8A 4W7WA 3MWCA 3WYZA 1PIFA 1HG3A 1VCVA 3WDIA 5FI8A 3H24A 1BSIA 2AGKA 3VFCA 2EPLX 1RD6A 1KFBA 4J57A 1EJXC 4XZNX 1GQIA 3COTA 1A5LC 4JTHA 3T9PA 2GGJA 3V0TA 4AVFA 2WPFA 2EKCA 4RNHA 3L23A 4GX8A 1XKYA 3ARZA 2A7PA 1DHKA 1ZJHA 1LM1A 3W07A 4XUYA 2PWGA 3W86A 3WDJA 4LYRA 4MADA 5C9ZA 3VGDA 3B9EA 3DK4A 4JX4A 4UCGA 3TTSA 2GQAA 3GAKA 4C6BA 1D9EA 4PFMA 2PDHA 3CH9A 3WF0A 1GG1A 1W3JA 1VR6A 3TN3A 1KM1A 1H7PA 1TA3B 2IQDA 3PTDA 4LH8A 3W1AA 2IPWA 2Z6IA 2EPKX 1QNQA 4MJMA 1QNSA 3F5LA 4FOJA 1O6IA 2XWEA 2H8XA 3R5EA 3VDHA 4V27A 3W7JA 4ORMA 3VKBA 2FIQA 4IJCA 3QLLA 2FZNA 3I6TA 2YCLA 4GABA 4LVDA 3JZUA 1WX0A 4N4QA 1XYZA 4ZXLA 3F7JA 2YB4A 4PUDA 1HTIA 2RAGA 3F4NA 1LUCB 4JFVA 2ZA1A 1BVWA 3R4IA 3S1VA 4R88A 3KLKA 1TV5A 3MUY1 2GH5A 1KXQA 3EWCA 5IXEA 5EFFA 3IRDA 4DBDA 3ZJ6A 3EOUA 8TIMA 3RCYA 2C19A 3WX7A 3D6NA 2E7FA 1JD7A 1OGGA 1JPKA 1MRQA 1S2UA 2C15A 2QUMA 3UXDA 5JCKA 5C9XA 5FJRA 4J28A 5AHIA 4V28A 1AK5A 4GMEA 2XZ9A 5J5DA 2OX1A 2G5WA 3HQOA 4GKLA 1R5YA 2WMJA 2WKLA 4Q4MA 3VOHA 1JCJA 3JS3A 5CC6A 3OZOA 1T40A 4XWUA 5FKYA 2ZCGA 4H7ZA 1JZ5A 3LGEA 1GYMA 3NQEA 1TV8A 1OC6A 3GU2A 3QSTA 3SGUA 3URHA 2E1WA 3B0XA 2JGYA 3TYDA 5AHEA 4K7ZA 3LZ5A 4GO8A 4WLCA 2NUYA 4Q8QA 4QRNA 1YE6A 2QCDA 3PZMA 2H90A 2AQVA 3F2CA 2VGBA 3R89A 1Q66A 1SU5A 3DK8A 2BCPA 4LNCA 3OP2A 4A3HA 1FFUC 4EM4A 2JBMA 3AFBA 2XDFA 4GK8A 3WBEA 1WYIA 1A3WA 1L6YA 2ZZ0A 5HULA 4UTWA 2J9ZA 3MV11 3CWOX 1LL6A 4KEVA 1OX5A 2WC3A 3N19B 4HPNA 3W7DA 1VBJA 3KWXA 3GNOA 1XIIA 2PTWA 3CAWA 4KGLA 5HAOA 4GZEA 3WKZA 1U1HA 1I6NA 1XSKA 4HNOA 3GDRA 3K30A 2PWEA 1W1ZA 1Q6OA 2V38A 5BCAA 2O0TA 3DXIA 5BMWA 3DECA 4H41A 2B4GA 2ZZ5A 4CNOA 3C3NA 3ITTA 2FVMA 1Q6LA 3PZNA 1U2YA 3O1NA 4KPLA 3E3HA 5D8WA 4TVDA 3LB0A 1FY6A 3G1FA 4Z42C 3HZ3A 1FH8A 3L5OA 4JCMA 3FA3A 2CLOA 3H7VA 5JMUA 2E40A 1B5TA 1E72M 4R9OA 3BICA 4HA1A 1KBKA 2QJIA 4IQJA 1GW1A 1LWHA 1CPUA 4CD4A 1J5TA 4JTTA 4FI4A 4RR4A 2OQYA 1E4NA 5FD0A 3TN6A 2BOEX 2OG9A 4FNUA 4EANA 5LSMA 1W54A 1XLGA 3TV8A 2D0GA 3FVMA 4O8RA 1L8NA 1M7JA 4JOMA 2WPEA 1RBLA 3S6TA 1J0HA 3VIMA 1V02E 4MAVA 5A6MA 5A1AA 2QCDB 3W74A 1VHCA 3MBDA 1W1A1 2GDUA 3TFCA 2QJHA 3QV8A 3HGOA 4O12A 1G7UA 3H2CA 1GQJA 4UQDA 1GQNA 5M03A 1DWFM 2VZSA 1PSCA 2GK1B 3KHJA 3R2GA 2YCIX 2EHHA 4IP5A 1CXIA 4B5UA 2QPSA 2R24A 1J96A 3QC3A 3N6JA 3B4YA 1TWIA 4XZ9A 1AQ0A 3NQBA 2NQJA 1VFLA 2DW7A 4MNKA 1V6TA 4CQBA 5A8GA 4L4OA 2J13A 4C60A 2ADAA 3P74A 2X8CA 1I9CB 2F5ZA 1AW2A 3P80A 1O7AA 3I68A 4IFKA 3H26A 3TX9A 5D2VA 3VX1A 4KEUA 4RW3A 2P3ZA 2DT3A 5A69A 2VGGA 2BGNE 2BXZA 4O54A 4TIMA 4NSBA 2IPJA 3W2JA 1KW1A 4XO6A 3RPMA 4DNHA 5D2WA 1P7TA 5MF5A 3PBVA 3RDKA 4CN6A 5L6UA 3XISA 5E0CA 3TQ0A 5DBTA 2XFFA 1A80A 5HDRA 1H7OA 2OT0A 1X2GA 1PX4A 3QV6A 1W31A 4O13A 2DU2A 2Y70A 3EEGA 3P14A 3WH8A 1UP0A 3SGZA 2AAQA 4JQ4A 1W17A 4F0RA 4KETA 1FCUA 4XVEA 1QWGA 3KVJA 3QW4B 4QJ1A 4HSHA 3KS5A 4WKHA 4MWAD 4J56A 2FZMA 2J8FA 3A12A 4RKAA 2PWVA 3TCSA 4PE8A 4A2RA 3R11A 4U2ZA 4IQEA 3UWVA 1ZY8A 2GR0A 3AMGA 4S3DA 1UR2A 4MOZA 3T09A 3TJLA 3EKGA 1VLIA 3A24A 2ZUWA 2J74A 1P1XA 1UWRA 4HZ7A 3VZXA 4D1IA 3BPWA 1S39A 5EU9A 2B7PA 1DWGM 2QUTA 3W3OA 2EEXA 3L8KA 2X09A 1NHQA 4W88A 3NGFA 2XH4A 1VEPA 1N63C 1FP9A 1V77A 2XFYA 4C6IA 1UQZA 1ZALA 1W9VA 1O4UA 1EJUC 4GJ1A 4PODA 3ARRA 3R7MA 5CCZA 3NM3A 2F6XA 1LOSA 4JGDA 3PR2A 3S5SA 3GTHA 1JF5A 4GY0A 3R13A 1W1YA 1SUXA 3OU8A 3ID7A 5JCLA 1J9YA 2HZGA 4IQLA 2FGBA 3NL5A 4IFKB 1CENA 5JQ9A 3IIZA 3GXMA 1DJGA 1U30A 3C86A 3WLQA 1R6WA 4OU1A 3MUXA 3O8AA 1XD1A 4R33A 3MTWA 1Z41A 4GI8A 3MYPA 1P7TB 1OZQA 1OIFA 1W9BM 3GHSA 1DJHA 1ICPA 4J3WA 1B3XA 1G0CA 3O3RA 2F6UA 5FIPA 2IXVA 5D03A 3AJXA 1MXGA 4AEFA 1TPC1 3LI1A 4H9XA 2DSVA 2V5LA 4TX8A 3CGEA 1KTCA 1KLYA 2GDVA 1VPXA 4H9UA 4ACZB 3GX9A 4RE0A 4PSRA 5BRQA 1Q1WA 2YR1A 1FWWA 1WUFA 3UU0A 4Q8VA 2DZVA 1GPFA 1XLDA 2EO7A 3CH0A 1S2CA 1GYNA 1BG4A 3SURA 2WPCA 3GC5A 3BAYA 1PIGA 1NDZA 5DMMA 3ZVHA 2VTFA 3PTMA 1HKIA 4UIOA 2FVLA 2I17A 3BLEA 4JTCA 3TTEA 1ZL1A 2CCRA 3RX3A 1V7AA 2MNRA 1F6KA 1EO7A 4IIBA 2YL5A 1W1VA 3WD4A 4LRSA 1NWRA 2RUSA 3UZZA 5JBEA 1M01A 1TPUA 4YTQA 2VDIA 1E4IA 3A64A 5D33A 4NZ1A 3LA4A 4MDOA 1UC4A 3O0KA 5BOOA 3E74A 2YDAA 3ZSTA 5LXXA 1GRGA 3QV7A 2BHYA 4UZUA 1XLBA 4YIWA 2A3EA 3G3DA 3T0BA 2GUYA 5AYYA 2YDQA 4GBUA 1XC4A 1UC5A 4IICA 1H0GA 1PTDA 4XTDA 4H4YA 3IVTA 3MVTA 3ARXA 1VAHA 2CZVA 3OLEA 1WYGA 1H63A 1E9YB 5A94A 2J7FA 3A5VA 3UXLA 2CPUA 2CLMA 2I5QA 5A6JA 1FWAC 2JFEX 5A2BA 1IEXA 4H8HA 2WVVA 1BQCA 3MMUA 2E8ZA 4L9YA 1HJWA 