1FHVA

Crystal structure analysis of o-succinylbenzoate synthase from e. coli complexed with mg and osb
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
323
structure length
322
Chain Sequence
GSAMRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGREGWGEISPLPGFSQETWEEAQSVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILKLADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNPDYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQVRRWPGSTLPVVEVDALERLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-SUCCINYLBENZOATE SYNTHASE
publication title Evolution of enzymatic activity in the enolase superfamily: structure of o-succinylbenzoate synthase from Escherichia coli in complex with Mg2+ and o-succinylbenzoate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 106
structure length 322
sequence length 323
ec nomenclature ec 4.2.1.113: o-succinylbenzoate synthase.
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1fhvA01
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1fhvA02
4HPNA 5BOEA 1XS2A 3N6JA 3PWGA 4JHMA 3D47A 4IP4A 3RR1A 4F4RA 4A3RA 3V5FA 2AKZA 2PCEA 3CXOA 2ZC8A 5EU9A 3STPA 4E4UA 3MZNA 3DERA 3DDMA 3UJRA 2ONEA 3ZVHA 3RITA 3SBFA 1XPYA 5FJPA 2HZGA 2PS2A 3T6CA 3B97A 3R0UA 4GIRA 1W6TA 3FJ4A 3SN0A 3TJ4A 3RGTA 2QJNA 3DFYA 4GYPC 3ZLGA 1SJBA 1MDLA 2GDQA 1PDZA 4GISA 4Z1YA 4E5TA 2AL1A 3VCNA 4A35A 1EBGA 3Q4DA 3DEQA 2OQYA 4IP5A 2QDDA 3H12A 3SQSA 3OZMA 4DN1A 1OEPA 1BQGA 1R0MA 1IYXA 2HXTA 3R11A 1PDYA 2PA6A 3SJNA 3OZYA 1F9CA 4HN8A 2QVHA 3S5SA 1EC9A 4GFIA 3TJIA 2OKTA 3H8AA 3QPEA 3ES7A 4HCLA 4ZA0A 2QQ6A 2XH7A 2OZTA 3GY1A 2AL2B 1R6WA 5IDZA 4ZCWA 2P3ZA 3QKEA 1MRAA 3UXLA 2P8CA 3U9IA 3TQPA 3EKGA 3TW9A 3OP2A 1NELA 3GC2A 1BKHA 4GGHA 2XH2A 3TTEA 2QGYA 2MUCA 4KT2A 4J1OA 3NFUA 2GGJA 4M0XA 2P0IA 3CAWA 2PGEA 3MQTA 1FHUA 1L8PA 3DG6A 3MWCA 4MGGA 3H7VA 2AKMA 3P0WA 3I4KA 3UXKA 1JDFA 2XSXA 3FVDA 3JW7A 4HCHA 1WUFA 2XGZA 4HNLA 3DFHA 2DW7A 2POZA 3IJLA 3CB3A 3R10A 3V3WA 4J3ZA 5FJOA 7ENLA 3RO6A 1KKRA 1MUCA 3UCDA 1P43A 2OVLA 2OLAA 4IHCA 4DXKA 3UJFA 1JCTA 2AL2A 2ZADA 1E9IA 3PFRA 3UJSA 4K2SA 4DYEA 2OZ3A 2P88A 3MY9A 3ZLHA 1TKKA 2PP1A 2GL5A 3UJEA 3VC6A 3FCPA 3IJQA 1RVKA 3I6EA 2O56A 4ENLA 4HYRA 4DHGA 2PP3A 1ELSA 3K1GA 2PU1A 3R0KA 4ROPA 4HNCA 4IZGA 4DX3A 2GGIA 4GMEA 1JPDX 4FI4A 3NXLA 4DWDA 2PGWA 3DGBA 2QJJA 2P8BA 3SN4A 3S47A 4IT1A 4KEMA 3T9PA 3HPFA 4G8TA 4IL0A 3GD6A 4EWJA 1KKOA 2PTYA 4GYPA 2NQLA 4HCDA 1MNSA 3CT2A 3UCCA 2HXUA 2QDEA 2OFJA 2PTZA 2OPJA 4H19A 1SJAA 3VDGA 4H83A 3T4WA 2PMQA 3VA8A 1TE6A 4IL2A 2HNEA 4E6MA 3H70A 3JZUA 2PPGA 2FKPA 3CYJA 2CHRA 3V4BA 1WUEA 3THUA 3P93A 2GGEA 4K8GA 2QJMA 3V5CA 3P3BA 6ENLA 4KWSA 3N4EA 3I6TA 3SN1A 1TZZA 2PODA 3EEZA 3JVAA 3UJ2A 1P48A 4Z17A 3CK5A 3SSZA 3RCYA 1EC8A 5FJTA 3NZGA 4KPLA 3OPSA 1KCZA 3QLDA 2RDXA 3ENLA 3BJSA 1DTNA 3MUCA 3TCSA 4G7FA 3MSYA 2OQHA 4A6GA 4H2HA 2OG9A 3FXGA 3N4FA 2MNRA 3ZLFA 4E4FA 1YEYA 1ONEA 3GO2A 4X2PA 2GGHA 3DESA 3QN3A 3R1ZA 3NO1A 3UGVA 3VFCA 4JN8A 4K1WA 2OZ8A 2OX4A 4H1ZA 3OW1A 1ECQA 2OO6A 2FYMA 1EBHA 1NU5A 2PP0A 3Q45A 2I5QA 4E8GA 2DW6A 2PTWA 3KUMA 4M6UA 5BOFA 1MDRA 4GGBA 3OTRA 4MMWA 4FP1A 1FHVA 5ENLA 3PWIA 2XH4A 4MKSA 3ES8A 1EC7A 3QTPA 2PU0A 3FV9A 3BOXA 3U4FA 5FJRA 1JPMA 3TWAA 3VC5A 3TWBA 4JN7A 3DG7A 4YWSA 3ZVHB 3R25A 2GGGA 1SJDA 2XH0A 2PSNA 3MKCA 3BSMA 3FYYA 5J04A 3IJIA 5FJUA 3DG3A 3RRAA 2PTXA 3ZVIA 3IK4A 3TOYA 3N6HA 3PK7A 1KD0A 3VCCA 1SJCA 3T8QA 2GSHA 3D46A 3DIPA
chains in the Genus database with same CATH superfamily
1HQTA 5J5RA 2OXNA 3GFYA 2FH8A 1IXNA 1HJVA 1MNZA 3RDKA 3FKKA 4OBSA 1LL6A 1AQ0A 1GRTA 4AIBA 5CJ5A 3K4DA 3RR1A 3V18A 5DCDA 5C54A 3ZXWA 4J9JA 1XANA 1GQIA 3G0SA 4F0KA 2VCAA 4CU7A 2EAWA 1GRAA 4KFOA 2RFGA 1XH2A 1HJWA 3OHIA 4C1NA 4LVDA 3OQ8A 3WQ8A 4ICNA 4AISA 2PWFA 3QMSA 4XG1A 3Q2DA 4CKQA 1E15A 4M8UA 1C8VA 4JTHA 3SBFA 3CAKA 4K6AA 4LVGA 1EHAA 1NWSA 2QNEA 3NWRA 3C6CA 2ZTJA 1T96A 2EG8A 3L4UA 3DHUA 3TSMA 2CWNA 4GIRA 1W6TA 1YTDA 3WQCA 3APGA 4W84A 4ZENA 5E0CA 2BOEX 2H9AB 3QXBA 3VUPA 2V63A 1OZMA 3LZ3A 1HZYA 4Z2LA 2ZICA 3CUXA 1T8QA 4GABA 3CIVA 4J3UA 3F4VA 2FPVA 3PZUA 1F73A 3AICA 4PMDA 2C91A 1YLVA 4PTDA 4UTKA 1UWUA 4NNAA 4K8DA 3PPGA 2HQAA 3CWHA 1TZ7A 3EXTA 2A7RA 3H2OA 1F9CA 1US0A 2WSQA 5F4WA 3GTXA 1KTNA 2WMIB 3C61A 3EMCA 1BYCA 4Q4PA 2UZ9A 3KRUA 5XINA 4JTIA 3CL7A 3W7KA 2OZTA 6PTDA 3HGRA 2WKLA 3P84A 1JCXA 3BCDA 3OP2A 4P8XA 3E2VA 3W23A 4DY1A 4JX6A 3P5YA 5DRIA 3WEOA 1VB9A 1GVSA 4UTTC 2NUXA 5LYRA 4XBKA 2TODA 3AIVA 3B8VA 5A8GA 2YYTA 3WDJA 3BJTA 3M6YA 2ZUSA 3GWQA 4LALA 3FVDA 1T5AA 2W3SA 3GD4A 1K8XA 2J7EA 2R94A 5FAGA 1BVWA 2QJGA 3HU7A 3M5XA 4PMYA 4C6IA 2OJPA 2WLZA 3VIHA 2D1ZA 1R5YA 1H49A 3AHVA 4LUSB 4ZEPA 3CMFA 3GX9A 4FXRA 4H50A 2IKIA 1TA3A 4GI9A 4ZXOA 1MXSA 1UR3M 3KP1A 1XHCA 3M7SA 1YKWA 1CGWA 3ZS4A 4ERGA 3ITYA 2FTWA 3O2LA 3IJQA 3FFSA 1OGBA 1KBBA 4LCRA 5FI8A 3GIYA 3ITXA 3PBWA 1E5JA 1U5VA 1OINA 1E6QM 4QEEA 5EB8A 1I45A 1J0JA 5A6BD 4JKKA 3UPMA 1FWIC 2BVDA 3GXPA 2X7WA 4H01A 4EOUA 4PUEA 5A6TC 3SB0A 1JEHA 1BTCA 4B2DD 7TAAA 4MVAA 4APNA 1XC6A 3WL0A 5AFDA 4ZFCA 5A2AA 1WBJA 4HA4A 1GEUA 5C5YA 5FOOA 2G4JA 3ZQ9A 1EJVC 3MVIA 3P60A 4QCEA 4G8TA 4MWAE 4IL0A 3GD6A 1P0DA 4L61A 3L0KA 2DIEA 1QTWA 3CT2A 1XGDA 1W1TA 2GR0A 2NSXA 1HW6A 4C1NB 1JPHA 3H23A 3BG3A 2OFJA 8RUCA 2FPTA 4Q8TA 1JZ3A 3PZVA 3UWZA 1KM3A 1H6VA 4XUGA 4W8AA 1V02E 1KBJA 4PR4A 4CNUA 5AY7A 1QDSA 3AIRA 1GW9A 1CEOA 3PPHA 4F79A 4EXAA 4GYJA 1GVYA 3CNYA 3UZYA 1LWHA 4WGHA 4H4WA 2VGBA 5CGTA 2QGHA 3GRTA 3MUAA 2D2GA 4ZQOA 5D2TA 1H0GA 1CECA 3BQ6A 3HFYA 3W7RA 1GJUA 3GTIA 4YN5A 1W32A 3UY8A 3WF4A 3AZRA 4V2XA 1GZGA 4ERAA 1V3KA 4EANA 3S1VA 2VKZG 3TTQA 4PB3A 3KCJA 2PC4A 1VLIA 5DY3A 1Q6FA 3MUCA 2X0HA 3KBNA 4HA3A 4KS0A 3HQPA 3K30A 2IPJA 5ECUA 4E2DA 1N8IA 3NYDA 1A3XA 5T9BG 1XICA 3PHAA 3SRHA 2ZWZA 5T91A 3B8TA 4Q8VA 1NHRA 3TYCA 4WVXA 4H9YA 4UTHA 1PX4A 1RBOB 3N19B 3R6IA 2W63A 1EEPA 3C8NA 1EQCA 2GJXA 1ZS2A 4LC8A 4PEEA 2BSLA 4ZO8A 3EOSA 1RCOB 5A95A 5GRTA 1QBAA 3T0TA 4N6FA 2AQOA 4GJJA 1F3TA 3QPZA 5G2IA 1T8XA 2F5ZA 3EX1A 4PE8A 3PPFA 3GIQA 3OTRA 2OEMA 4MB1A 3SZ8A 1KNWA 3DU0A 2YBTA 4MKSA 4K7ZA 2PLMA 3G1HA 4DYKA 1J0ZA 4ZQMA 3OLIA 3QH2A 5FJRA 3AM9A 3W2JA 5GNYA 2RGLA 3L8KA 3TH6A 3BAIA 1IXOA 4XAGA 7A3HA 5BZAA 3WH7A 8XIMA 3NQFA 3U3HA 1RD6A 1LYXA 1VCGA 1A49A 4O28A 1TV7A 1PEZA 3TU9A 3E5BA 3QC3A 3GBDA 5D30A 1TTQA 2YB1A 1P0BA 2RH9A 4Z0JA 3LLFA 4XISA 1UP0A 5FS7A 1JJKA 2QCEA 1TUXA 3TVAA 4IP4A 4YU1A 2X50A 3OQEA 1OFDA 5FIPA 2J3NA 2R91A 3DAQA 2ISDA 2OYLA 1H61A 4LVBA 3IV8A 1TYPA 3N9RA 4H4TA 1ONWA 4AD4A 3MZNA 1JDDA 1SYTA 4DAFA 3HPZA 1E40A 5CZKA 4L6DA 4CN1A 1XIGA 2PWUA 1C8YA 1XPYA 1A5OC 3TYEA 1F6YA 1XLGA 1US3A 1DWAM 4XX6A 3GDKA 3TJ4A 3XINA 2WHKA 3MHGA 3LCLA 3DFYA 4HK7A 8A3HA 1DE5A 1XLIA 1R3RA 4O11A 5BU9A 1KFJA 1K7EA 4GISA 3VDCA 1I2QA 1O5KA 2C3ZA 1MMFA 1LUCA 4F48A 2AL1A 3BH4A 3VM7A 4B5XA 2V5BA 4GY1A 2HJPA 4HJWA 1M5WA 4OJYA 5H6HA 4DRSA 3RPDA 4CNTA 2W0HA 3BC9A 1M7JA 4DJEA 1CB7B 1UD5A 4LAOA 2VHLA 2A7NA 2D0FA 2PZ0A 4HN8A 2ACUA 1ZX9A 4EIVA 4A3YA 1TPC1 3UA4A 2YFNA 1T99A 3GW0A 1VCVA 3EKLA 1QI5A 4EE9A 1VHNA 4RV3A 4QQUA 3WH5A 1CZ1A 1WYIA 3E1F1 4BF9A 4X0VA 4R5EA 3WMCA 2HK0A 2Z1VA 1RV8A 4MNJA 2P8CA 2BGSA 3CS2A 4D71A 2I57A 5CJMA 1C7TA 4GGHA 4PMRA 3FIGA 3SY8A 3FSTA 4RZ6A 1TWIA 4E3VA 2YBUA 3S9ZA 1PKNA 4PUUA 3DG6A 4MGGA 4RE4A 3WJXA 5FF7A 1ENUA 1VYSX 3LK6A 3QLLA 1UJPA 2J8TA 2NX9A 1DJQA 1JF5A 2WK2A 2PFHA 4QLJA 4L4PA 1IEVA 4ZOHB 4H8VA 1HX0A 3PTKA 4JQ9A 3M0VA 1X38A 1HKVA 2POZA 4Q6XA 2YFOA 4O18A 1EJWC 1DXFA 1ME7A 2GJXB 1C29A 4MG4A 2CXEA 5F2LA 5I78A 3W86A 3CUHA 2A8XA 2G3JA 3L4TA 1LPFA 1P43A 4QX4A 5A69A 1ZQ5A 3T08A 3KBVA 1V6UA 1XINA 3CH9A 3IV3A 1GV4A 2PP1A 1AD1A 1G7UA 4UTWC 2V69A 4CN4A 3G8RA 1NP2A 1E43A 1OY0A 3MMWA 1L6SA 5HNRA 1U1JA 1CXKA 1WXZA 4KF1A 3QTGA 5HNUA 2VR5A 1UC5A 4B15A 2ZQ0A 2RAGA 3NAVA 4JIPA 4C5YA 2Y7DA 5BXSA 4DX3A 4HU8A 4S39A 4FI4A 3LHWA 1HKMA 4LGXA 1SZRA 4CCZA 1SSDA 4JQ1A 4PCTA 1A53A 1Y7VA 2XN0A 3L4VA 1XI3A 1T6MA 4PMZA 3EZ4A 1RP8A 3LLDA 4EP8C 4BR1A 5DXXA 4IT1A 2VFIA 2CETA 3LA4A 3QZAA 1CGTA 2OR2A 2X41A 4YYFA 5JCNA 4HCDA 5E5CA 1MNSA 3LN3A 4QR6A 4H8UA 2GSEA 1KWKA 3W25A 1U1HA 2PTZA 3V0SA 1TUFA 3AN1A 2VX6A 4O57A 1K02A 1TJ1A 3S46A 4XSMA 1I60A 3KE0A 2F2KA 2ZZ7A 2R24A 3SY1A 1EZWA 4PA8A 3IIPA 3JZUA 3WMLA 1UP3A 4GCAA 1NOUA 2GVJA 4IMFA 4WIWA 1ITUA 1Q65A 3LXDA 1Z9AA 1QW7A 1G4PA 3WLTA 1OBAA 4I3GA 1JYVA 3N4EA 1GW1A 1NVMA 1S46A 2V30A 3HRDC 1X96A 2ZZCA 1B3XA 3H22A 1QRQA 3L5OA 4ECLA 2WKGA 1GZ1A 1NDZA 1T3QC 4H9XA 1Q4NX 3W7IA 3EDJA 1IR1A 4GJIA 3OVPA 5U4NA 4G1NA 2EQ7A 2V3DA 1LT8A 3TTOA 2RDXA 4PL1A 4IJCA 2V5KA 3VNZA 5GPRA 2C79A 2OEJA 3FXYA 3UZXA 6CGTA 3GG1A 3O6CA 5KINA 3PZTA 2MNRA 3NDOA 4RZ5A 1KR0A 3RX4A 1UQYA 2XN1A 3IJ8A 4UOJA 2FZDA 4IIDA 1F8IA 1YEYA 2XDFA 1K9TA 3EA2A 1FWEC 2BVTA 4PSPA 3R1ZA 3NO1A 1J4EA 4AMAA 4EM3A 5EPDA 3LB8A 3BJFA 4K1WA 1BG4A 3DK9A 4JIHA 1C8XA 2VEFA 2VEPA 3PZIA 3N2TA 1NU5A 3S5OA 1E4MM 5FEXA 2VURA 3AIUA 4OU1A 5BOFA 4O8AA 3GU2A 1LL4A 4BY3A 1E9LA 2IPFA 4B5WA 3RUBL 5M3WA 1J8VA 1QUMA 3WF0A 3DHFA 5BXRA 4O54A 4J56A 3ZVHB 3R25A 1KV8A 2GZXA 1C3FA 3EX6A 4GXMA 1MZHA 5FJUA 4IX2A 3MMUA 3M07A 2DH3A 2J62A 3LY0A 1NH6A 4HU4A 5FS8A 4JN6A 1R2RA 3ONBA 4FHAA 1QOXA 5JH1A 2ANUA 1V51A 2E5DA 2DUZA 2QHAA 2VTFA 4S38A 4W8BA 4PL2A 5C2CA 2RDUA 4RDYA 2HV5A 1E72M 3QGAC 1XR2A 1ZSXA 1TYTA 5I3DA 4TXEA 2WMFA 4M29A 1FOBA 2PDKA 1SW7A 2VX5A 5JVLA 3QQ0A 3AWOA 3P7YA 2PWHA 3IK2A 1ZBCA 2FIQA 5DT7A 3ISIX 3M0JA 4Q3MA 3TE9A 4B5VA 3AI0A 1HJQA 3PB2A 3GH4A 3N2BA 1IGWA 2DSVA 5GNXA 3G6LA 4GFSA 3VFLA 4GQGA 1MXDA 1B30A 1Q13A 4R7JA 1QI3A 3CV7A 4Q7BA 3CTLA 2F7FA 2YL5A 3KW3A 4JKLA 3GNPA 1XRVA 5D2VA 2ZA1A 4Y8EA 1IE7C 1E71M 4UMCA 1VFLA 4QP0A 4U33A 1EWDA 2WP6A 2ZRWA 3IVUA 3ZJKA 4IQJA 3EYPA 4O50A 2V5CA 3M16A 2X8CA 1K7FA 2PDBA 5AC7A 1FQ0A 1TMLA 4D8ZA 1LP6A 3VGEA 2NXGA 3SUUA 3ZIZA 3WDQA 3SR6B 4DM1A 4FSAA 1UKOA 1WKYA 1XIMA 2V67A 4HHMA 2CWXA 1RR2A 3ME3A 3H8AA 3M44A 2PB1A 3KVMA 4J35A 3GNOA 3APTA 2REQA 3GYEA 4Q8QA 1A5LC 3NRZB 2E28A 1W5OA 2Z7KA 2XH2A 3ALGA 1EGZA 2VUYA 2Z4GA 3C2EA 2GGJA 2YW4A 1W3KA 4UB9A 4N4PA 4JEJA 1VJZA 3KBSA 1RY0A 2DT3A 1W5QA 2WVUA 3C2FA 1H62A 4HNOA 1K7XA 3W76A 3V3WA 2WZMA 1C8QA 4JNMA 5FJOA 5DY2A 4HA0A 3W2UA 2NZLA 3HTWA 4XD3A 1YIXA 2WC3A 3STCA 1TYGA 1Y8BA 3DFQA 1XYFA 4JYFA 1E0WA 2ZADA 3UJSA 5EMLA 3DH9A 4HVXA 4WUIA 2BOGX 4NJJA 3S2LA 4IIBA 3KEHA 2J13A 1NQ6A 3ZLHA 5I79A 5T8GA 3VC6A 1DPMA 1R38A 