1E6XM 3HMCA 1ZBWA 3KBJA 1N61C 4L4MA 4JEQA 5DF0A 3AQUA 4GPNA 3L4XA 3W2UA 3QOMA 2BS9A 3RUBL 2A6NA 1DYSA 1P0DA 2ALRA 3OG2A 2QVHA 1IHIA 4NZFA 4PR4A 4TTUA 2D0HA 3C56A 2X1UA 3ORWA 3CMFA 4H4VA 5HANA 3II1A 1LYXA 4QSHA 1VLWA 1G4EA 1GKRA 3TXZA 2RDXA 1UBSA 4QG8A 4L1XA 3B8IA 3GG8A 1EBGA 2Y88A 3BAJA 5AOUA 3HG3A 3ANYA 2CBUA 3B9DA 1KR1A 1VB9A 4C1NA 4HU8A 1STZA 2RFGA 1T7LA 3T6CA 1K9TA 1TTPA 3E0VA 4UQ9A 2FH6A 3FAXA 1S46A 1PB0A 2VQUA 5D4YA 3E2VA 2NSXA 1B90A 3DESA 6XIMA 2JKEA 1IT0A 1V5XA 1AL8A 3AHVA 2PZNA 3WDHA 3CIWA 4BCEA 1W1TA 1G4TA 3NUKA 4JIRA 2Y63A 4KKXA 4TX9A 1QHOA 2JE8A 3N4AA 1Q2RA 1TVLA 1CIUA 2PGFA 5CLTA 2V82A 4PTDA 3K1GA 4K39A 5GQBA 4WSKA 4A3RA 4Q3MA 3NIYA 2WP6A 3RCNA 1FWDC 1W56A 4FR6A 3MDUA 3CASA 1XRVA 2GQ3A 3TJIA 4MF4A 3OLGA 4ORIA 1PE1A 2V8ZA 1F8MA 4M6PA 4H6RA 1RPXA 2O4MA 4WSHA 2ZZ6A 3WMBA 2PODA 4L61A 5A6KA 3W7OA 4ICNA 3CS2A 3M0VA 1SZFA 4AZHA 3LV5A 4TTGA 2WVVB 3N4EA 3BMXA 3U2EA 2Q6ZA 1JPDX 1IT7A 2PDLA 1L6WA 3KWSA 4NAEA 3WBYA 4WSJA 3FFSA 3G1HA 1NEYA 5U1OA 1J4EA 2WANA 1VCGA 1LG1A 1RZMA 3O6YX 1TUFA 3GQYA 2C7FA 4C6EA 3S1XA 1NFBA 3ITYA 4IMFA 4ZTXA 2Y89A 2W4XA 4NKCA 2ZVIA 1ZAJA 4YCOA 4E0CA 1JCXA 2BP1A 4NU7A 3UZ5A 3DFSA 4LT9A 3EWDA 1DWAM 2E67A 2JALA 3TQKA 1UBPC 3EMCA 1UR8A 2L5HA 4GZ7A 4ZTYA 5BU9A 3W23A 3SBFA 2V5DA 4RNIA 3K4DA 2CKRA 3GDMA 4WVXA 3OGRA 2VHLA 3GFYA 1AOGA 3O6CA 2IPGA 1XDMA 3WQOA 4C1NB 4ZO9A 5DX7A 4S2CA 3SCVA 3Q58A 1YNYA 4JTGA 1S5VA 1TPEA 4F0HA 3CUHA 3S2JA 2P3EA 1LL7A 1A4MA 2FZBA 1VJZA 4GQGA 1V3LA 4KFOA 2HVOA 3WELA 4PTXA 2GRTA 1BTCA 1Z32X 2CWNA 4U5IA 1PS9A 1F4AA 2CW6A 2OR2A 4KERA 2HCVA 3S4TA 3THQA 4KEZA 2PEVA 3P0XA 1TTQA 4IUGA 3VOCA 1GOQA 3ALGA 4HSOA 2ZOXA 5CPOA 4O10A 1ZQ5A 3KBNA 2ZYFA 2VCCA 4B4HA 4W8AA 5LIWX 1O68A 2RJHA 4CVUA 4FNQA 2YBUA 1FDJA 4XBJA 3WNKA 4KWOA 2ZXDA 4C65A 3N6QA 3AOFA 3A47A 4DO7A 3O16A 4XZBA 3INPA 2VRKA 5FEPA 4PMJA 4BURA 2VC6A 1TV2A 2HJPA 4PTNA 2F9RA 3QEZA 4MFEA 3P8IA 4NAEB 1ENUA 2XIJA 1ME7A 2HVNA 4JDRA 5XIAA 1XCWA 1RP9A 8XIMA 1HT6A 4D6CA 4BWLA 1OSEA 5LKYA 4W89A 2ZRYA 3EDEA 1CLXA 1UWSA 3SN4A 4POCA 3V18A 1OHLA 6ENLA 1XLEA 1IEWA 4JIIX 3B06A 1K4GA 5JU6A 1AVAA 1R8LA 2PCQA 1N8IA 3NCOA 1BWLA 1JVNA 4U4MA 1DQXA 4TMBA 1ZB5A 3MW7A 5IDZA 3FNDA 2BB0A 2OYMA 1D7YA 2GVJA 3MJYA 3T81A 4B5SA 3MMWA 5G2HA 5LIUX 3BQ6A 3A9BA 2SFPA 3VPLA 4NYYA 1TTJA 1KFLA 4GYJA 2ZUTA 1FTXA 5I02A 4IP7A 1UUOA 5BZAA 1FHUA 5D9MA 5FF2A 3ZFHA 3MP4A 3AMCA 1V0KA 3C0LA 3L4VA 2XZ7A 1YNQA 4MKNA 1UPMB 2YCEA 6PTDA 2HBVA 4LVGA 1G94A 1VDVA 4CU7A 1OEPA 4I90A 2C6QA 5T9CE 5LGXA 4PTMA 5KZDA 2E9LA 1LL4A 1N7KA 4UOZA 1V8EA 4EPBC 4PMDA 3HPSA 3GE7A 4UTLA 2ACSA 2JQXA 4S38A 1WXJA 2CETA 1V08A 4H9TA 5E9AA 1C92A 2WMGA 1K3UA 1PDZA 4Q33A 3FVDA 4RW5A 1UHVA 1A0CA 4KWVA 2EQ7A 3S5NA 4AIUA 4Y9PA 3C8FA 2BODX 3AIBA 1PVNA 4OKDA 3VIPA 4GE8A 1GK8A 4U5KA 4V15A 4UTKA 1H49A 1ZJIA 5HA7A 3VNZA 4ZQRA 1GTHA 1HKKA 1BTMA 4XISA 4GQQA 5FOOA 4ZO8A 3CUXA 2WKGA 3C0SA 5AC5A 1DKWA 2J66A 4FB7A 3W6LA 1N60C 3IK4A 2VKZG 3V4BA 4JICA 2YXXA 1JR1A 3LBOA 4JX5A 4HMNA 2TMDA 3UYCA 1RLDA 1MRAA 1LDCA 3LTSA 1V03A 1XLCA 3RIKA 3A7RA 3W70A 4AHOA 2EG7A 2JF7A 2FTPA 3IWPA 2QLYA 2E6AA 4DF2A 2QUVA 4H2CA 2DJLA 4EWJA 3AM9A 2HVMA 4AHPA 1ME8A 2VJXA 4CNTA 4J3SA 2J47A 2J7HA 2QMJA 3CUFA 4XUGA 3OEXA 5DELA 3PWIA 3S3GA 3ZJ7A 3SGGA 1PO9A 1R3YA 2OODA 1OCNA 1VFMA 3BW4A 1YBQA 3CJPA 3VGEA 1UR3M 3ITXA 4M0XA 9XIMA 1NSJA 1F5ZA 1EFZA 3ISIX 3LMYA 2CLIA 5TQLA 2A5HA 4JAWA 1GHSA 3UXAA 1G1YA 3WBAA 1SO3A 3UT0A 1JZ8A 3QPYA 1YDNA 4QGCA 4QJ4B 3V16A 1S7MA 1XIBA 4C5ZA 4HJWA 4ZB0A 3F1QA 1IV8A 4Z2HA 3H7UA 4QEEA 3U5UA 1Z3NA 3PWAA 2OYKA 2P76A 5DT7A 5AC4A 4LY4A 2NSOA 5FJUA 4XSMA 1WDDA 3QZEA 4IL2A 3UR5A 1U5VA 1JYXA 1KTNA 1PKYA 4XZIA 5KVHA 3DI0A 1UROA 1LCOA 2Y5EA 4N0RA 3UG3A 4ES4A 1WQ5A 4NRRA 1EBHA 1ODZA 4O18A 1V79A 4LUIA 3NAVA 3NL3A 1BXNA 5CZ0A 3P82A 1GJPA 2ZRZA 2WP5A 2OZ3A 3GG7A 1RALA 1JQVA 2Z2AA 3BQ5A 4HQVA 2VYOA 2WKJA 3Q94A 1YPFA 4UTFA 4AX6A 1X1ZA 3IC9A 1EBDA 3G22A 1XV8A 3U4AA 3MCMA 3N2TA 1QNPA 4HYWA 1O1HA 3WNOA 3WQ4A 4DWSA 4NAFA 4PMRA 4A3QA 2X05A 2PTDA 4HBKA 1DJQA 4RDZA 3V35A 2OXNA 4QHRA 4TV6A 3R8GA 3EX4A 3BZGA 3TE9A 4UTJA 1FBAA 1YBQB 9XIAA 3ANVA 5I7GA 1K7EA 4CN4A 4UBPC 4YWSA 4HB7A 1MQRA 1FA2A 2JIWA 3SY8A 3B0UX 1PUDA 4KWWA 3WF2A 3WN6A 3BAKA 4NUWA 4ZA0A 4F0LA 4Q22A 1SSGA 4AZ7A 4XB3A 1JFXA 2FKPA 1G69A 1CYGA 2P0IA 1GT8A 1E6ZA 5EMUA 2W62A 3RLVA 5F2LA 4L80A 5FSEC 1U1JA 3R07C 4S3GA 1BQGA 1JCTA 4YU1A 1LT8A 3THAA 2OGYA 2V3EA 1W32A 5E93A 3VKAA 1MXDA 5I03A 4M24A 2HNHA 3BSMA 3S2NA 4U2YA 2W27A 4FXRA 3P5YA 3CB3A 2F8QA 1XSJA 1O94A 4EQWA 2D2HA 2BHUA 5F4WA 1QI0A 1MW3A 1GRAA 2WVUA 1FWTA 4YVXA 4ZVJA 3VMNA 4D1JA 1XUZA 4BF7A 1XICA 1KM2A 4ZEPA 4N7QA 3THDA 2FFIA 3I6RA 3AICA 1R3TA 4JQ9A 5CPLA 5BWFA 1QT1A 1UR9A 3SI9A 3H70A 1T8QA 1JDAA 3K8KA 3OYZA 4NZ5A 3ALFA 4PUEA 4HZ6A 1EDQA 1MO0A 2WQPA 4DHGA 1XYAA 4B9ZA 2ESCA 4DWSB 4NAFB 2BGQA 2EJAA 4ZE4A 2XSAA 2Y7GA 1EA0A 4CEUC 3PB0A 4E38A 3BWWA 4E8CA 2Z00A 1KBLA 4YCPA 4LV4A 3T78A 4DXKA 1X6LA 4PMXA 4MYXA 4CN1A 3BDKA 3USZA 1EJTC 1Y5XA 3MBFA 1ICSA 2HISA 3ZR5A 3ZMRA 3GTFA 4ZB5A 4XBKA 5A8MA 3H12A 4GOAA 4OUEA 3CNYA 1AZ2A 2QJJA 5A8QA 2E25A 3CL7A 4O1AA 5EY5A 3EZ4A 3R0UA 1J5SA 4QAWA 2CBVA 1TJ2A 2HE8A 2PWUA 2DJXA 4DY1A 3EDDA 1EYWA 1E56A 1HZYA 2QYGA 4EKJA 2VXNA 3C4UA 4IMDA 1VFFA 3NRZB 2AAMA 3ABRA 3OBAA 1KM3A 3FCPA 2EPNA 1N5XA 4GIAA 2V5BA 2OVLA 3MP3A 1M7OA 2AQOA 3ZLHA 4D6FA 1XDIA 3WD1A 1GZJA 3T8LA 3ME3A 2Z0IA 4BFAA 4LUYA 1DEDA 4J2MA 1NDVA 3VGBA 4XAFA 4RDWA 2FB2A 2PGRA 1YLVA 1DE6A 1S2WA 1A5KC 2DIEA 4YHEA 5AYZA 3V3WA 3RLGA 1ITCA 2ZUMA 4A05A 1B3WA 1T5AA 1X6UA 1QPRA 1P0NA 1E0TA 3CLWA 4GRSA 1WDSA 5IBXA 3WQ8A 4MJZA 2OQHA 5G1TA 3CYVA 3L2MA 5BXPA 4GYPC 3NVTA 5SWUA 4W93A 5EBAA 2GSHA 3O0FA 4AWTA 1F05A 4JTAA 4P7LA 4MY9A 1GHRA 1DOSA 3S42A 1SB3B 3R10A 2IKJA 1GEHA 1F73A 3VUSA 3PM6A 5B7ZA 5K3VA 1ESWA 4LBSA 3WQVA 2UY4A 3T42A 5EKYA 1I0BA 1WKDA 4IWWA 3AUOA 2FZ9A 2OT1A 4HGXA 3RO6A 4GY1A 1GUVA 4C6LA 3QPZA 3BG3A 5EMJA 1YADA 5I6SA 5KMYA 2WWDA 3GKAA 2Z4GA 4JZ5A 3LENA 1W9PA 1GVRA 2PD5A 3TYAA 5A6SA 1VF8A 5H6HA 2E6YA 1EXPA 1CEOA 2ZX9A 2OPJA 3DI1A 4M29A 3GYEA 1JRBA 3FW6A 3W1LA 4MZYA 4W86A 1YDYA 5I78A 5HUOA 2EPOA 2CLHA 3QFAA 1AJZA 1YEYA 2QDHA 5XINA 1A5CA 1L2QA 2EJ1A 4X22A 3UYIA 1V4YA 3KVKA 4H3DA 2PDQA 2YA0A 3N12A 1QO2A 5IHRA 3W4RA 3N34A 2XGIA 3R0DA 3C5QA 2WNNA 1ZTVA 1GCYA 3RNMA 4X9YA 1RJQA 4NT0A 1MXSA 1WKFA 4IIEA 3EKZA 1TPVA 3R6IA 3DFNA 1X1OA 3V1PA 5I0DA 4LGXA 2QPUA 3G3MA 2QF7A 4QIUA 1U1UA 1AQFA 4PA8A 1I60A 3LSBA 4W8LA 2H8ZA 4YLWA 5H91A 3BC9A 3BURA 5A8PA 4MWAE 4HNNA 3B0PA 2OYLA 5CG0A 1WBHA 1FWCC 3KRZA 4JFWA 1UZDA 2X42A 4EX4A 3TWAA 3EWWA 2BTMA 4U31A 3W1TA 2RDUA 1J18A 3EXTA 3QR0A 3TWBA 6XIAA 3MQTA 1NDYA 4PFHA 2PWHA 1XFCA 1V51A 1MOKA 2YOCA 1BXBA 3ABOA 3LMZA 1UUMA 1AD1A 3BMWA 1P48A 3KOFA 3PULA 3ERPA 2VI0A 4N6EA 3KLJA 1KNWA 1RAKA 2W3SA 2J3NA 3GU1A 1QOPA 4OWGA 1XF0A 4XX6A 3WQPA 1Z44A 5E9XA 4AYSA 3FOKA 4PRTA 3GBDA 3EOSA 3NPVA 3CYJA 5JBDA 1ZRQA 1S2AA 4U3CA 3KXQA 5G4EA 3FXGA 3OA5A 4KFNA 2VR2A 1UUQA 1WZLA 3GDTA 2OQLA 2F84A 2X8GA 1RSCA 2DY3A 4FLOA 3BANA 3G1AA 3E5BA 1EB3A 3WQWA 2BX7A 1FHDA 4WKFA 5LHFA 2OGJA 4UFLA 1DIDA 1NVMA 1RBAA 1YRRA 4E3VA 4EXBA 1XLLA 4ZQNA 3WMCA 4IPJA 4AZBA 1P6BA 5IRPA 3WK2A 1HFBA 3LLXA 3QQ0A 3QV9A 3AS2A 3EWYA 2VC5A 1T41A 3RG6A 2ZXBA 1QNRA 1DIKA 3ZSSA 2HXTA 3VDAA 3L9CA 1GOMA 4G1NA 4KIRA 4KEMA 2QJGA 5DRIA 4O16A 4CD8A 5U25A 4IUOA 2AGTA 3AMZA 1WKYA 5I24A 3AROA 5BROA 3U2ZA 3S6OA 4RZBA 2VMFA 5FF0A 5HMEA 3DCPA 3VTRA 3Q67A 2INEA 4QDMA 4GNJA 1WE5A 3KRSA 4JTUA 3TYUA 2QXWA 3NL2A 1ADOA 3R12A 3DFTA 2Z2BA 1ADDA 2IQ0A 3IJLA 2W0UA 4EQRA 2R94A 3T08A 4XZHA 1NJJA 1H1ZA 1YPIA 5JXQA 4LCSA 4GKTA 3H22A 2P0OA 3NFUA 3VNJA 4JTEA 3B8DA 4EP8C 2QR6A 3W7LA 2DZUA 3EB2A 2WCSA 4DWSD 1XGEA 4Z17A 5FAGA 2Q8ZA 4CLMA 4YYFA 1XDLA 4Y2WA 1XXXA 5F1UA 3T55A 5J5RA 2X1SA 3ATYA 2VEKA 3WDRA 1MVYA 3RMJA 3C2VA 1RHCA 2DZBA 1LPFA 1TV4A 3QY7A 4KRTA 5DEZA 5JUVA 1A5AA 3M5VA 1T99A 3PWGA 3B9OA 3QMRA 4BA0A 4IP4A 4US6A 3QY6A 2ZA3A 4KCUA 2X1IA 4GX9A 3WH7A 2QAFA 4J5NA 1RY8A 1IR2A 3B8WA 2VEGA 1IGSA 2DPEA 4AD4A 4NNCA 2D69A 5B7YA 1V0MA 4UFJA 3HIJA 3H2NA 4TMCA 5H8UA 3N3TA 2OEKA 3KFTA 1LLWA 6ALDA 2V3GA 2I56A 5AZ0A 2XSXA 3CK5A 3WDPP 1VFTA 2PD9A 3TAOA 1QOXA 1D2KA 1GJUA 2C3ZA 2GZXA 4DX3A 1DJYA 3T0DA 1LJYA 2YJQA 1PIIA 4UTIA 5LNUA 2FH8A 4B5WA 3VZZA 3HFTA 3RJXA 1S5MA 4B16A 2BY2A 2NW0A 3SDOA 3VDBA 1QK2A 1UWIA 2X50A 3ES8A 3KVLA 2VEIA 2PU0A 3OVGA 4DF1A 1E40A 4IISA 4QG6A 3STGA 3E0IA 4C6FA 4JYDA 4DJEC 3CV7A 1UP2A 4X3ZA 2YYUA 4E8GA 4UNLA 3G77A 3ITOA 3L68A 3DJJA 3HMJG 3TA6A 2DEPA 3SCUA 4DUWA 3KEHA 1H1YA 3DK9A 4KGJA 1ZY9A 3ARYA 3W01A 1K6WA 1X7IA 1OG0A 4HNCA 1KRMA 3E02A 3V75A 3GVWA 2BG5A 4J27A 3R94A 3CV6A 1HUVA 3VIIA 1ISXA 5BU6A 4MWAC 4AC1X 3VNLA 4L65A 4U3AA 4UTHA 1CZ1A 4Y7EA 1VS1A 3STCA 5AFDA 3BXWA 2WLYA 4WDTA 3U3HA 7A3HA 2E4TA 2E5CA 1PZ0A 1FEBA 4G7EA 3SADA 2OU4A 4DBUA 4GBDA 2ZZ7A 3FDKA 