1E4NA 4K7VA 1TIWA 3EB4A 3FGCA 4PMNA 1UD6A 5D2YA 1G7VA 4IZGA 4PEKA 1DIEA 3T4CA 3C5QA 3ZT7A 4QTGA 1GTHA 3PJXA 4Q32A 4TQTA 1H7PA 3LBCA 4Q4MA 1ZZMA 2R14A 1JFXA 4GMEA 1KA9F 2FGZA 4DWDA 1EYWA 3AYSA 5A94A 2PDUA 4ADSA 3LI1A 5C2XA 3GR8A 3TJXA 2PWVA 2HS8A 1D8CA 1UWQA 2G4FA 5G2WA 4GWEA 1QMLA 2WNNA 2XIIA 5DFAA 4H4IA 4CQAA 1SO4A 2PDGA 1QPRA 3A3WA 5B7YA 1XF0A 2E77A 1Q2RA 3PAOA 1H2JA 1QW9A 4C1KA 1H1YA 2Y70A 4UQAA 1W9VA 3VUSA 1F76A 4WZHA 3CAQA 1B0IA 2ASHA 4W5UA 4BWLA 1LG1A 2Q02A 3TN6A 2J8FA 2BXYA 4XZMX 4YS1A 3SCRA 1QT1A 2ISVA 1VYRA 2DZPA 1K8YA 4FX6M 1ONXA 3RAOA 2FZNA 3H70A 2D3LA 2ZZ5A 2OSWA 4PH6A 4Q8UA 4EMIA 2JKEA 2V8ZA 1DWFM 3PZ9A 1WX0A 2QAPA 4PCFA 2YSWA 3P93A 2OSXA 3NVYB 1NF0A 4TVDA 3Q37A 1M03A 1J93A 4GZEA 2EGZA 2CZFA 4DLFA 4UMBA 4LF1A 3C0JA 3P82A 2YR1A 2AOSA 4MHBA 3TNBA 1TSIA 1OGGA 3L9CA 4YLWA 4Z17A 2EPNA 3LADA 2CNCA 2ESCA 1Q6LA 2EXOA 1R46A 1GKQA 2BOFX 3M0IA 4KEUA 3W71A 1XQLA 4ZODA 4B92A 5KETA 2QV4A 3ZYZA 1SZFA 4QS5A 1YHTA 3NVVB 3FX4A 1XCWA 4UBPC 3MP3A 1FCBA 3CWOX 1DJYA 2X1IA 3GVWA 5U1OA 2Y85A 3GO2A 3N2CA 1YPFA 3JUGA 3SQMA 4HOXA 3DGHA 1IXPA 2C0HA 2OZ8A 2WNQA 1A0EA 3CGCA 3OIHA 5REQA 3SCUA 2ISFA 3W1TA 2FYMA 1EA0A 4GUIA 2Y1HA 1S38A 3OVGA 4RW3A 2DSUA 3QOMA 4TVUA 1W9DM 3KZPA 3PB0A 1RUSA 1QOQA 4PMUA 2DGAA 3DFSA 4PUNA 3O0FA 4JTTA 5JH2A 2WVSA 4BF5A 2YZ5A 4J5NA 1S5NA 3DK4A 3NM1A 2CXGA 3GTNA 3BSMA 2VEGA 3RCNA 3NVZB 4BS0A 1EJ7L 1SO5A 1JNEA 3NOYA 3P0XA 4LVAA 1BHGA 3EUB3 4WKHA 4AZBA 3HOJA 3UXDA 4EAMA 1JIBA 3CGTA 2XU2A 3FGCB 3T0AA 3DKJA 5LSMA 1FWRA 4ZL1A 5AHIA 5C70A 3I3EA 3UWWA 1IEXA 2DZVA 1JQXA 3GNRA 4BI6A 2WAGA 3N17A 2ZUMA 1XG4A 2HS6A 3BMVA 3R0DA 4LUJA 4DBEA 3RX2A 6A3HA 1TELA 3P81A 4JTCA 4YTRA 1S5MA 1XDJA 3H2FA 1PWMA 4ZB0A 2RDTA 5BMWA 5DCBA 1NDVA 4LH8A 1JCNA 3EDEA 2HZGA 3HO8A 1RJPA 2TRSA 2VELA 3LDVA 3R0UA 3WLHA 4HGXA 1WPCA 3UT0A 1ODUA 4DO7A 4LUTA 1KWGA 5C8BB 1UZHA 3N3TA 4ZFMA 1SJBA 3N25A 4JL2A 4Z1YA 3AUJA 2IKJA 1TR9A 3VCNA 4A35A 5BYWA 1M3UA 4IXHA 2ZZ6A 3V36A 2WMJA 4DO5A 1Q66A 2WQDA 4IP5A 1EWEA 4MIMA 4RR4A 2QXWA 4A2RA 4NYUA 4FAMA 3QV9A 4M24A 4LX4A 1N7KA 3R11A 2F2HA 5K9DA 1PE1A 3CLMA 3WJWA 2Z1SA 1KCXA 2BBFA 1TV2A 3SCVA 1VBRA 2XH7A 3ARWA 2XWDA 3U2EA 4NJKA 1PX8A 3MKKA 4J40A 3O07A 3CHCA 3QKEA 1HKIA 4CD6A 1F3PA 3KOYA 4NF7A 3UPWA 2XSBA 4A3UA 4L5ZA 4XV0A 4ADWA 1V3MA 4DLMA 3BUVA 5XIAA 4HP5A 3IAQA 2DIKA 2DZXA 1VENA 1V6VA 3EAUA 4XIMA 5CSSA 1CGUA 1MUWA 1UH2A 2I5GA 1RJQA 1EPXA 5BOOA 4O53A 3IJLA 1K4HA 2X2YA 3EF6A 3II1A 1N60C 3ETRB 3RRXA 1AH3A 5LIUX 4DWSB 5HJYA 3O15A 4HQVA 3MB9A 2ZUNA 5REQB 4ML4A 3E0VA 5LNRA 2VWTA 3WBXA 1FWAC 1PZ2A 2FLIA 2I16A 2PBOA 2XG9A 3VGHA 4DYEA 5BRQA 3L4ZA 2OWXA 2YPIA 2EPLX 4Y90A 5AHNA 3UR7A 2E09A 3DYPA 4K3ZA 3GXFA 4UFJA 2O56A 3PUOA 4MJ2A 4QNEA 4UR9A 4D6HA 5A6JA 3GR7A 5A6LA 3CMGA 4DJEC 3Q94A 2VEIA 1KM5A 4LYRA 2YBVA 2Y8KA 4ROPA 1NARA 5ABFA 4KIRA 2UY5A 3KTCA 1U5JA 1KFBA 2PDWA 1T0OA 2TYSA 4JYEA 3AROA 1A47A 3WQDA 2YLLA 3UWVA 5JBEA 3KOWA 4GX9A 3M4HA 3UP8A 4I9JA 4N0RA 1Q8JA 1MSSA 5LA0A 2VD9A 3OLGA 3VIGA 1E55A 1R9XA 3BG9A 4YCPA 4MZ8A 2WWDA 1XYAA 4JTEA 3VDBA 5DQPA 3TA9A 1ZNNA 2NQHA 4ATDA 4BI5A 4GYPA 4UFLA 1ZBVA 3UGRA 3UCCA 1ZJBA 2HXUA 4AYGA 1MQRA 4MB3A 4GINA 5AB3A 3WDIA 4H4PA 1JPKA 4LUYA 2NLIA 3AS2A 1VKFA 4MNLA 2BB0A 2YVGA 2X1RA 4Y9NA 3A23A 1W8SA 3UVAA 2XIOA 1P0NA 3DECA 4NILA 2RKXA 5A6SA 2YDAA 3AMLA 3V1HA 5KEZA 1HFBA 4JYDA 4M1BA 1E1EA 3AQUA 3ABSA 2KZHA 3BW3A 3VDHA 1AG1O 1EP2A 3B40A 2FZBA 5TIMA 4YIWA 3CV1A 2WWCA 2J9YA 3ITVA 1BD0A 2QCCA 3THUA 2B7PA 3FN9A 1SUXA 1KM2A 2NX1A 2BX7A 3VMPA 4Y96A 3ZM8A 4B5UA 1CI1A 4FNRA 4IXXA 3JVAA 3PJWA 5EMYA 3WENA 1VDVA 1KTBA 4HBKA 1KN0A 3GXNA 3MCNA 1D7YA 1O5RA 4PTWA 1LJYA 4PTXA 3DZ1A 1REQA 3LPPA 1EO7A 3QHOA 3BJSA 2WOWA 1A5CA 5ABGA 2QZRA 4JFTA 3VPLA 1VCFA 3JRKA 2QKFA 4JL1A 2WJEA 4LAKA 4GQQA 4KIEA 2Z0IA 4A8IA 2TPSA 3N9KA 1JF6A 4FOUA 4MLJA 4B5NA 4D6IA 1ZAJA 3NXFA 2PDFA 4IISA 1O4UA 3L4YA 1XBYA 4IPLA 5HK4A 3KTXA 1QI2A 3S6DA 3W37A 2XSAA 3EGJA 4JN8A 2D0GA 3CQJA 3L66A 4ZB2A 3ZMRA 1AQHA 2FMNA 3UQNA 3K4AA 4NZFA 5IHSA 3CHEA 4QG9A 2XN2A 1AQFA 1B3WA 3AHTA 1FXPA 1I0DA 3BLDA 4HOWA 1IGSA 1WKFA 2XH4A 3UG3A 2A2IA 2PU0A 4S3AA 3UG4A 4AG0A 3EMQA 1H1ZA 4HHLA 5JIWA 4GA8A 4IOTA 4NJIA 3TWAA 2YJQA 3F7JA 3C2OA 3RLUA 1W9PA 3IARA 1SJDA 2PSNA 3IGUA 5C2GA 4JKMA 1V0NA 1R3SA 3W1LA 2FHBA 4M51A 3C86A 3NPUA 1GOOA 3W83A 3KRSA 1VZWA 1ZHAA 1AW1A 3GAYA 2VENA 2P76A 4H4YA 2WZIA 3IACA 3GHTA 4AB4A 3F4CA 1E6PA 1BF2A 1EF3A 1CGVA 2PAJA 4AHQA 3KOXA 3WSUA 3SCSA 1YW1A 4IIFA 4AXNA 2Y5JA 1M9HA 1E4IA 2ZC8A 3Q6JA 4G6CA 4QRNA 5H8PA 4E4UA 1OCNA 4KH2A 4H7ZA 3GHRA 4DJFD 2ONEA 5CBIA 3TXVA 3VOGA 3B06A 1LZOA 1JCJA 2JEQA 2CLFA 1EXPA 2EKGA 3NCOA 1HKKA 3E38A 3AMGA 4F9JA 2JF7A 3ONCA 2ZX7A 2C7FA 1D3GA 4P7OA 2DZBA 2WM0A 3DI1A 2VRQA 3RGTA 3L65A 1KFKA 2A1YA 1FWBC 4O8RA 3XISA 2IKGA 3ID7A 1KC7A 1FEBA 2CC0A 2KAUC 2DH2A 2WYSA 4UCGA 4C6KA 1X6UA 4MLRA 3M0KA 4MZ1A 4S3GA 1UD3A 5BRBA 1OYCA 4KPRA 3VNKA 3UERA 5HR6A 2NVAA 4JR5A 3RHGA 4J57A 1CX9A 1RY8A 4P8VA 1GYNA 3C2VA 1YQ2A 3HN3A 1RK5A 4WGXA 3GM8A 3EDKA 1EC9A 3SFWA 3TJIA 1LG2A 1TMHA 3PUGA 4Q8OA 3QC0A 4X0NA 4PRWA 1EJRC 1YDNA 1V03A 1DTUA 2E3ZA 2XVNA 1EEXA 2CLKA 4ADUA 3SQLA 4F2BA 3GH5A 3U9IA 5GNZA 4M19A 5HMFA 