2V0TA 4S3EA 2YZ5A 4A4AA 1V3MA 2Z2UA 1Z89A 3AS1A 2OCZA 1JOAA 3GNDA 1HJQA 1HW6A 1RVGA 1FWFC 3GW0A 2V69A 4L4LA 3BOFA 1JCYA 3KBWA 3HRDC 3H4KA 1SO4A 2YLLA 4IG2A 4QEHA 4DM2A 3OW1A 3GFZA 1FWSA 4ICMA 3QHOA 3MYOA 4O0ZA 3A4JA 4UQEA 2ACUA 3GH5A 3VK5A 3EGJA 3FN9A 2GWGA 1X2HA 1QNOA 3K4WA 4R53A 4X61A 2FLIA 2PPGA 4PZVA 1M9HA 4LVFA 2TSYA 4P8VA 4IMCA 3FJNA 2YW3A 1IXPA 2NV2A 4Z2IA 3S1WA 3AXHA 5FEZA 3AIUA 4Y90A 1ZAHA 2OTDA 4Q32A 5A6AA 2PLMA 1GVEA 5A6LA 4F79A 4I7UA 1ZENA 1FQ0A 1DTUA 3WJZA 1WUEA 2PDGA 3G24A 1P4CA 3IUDA 3DYOA 3RITA 1J0ZA 3IJDA 5D02A 2XFRA 4E2BA 3M0XA 3EMZA 5AYIA 1EEXA 3GD6A 5G2WA 1FWGC 2NQ9A 4ZSUA 3DKJA 4E2DA 4FF7A 1GVIA 4WJEA 3A3WA 4O57A 1ICQA 1J10A 1RLCL 1TCDA 2R9RA 1IZCA 3VA8A 3CGCA 5M2FX 3CZ8A 4G7EB 2W9MA 2WB5A 3N13A 4F8XA 5BRPA 2B7NA 4K37A 1LROA 4HU0A 4ZFMA 2E77A 4AY7A 1SFSA 2I5IA 2VELA 4JTJA 4Y96A 4F4RA 4Q8WA 1US2A 4ZQMA 2A8XA 2NWRA 4R34A 4H4PA 5CJNA 3H6OA 4H9YA 1UD4A 3NM1A 4HPJA 2J9YA 3B4UA 4YHGA 1A5MC 1V93A 3GRSA 4GH3A 4LF1A 2TODA 3BJTA 9RUBA 3W7CA 3HQNA 2HROA 3V5CA 1WBJA 3MSRA 3UR7A 1JFHA 1CXFA 5EBUA 3EEZA 3I3BA 5C54A 1CXKA 1Q85A 4P7QA 2QW5A 1YX1A 1XC6A 1XSIA 1KFKA 4C6DA 4G8TA 3WFLA 1EA9C 3AIRA 3DFPA 1V97A 4L6DA 1MFVA 3LCWA 1X97A 5GVJA 4TV5A 3W2NA 3RM8A 3N17A 1SO6A 1W2PA 1K8CA 3VCNA 3QFWA 4MVAA 7ENLA 3FYYA 1DTNA 1MUWA 2YPIA 1E1EA 3KOXA 5EFDA 5HPCA 3WIJA 1K7FA 2DVTA 1VENA 1XIDA 1FOBA 3MKVA 1XBYA 4F0KA 3AS0A 3TR2A 2PDKA 1UKQA 3NSMA 4LS1A 5C71A 5FA5A 3WNNA 1XLMA 2W3RA 2O55A 1UB3A 2TRSA 3UVAA 3WMLA 4R9XA 4WRHA 1GVQA 2OZ0A 5BRBA 1FH7A 4QS6A 1JZ3A 1Y7VA 4GQ0A 5FAJA 4HK6A 4J2PA 3G1VA 3M07A 1D8WA 3ZWSA 2QGYA 5FL1A 3Q65A 2JIEA 2I9EA 1YTKA 4L9ZA 1B1YA 1RH9A 4OV9A 3V0UA 4JYEA 3K13A 3HV8A 4C6JA 4APNA 4ZL1A 3C8NA 3WF1A 4ZR8A 5ABHA 4HPHA 3VNIA 2CIPA 5GRTA 2JK6A 1KQYA 3KAOA 4DZHA 1GESA 1X39A 3J7HA 2F6KA 3NPWA 4QFUA 3PN8A 3ELFA 3MI2A 1MQPA 1TX0A 3S2MA 3W7PA 4FHAA 1E51A 4JIQA 2G0WA 5AYBA 3QZ6A 4BQ5A 2H3DA 4DJFC 3TFXA 1XIMA 1WZMA 3G8EA 2J77A 3OVRA 1RV8A 2VRQA 2PRHA 4O19A 1M7XA 2Y4SA 5K4XA 5FEXA 1B9BA 1SJDA 4M6QA 1W3TA 3UWZA 1ZS2A 4LUTB 5CPMA 2ONEA 1TIMA 4KRUA 3EWBX 5G4HC 4TO8A 1O5RA 2WZHA 3VNYA 1K70A 4CEXC 1ITXA 3PZUA 1KWKA 3WLLA 1XRTA 2Q3RA 4MAZA 1Q13A 4EAMA 1JDFA 3W38A 1XIFA 1KM5A 3PTKA 5D09A 2FHBA 1I1XA 2XVNA 1CXEA 3W7QA 3WLOA 3SUSA 2FPYA 2Q02A 4M7TA 1WAUA 4GQBA 4UMAA 3TLLA 1NOWA 1QVBA 1BYAA 2GWNA 1OY0A 3JW7A 3K4AA 4G7FA 3NXFA 3SRDA 5A8OA 1SW0A 1XCFA 2YXGA 1GREA 1PYMA 1V6XA 4QJ5B 2CWXA 4H01A 2OLSA 1Z42A 4PUJA 2O7SA 2ZADA 4MGGA 3L5LA 3DG7A 5BNKA 2QDDA 1CXLA 4BF9A 3QGAC 2WC7A 1GG0A 3PBGA 5HJYA 1YTEA 5M5DA 3LADA 1HL8A 5C70A 1I8JA 4H83A 3RX2A 3T05A 3GTIA 5G1YA 3R79A 1U5JA 5JRBA 3TZNA 3GO2A 4I5XA 4LAZA 4KCTA 2YW4A 4N6FA 2VURA 3VM5A 1RCOB 3W37A 1E3XA 4G9PA 2PP0A 7CGTA 4ADUA 2PRLA 3NYZA 1OFQA 4JXCA 2X2GA 5KITA 5CZTA 2E3ZA 2YA1A 1GGOA 3UR8A 1XLAA 3B8TA 1FFVC 4DPQA 3DZ1A 3TYEA 2Z1SA 3AALA 3HG5A 3QHNA 2NLIA 3M7WA 2J62A 4FALA 4UMCA 1TYPA 4RLIA 4P7RA 5A3HA 2E1DA 3MVIA 3IJ6A 2WSPA 4NNBA 4NJIA 3QKEA 1SJAA 2CEQA 4F2UA 3VI2A 4GA8A 3FEMA 3QF0A 1CT5A 1JUEA 1UZ4A 5FESA 2X1TA 3MI6A 4G56A 8XIAA 4W4QA 3BOXA 5K9CA 4NJKA 5LNRA 2VEFA 3TZFA 5DY3A 3VKKA 1OB0A 1LP6A 4DZ5A 2DUZA 4IIHA 1QW7A 4WY0B 3THUA 2GYIA 3LPPA 5LYRA 3NA8A 4UQBA 1AG1O 2WZTA 3GHRA 4M5PA 2WMFA 3MSGA 4BI7A 1XBZA 2WZEA 2VVNA 2V81A 1AL7A 1FFQA 3QPEA 4JFSA 4AF0A 3S9IA 5JCIA 5AHMA 1REQA 5FSDC 3KBVA 4OE7A 1MNSA 5KZMA 3JVAA 2INFA 4IX0A 3QRHA 3WD3A 5C5YA 1GERA 3MPGA 5TF0A 3LHVA 3L5MA 1A50A 4WOZA 6A3HA 4MKSA 4FLRA 1ZZMA 3A3HA 1NU5A 2DSUA 4H9MA 2JEQA 1W1B1 4NL1A 3QY8A 1KCLA 2QUUA 4JBRA 1CBGA 3ZT7A 4QP0A 4ZOHB 3H21A 1EWEA 4K3ZA 5CGTA 4W87A 4N9CA 2QCGA 3N2MA 1WP6A 5F4SA 4DI9A 3CBWA 3UPMA 4JHZA 1LBMA 3WFAA 3WK3A 1ONXA 2G4JA 9CGTA 5FCZA 4WQ6A 2NLYA 4DQWA 3FXYA 1JROA 1SZEA 2ZBTA 1R85A 3NYDA 3SQSA 3WLJA 3NQ7A 3GKFA 1E6NA 4MKVA 3USBA 2ZX5A 3FX4A 1NWUA 5JIWA 2XM2A 1KM4A 3AAMA 4NP7A 2I5GA 2O9OA 1BYDA 3IACA 2V63A 3BOLA 1ONWA 5DCDA 2TAAA 5A5WA 2AL2B 3WK1A 3W76A 1OJXA 4ATDA 3I7QA 4NZJA 1JEZA 2BWGA 2WZMA 4A8RA 4ML9A 3TEVA 4PCSA 2J88A 4MNJA 1KKRA 3JUGA 1V0NA 2R1KA 2XN2A 3ZJKA 4GISA 4GI4A 1Q7MA 2AKMA 2F2KA 4IIGA 3WF3A 4DB7A 1WDQA 2HTMA 4I7WA 3KRUA 4L7ZA 2XTKA 3QFEA 3KHDA 3IAPA 1ZPTA 2J7EA 3OJGA 1LQ0A 4QLJA 2PE4A 2Z24A 1UD5A 2GGEA 1FRBA 1V0LA 3CQIA 2VFHA 4HCLA 4K8EA 1TE6A 3T44A 4HTYA 4REQB 3AC0A 2ISVA 2V30A 3WY1A 3MUAA 1KFJA 1YPXA 3W87A 4ML4A 2ATSA 3II4A 1LWIA 4IFRA 1RQBA 2FZ8A 