3LEPA 4NXSA 1V3HA 3O0HA 4BV6A 4CQDA 4Q7IA 3KHDA 3JZEA 1KBIA 2V9DA 3TW7A 3RN6A 3EOOA 2XGBA 3O06A 1TJPA 1OJTA 1NWUA 1BXNA 3U0HA 3MV11 1NHSA 3QKZA 1FKXA 3MO7A 3BICA 3HGOA 3GNDA 4U2ZA 3W7GA 4IMEA 4BJHA 5E6ZA 2OGJA 2A3LA 1V6YA 3OOQA 2DSZA 4L1GA 1GQNA 4LAMA 1QXLA 3FHAA 3QV8A 3HPSA 4AX7A 3OC4A 4TMBA 2VQUA 2A6NA 4G9PA 4A05A 3URNA 2NLYA 3LHYA 3IAPA 1CPUA 4NZCA 4FO4A 3AS0A 4WQ6A 5LHFA 5DLCA 1J5SA 3W1PA 4FF5A 5JCIA 3W7NA 3MCMA 1YXDA 2D23A 4UNIA 2A0NA 3ITOA 4LIIA 1M01A 1Q5MA 2YCIX 5I00A 1QHOA 3KXQA 4I9MA 1UR9A 2Y8UA 4OE7A 1UB3A 2P8BA 4GPNA 1GOQA 1PS9A 1UKQA 2HNHA 4MYXA 3PR2A 4FOJA 3REQA 2GDUA 2Z1KA 3V35A 2FMOA 4HHHA 5BNKA 4F3HA 2CBUA 5LKYA 2BHYA 2JK6A 4GZIA 2XFRA 4DXVA 2JE8A 2NQLA 2YA2A 3RG6A 2IUZA 4LBUA 1PKLA 2BVWA 3R43A 4LUIA 3WLOA 1TRIA 1O95A 1XW8A 4XZNX 3TTYA 3TX9A 2BZNA 2QT3A 5CKSA 1FXQA 2RABA 4LCQA 3UZZA 3GDLA 4K68A 3R58A 3W7HA 2DT1A 3UR5A 1GRHA 2WANA 4RE3A 1PJ9A 1E73M 3KLJA 2CEQA 4MB5A 3W1AA 2Y7EA 3W7EA 1A3HA 3LXAA 2X0SA 3P5ZA 2A3HA 4JS3A 5E9XA 1DWIM 1JRCA 5A6BA 1O1ZA 2Q8ZA 4H00A 1WUEA 2YB4A 5FF3A 3L2IA 1IT7A 3QFAA 4BK9A 5LA2A 1OT2A 1JRPA 1GKPA 2ACSA 1LRNA 1SW3A 1H2IA 3UWUA 4LS2A 1QAPA 2E1DA 4NNCA 4WXZA 4LAZA 1BTMA 2VC6A 4AU0A 4WDUA 3UJ2A 4PMJA 2DZTA 3C0QA 1JULA 2J74A 3RCYA 4UTTA 3B3DA 1SFSA 4ADTA 5K4ZA 1Y5WA 1XX1A 4K7YA 5CPOA 4XO7A 1STZA 5EFDA 4HNUA 4JQ3A 1KXTA 4RKAA 1JD7A 4FLRA 3URBA 4WXYA 5D04C 4MF4A 2WNZA 1HVQA 3EWBX 4IP7A 3VAVA 3ZLFA 4JDRA 3OGSA 3LXCA 1BWVA 4D72A 1VS1A 3U5YA 2GJRA 4QHRA 3CQKA 1SFLA 4CQBA 3OW1A 3VGBA 1QU4A 1OF8A 2HMCA 1NDWA 1A5SA 3TQKA 1FWSA 2CLEA 1XD1A 2DQXA 3MUXA 4FALA 5CEWA 2YVFA 2OODA 5ECVA 3IIVA 4ZSUA 1FHVA 1XLJA 3ZR4A 3YPIA 3UZ5A 2VZOA 1J2WA 4HK5A 1EC7A 3B8DA 3I7SA 3WLMA 4Z1BA 1WB0A 4C7GA 4B3ZA 4JNYA 2DPEA 4Y2WA 3TWBA 4HPHA 4JN7A 4NJGA 4IH3A 1O5XA 4AWEA 3CU2A 3QM3A 4W89A 4C90A 3IJIA 3DG3A 1DJIA 4PBFA 3W9ZA 5AHFA 2AAAA 1DV7A 4R34A 1B57A 1M53A 3E12A 2HVMA 3CZKA 3C3NA 1R87A 2C18A 3D46A 3DIPA 4MYAA 2B4GA 1H1NA 5HJXA 4U3AA 4EXQA 3BLPX 2PUZA 3PNZA 2B7NA 1XLAA 3GHSA 1FHLA 4U31A 2VOTA 4CQCA 1B4EA 2W54A 5AYBA 1XIHA 5A8QA 1H63A 3HM7A 2VGIA 3PSWA 4PCNA 2VX7A 3EMZA 4M7SA 3V5FA 2YDRA 3HPAA 3TFCA 5FKYA 2DP3A 2QDHA 1EGVA 4OOZA 1VRXA 1Q6GA 2HCVA 1ZXIC 3REQB 3WFZA 1WCGA 3WH9A 4DWSC 2ATMA 4PTVA 4C6BA 1FWDC 3K46A 4RNFA 2WJFA 1XL9A 4H04A 3IJ6A 1TCMA 4P8WA 4AVNA 5HOSA 3T6CA 1S1PA 5CZ0A 3LTYA 3RMEA 2Y89A 2JALA 2A85A 3KBJA 3CM4A 3ATYA 3E5PA 1OFOA 3PTMA 1KQZA 3SRKA 3W28A 3ABOA 4GVHA 1A3WA 4OBTA 5IOBA 2CZEA 3VIPA 6ALDA 2WZTA 1FO4A 1R3QA 1Q85A 3SSJA 4XKYA 2XFYA 4Z2JA 2ABAA 1BQGA 3CHFA 1Q7MA 3QOKA 2ZZ2A 2PA6A 3SJNA 4G7EA 1BWCA 1MRQA 3QPEA 5BWAA 4ZA0A 4DBUA 4GO9A 3B0UX 4GNKB 2YCKX 3GFXA 1ITXA 2P3ZA 1QR7A 2UBPC 4M3PA 3MZ2A 3OYXA 2Z00A 3G2GA 3TQPA 3C0SA 4DVOA 5GJNA 3AYTA 4QE4A 1NELA 2X8GA 3DYMA 2QGYA 2PWEA 2YXOA 4LRSA 5E6YA 2VJXA 4NXKA 2FTYA 2W62A 1UUQA 3MWCA 1MW3A 3K5XA 3WDPP 3ZZ1A 4DWSD 3PBYA 3OGVA 3S9IA 1B9ZA 1N2VA 4XVEA 3JW7A 5HMEA 3ITLA 5A8PA 3RU6A 1O6IA 1GXFA 1F5ZA 1EDGA 4AZCB 3N2MA 3VKKA 1OC5A 3M5ZA 2ACRA 4LC6A 3G3MA 2A3CA 2VZVA 1BYBA 3P2VA 1XSKA 1MUCA 3AJXA 3PFRA 2OQLA 4DJDD 2EQDA 3ARXA 2OZ3A 2VUNA 3ABQA 2Y8VA 3URQA 1BGAA 3WBYA 4P7QA 3TQVA 5J8LA 1UUOA 2GOUA 3IUHA 1XIIA 1UP2A 1UR2A 4IUOA 1DJWA 4PUMA 3G5EA 1SM9A 4QLKA 4FXFA 3A24A 1XJBA 2WSKA 3WQ6A 3NQ8A 4AWSA 5EMKA 3NSNA 2YXXA 1POKA 1R2TA 4KCTA 2BG5A 2DSWA 8XIAA 3NQDA 1N61C 3MBFA 3ZT5A 3CZLA 2PGWA 1UIOA 1BSIA 2QJJA 4W7VA 3H4KA 1WDPA 2E1WA 1V59A 4QXIA 1FWWA 2J25A 4NJHA 1H7OA 1S2TA 3A6OA 2EQ9A 2G3FA 1BVNP 1DNCA 1QASA 4GJ1A 2BLEA 2D20A 5DCEA 2P0OA 3EB3A 3THQA 5DMNA 2OYKA 3E3HA 4AC1X 3FAWA 2E5CA 3T0BA 5G5IA 1K8CA 3WLPA 1OJXA 3BAYA 4ZSTA 3RK8A 1GYMA 4O0QA 4IPJA 1R8LA 4ZMGA 2E0PA 1KW1A 2E8ZA 1UYQA 1TPDA 2HSAA 3C2YA 1VBJA 3NVDA 1TE6A 4IL2A 5IFPA 1QNOA 2NSOA 3HG2A 5EMJA 1D3CA 1W3TA 3QR3A 5DANA 4L65A 3R94A 4BQ5A 1SPQA 4PMXA 3VZXA 2VO5A 3NQCA 3PWAA 4E8DA 1MFVA 3BW4A 5DMLA 3BO9A 3A7RA 4DO6A 4KWSA 2NX3A 2AAQA 4CQ8A 3EEZA 3TC7A 9CGTA 2YYUA 2XPKA 2GRTA 4B3KA 3QGKC 4YMZA 3CTTA 4WX2A 2PDNA 1K6WA 4RNHA 3OPSA 5IFTA 3FEQA 4DB7A 3C3UA 3E49A 4G7EB 4J2MA 3WIJA 4M82A 1GERA 3GAKA 3CWNA 3TLLA 5HNNA 2BY1A 2V2HA 4R53A 2OQHA 1ZTVA 4AZHA 3V1PA 2QF8A 3M6DA 1UR0A 1THFD 3E0IA 3UWQA 4E4FA 4UFMA 4L9XA 4QEHA 5U25A 3LGDA 2GK1A 3BGGA 2FGBA 2ZC1A 4HN4A 1I0BA 3ZJ8A 3NURA 3BG5A 4V27A 2WMGA 1EBHA 3QY6A 4UTWA 3TR2A 2PP0A 5HMDA 3CHVA 1S3HA 2PTWA 3TP4A 4H9VA 3DH7A 3SECA 2X30A 4L4LA 4H4SA 3ARZA 3ES8A 2XM2A 3LHTA 4HTYA 1MXGA 2H3BA 3BOXA 1P0KA 2PBGA 3TW6A 4GC4A 4PGLA 5EYWA 2BHUA 1AJ0A 2HDJA 4WY0F 1PYMA 4J7RA 1CBGA 3HBLA 2Y5SA 1XLMA 1R9YA 4ZE4A 2GGGA 1M1BA 2O4QA 4FS9A 2EO7A 1W5MA 2G0WA 5HATA 1QHZA 3WBAA 1NM9A 4QAWA 4C6LA 2QAEA 3HG3A 1LM1A 3EANA 5HPCA 3WD3A 2PLKA 3S5NA 4KCVA 1I2PA 3DGZA 1FBAA 3UNTA 1MI3A 3PWGA 1E6XM 1Q6OA 1XBXA 1X8CA 4CN6A 1UWAA 4NX5A 3KCLA 1XFCA 1EOKA 2PGRA 3URAA 2GYIA 3PPCA 2IPGA 5CSYA 1E0UA 3F4NA 4UZUA 3WLQA 1EYEA 3OG2A 3AHXA 4IGSA 2D24A 3H54A 1EUAA 1EDQA 1E1FA 3GR4A 2ZX9A 3HV9A 3VOCA 3CZEA 4LRTA 2R1PA 4MWAD 2W0UA 4FLQA 5A2CA 2PS2A 2HVOA 1F2JA 1RCQA 4ORIA 6TIMA 1EZ2A 4R7WA 3C8FA 2QJNA 2ZXAA 3EKZA 2ZUVA 3R89A 2WC4A 4O13A 4I7UA 4FR1A 1PHQA 4GZ7A 3PG6A 1W31A 4PFMA 1TJ2A 3GKFA 1GPWA 2D73A 2ON3A 1WYGA 3RJXA 1FH8A 1ITQA 3S83A 4D9PA 3AJ7A 1O1HA 1AA1B 4BQ3A 3M64A 4H2CA 5I24A 3KM8A 3VE9A 4O0ZA 3MC5A 4JTQA 3UXIA 1OEPA 1J0KA 1R0MA 1XDLA 3GVRA 4ZQCA 1IEIA 5KZDA 1Y0EA 1W91A 4AY1A 3QR0A 4GKTA 4O52A 3SGGA 3VTRA 2OKTA 4HCLA 1XKJA 3UZJA 1BSLA 2R8WA 2Z26A 3AIQA 1CLXA 3NQ6A 1W9BM 2PDIA 1ICPA 1HO1A 3FOKA 5IDZA 4Q22A 1V0KA 3UG8A 4FX8A 3B9NA 3K13A 5E1QA 3RNDA 1UKPA 3TW9A 1QHPA 1BKHA 5CJNA 3S42A 4ZQPA 4IWWA 2GDVA 3SCWA 2E40A 4CEXC 2ZUUA 4WR3A 1PBGA 1U1UA 4GI8A 4AUBA 3UXKA 3QFWA 4EQXA 1LL7A 4PN2A 1FH9A 2A7PA 3H2NA 4HZ6A 4O1EA 2PDMA 1P1MA 4K8HA 2E9MA 1NSJA 2VVNA 3S9YA 4J3ZA 3T1GA 4MDPA 4HMCA 1X7IA 2R1MA 4ZR8A 2Z6IA 3PBVA 3V7PA 3UCDA 2FH6A 1ZGDA 3RILA 3AIEA 4DXKA 2YCLA 5CC3A 1HVXA 5EFFA 2VGGA 1RK6A 1X98A 2CFFA 4FB7A 1GTEA 2B31A 1ONFA 3AISA 1H09A 4H4XA 4KRUA 3MYPA 1PX3A 4WRHA 4S3BA 5C9WA 4E4PA 1L8NA 3VOFA 2BVYA 5AC5A 4QS6A 4HNCA 3GQYA 3AZSA 4WY0A 3SO7A 4UXDA 4PZVA 1BVZA 2QYGA 1IR2A 1KGUA 4PUKA 5A8NA 3I7QA 2G3MA 1ISZA 3EBVA 2EF9A 3O6AA 3ALFA 3NXLA 2GFTA 1EL3A 3LQGA 4RW5A 4U28A 4CD4A 3DGBA 1E9ZB 1DORA 1LRQA 2O0TA 1XXXA 4BKNA 5CH9A 1OFRA 3IJ7A 4ZQRA 2EPHA 1IIGA 4HSNA 1M7PA 4TVYA 3DHPA 3FJ6A 2E25A 3ARYA 3SFKA 1AW2A 4JFUA 3PZMA 4TV5A 3HPFA 2PF0A 2QJIA 2ZKMX 3HJZA 4DZ5A 1I4NA 4NHVA 3I65A 1OVDA 4QJ5B 3CUIA 1DHPA 4S1FA 1IZKA 4JCMA 5M03A 4KWVA 1X2GA 3GE7A 2NXIA 2OU4A 1AUSL 4R7OA 3VNDA 2XTKA 2XVLA 1W1ZA 3LERA 4GY7A 1JDAA 1UA7A 3IANA 3ANYA 4AWUA 1GVEA 3M9YA 5JQ9A 1RA0A 4OFCA 4QFUA 2DVXA 5AYIA 2V6OA 3CGEA 1W1YA 5BWFA 5GJMA 3CLWA 3E2RA 2GVLA 1J6PA 1TR1A 2FJUB 1JAKA 1G0CA 4OZOA 3SEPA 1J12A 2NUYA 3CMJA 2ADAA 2NV2A 1MZRA 3NL5A 3IJDA 1VEMA 3WFAA 3R4IA 2OWCA 3MHFA 1TZZA 1DWHM 2HWGA 4CNPA 2CU0A 1W1VA 4Q4RA 3TSDA 4TTUA 2HE5A 1P48A 2QUNA 3IGXA 2V81A 4A2SA 8TIMA 1M6IA 2OT1A 4KWUA 5FJTA 1KXQA 1AODA 5JXQA 1KCZA 1VP5A 1LVLA 3BAKA 5TBOA 1CWYA 1T41A 2X2GA 1UA3A 4JTKA 1MEIA 1EB3A 2ZE0A 4R9XA 4P7LA 4G7FA 5H8UA 2DDXA 4XSLA 4A6GA 1W8GA 1FDYA 1V3LA 4QDMA 3S2JA 4A3HA 3LHZA 3W02A 4JIIX 4O16A 2IMRA 1VBGA 2ZOXA 3LTPA 4L9ZA 1ONEA 4ZO9A 2W5FA 3UGVA 1YRRA 2WSYA 3S1GA 1DXLA 1TIMA 3A21A 5LNWA 1XC4A 3TR9A 5HNTA 3MMDA 5CPSA 2WC7A 2WBKA 4KWWA 4US5D 3A9BA 4K37A 4E8GA 3DX5A 2AQVA 4WDXA 3EX2A 1WAUA 3TNOA 3ZJ7A 3NUKA 4L56A 4NG3A 4D6EA 4CQ9A 3B4YA 5DXYA 5AC4A 1V7YA 4AF0B 2X1TA 4H4RA 3BXWA 2YDQA 2PRLA 3VIJA 2YCLB 1PVNA 3MKCA 4I7VA 5J04A 3LMZA 1E70M 4M1RA 3KHJA 3BLLA 4RE0A 3BE7A 1DIKA 3N6HA 3U2OA 2CIPA 2ISSA 2F6KA 5IXEA 4GIEA 2XGIA 4FEZA 4HKPA 2FVKA 2NUWA 3WNNA 3W7QA 2V0TA 3VO0A 1SZGA 1V0MA 3PULA 4QSHA 4C60A 1XS2A 1MYRA 3N6JA 3MI2A 2VP8A 4WY0B 3LPFA 3SCOA 4ILSA 2V2CA 4U2YA 4FOKA 2BC1A 3B4UA 3MBDA 2PCEA 1EA9C 3TLQA 3PM6A 3QHMA 3AS1A 1V3JA 3LG3A 3HMCA 2DQWA 1IZCA 5AC8A 3TYDA 4JFWA 4NU7A 3AHZA 3WFLA 1H5YA 4KCWA 3WF2A 3S2CA 1Z8AA 2J88A 4POCA 4PMVA 5D8WA 5GJPA 3WLIA 1ZCOA 1JQVA 3IUIA 2Y6ZA 3VMOA 3UD6A 2V3BA 3HV8A 3HGJA 1WP6A 2ZVIA 3D5HA 3RM8A 3M0XA 3ZLGA 1KM4A 2Q3RA 4MNMA 3N04A 4ONVA 4EF8A 3IS4A 3W24A 5LIWX 3LCGA 1XIBA 4HMDA 3QPYA 4E5TA 3E2QA 3M7WA 1SSGA 4LU0A 4QBXA 4DQWA 4MJ4A 1MFUA 2I7GA 2Y7GA 3VNIA 1IEQA 2J66A 4N4QA 3GIPA 2EEXA 2ZXQA 4IJRA 1KGWA 1TRDA 5EGRA 4J3SA 5HPOA 1BWLA 4EPEC 1JZ7A 2PRMA 1PCKA 4XZLX 1GYLA 1PDYA 4YWOA 3M1ZA 4GC3A 4GHRA 1TVLA 1ONRA 1PTDA 1GQLA 5LXXA 4IFKA 4S3JA 1CYGA 3LXBA 5LNVA 4MPKA 2UWFA 1TPFA 2POTA 4Y9AA 1YNQA 4Z1CA 3HQNA 1OZQA 3V0UA 5LGZA 1CENA 1VLWA 2CBVA 3UY7A 3N13A 3OEXA 1FDZA 3B8WA 4HU0A 1SQ7A 4HMNA 4NAEA 4Q8WA 2NW0A 1LQ2A 5K9CA 1X6LA 2I17A 3WELA 4IICA 3GC2A 4CGTA 3QHNA 1PZ0A 3VILA 3WNPA 3RX3A 1JDEA 3HJEA 3ZT6A 1FHUA 1BXBA 3LQLA 2WPEA 3G0XA 4ZXLA 4L6HA 5I0DA 3L5LA 4HHPA 3PG8A 1FFRA 3AU2A 1ZJAA 3KBMA 4I5UA 2ACQA 4X60A 4QCFA 3S2MA 1RH9A 1AFSA 3OHMB 3DUGA 2C16A 4EMJA 5C7HA 3E0WA 4AAJA 3QSTA 1PB0A 2V3EA 1TPWA 4B9YA 5C0QA 2A6LA 3UCQA 4D6JA 3BMWA 2QCFA 2VFFA 4HOZA 4IGNA 4GQ0A 3CASA 3W70A 3QW3A 4JCLA 1BFNA 7ODCA 5TF0A 1MWOA 4K36A 4JTJA 3W29A 1S7MA 3MU7A 4S3FA 4B4FA 2ZXDA 2AAMA 3MDWA 4W85A 3K1GA 2ZVRA 1BXCA 1ICQA 3FYOA 1TPH1 2WBGA 2C1HA 2PC8A 3JU2A 3N6QA 4QM1A 1FRBA 4HZ7A 2FJKA 4W5ZA 2G5WA 5CSUA 3NVWB 1FEAA 4V1YA 1HP5A 2J27A 1BPLB 5DX7A 1LF1A 1ZAIA 2Q8LA 3AXMA 3A64A 3W6LA 2RJGA 1QO2A 4JGDA 1SO3A 3W6YA 1M7XA 1UR4A 4QROA 2C6QA 1JI2A 3F5JA 1I75A 3H7UA 3RM9A 2W3RA 4W7WA 1RALA 1ALDA 2HQMA 4HYWA 1P0EA 1UMLA 2DZUA 2DIJA 2V5JA 4PRRA 1K3UA 1CTNA 1RP9A 2PLCA 5CC6A 2MANA 3P8IA 5CPNA 1KQYA 1W1PA 1VIZA 5GQBA 1L6GA 2YXGA 4MKNA 3DFOA 4GK8A 1ISYA 3QSRA 1JZ6A 5F1UA 1G69A 3ZWSA 1Z32X 1XYMA 4A3QA 5HQEA 4KCUA 3HF3A 3NVTA 3MWAA 1HG3A 4A29A 3HQ1A 1VF8A 2EHHA 3WQFA 4WJXA 3PUDA 1ADOA 8CGTA 3H55A 4Z1AA 4JQ4A 3HQOA 1ESWA 4EAYA 1TV4A 4NAFA 4E2OA 4WSJA 1XV8A 3R8HA 2GPTA 3NM3A 2V2DA 1JR1A 1QNPA 1MW1A 2BODX 2WJZA 3LRMA 4FLSA 1XRSA 5CLWA 2WBAA 1JZ5A 1IXQA 2YCJA 4ZOAA 4KQNA 2QCMA 4ZB5A 3CB8A 1UKTA 3TN3A 5C55A 4W7UA 4F0MA 4JX4A 4AX6A 1X2HA 4LB3A 4P61A 4IFKB 3TCSA 4NZ5A 1YMYA 2CW6A 1L2QA 3H53A 4AEEA 1LOQA 3VIOA 2DUAA 1JXKA 1NOWA 1GGOA 2ISWA 4LY8A 3W2NA 1XH1A 4V28A 4KETA 3VINA 4RDVA 4IUGA 4AIEA 1EP1A 1DWGM 1XWYA 4NAEB 1LBMA 4OBRA 2XFFA 5D09A 2PGFA 2VWSA 2GGHA 3MMTA 1LDCA 3TXZA 5ABEA 1A5KC 4HPJA 1AJZA 4H4QA 4A8LA 2XVPA 1VYPX 1OK4A 3SUSA 