1R0MA 5HUPA 5DMYA 3OHMB 2WJDA 3LDVA 2BSLA 2VOMA 3N14A 2XJ7A 4ERAA 5BWAA 4AXKA 2BXVA 4FR1A 1EL3A 2D73A 3IV8A 3GS6A 3CGTA 3NQ8A 2QZRA 4AVOA 1OYCA 4ZODA 3V7PA 3N2OA 3GNRA 1A5NC 3N9RA 2OZ8A 5E70A 2JEPA 4H6QA 3VD3A 2Y7EA 4O53A 4G2DA 2VX4A 3MA8A 1OWQA 3S8HA 4MB3A 1QASA 4GNKB 2ZA2A 1CECA 2XSBA 2W91A 4M51A 2HPMA 3OPSA 3WO8A 3D47A 2PB1A 2WJEA 5C6MA 2IQTA 2EG6A 3UZJA 4UQCA 4NHVA 2HWGA 3M47A 3LCXA 5C8BB 4F9JA 2QAPA 4ZO7A 1QMLA 4LB4A 3W29A 3LTPA 2ZICA 3WH9A 4FLSA 1A5BA 4DIAA 2BVWA 5IFPA 1LRTA 1PKLA 2Y24A 3A3XA 3NSXA 2AQWA 1UD6A 1J6PA 4I6KA 1EUAA 3VD5A 3V36A 4ZOBA 3VKDA 4FXSA 3VMPA 2R14A 4YTRA 2B0MA 3G6LA 1A4LA 2D0FA 2HK0A 4PSPA 3CLMA 3LQGA 3OLDA 2QGHA 5DY2A 3HJZA 1SVDA 4RPPA 2HQMA 2GR1A 3IJ9A 6TIMA 1H7NA 3D3FA 3FY1A 1JZ7A 2G3JA 2PWDA 2PBGA 1SYTA 1EEPA 4D2JA 2RDWA 1J79A 1XCXA 3TYCA 1HXJA 4XIAA 1F07A 1HN1A 3BG5A 1TPB1 1CGWA 3EA3A 1UIPA 1EGMA 1OT2A 3UWQA 1KBIA 3HF3A 4QDPA 3STEA 3D9XA 3SZ8A 4I5UA 2XVKA 1JF6A 1ZSXA 2A85A 1FH9A 2FZDA 3N29A 3AXKA 2E8YA 3RM4A 3W85A 4L1GA 5HINA 5E0KA 1PXGA 1W3HA 4GXWA 3FG2P 4X63A 2OMAA 4LPCA 3KM8A 1JAKA 4R5EA 2WJZA 4AD5A 1UD2A 4DNMA 1ZUAX 3CUJA 4IMGA 4MLRA 2WOWA 3EXSA 5A2CA 3W84A 2I57A 4GYKA 4XSLA 4O14A 3TA9A 1U33A 1I2NA 3WEZA 1H5VA 3PF3A 2OOFA 4DJDA 1B4EA 1XH0A 2ZIDA 2FYMA 3EBVA 3SUVA 4AD1A 5XIMA 3G1RA 4QAIA 3OGVA 4O1DA 1JYNA 3H53A 3DIPA 4PEEA 3WQ6A 4PBGA 5GJNA 2R9ZA 1ODUA 5AYXA 3AHTA 2W92A 1WKEA 3W72A 3AMDA 3E9AA 3CV1A 1VKFA 1CLKA 3IGSA 1AD4A 2DUXA 3MUIA 2GR2A 4V1XA 4KF1A 1BVZA 3ZR6A 2DSKA 4PN2A 4RV8A 3F2BA 1HL2A 2NVCA 2BDQA 4PRRA 1W5QA 5MHBA 2KAUC 1IR1A 5LHEA 2GSEA 4MM1A 5ENLA 3GG1A 3GIYA 3AI0A 1CB2A 4HMEA 3N04A 2C1IA 3A4XA 3BV7A 4HCDA 1GW9A 3JRKA 1OF8A 4EPEC 3GDLA 5A8NA 5DANA 1ONEA 4KRZA 1TUXA 3Q4DA 4GC3A 3G0XA 1ITQA 4K8HA 3ARUA 2WOVA 1EQPA 3UGVA 4O52A 1OFAA 4J4KA 2UV8G 1KXTA 4CCZA 2NUWA 5AC6A 1TYTA 2V68A 3MDWA 3BJSA 3KX6A 3P67A 3JR2A 4CGTA 3NL6A 4A35A 1EGZA 1WZKA 4HNLA 1UH4A 5EB8A 2XYLA 3QQWA 4OOUA 1FP8A 3B3DA 1PZ2A 1QRQA 4NEVA 3GDBA 3W1UA 3ABQA 2XH0A 2HSAA 3UWWA 2WNQA 2ZRVA 3PZ9A 4IZGA 1RK6A 4WXZA 4B3KA 3P84A 4LAMA 1JCNA 4GVGA 4XG1A 3TLQA 1HNYA 4BWLC 5D8ZA 3HW2A 2QEZA 4I7VA 3M16A 5CSSA 1KR0A 3O06A 2YCLB 4FXJA 3ARVA 1JPHA 4NF7A 5HWNA 5KTLA 4PCPA 3SUWA 1QHPA 2XIBA 2YFNA 3NQMA 3T4CA 4LALA 1I0DA 5K7JA 2WO5A 3CWNA 3BUVA 4E4FA 1KFCA 2WMIA 2DUAA 2RGMA 4GUHA 3SEPA 3WD0A 4BJHA 1JYVA 3U0HA 1XLFA 1PZ1A 2J7DA 1C91A 3GH7A 3LUTA 2Y7FA 2JF6A 4B91A 2CLKA 3VNDA 2A3BA 1TJ0A 3RF9A 1ZBKA 1CNVA 4G5DA 2VWTA 4F48A 3IIPA 5IHSA 6REQA 1TMQA 1H0IA 4OHQA 2D24A 3K5XA 2Y1HA 3VCRA 3M9YA 3MO7A 5B80A 3SB0A 5PTDA 4TR9A 4X2RA 2BMBA 1NQKA 3GM8A 1H50A 4HT3A 4AY1A 2OELA 3KTXA 3PZTA 4M81A 2DIKA 3VGHA 4H7CA 2P8CA 1GOIA 4Q7IA 1O12A 1ZP3A 1Q6FA 5DMNA 3WMSA 3M5YA 2FGLA 4NX5A 3DG6A 1OX4A 1F2JA 2IPFA 3L4ZA 4OTKA 2W66A 2G96A 4P5UA 4JTSA 1TWZA 3KCJA 4BHYA 2MUCA 1VFUA 3LXAA 4N2YA 3W7KA 2Q71A 3LD5A 4QLKA 2GPTA 1VBUA 3TC7A 4TVUA 1W3KA 1AQMA 4PUWA 4L4PA 1E6RA 3OYXA 3W83A 4BF5A 5FEWA 4DN1A 1WCGA 5CJMA 1E4LA 4HA0A 3AJ7A 1VQZA 3K1DA 1ISWA 1VYSX 3C2RA 1NHPA 1DNCA 4FO4A 3M43A 5FACA 4AWEA 4AWSA 3BCDA 1ZCOA 1FXQA 4Y9AA 4AIBA 3U7BA 1UKSA 3H2OA 1NHRA 2VDGA 3MKKA 5T9BG 3L4WA 1WDWA 2CBJA 4H00A 2G8ZA 4B90A 3LRKA 4X2PA 1TWDA 4DLFA 3ATZA 2WCAA 1EJWC 2Q01A 4URIA 4DBWA 1MFUA 4UR8A 1TO3A 3M0HA 5D37A 2WMIB 3L7RA 1UKTA 4ADTA 1EJ7L 2CFFA 3VOFA 1K4QA 5LNSA 1ECQA 3UCCA 2OKOA 2GGHA 3WQGA 1BD0A 5U7SA 1B31A 1JNEA 6REQB 3MCOA 1FCQA 4MMWA 5M17A 4HPXA 3CQHA 2VGIA 3OBKA 1FHVA 4F0MA 2VL4A 2E9BA 1PWMA 3IS4A 3AU6A 2B81A 4UFHA 3M0ZA 3EB4A 4ASTA 3PS7A 4JNZA 3BV4A 3CUGA 5BOEA 4UCFA 4AZ5A 1TZZA 2O56A 4C7FA 3TSDA 1JL8A 1EH9A 1J0YA 2P10A 3VVGA 1QW8A 2R91A 4AXNA 2O9RA 3W27A 3RR1A 4NG3A 2PMQA 5GJPA 1B9ZA 3HGRA 1XI3A 4LUJA 3H4WA 2Y7DA 3UXKA 1Q6EA 3CPUA 3RLHA 4KCVA 3D5HA 4LV9A 2GJNA 1V6VA 1H3GA 5FS6A 4YVPA 5G1MA 1E0WA 4JY9A 3RJYA 4P61A 3N1AA 1KO0A 1XIGA 1VYPX 4H7VA 2YDSA 2Z25A 2DT1A 2WMHA 5HMSA 1V59A 2QCMA 1EHAA 4H19A 1IQ8A 4IX2A 1IE7C 1UR4A 1F4HA 4PMYA 4N9DA 4JR5A 2EF9A 4IGNA 4J40A 4PUMA 4MB5A 3E49A 4NI8A 1EDGA 3K2GA 1BG9A 3ZS4A 5CSRA 4C6MA 2ASHA 3VABA 3AYVA 4PB5A 3OZPA 5HJXA 2E5DA 3VIHA 4IPNB 2VGFA 2WOQA 4L5ZA 4QROA 3TONA 2QKFA 1H4PA 4DWSC 3GRTA 4NI3A 3HM7A 3YPIA 3V0SA 3BAWA 5CZSA 3GG0A 1E9IA 2FB3A 2J27A 1EIXA 2H3BA 4O11A 2WHLA 4H9VA 4HIBA 4LYKA 1TB3A 4DELA 4TOQA 3WNLA 1FHLA 2YKKA 3D0CA 2ZX6A 2ISFA 3DC8A 3HB9A 3A7UA 3H4XA 1EZWA 2E9MA 3O2LA 2HNEA 3M0MA 3DFHA 3UZYA 3AYSA 4HOZA 1HIZA 4LSBA 2REQA 4PGLA 1PDYA 2V2DA 4YNGA 5KZEA 3I7SA 1GYLA 1N55A 3CQJA 4FLQA 3PAJA 1YKWA 2WV8A 3L66A 2C1HA 4NQ1A 1UH3A 3TSMA 1BWVA 4X0NA 3SSZA 1SFLA 3CTTA 2EGZA 1TE1A 2Y61A 2V2CA 2IS7A 4DJDD 3FSUA 3VGFA 2A3CA 1C8XA 3ZZ1A 4A8NA 4C91A 1R87A 2J75A 4IPIA 4LFYA 5G2IA 4IHCA 3ABSA 3M0YA 4MFDA 3GXNA 3FAWA 5DO8A 3SO7A 3QN3A 2Q8XA 5AKQA 1OT1A 2VX7A 1OGBA 3F4WA 3VNKA 3D46A 4JTFA 4AC7C 3WLTA 5F2GA 1Z6KA 4US5A 2R1PA 3EUB3 1W5PA 1E9LA 1GVFA 3B04A 3SQPA 3RRXA 1LLZA 1C8QA 3BLOA 3JU2A 3APYA 2X0HA 4E3TA 4NZ3A 3M5ZA 4GWEA 1XHGA 3VNMA 1G01A 4PULA 4H04A 1F3TA 5CEWA 4CCCA 3ZJ8A 3GFXA 1SO5A 2VR4A 4O1BA 1OQFA 3RR4A 2POZA 2PDYA 3DHUA 3KTSA 1P0EA 3OG3A 3HFYA 1TQXA 3M46A 4JS3A 2EQDA 4AFYA 3LCHA 1M3UA 3CZLA 4O1CA 2RKXA 3WUGA 5HNUA 1E6PA 1E5NA 2GUBA 4JHMA 3UP8A 4B15A 4CNUA 2CZEA 5HK4A 2CBIA 3ZVHB 1XANA 4PTWA 5BXRA 3CPRA 3C2FA 1YTDA 3W88A 4Q8OA 1ZDLA 1QPKA 1JDEA 1OFOA 5AZ1A 3I3EA 5D38A 3STPA 3WLKX 3NQ6A 4OOZA 2HS6A 2D23A 3FV9A 3NQGA 3TVAA 2VDHA 2ZUSA 3FKKA 4G6CA 4IGHA 3GXFA 3OC4A 1QI2A 4DI8A 4HNUA 5C2CA 2ZVRA 1JDDA 5IFTA 3B03A 2HMCA 3EOEA 3AU2A 4K7VA 2QNEA 5C7VA 1QK0A 1ZLPA 2VFGA 1Z48A 2ZX8A 4L56A 4AEEA 3PUEA 2C14A 1HGYA 3OZYA 4LIIA 3KLLA 4PUNA 3PFMA 5D2YA 4V1YA 3EWZA 3GH4A 3ZWTA 4FNSA 4XAYA 1Q6DA 2NXIA 5D2TA 4F3HA 1DWHM 3W7GA 3VFLA 1OVDA 3CHEA 3M0IA 4E4UA 4ECLA 1F9CA 3PP7A 1JNDA 2NQ5A 4HA3A 3DAQA 3LPOA 3GWQA 1UWAA 2WW5A 4QS5A 2FGZA 3SCTA 1E3ZA 1QWKA 3TUUA 2GJXA 3NOYA 2GSJA 1K8XA 3U4FA 3U8GA 1R9YA 4AB4A 4GCAA 5IBXC 3NVDA 1NWTA 4DUXA 1A0DA 1I1WA 3MZ2A 3UGRA 1C93A 5D04C 3VMOA 4GO9A 2NXHA 2G41A 3EPMA 3NEHA 1KCKA 1A3HA 1EF2A 2C1GA 4WD0A 1R46A 3NDYA 4CNNA 3RILA 3UETA 4ZFCA 3PZIA 4R3UA 2UY2A 4IPLA 4QSFA 2G3FA 4S1FA 2QVNA 1MZRA 4MUZA 2Z1KA 4LVAA 3HGJA 4IOTA 2PF8A 4Y8FA 4UC5A 3WZ0E 3H54A 5CAKA 2X40A 1GONA 1R38A 2BVDA 4JN7A 4FOUA 1YW1A 5CLWA 2A21A 4BR1A 1UYQA 1EF3A 1OINA 3OQEA 1AA1B 5CAHA 4QITA 1HJSA 1POKA 1W5OA 1XYFA 5BXTA 5HOSA 4HOXA 2RHGA 4GHRA 2C8NA 2W6RA 3PB2A 4PMUA 5FMHA 3SIMA 3UPBA 3N18A 4O8AA 3KDNA 5ABFA 2UBPC 3SRFA 3P7YA 2QPXA 2Z28A 1WXYA 3O15A 3F5JA 5CQ1A 3LHZA 3TSBA 1VYRA 1E0VA 4A22A 3LCFA 2EPHA 5C2XA 3IARA 4MY1A 5G4WA 4JIHA 5DLCA 4D6GA 3NQCA 1VBHA 3W0KA 3NVZB 1C8VA 1HJVA 1SMDA 2QQ6A 2Z27A 4PYSA 4HKPA 4IMAA 3M44A 4JTIA 3DFYA 3DH7A 1UJPA 2HS8A 4MZ8A 5CBBA 3WJYA 1TRIA 4GI6A 4D9PA 2CNCA 4A3UA 1W9XA 2XPKA 2EQ9A 1K1DA 4H1ZA 4K68A 3U5YA 2OEMA 3TAKA 1V6UA 3APGA 4UUIA 2HV5A 4ZOAA 3SFWA 1CWYA 3W2MA 3OLIA 1VIZA 3MMDA 2VCAA 4IMEA 1J0IA 1NY1A 2W63A 2WSQA 3MI3A 4DJEA 2G3MA 4AD3A 3WENA 2V3FA 4QX4A 1HJXA 3UG4A 4FAMA 3QMSA 3N2XA 2PP3A 4TVWA 5DFAA 3NO3A 1QI4A 2ZFAA 1EWDA 1OFDA 3CV2A 4Y9OA 1SZGA 2DVXA 1FX6A 3C6CA 4GC4A 4NZCA 4Q8NA 1ZMCA 1GXFA 1XYCA 4DVOA 2WSKA 2JGQA 5FS7A 3U9IA 1E71M 1SR9A 3KBSA 3TROA 3GSMA 4PMNA 1QPNA 3IEBA 2DVUA 5CGMA 4Q4PA 3C3UA 2G3NA 1KLZA 1TVPA 3HN3A 1EJRC 4HU3A 3TKFA 3LI0A 5ABFB 1J2WA 1R9XA 4ZBCA 5CC7A 4AZIA 3MO4A 1L6FA 4BV6A 1JZ4A 1OGSA 4PUUA 3DHDA 3GNPA 1B3VA 1JZ6A 3AUJA 4XQ6A 1M6IA 2DQXA 1IXNA 4B5VA 1NF7A 1TWWA 4IXXA 5LA2A 1QCWA 5DN1A 5CBJA 2YVFA 2NT1A 4HA4A 2WHMA 3I6EA 3HG2A 4HK5A 4Q7NA 3WG6A 4U33A 5HBFA 2WSRA 1NM9A 1F3WA 5I3KA 1BXCA 1R30A 2J9XA 2ZTKA 3SY5A 3UNDA 4GXMA 3W6MA 2CLEA 3NQAA 1O5XA 5I23A 3VGGA 3ZR4A 4INFA 3T0CA 3N25A 3NGJA 3NVVB 3N6HA 1FECA 1XYLA 5AN7A 5KSWA 4DAIA 4C90A 4A2SA 4E6MA 3AZRA 3W1QA 4D8LA 2Z1XA 2P8BA 1EX5A 1SZRA 3URAA 1JCMP 1GKQA 1J6OA 3UJSA 3F5KA 1UD3A 3WJXA 4PH6A 2TYSA 3U2OA 4KS0A 1RM6B 1VEOA 4DBEA 3S1UA 4LEFA 3LV6A 3GB6A 4I5RA 3ZOAA 4ALDA 7ODCA 4K8DA 3PJXA 1UA3A 5AY7A 2OKTA 2G50A 2V67A 3TW7A 2BY1A 3HPAA 2EQ6A 1C8YA 5D9PA 2OX4A 3LCLA 2JK2A 3LLFA 4EPDC 1JEHA 1YQ2A 1LWJA 2B31A 4JKKA 3E2SA 4GFSA 1AFSA 3BLFA 7TIMA 3TOPA 3W7IA 3NWRA 5F2MA 1V3IA 5CC3A 1W6TA 1FWIC 4YTUA 4IPPA 1GOWA 4JY8A 3LG3A 3CHFA 3GVRA 1K9EA 8CGTA 3P8JA 5HPOA 3RXZA 3KRBA 2X8HA 1JCLA 3MSDA 4QDWA 2FDSA 1PTAA 4ADSA 3HURA 5DT5A 4JQ3A 3OOQA 1YXCA 2CITA 3CXOA 4XZLX 4AY8A 2VC7A 1R9ZA 2BXYA 5JH2A 1UR0A 1W9UA 4EAYA 3UERA 5FJIA 3H2FA 4GVIA 3L21A 4XZMX 2C13A 3T2OA 2PDUA 1B3ZA 1TPWA 3M41A 2BASA 3LCGA 1H7RA 3VUPA 4JD4A 2GL5A 3DC0A 3NQVA 5EMKA 4E5TA 1XYBA 2D1ZA 4OBSA 5AC7A 1KRAC 4QE1A 2I7GA 3WSUA 2PDBA 4MJ4A 3LXDA 1M5WA 2DZTA 4XAZA 1A5SA 1TFVA 4US5D 3TQPA 5EMLA 3FLUA 4TUFA 1C90A 3TQVA 1PKNA 5LGZA 1WDRA 1W1PA 4BK9A 2KX9A 3BARA 4QM1A 4JDYA 2GQWA 4YMZA 3Q2DA 2EXOA 1JG9A 3PJTA 3BCFA 3IUIA 2V5CA 4HZMA 