3K2GA 3NQEA 4R9OA 4Q8NA 4UTIA 3L2LA 3NGJA 3FV9A 4V1XA 3U4FA 4JTAA 1S1RA 3ZR5A 2ZUWA 4IGMA 5I23A 3QW4B 2IS7A 2GVEA 2QPXA 4YWSA 3NJ3A 1VH7A 4S3DA 4IQDA 3UW6A 3OJGA 5F4XA 3EDDA 2V82A 2CPUA 2VOMA 3LX9A 3FNDA 4B90A 5DBUA 2QS8A 1KV5A 4LEQA 3LBMA 1XIDA 2H6RA 5H2ZA 2QCHA 4FX9A 2CBJA 2C3CA 3H4XA 2W4XA 3R8GA 3VCRA 3W22A 5A1AA 1KCLA 3ITTA 3PBMA 4WD0A 4FNSA 3CL8A 3L7RA 1UJQA 3W88A 1KRBC 3E96A 1NTHA 1W2PA 3WJZA 2WKJA 3KX6A 1QOPA 1XLFA 4XUYA 1C9WA 3UG5A 5CG0A 3DBPA 1QWKA 3R13A 3W01A 3ZVHA 4PCPA 3POHA 3SI9A 4Z2GA 2A4AA 3PS7A 1ZLPA 3SDOA 3IRSA 5D4YA 3KBWA 5FAJA 1TPUA 2HTMA 4JEQA 4ACZA 5FJPA 1GKRA 3LMYA 1MW0A 5A2BA 1H7NA 2Q8XA 2WPGA 2J7FA 1PIIA 1QK0A 1X1OA 2VI0A 2TPRA 1B9BA 3T81A 1PDZA 5LXEA 3SRFA 1EBDA 4C6PA 3TEVA 2J7HA 4B3LA 2RDWA 1IQ8A 3DEQA 3PNUA 1DKWA 3G6MA 2J8GA 4NP7A 2QDDA 4ZO6A 5IDIA 3O0KA 3OZMA 3B0XA 4DNAA 3C56A 1VGAA 3TTSA 4XWUA 2Y62A 1KGXA 3RXZA 2Y7FA 3FJLA 4IX0A 5BROA 2P10A 4E0CA 3NO5A 2QVHA 3DC0A 4NAFB 3UBPC 5G1MA 2XJ7A 4GIAA 3ES7A 7XIMA 1DHKA 1Z41A 4OWGA 1CW2A 2VC9A 2PTDA 5BW6A 4FMVA 1GVOA 2CERA 2AGKA 1Q6RA 5C9ZA 1SB3B 1UZDA 2MUCA 4JQAA 4JX5A 1TTIA 4H3DA 1YNYA 1K1DA 1E9YB 3KS6A 2CFYA 2BP1A 3PJTA 2OOGA 3PC0A 4JIRA 3KOFA 4A8RA 3RIKA 2BHZA 2VFHA 3MHUA 1B5TA 5HQLA 3SGUA 1SMDA 3FYPA 1JUEA 3E74A 4AZIA 1H41A 4LPCA 3I68A 3APYA 2DW7A 3LD5A 1FH7A 3WK1A 5DRCA 2EPKX 2OWWA 4XZIA 2ZYFA 1KKRA 1G4EA 4XAFA 4GH3A 1G9HA 1K8ZA 3GC5A 4UTFA 1CNVA 3NZQA 2HROA 2XFWA 1XBVA 3MY9A 1KXHA 5ABTA 1F3EA 5I3FA 4PB4A 1XDIA 5CXPA 3UPBA 1FECA 1OABA 4HYRA 5FS9A 3PAJA 2UY4A 3R0KA 1R3YA 3P14A 2FB2A 4D6GA 4NX0A 5I3IA 1FIQB 1XLLA 2JBMA 4WK9A 3ZOAA 3FA5A 2J47A 4MKVA 2ZE3A 3NTYA 1IF2A 1AZ1A 2QUMA 1V5XA 3KRBA 2XINA 2OEKA 1QBBA 3LHVA 3RNMA 3SCPA 5JCKA 4F40A 9XIAA 5IHRA 1Q6DA 2J78A 3G1AA 4ERIA 2GLKA 3CO8A 2VMFA 1UOZA 4FIQA 2VRJA 2HISA 2QEZA 1XLBA 3I3BA 1V97A 4KGLA 5L6UA 2PDCA 4QE1A 5FJJA 5AC6A 2A3BA 4HIBA 2J6XA 4UR7A 3I4EA 4DBDA 4MSSA 3RPTA 2VNCA 2D2JA 5H8MA 4H8NA 1NQKA 3TC6A 4ACZB 2WCSA 4UNLA 3SCNA 1MO9A 2NWSA 1NPXA 3G8EA 3KOZA 2VXNA 1W1IE 3U4AA 1B31A 3BLFA 2NT1A 1XSIA 2PDHA 4INFA 4NT0A 1GCYA 3LOTA 4CU8A 1G6CA 1XKYA 5D2XA 4GCXA 1WDDA 3G0UA 3KWSA 4HPGA 3ZJ6A 1W3IA 5HA7A 1BRLB 1FVPA 1C90A 3W73A 2XVGA 3WLNA 3W07A 3WY1A 4MAZA 1VRDA 2HEJA 3DKLA 5JCMA 4OUEA 1N5XA 4YVVA 1X7FA 5BRPA 1EX1A 3NG3A 4S3KA 2TAAA 3ZO9A 4ZZ9A 4D8LA 4J28A 4Q4QA 2H8ZA 4JFVA 3PZGA 3FXGA 3A3XA 1XG3A 1POJA 2Z1WA 2FGLA 3O8AA 3LSCA 4L1XA 3NQ2A 2XVKA 4QITA 1KR1A 5D05A 3QQ1A 3WNMA 2GOKA 3CUFA 1ECQA 2OO6A 1A5BA 1C91A 1E0TA 2O9RA 2I5QA 4TR9A 2G41A 2IXUA 3VKDA 3KUMA 1Q7ZA 1RXOB 3INPA 3LYEA 4GGBA 4PUDA 5FSEC 4FP1A 3CQHA 2GR3A 3ARTA 4QLLA 4C91A 3M47A 2I9UA 4O0KA 4DEFA 5I3HA 3OBKA 1UHVA 3OU8A 3BZGA 2BY0A 3CZJA 4YPJA 2O55A 4Y8FA 3CUZA 3CAVA 2PD9A 3NZ1A 3WDHA 5A6KA 4H8HA 4CD8A 3PZQA 4XAYA 3LV5A 1VJSA 4O14A 4O19A 2WOIA 3GSMA 4GIYA 1ZL1A 4BURA 1S2CA 3EX3A 5AYZA 4F0LA 3B05A 1KBLA 3T2PA 2EJ1A 1AH4A 1DXEA 1K9FA 1MO0A 2VR4A 4RCXA 4EX4A 1GREA 1F3WA 3VD9A 1WOAA 4PULA 1H51A 4JHMA 2HPMA 2XWEA 4YNGA 4YL2A 1BZLA 5JIPA 3TZNA 6REQA 4A3RA 5AZ1A 3VX0A 2ZRXA 1CCWB 3KDNA 1UUMA 1EH9A 3G3DA 5FACA 4NZJA 2JGQA 3ABXA 1TQXA 3WMSA 2PD5A 4P8UA 2BXZA 5C9RA 2PWGA 5A3HA 4LANA 2E6DA 4W93A 3MYOA 1GRGA 2CZVA 2WVVB 5I02A 2WCAA 1GVFA 4BQ2A 1ZK7A 1YQZA 3AUOA 3F1QA 4HB7A 1RLCL 2PF8A 1JDCA 4JBRA 3QJAA 5LIXX 1OFEA 1P6BA 3TQ0A 3S4TA 3SN0A 4GI6A 1KFEA 3IGSA 4A22A 1RBLA 5JUVA 4JY9A 1LOSA 2X7VA 1W17A 1CXLA 3BOFA 1LQAA 2WNWA 3BURA 2Z25A 2Z28A 1BEUA 1UWRA 3Q4DA 4UR8A 5HUPA 1VBHA 2ZRYA 2OQYA 1C93A 4DZHA 2Q71A 3BVJA 1RPKA 2ZIDA 3HIJA 4CNSA 3W1UA 5EBAA 2IPWA 1XD0A 4N9DA 3S5SA 3D3AA 5CC7A 2UY3A 4OVXA 4DF2A 3CQ0A 4ALDA 3HURA 1JEZA 3MUY1 3OZOA 1VEOA 1UPPA 5F4SA 2QQ6A 1LLZA 4I5XA 4P7NA 4A21A 4MY8A 2AL2B 1ADSA 4O1FA 1R6WA 3A12A 4H6EA 5AYYA 3OG3A 4XZHA 2Z1XA 1BAGA 3FK4A 1FP9A 3BSHA 3QV6A 3G1SA 5G1TA 1ZAHA 4V15A 1W1B1 3URHA 1SR9A 2GWNA 1B90A 5LZLA 5K3VA 1NOFA 3GD3A 3JR2A 4NL1A 1TREA 3M46A 2J77A 1P4CA 4UTJA 2AKMA 4Q4SA 2JEPA 4AHOA 3T78A 1GOKA 5FF2A 1FTXA 1W3LA 4HCHA 3GRSA 3CPGA 1Q2SA 1WUFA 1PWLA 1JPIA 3CUGA 1CT5A 2VFGA 1JNDA 3KL5A 3UR2A 3EPOA 2WMKA 1Y65A 3W2KA 2VT0A 3G1DA 3QZ6A 3BQ5A 3WQVA 3ITGA 3FW6A 1VR6A 1P5BA 3LLXA 2AMXA 4XKMA 3WN6A 2PDXA 3ATZA 3II4A 3C4UA 2GQWA 4F2TA 1QWGA 3GDTA 1LWJA 1TKKA 2XYLA 3OA3A 1F4HA 3OO2A 1V93A 1OB0A 3G1RA 1D2KA 3IC9A 4L4OA 1DP0A 4MB4A 6XIAA 3NSMA 1O94A 2YX0A 3S2NA 1VFFA 5AECA 4QE5A 3MSDA 3W1XA 4FNTA 1UH4A 2J7CA 1Q6QA 4CNOA 3I10A 3LV6A 4R33A 1LLWA 3VMNA 4YHGA 3SADA 3R7MA 4X3ZA 4MAVA 1JPDX 3TA6A 3NA8A 4CCDA 3WJSA 2JIEA 4DWSA 1XUUA 2O7SA 4O4WA 4DYJA 5DMYA 1SZNA 3WD4A 1PTGA 3TDFA 5KITA 3TUUA 1PCWA 2H3DA 1C9DA 1CLVA 3CV6A 4NNBA 3WYZA 6REQB 3I7RA 3KLKA 1W5NA 4B5SA 4UUIA 4NIRA 1OFBA 1KXVA 1ZU8A 5LHEA 2Z27A 1QFEA 3WQ5A 4DJDA 5MKGB 3BAXA 3N2OA 1WQ5A 1K03A 3MJYA 2AMGA 3R12A 2NQZA 4H19A 4XD4A 4WOQA 2NVKX 4Y7EA 4JFSA 1SR0A 4H83A 1Z42A 3LGEA 1YTKA 4Z2KA 3W3OA 2HK1A 1G1YA 2NVDA 3LPGA 5CZTA 1WNOA 1AQMA 3BPWA 3DYOA 3RJYA 2VC7A 3TOPA 5HANA 3LSBA 1F74A 4BEQA 3WL1A 3MT1A 1GQKA 5CZSA 4JPGA 3P3BA 2TMDA 2DVUA 2O9TA 3MV01 3WNKA 1K6AA 2CLOA 2O92A 1W54A 3BL3A 4YTUA 5M2FX 4UWMA 4AC7C 3CK5A 3NSXA 4KPLA 3VVGA 2R6OA 3THCA 1DTNA 