3GIQA 4LAOA 3B8SA 3GAYA 4JFUA 1JI1A 4CQAA 1DPMA 1XGDA 2AMXA 3L5AA 2NVDA 4F40A 3GC2A 4C7DA 1BVNP 4XKYA 4Q4KA 1OC7A 3QM3A 1T6MA 3TJXA 3ZO9A 4UWMA 3IGUA 1ZX9A 1P6CA 4H4TA 3GU9A 4JX6A 3V5FA 4EQXA 1EDTA 3UZXA 4GD0A 3F4VA 3EX2A 3R1ZA 3U48A 4GVFA 2QMKA 3PBMA 3QTGA 4BI6A 4LWWA 4H4QA 3L4YA 4ENLA 1P1MA 3VXGA 4HHMA 5A95A 1QPOA 2XVLA 3UR2A 4RJEA 1OM0A 1UOZA 4E2VA 1ZAIA 1EOMA 1RQEA 4LRTA 3CGDA 5KINA 2PURA 2WBAA 4QJ3B 4OT7A 5I3FA 3L4TA 1LRNA 3LSCA 4GACA 3ZIZA 2V3AA 4DJFA 2DW6A 4WK9A 1PEZA 5DXYA 3KL0A 3DGBA 3SSJA 2GK1A 1NFGA 4WDXA 1H11A 3KUMA 4GG9A 1EX1A 1OK4A 3WDQA 3G0UA 2WM1A 4DYKA 4C1LA 3IGXA 3AZSA 2IKGA 4QQUA 3NSNA 3CEUA 3ENLA 1DWIM 1MO9A 1UMLA 4AD2A 4GQRA 4MSSA 2HQAA 3QGVA 3BAIA 1GRTA 5HWMA 3EX6A 3NQDA 3CHCA 3T0TA 1NAL1 3XINA 4FNPA 2QDGA 3APTA 4CKQA 4H4SA 5HNRA 3W7RA 1R86A 4YYCA 2PLCA 1ISYA 5ECUA 2YBTA 1YYAA 5AC8A 3EXRA 4XKYB 3ZLFA 2OWCA 3UWYA 2CYGA 3SUUA 3CZKA 4MHBA 1A5UA 3LGGA 2A4AA 4GIEA 2HDJA 4GUJA 1V6YA 3TN5A 4CU8A 1OBAA 4XO7A 3M0KA 2BZNA 3VILA 3GD4A 2J7BA 2YBVA 2POTA 3NVYB 2CU0A 3CUZA 1ELSA 1SR0A 3LB8A 1PCWA 1EC9A 1X96A 1D8CA 1IZKA 2ZXAA 1XM3A 3AYTA 1M04A 4CQ9A 3G2GA 3O05A 4MDPA 3VD9A 4OQVA 1TR9A 4XD5A 2BC0A 2ZWZA 3T1GA 4WGXA 3LHYA 4O28A 1QHZA 3W7EA 4AVNA 2XGZA 4P7NA 3FYOA 5JH1A 3BH4A 1YXYA 3DYPA 2Y8VA 1ZU8A 3T2PA 3IV3A 3FA5A 5HR7A 4LC8A 2D3LA 3PBUA 1TR1A 1W5NA 5HWJA 5E5CA 4ADWA 3BW3A 1QI5A 3W82A 2J24A 5JCMA 1G7VA 2D2JA 2ZRXA 2V3DA 4K8GA 3LY0A 3OVQA 5E6YA 3E96A 4B5TA 4H2HA 3AIEA 5LIKX 2CDUA 2QIWA 3VC6A 2FQIA 2E0PA 5IDIA 1LOLA 2NV1A 4D6HA 1HGWA 3ARSA 3ITGA 2Y5SA 3OTRA 5GNZA 5C9UA 3BSHA 1Q6CA 3THCA 4DJED 2EG8A 1A3XA 1LG2A 1KV5A 4J9JA 4RE3A 4DF0A 5HNNA 4RZ6A 1HVQA 3VIKA 3W2KA 2J6VA 3FJLA 3SRHA 3QBUA 2RDTA 5AVNA 3WQ5A 5HXMA 4QCEA 4KH2A 1XFBA 4EACA 3QC0A 2FPVA 3ES7A 5C7HA 1G6CA 3KP0A 1FXPA 2ZZ1A 1QXLA 1CTNA 2DZWA 3U2CA 1NFPA 3BLLA 4AEOA 2FHFA 1E4MM 3L4UA 2WNZA 1UOKA 2Z6JA 1KD0A 1OCQA 3GXDA 2CHRA 4ACZA 5CKSA 1CGXA 1GRBA 1XLJA 1WB0A 1L9WA 3WEOA 3TTOA 1QU4A 1UA7A 3SJ3A 5EYWA 4K1GA 1HX0A 1U83A 4MJ2A 3LN3A 5CZKA 2DZAA 5I3JA 2ZXQA 1TVNA 3AXMA 3DKLA 1R47A 3VD7A 5FL0A 4KBXA 3KBMA 4ZB2A 1VJIA 3KZPA 1XQLA 4KCWA 4Q8MA 3ICJA 4S2BA 4K38A 4B3LA 3AIQA 1DVJA 4WOQA 3UZWA 3WQDA 3UBPC 1DJNA 4TXEA 2ZX7A 2VT0A 1AH3A 4DRSA 2YXOA 1IWPA 1R3VA 1X6NA 4IXHA 1O60A 1Q8AA 3CHDA 4HNTA 2ZRWA 4I6VA 2ZTJA 2ODOA 3BLIA 2VD8A 1EP1A 3VZYA 3W1RA 2HXUA 3ARPA 3EDFA 1ZXIC 3IAQA 1X98A 1S2VA 5IM51 5I06A 1G4PA 5HMDA 4XK2A 3MMTA 1L2UA 1FWJC 1SFJA 3ECQA 2YAUA 3KZSA 3AXIA 1NOUA 4M1RA 4IFOA 2V6OA 3UJFA 4JNYA 1BYBA 4Q7BA 2J8TA 4CQDA 1MDRA 4JN8A 1DORA 4O17A 3OZMA 2A7RA 3LEPA 2PI6A 3GUGA 1IZJA 4PTVA 4ZOCA 4PMOA 1AUSL 4JTQA 3UXIA 4WXYA 3VIJA 2J78A 2GJPA 3C61A 4OZOA 3WNMA 3FHQA 2ZC1A 3FJ6A 3F2DA 2GR3A 3GC4A 4N9BA 5FS9A 3PPGA 4WHBA 2Q3OA 3IUHA 2A3AA 4FX7A 3P0WA 5LIYX 3SJNA 4ZO6A 1KBJA 1K77A 1GEUA 3NG3A 4QTGA 3E38A 3RPTA 3ZT6A 1SSDA 3PUGA 3T40A 1CW2A 3UWEA 2W79A 3T2QA 2YB1A 4PMVA 2PDFA 2Z1WA 1TMHA 4F9DA 3PSWA 4XAGA 2ZQ0A 3UD6A 2GJRA 1AW5A 1LQAA 4DO5A 1HL9A 1GTEA 3G0SA 3M5XA 1K9DA 2R1MA 2P50A 4LF2A 4R27A 1T3QC 3IIVA 1XLHA 1EC7A 1V7YA 1Q1RA 2C71A 3W6YA 1TELA 3LCIA 1JAEA 3PJWA 3ZQ9A 4FDCB 2A79A 4Q6JA 1R3QA 2GFTA 4EIVA 3QW3A 1TJ1A 4OGZA 4S3AA 1AQHA 2GVYA 1RCQA 3BLDA 1W1IE 2ZDSA 1Q8JA 3TYZA 1XG4A 4HTBA 1Q6GA 1BZLA 5BMXA 3TJ4A 3MCNA 3DG3A 3W75A 3K8MA 1HKJA 2P5NA 3LS9A 3S5OA 3WUBA 4ZGYA 4RE2A 1RUSA 3VIFA 2AAAA 2PLJA 4UZSA 1ECEA 3M6YA 3TXVA 2OOGA 3RFAA 1KXVA 3NR0A 4BQ4A 4DYJA 3PUDA 1R3SA 3XIMA 1PAMA 3SCRA 1CLVA 2PP1A 4L6OA 7TAAA 1B57A 1FDZA 3B0YA 3VCCA 4NJGA 1S3TC 1VD6A 5GJMA 5ABGA 1R2SA 2ZC8A 3CAKA 3KOYA 1FVPA 3CT2A 3DBPA 2ICSA 3S9YA 3AZTA 1BSLA 3QQ1A 2BBFA 4W85A 1UIOA 2OB3A 3WL1A 2OSXA 3MUZ1 3OA3A 3KW3A 4ZMGA 1DJIA 1W91A 2GVEA 5J04A 1J8VA 1VH7A 3SCPA 3NDZA 4QCFA 3QHMA 5CGQA 3FS2A 1H51A 1GQLA 3I10A 2C79A 1ZK7A 1EUNA 4B92A 4MG4A 1V3HA 1W3LA 4D71A 4XD3A 3CU2A 1NOFA 3G1XA 5I3IA 2WVTA 3WF4A 2PF0A 1O5KA 5C55A 3CEPA 1NH6A 1OADA 3PFRA 4NX0A 1MEWA 3BMVA 3CMJA 4AMAA 5TD4A 1D7FA 1W5MA 1KRCC 1DWJM 1TV3A 4XAPA 2WNWA 1PX3A 1TG7A 3MHUA 5AB3A 1LBLA 3P2VA 4LYQA 1K8YA 1QUMA 4HK7A 5H8PA 1GNXA 4GI9A 3DJGX 3WQFA 2DP3A 3IVSA 1XP3A 4DJFD 3WD2A 2FHCA 2YGYA 1FUYA 3OB8A 3SR6B 6TAAA 3WLHA 3VC5A 3T4WA 4KESA 2OJPA 3W9ZA 1RA0A 4FP1A 4EWND 4EQSA 5BYWA 3RNDA 2Z1BA 3PHAA 1OF6A 3LNMA 3VOJA 1F61A 4J3TA 4MNLA 1EHNA 1WOBA 2TPSA 2I14A 1VRXA 2QV4A 1GOXA 5GNYA 1YE4A 4PEKA 1ZJAA 2XGBA 1VFSA 