1O66A 1TX0A 1VAHA 4EMWA 1M41A 1UWSA 2DT2A 3SUVA 1RCXB 2B81A 1EJUC 1OD8A 1HT6A 4FR6A 4C6MA 4QAIA 3J7HA 5F2IA 3VIKA 3GBEA 1RVGA 2CITA 3DJJA 1YDOA 3R07C 3VDAA 3HFTA 3UA3A 4XBJA 2QMJA 2GQ9A 2GVGA 3W53A 3IPWA 3RLGA 1VFSA 4KFPA 4TOQA 4TX9A 3ZWTA 1LT7A 2PDLA 4HD5A 1GVIA 1MDRA 4IJBA 3DFTA 3U7VA 1J18A 7PTDA 1H7RA 5TQLA 4GE8A 4N2YA 4WDWA 5I07A 3WQGA 3QTPA 2OO0A 3B9OA 4TUFA 5G5GB 4AIOA 4C1LA 5HINA 2QLYA 3CZ8A 4GBDA 2W6RA 3C52A 5HUOA 1S2WA 4J3WA 1PKMA 4L80A 4H41A 3VZYA 3KVJA 1FY6A 2ZTKA 1VIWA 2ZZ1A 4N7QA 4LWWA 2R9ZA 1F4AA 1E51A 3MSGA 1V6XA 1IT8A 1HGYA 3GZ3A 3ITCA 3GYCA 1DVJA 1XGZA 1U30A 3ARUA 1R9ZA 4KW2A 3RU8X 2YA0A 4BI7A 5A6AA 4WHBA 5I3GA 1O68A 3CYVA 1H3GA 4AZ5A 3W1NA 1W3JA 2VCCA 3CXOA 4GNJA 2DORA 3FY1A 1ZDLA 3B0YA 3IRDA 3MA8A 1PYFA 4HSHA 2FDMA 3GUGA 3EB2A 1KLZA 4PTMA 2ZX5A 5TNVA 5M1TA 3VIFA 4WCJA 3LCWA 3N11A 1SFTA 3B97A 4RXGA 4EQWA 4Z0SA 3ABRA 4LJ3A 5IM51 1Z3NA 3BLOA 1GK8A 4DPPA 3N9SA 2GDQA 3D9XA 1H0IA 1KRAC 3VD7A 3EAOA 4O12A 2E5BA 5ABHA 4OECA 2E67A 1SVDA 1V6WA 1V8EA 3RLVA 4DF1A 3SQSA 2Y0FA 3ANVA 2JK2A 4NI3A 4LOCA 2OMAA 3AMCA 1A80A 1WBHA 2WM1A 4QSFA 3W27A 1KM6A 4GFIA 4AHPA 2V3AA 2EPOA 1A5AA 1TA3B 4NEWA 4AMCA 2ZUTA 2J75A 1DQUA 3MI6A 1MRAA 4I8DA 3Q67A 5K4XA 4N02A 4EQSA 5EL1A 1YXYA 4UIOA 5LNUA 4MWAA 2GJNA 2PI6A 4GUFA 4IF2A 5MHBA 3A4WA 5B7ZA 3P67A 3PF3A 4XZWA 4O1CA 2D3NA 3I4KA 1S2AA 4GI4A 2ZX8A 1QI4A 3VX1A 3XIMA 2XGZA 4YHEA 1EQPA 3DFHA 4S23A 3CGDA 5C9UA 3SR7A 4CU6A 1V02A 3ARPA 3N18A 3SAZA 1BYDA 5D9PA 4ZE5A 4R85A 3M0ZA 2FZMA 2Z2AA 4EACA 3RO6A 4AY8A 1ZCCA 3GG0A 2G97A 4DZIA 3GRIA 1QW8A 1ZJHA 3S8HA 5JBFA 2A79A 1TG7A 2OVLA 3BSGA 3BOLA 1GONA 4DPQA 5CCZA 2Q09A 2L5HA 3ZSTA 3UWEA 2OLSA 3CUJA 3SM0A 5L9FA 2XIBA 3VZZA 4O1DA 3B8SA 1X1NA 3AXXA 3BZJA 5CSRA 4Q6JA 2J79A 3KLLA 3UJEA 1P6CA 3ERPA 1EOMA 4CNNA 1HO4A 1DJNA 1HIZA 1O60A 5D37A 4EK7A 1GJPA 1XIFA 2G95A 4DI8A 1RHCA 3LM3A 3WUGA 2NXHA 2F61A 3WD0A 1M68A 4J2PA 4GYKA 5FCZA 1KB3A 3A47A 3PUEA 4DJFC 2BDQA 2HBVA 5H91A 4JTGA 3CQIA 3Q58A 2O4MA 1WXJA 2I1OA 4KEMA 4I9AA 3L4XA 2HVNA 2BASA 3TN4A 1ICSA 3L2MA 2NPXA 1EIXA 1OG6A 3LBOA 1Q45A 2O9OA 1QVBA 2PTYA 3T0DA 2C1IA 1M7OA 2X05A 3B8IA 3W4RA 3TK7A 3SQPA 4EQRA 1VQZA 1K9EA 2CZ5A 3LZ5A 5D9MA 3QV7A 2QCGA 4C6JA 3SCTA 2JQXA 1XLKA 3IUDA 3PVFA 3DFNA 1SJAA 5HMSA 4J3XA 4P2VA 1IT0A 4MADA 4DBSA 2VFDA 1YXCA 4W87A 3AS3A 3W81A 4JTRA 1XM3A 2E9BA 2HNEA 1D7KA 5HAOA 3GDRA 4CLMA 1OIFA 4WJEA 1A5NC 2W92A 3S3GA 3W2MA 4K38A 5HDRA 1FFUC 4UTMA 1E0VA 4G56A 3MW7A 3VGGA 6ENLA 3VXGA 3BW2A 3CV2A 3M0LA 2CHNA 1I2NA 4IQLA 3GXDA 1OADA 3N15A 4BA0A 1ZKQA 4HU3A 3SURA 3NPXA 2PODA 2G37A 1IIHA 3MP5A 4W8LA 2VCBA 1X6NA 5BXPA 1LOLA 5T9CE 1A5MC 4D6FA 2EBNA 4NZ1A 4IIHA 4ZBCA 2C0AA 1V3IA 3NDYA 3WNLA 1CXEA 2P1FA 4GG9A 5E9AA 1NJJA 4J27A 1A0DA 2GJPA 1FX6A 3T55A 5F1VA 1F6KA 1TCDA 1W3HA 3JS3A 1WZKA 4Q8MA 3WUFA 5D2WA 5DMMA 4MY1A 1GT8A 3TJLA 4Q33A 3MUZ1 4MWAB 4R27A 3VOHA 4QISA 1GVQA 3STGA 3F5LA 1CXFA 2OCZA 4NY2A 2BS9A 5G1YA 1JROA 2X99A 1GPFA 2X1UA 3N3MA 1F61A 4L7ZA 3WBEA 2BTMA 2ZBTA 4GQBA 4XB3A 2GQ8A 3GTHA 1PTAA 1XPGA 5E70A 1GORA 3NQ7A 1HKWA 3AXKA 1ZY8A 3UYCA 1XRFA 3R5EA 3WF3A 4H9UA 4LF2A 1CGYA 1IZJA 1XLDA 3FYYA 2WW5A 4QG6A 3LPOA 4GKLA 3S1UA 1XYBA 2R1NA 2ZWYA 1JCYA 4L9YA 1KD0A 3GXMA 4WKFA 3POCA 4RUBA 3T8QA 2Y88A 2GSHA 1OSEA 4IPPA 1IHIA 1NDYA 4LA1A 1LLOA 3B9EA 3U48A 3FA3A 3W38A 1I2RA 1ZJIA 4IPIA 1XH0A 1J6OA 3U2CA 2DJXA 1LUCB 4HK6A 5D33A 2VC5A 2J4GA 3GG8A 1JUBA 1AL7A 4LYQA 1R3VA 4GO8A 1TWWA 3K4WA 4JZ5A 3H24A 4US5A 1UC4A 1F07A 2YW3A 4M6QA 5A6MA 3OA5A 2HE8A 1JGMA 3WKZA 4LEFA 4PODA 1M6JA 2OZ0A 2PZNA 1TV8A 3HB9A 4W86A 1XLHA 2ZRUA 4D8AA 4DNHA 4DUXA 3A7AA 4QQ3A 1KFLA 1OF6A 3D0CA 2V38A 2QCLA 4ROQA 2GQ3A 3LS9A 1QATA 4C6FA 1CIUA 4Z42C 4H4UA 3RCMA 1UROA 4M56A 2BV9A 4FF7A 2NT0A 4W4QA 1WDWA 3NGFA 5E0KA 4LS1A 1GOXA 2C71A 3GLCA 1BF6A 1F8WA 3QQWA 4R3UA 2YQUA 3H12A 3VM5A 1L0PA 1WDSA 2FZ8A 3EA1A 1IYXA 3I3DA 1LTDA 4NASA 2AGTA 2W27A 1A0CA 3PG9A 3E9AA 5RUBA 4HYVA 3AYVA 2CBIA 4S3EA 3VKBA 2ZX6A 1UW9A 1NFGA 3VGFA 2C19A 1KBKA 3G1VA 2IKHA 1GEQA 1KFWA 1UOKA 1JYWA 1TVNA 3EOLA 4JD4A 3W26A 1Q6CA 5CBBA 1U33A 1J79A 4Y9PA 4OGZA 4M0XA 1OT1A 2PGEA 3DHDA 2VDGA 2UY2A 3K1DA 2VM8A 3FLUA 1QPKA 2C15A 1OYBA 3IWPA 3O16A 1QCWA 1JYXA 3MO4A 5LA1A 3SJ3A 2ABBA 3F4DA 1OX6A 2VQTA 4BCEA 4UOQA 4GXWA 1GWJA 4F9DA 7ENLA 2C8NA 2XIMA 4C6OA 1LROA 1OK6A 4B2DA 1E9IA 1R30A 1M65A 2PDJA 3SIZA 2HPIA 3SUTA 1L2UA 2P88A 2Z24A 1XDMA 4AFYA 1UKSA 3WD2A 1I2OA 1PZ3A 1DIOA 4UQDA 4FIRA 3UNDA 2QR6A 2OX1A 4DHGA 1S39A 1R2SA 2PP3A 4ICCX 1JG9A 4WF7A 2Z7GA 3MTWA 3GU9A 4FNPA 5B80A 3R79A 3OB8A 3DOPA 1JOAA 1IV8A 3MVTA 3RR4A 5I3JA 3SIMA 2X09A 2WVTA 3HG5A 4Z2IA 3GUWA 3BLIA 3GB6A 3WQPA 4AZCA 4E8CA 4OOUA 3LCHA 4AXKA 4IGHA 4KBXA 4JDBA 5AN7A 1ZRQA 3W7OA 4K8EA 4S3CA 2I14A 3VYLA 5DT5A 4B5TA 1TMQA 2PDQA 3GDBA 1OC7A 3F5KA 1D7FA 1TPEA 1N62C 4ZOBA 1VPYA 1KM1A 3MI3A 1AZ2A 1G01A 1R47A 1WA3A 1OD0A 1PKYA 4DELA 4AWTA 1V4YA 2DU2A 4E38A 4DUOA 3ZR6A 4B16A 1R7OA 4H9MA 3H7RA 5I6SA 1WKEA 4PSRA 2A21A 2P50A 1Q63A 2JGYA 2V3FA 3N2XA 3T4WA 5A8MA 4PBEA 2PMQA 5TAOA 2Z2BA 5CGMA 3QY8A 1YNPA 1LBFA 4AIUA 1EJSC 5FL0A 3LM7A 3U6WA 2RJHA 1ISVA 4Y6GA 4RNIA 3EWUA 2Y5EA 3AWNA 1DBTA 2B7OA 4KGJA 2FKPA 5KTLA 