1I2OA 1GOKA 1J0JA 3NQ2A 3F4DA 1EZ2A 1DBTA 1N8FA 4QR6A 1XKJA 1Y65A 5I3DA 2FDMA 4JTRA 1ITUA 3U6WA 1XLKA 5JIPA 4BI5A 4O1FA 1O95A 1JZ2A 3L2LA 4LANA 2P88A 3UFYA 2VZVA 2CERA 4AZCA 3A4WA 4M7SA 2NX9A 2R1LA 5F1VA 2PZ0A 1TIWA 1EQCA 3M0JA 2E6FA 1Q7QA 4L9XA 4JQ2A 3A9IA 4FX9A 2ZUUA 4DBSA 4GIYA 1MSSA 3CIVA 2OLHA 2PDIA 3HU7A 4A29A 6CGTA 4HNVA 3AIVA 3L2IA 1M6JA 2BFGA 3HTWA 1XRFA 4HYVA 4NY2A 4UFKA 1CGYA 1LQ2A 3W1NA 5FJTA 1MW2A 4W9TA 4YN5A 5H2ZA 3L0GA 4MNMA 4W5ZA 2ZZ3A 4PC8A 3OGSA 2XFWA 7PTDA 4H50A 1E0XA 5MKGA 4ATLA 3VIGA 3RO8A 4J3VA 2RABA 2OO6A 1E55A 1EPVA 3B9AA 3SQMA 3IJIA 5ABTA 3SN0A 1S5WA 2WYSA 1TJRA 4BQ3A 1T0OA 4HVXA 4ROPA 4BY3A 2WBKA 3C2EA 2AOSA 3ETRB 3GTNA 1MEIA 3W7NA 5TIMA 4AMCA 4R7OA 3VDGA 2WMKA 4O50A 4YL2A 4IIFA 1DXLA 5D2XA 4A6GA 3NEVA 3EOOA 1BF2A 2ACQA 2CHNA 2D2OA 1PPIA 4NRSA 1L0PA 2DSWA 1CCWB 4RUBA 1KRBC 4RXGA 2A0NA 1AMKA 4M8UA 2FJKA 2QF8A 4PCTA 3GXIA 1B0IA 4S39A 2LLEA 3UY8A 1TWSA 3QZAA 5I5RA 3W25A 4LVBA 4AZGA 3UA3A 3M1ZA 1KFWA 3ZXWA 1VFHA 3P5ZA 1TJPA 4AZCB 2PWFA 2YFOA 3MHFA 3CT7A 5F4XA 4D6IA 2WSYA 3M7SA 1J12A 1HO4A 1RQHA 4HYRA 2I1OA 3C2YA 4DO4A 1IWBA 3UG8A 3VKJA 1JPMA 4MLJA 4C6QA 2VENA 4A21A 3UCQA 5ER0A 4UTTC 2IXUA 1RP8A 4MPKA 3S2CA 2YIHA 4ZE5A 3O6DA 3KCLA 1XG3A 2P53A 1IIGA 3MP5A 4TVYA 5K9DA 2A2IA 3K46A 1TX2A 4K2SA 4RCXA 1JQXA 1KCXA 3BO9A 4R7WA 3RHGA 3UY7A 1POJA 3ITLA 3NURA 4DZAA 2DZSA 1A53A 4OUIA 2NV9A 5MKGB 3GW3A 3W1PA 1BKHA 3CO4A 3WJSA 3E0LA 1ZKQA 4EE9A 4ILSA 4FPSA 4I9TA 2PBOA 4Z0SA 1N82A 4ACYA 4FNRA 1PHQA 2E28A 4Z2LA 3GHTA 3G1SA 1SM9A 4PUKA 4ZCWA 1MMFA 3KP1A 4M6UA 3G8RA 4J3XA 3HA1A 4RK8A 3DHFA 1U22A 4ICCX 1G4SA 1HKMA 1HKWA 1KBBA 1C9WA 3DEQA 1GVOA 4DJDC 4N9EA 4IG2B 3M0LA 3W00A 2GUUA 5LA1A 1KWGA 1Y5WA 3EWUA 4S3BA 3AISA 4LQ1A 3QYSA 3FSTA 3EPNA 1F8WA 3GYCA 5L9FA 1XUUA 4ZSTA 2BVYA 5I3GA 5F7UA 5TR3A 3EDKA 1I2QA 4P2VA 1MW0A 2GQ9A 1BGGA 3NPUA 4RE4A 3PNZA 4FS9A 3E2RA 2GVLA 4L6HA 4GZJA 4HPGA 3GD3A 2Y62A 4CUCA 5M3WA 1R2TA 4QISA 1Z9AA 4NIRA 5LA0A 3SIZA 1KTBA 2J6XA 1KN0A 1SJCA 2P1FA 1DXEA 4JPGA 4UQAA 1XQKA 4HCHA 4OIFA 3Q45A 4M19A 4DAFA 1VJSA 3BK0A 2C16A 1MI3A 4W8BA 3IPWA 1VCFA 3TH6A 3WFZA 4J35A 4RZ4A 2DT0A 2VZTA 3V1HA 3G1DA 4IIDA 2DV0A 2HPIA 5DMLA 1MNZA 2YDRA 3ZLGA 4XD4A 5EPDA 1VFOA 1N8WA 4UMBA 2QCCA 1ZBVA 4U10A 3UPWA 4GINA 3AYRA 3WBWA 3VD4A 2XWDA 4Q4SA 3N4FA 3CGBA 4JL2A 4NNAA 4WY0F 5A2AA 1LT7A 3VKCA 3PG6A 1EKOA 2J4GA 1XX1A 3QYQA 2PTYA 4H8UA 4S23A 4F2TA 3GK0A 4ATWA 2VFDA 2CLFA 3NO5A 4I8DA 4PMQA 1OX6A 1XIHA 1RY0A 2NWSA 4AU0A 4RXFA 4RPQA 4Y6GA 3D3AA 1OFEA 4GH1A 1MUCA 3RLUA 3UESA 1P43A 3HQPA 4LU0A 5AECA 3URQA 5KVIA 1UH2A 3DOPA 4C6PA 1XPYA 1GEQA 1ALDA 2VWSA 3PPCA 4XVDA 3R8HA 1P6WA 1XD0A 2ABBA 2Y8UA 3N3MA 4HN4A 2NX1A 1TYGA 3LU2A 3CB8A 3BW2A 4D72A 1S2TA 4UTWC 1GKPA 3GR7A 3NJ3A 4FSAA 4D8AA 1OZMA 1OABA 4PB4A 1ZHAA 1FCVA 1SGJA 1ZP4A 2PCEA 3WJWA 2J25A 2I9UA 3LRLA 1QJWA 1XIJA 3V5OA 1C7SA 4M82A 1G9HA 2WVSA 2OEJA 3VDCA 3ARQA 3MKCA 4DWDA 4RZ5A 3DU0A 3GNNA 4QG9A 4X9SA 1S1RA 4PL2A 3DFQA 1X8CA 2VUNA 2DFAA 1NPXA 1OYBA 4UOJA 2EKGA 1BHGA 4QNEA 2HBXA 4I3GA 2V5KA 5A6TC 3CXBA 3ZVIA 4EMIA 5H8MA 4B2DA 2WQDA 4P8UA 3BGAA 1J2BA 3SRKA 1N62C 4RDVA 2XH2A 5CPQA 4FIQA 4WDWA 1P5BA 1VEMA 1BF6A 4L64A 3KDOA 5FF7A 3T8QA 4E4PA 1PZ3A 1Q4NX 3S2LA 1YXDA 2ISWA 1OYAA 1ZNNA 1KA9F 1H7XA 1S1PA 2PA6A 4ZENA 3H55A 5FS8A 1FWRA 3WBXA 4UXDA 2CZ5A 3HJEA 4NVTA 1E70M 5CH9A 1FWBC 3KS6A 4EF8A 4CD7A 1VIWA 1NQ6A 1F6PA 4XTIA 2X41A 1E5JA 2YCJA 3HO8A 2VEMA 1Z7AA 2VRJA 1JJKA 4TU1A 1G5AA 1H7WA 3GVGA 1QOQA 3BL3A 1TKKA 3EB3A 1UW9A 3W24A 3EX3A 1IIHA 3WH6A 1UKPA 1WDPA 2XG9A 3EAOA 2X7WA 2XIQA 1L6GA 1I2RA 2QUNA 3UWUA 4C7GA 1OC5A 3KL5A 2ZRUA 1IGWA 1DE5A 1OD8A 2QCEA 4KWSA 3PBWA 5T91A 1BEUA 4YTSA 4OFCA 1TSIA 2Y5JA 5T26A 1BYCA 3GXTA 1Q6RA 3ABZA 2PC4A 2UY5A 4JTKA 4WUIA 1TZ9A 2Z29A 3EDJA 1V02A 4I9JA 3PJUA 3QXBA 4DLMA 1TREA 2ISSA 4PB3A 2QHAA 3W2LA 2E09A 4B4FA 3BG9A 1GWJA 1BGAA 1KQZA 3LX9A 1PX8A 1RD5A 3HG4A 1M1BA 4W84A 3C52A 1AZ1A 1L6SA 3NZRA 2NXGA 3GR4A 4FNTA 1J01A 3CZJA 2INZA 1K02A 3TC6A 2DGAA 1XRSA 5DCEA 1VQTA 1E6SM 2X7VA 3KOWA 3N15A 4EPKA 1GVSA 1F8IA 1GVYA 5AHNA 3WK0A 3W7HA 2QT3A 5EMMA 5GPRA 4JKMA 1O5QA 2DH2A 3DENA 2PDWA 3UQNA 1RJPA 1CDGA 3PTQA 3CWHA 1YDOA 1XIEA 3P6LA 2WM0A 4WDUA 3EWXA 2VEPA 4JIEA 2RJGA 3LOTA 4I9AA 1EOKA 5LNVA 3QGKC 3RK8A 2X2YA 2ZZBA 1QAPA 1ONFA 1F74A 3MWAA 2C3CA 3FEQA 2YQUA 3FJ4A 2EBNA 1VHNA 3B40A 1ONRA 3E0WA 2IKHA 5HJLA 3QH2A 3AS3A 4FZIA 3N11A 1QR7A