1EXBA 2CKSA 2CHRA 2VFEA 3QF0A 3RLHA 3A4AA 3IGHX 5BXTA 3A22A 1ZP3A 3KFTA 1OIMA 6XIMA 5M5DA 5AVHA 2V5LA 5SWUA 4PB5A 4NRSA 3SN1A 3S5YA 4C6QA 2F8QA 1WDQA 3NDZA 4MUZA 3STEA 3N34A 1AK5A 3NZGA 1ZBKA 2EQ8A 2D22A 4GUGA 4S2BA 1EKOA 3ZSSA 2BNJA 3MSYA 5D9NA 4UCFA 4NUWA 3U2ZA 1PHWA 1J01A 2OG9A 1A4MA 4RNJA 3B9JB 1TV3A 3WLJA 1S2VA 3U57A 2QMKA 2E6FA 4AZ7A 4MJMA 3QVQA 4AD1A 4M5PA 1JUKA 3GU1A 4EVZA 4GVIA 4QDPA 4DJDC 2XIJA 2E3TA 1V7AA 3TAOA 4OT7A 1WZLA 1K4GA 3UR8A 6TAAA 3DJGX 3O3RA 1HKJA 1UR1A 3WUEA 3NL6A 4M6UA 3UVIA 4MMWA 1I8JA 4BHYA 2X0YA 3EDFA 2VYOA 4H9TA 1NHQA 1GRBA 1OFPA 3IEBA 4QIUA 4FK9A 4GRTA 1I9CB 4NEVA 3OYZA 1Q3NA 3ABZA 2WCGA 5FS6A 1GHSA 2Q6ZA 1UWTA 4C65A 3ZFHA 4KKXA 3FA4A 5JMUA 2WPFA 4LV4A 2PWDA 3OVRA 2NQ9A 1PPIA 5HWNA 4L1WA 2NQJA 4EXBA 3VD4A 2X1SA 3WQ4A 4H6QA 3W7DA 3NQMA 1OM0A 1VBUA 3E0LA 3TMLA 4CD7A 5CPLA 3AAMA 1QI0A 1JAEA 3OBAA 4HPNA 4KEZA 3CHDA 2XZ9A 3F2BA 4JICA 1HJXA 3H4WA 4R88A 2I56A 4WLCA 1ML1A 4G2DA 3M0HA 4U10A 1Z69A 4XBSA 1RD5A 1W9UA 3PY2A 1LQ0A 5EU9A 5G4HC 1J10A 1XYLA 3M5YA 1J0IA 2EG6A 1JFHA 3DDMA 3DERA 9XIMA 1HUVA 3PBGA 1TJ0A 3TYAA 3TFXA 3QFEA 1GG0A 3WF1A 3KZSA 4WSHA 2CLLA 3LCIA 4DUWA 5CLTA 2A3AA 4JTLA 1HL9A 2FQIA 3UXAA 4C6EA 3B0VC 1EHNA 1N5WC 1G5AA 1BWKA 1AVAA 1QNSA 3ARVA 2REQB 4ZTXA 4FNUA 4U5KA 4D1IA 3A5FA 1JRBA 1SZEA 2ALRA 4C6CA 2JIWA 1HXJA 2NWRA 1DJGA 4DXXA 3FHQA 3AMZA 3OIXA 5FD0A 3I6RA 4D1JA 1E3XA 3BGJA 4LS0A 2X8RA 3FAXA 3BK0A 4XVDA 1GESA 4LY4A 2VRKA 5I5RA 2H8XA 4M80A 2W9MA 2YL9A 1OFQA 1XGEA 1OWQA 3WLLA 5CQ1A 3W6MA 3WNOA 2JFEX 4G1KA 4JOMA 5I2UA 2E68A 5DO8A 5FESA 3T44A 2IQTA 4M52A 1KTCA 1OG0A 4ZCWA 2YOCA 4Q4KA 2NV1A 4EWND 4P5UA 2FZ9A 3UXLA 1YE6A 4O4VA 2VZUA 3QGVA 1B3ZA 1YBQA 1UR8A 5HBFA 1P1XA 1UMYA 4TX8A 2D0HA 2WQPA 3NFUA 5IRPA 3W84A 4K1GA 3NO3A 3MQTA 5HXMA 3GVGA 3NYZA 1L8PA 3EPNA 2P53A 5JCLA 3VIIA 5LNSA 2WMHA 3MS8A 4FX7A 4LSBA 4HNTA 2XSXA 2EPMX 3BWWA 5D38A 1HGWA 4GQRA 2H90A 1BG9A 3MDUA 1P6WA 4YVXA 3R10A 2WB5A 1AJ2A 4FPSA 2ATSA 1W3NA 4GVGA 1KRMA 4JXCA 3UF9A 2OLAA 1LORA 1V6TA 3MP4A 1DOSA 1GOWA 2CLMA 1S5WA 1N55A 3ELFA 1VHCA 3TROA 3MCOA 2O7QA 1FUYA 3QR1A 4DZAA 4PRTA 5AKQA 1H60A 1KRCC 2VDIA 3HPXA 4HZMA 1V79A 1SMAA 2NV9A 4ENLA 4I5RA 1CLKA 1XSJA 2DZWA 3N29A 3PN8A 3O1NA 3TV8A 3WJYA 1F8MA 3WK0A 2GVYA 4LCSA 3ARQA 1J0HA 3GW3A 3K8MA 3R2GA 4PMQA 1FHDA 4JY8A 3CBWA 4TO8A 3BARA 1JGIA 2GGIA 3NEHA 3BDKA 1DJHA 4WKAA 4PMOA 2JF6A 4MY9A 3BCJA 1FWTA 4LV9A 4OKDA 1AOGA 2WOVA 2J6VA 1TPVA 1RA5A 2YLAA 3PBUA 2NQ5A 2YVJA 1FCUA 2W3ZA 4JTFA 5A5WA 3ARSA 4MWAC 5CZJA 2QPUA 5D9OA 1JL8A 1F3XA 1VPXA 3CH0A 1FDJA 2JKPA 3BMXA 2VDHA 2VD8A 4Q4OA 1KKOA 1SFJA 4WDTA 2VL4A 3TKFA 4TV6A 5KZMA 4H7VA 1B3OA 4NYYA 4PUWA 3GVQA 4GUHA 3H4GA 1WKDA 4NQ1A 2WOQA 4DNMA 5TR3A 4I6KA 3EWYA 5C9XA 1DEDA 4XD6A 4GVFA 3CEPA 3E02A 3EWDA 1J2BA 4KFNA 3AMDA 1P7TA 1YDYA 4RDWA 3EXRA 3MUIA 3HZ3A 2XM1A 5KZEA 4HZ8A 4QNWA 2PPGA 2G50A 1I1XA 3AMKA 1A50A 3P6LA 3GZAA 1NF7A 1PXGA 4RPPA 2FVLA 1RLDA 1DJXA 3MPGA 3V5CA 5FSDC 4DBWA 1EGMA 3WQEA 4B9ZA 2CLPA 1Z7AA 4AD3A 1LBLA 3NEVA 3NOEA 2FHCA 3L12A 1EJTC 3GNNA 4ZVJA 5D8ZA 1PZ1A 2FVMA 3L67A 3A3HA 3H26A 2EQ6A 2QIWA 3E0FA 3CPRA 2CHOA 3KRZA 1W56A 3NL3A 1WV2A 1EC8A 5I06A 3DFPA 1XYCA 1TB3A 3TC3A 3WG6A 3AO0A 3QLDA 1RQEA 4LYKA 2TSYA 2WZHA 5HWMA 3T42A 2E4TA 2X40A 3CXBA 4HNNA 2FFIA 3BV7A 3CPUA 5K7JA 4H2HA 3N4FA 3VU2A 1VFTA 2EG7A 3WMBA 1X97A 5FA5A 2D69A 1GNXA 1Z44A 1YBQB 3T2QA 4W9TA 1MOKA 1LRTA 1GZJA 4X9SA 2OX4A 4H1ZA 4I9TA 4GH1A 3WLSA 2ZDRA 3HGSA 2IQDA 4KERA 3UWYA 2G3IA 2ZZ0A 2GUBA 1F7BA 2X42A 1FCVA 3NNTA 1WZMA 1E3ZA 3KAOA 5ENLA 3PWIA 3MJMA 3NQAA 1EX5A 1J96A 4KRTA 3TMQA 1JPMA 2E6YA 2QULA 3P80A 4UFKA 3DG7A 1YX1A 4Z2HA 1JCLA 3PZOA 5LIYX 3WEMA 2Z2UA 5CC5A 4ACYA 3O05A 5CPMA 4NSBA 1D8WA 3BV4A 2YDSA 3ZVIA 3TOYA 1Z48A 1DL3A 2DV0A 3PK7A 1XQKA 4KMQA 4C6DA 7REQA 2FPYA 2G8ZA 4CVWA 4LW7A 4LUTB 5BOEA 2OELA 1WOBA 3W87A 5E93A 4DJED 2RUSA 4QJ3B 3H21A 1ZPTA 4KEVA 4YTSA 4BQ4A 3BANA 3QRHA 4F4RA 3B8UA 3KVKA 4LNYA 3MSRA 2YIHA 2QUUA 3C0LA 1GG1A 4PUJA 2HBXA 3TYZA 1FKWA 1DJZA 3VNLA 4RE2A 3FJNA 1ZMDA 3NPWA 4F0HA 4AF0A 4YCOA 2YZRA 4HNVA 1DQXA 3T40A 3W1QA 5FMHA 5DN1A 3L4WA 1PAMA 2YKKA 2VEMA 3HW2A 1Q6EA 1GQJA 1K70A 3N4AA 1TWDA 1PO9A 2G3NA 4YTQA 5G2HA 1W5PA 3EOUA 1ZBWA 3GHUA 3S0CA 2WHJA 2VZTA 5TD4A 3TONA 1TZ9A 1YDVA 3B0PA 1P7TB 5IBXA 3AIBA 4J3TA 1GRFA 3LNMA 1EDTA 4H4ZA 1UIPA 1RQHA 5KVIA 3G22A 3WDRA 3LI0A 2Y2WA 2RGMA 1VQTA 2DEPA 2HXTA 3USZA 4EPBC 1OX4A 4NKCA 1NY1A 1MQPA 1R85A 4ZGYA 4E3TA 1F6PA 1FWFC 5JBDA 1JCMP 1H7XA 3AZTA 2CLIA 2P3EA 3GY1A 3PANA 1FP8A 2ZA2A 2UV8G 2R9RA 3GS6A 2I5IA 4JNZA 1TE1A 1WZAA 4O10A 3WK2A 1YTEA 4C6NA 1KLYA 1HP4A 3U8GA 1BLIA 1Q7QA 4AD2A 2P0IA 2E7FA 3CAWA 5AZ0A 2X8HA 3VKAA 2GUUA 1FA2A 1ITCA 2WV8A 3P0WA 2X16A 3KP0A 1YADA 4HTBA 5AHMA 5ABFB 1JDFA 1RM6B 4A8NA 1FCQA 3QMTA 4PYSA 4HNLA 1PIFA 3N1AA 3KL3A 2E5AA 2J9XA 1W1A1 1HNYA 3O63A 5AOUA 1WO2A 3M41A 4UTLA 3QZEA 4M81A 1QK2A 4YJ5A 3TCEA 2O9PA 4K2SA 3SRDA 3W7PA 4UNKA 2W61A 5FL1A 4XO6A 3W00A 4ZTYA 4HSOA 3I6EA 1HJUA 1O12A 4REQA 9RUBA 4RZ4A 1R86A 1ELSA 1RAKA 1J9YA 4M7TA 3EEGA 5EY5A 3COTA 4OUIA 4PC8A 7CGTA 3EA3A 2LLEA 2Y63A 4OV9A 1SO6A 4PBGA 4I90A 2OT0A 3T8LA 3W7LA 5BU6A 3AIWA 1H11A 7REQB 2F9RA