1FHVA

Crystal structure analysis of o-succinylbenzoate synthase from e. coli complexed with mg and osb
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
323
structure length
322
Chain Sequence
GSAMRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGREGWGEISPLPGFSQETWEEAQSVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILKLADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNPDYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQVRRWPGSTLPVVEVDALERLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activity in the enolase superfamily: structure of o-succinylbenzoate synthase from Escherichia coli in complex with Mg2+ and o-succinylbenzoate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords O-SUCCINYLBENZOATE SYNTHASE
total genus 106
structure length 322
sequence length 323
ec nomenclature ec 4.2.1.113: o-succinylbenzoate synthase.
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1fhvA01
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1fhvA02
3OP2A 3FYYA 4G7FA 4MMWA 4IZGA 2QVHA 4Z1YA 2AKMA 2HXUA 3PFRA 3TJIA 5IDZA 3VC5A 3CAWA 1PDYA 1TE6A 3TQPA 2DW6A 3EKGA 3FVDA 3DESA 3QPEA 2OKTA 2XGZA 3SSZA 4H19A 3H7VA 3I4KA 4M6UA 4ZA0A 4X2PA 4ROPA 3R25A 1EC8A 3OPSA 3H8AA 2OPJA 1ONEA 3QKEA 4EWJA 3RITA 3BOXA 4IP4A 2GGJA 2GL5A 4ZCWA 2OX4A 4JN8A 4K2SA 3IK4A 3OW1A 4DHGA 3T9PA 2DW7A 3DFHA 3DGBA 4MGGA 3MY9A 5FJRA 3ZVHB 3PWGA 4YWSA 3MSYA 2P8BA 4KT2A 1EC7A 1XPYA 4KWSA 2QJNA 2XSXA 4Z17A 4ENLA 3RR1A 2GGEA 2P3ZA 4GISA 3V3WA 4HYRA 4M0XA 2AL2A 2PSNA 2QDDA 2CHRA 1DTNA 2PCEA 3IJQA 3ENLA 3CK5A 2AL1A 4KPLA 3ES8A 3DG3A 3FV9A 5ENLA 2PU0A 1R0MA 2FKPA 3QN3A 3SN0A 3T6CA 4E4UA 2HNEA 3IJIA 4E8GA 4FP1A 3UJEA 4A3RA 3BJSA 4JN7A 2MUCA 2OLAA 2HZGA 2PGEA 3SQSA 3RO6A 2PA6A 2OFJA 3ZLGA 3K1GA 4IL0A 3PK7A 4HNCA 2QQ6A 3DFYA 3VCNA 3SN1A 3R1ZA 3MUCA 2PTWA 3ES7A 3DDMA 2MNRA 4MKSA 3MKCA 3MZNA 4GIRA 3BSMA 2AKZA 3JVAA 3MQTA 1SJCA 5FJOA 3VCCA 1L8PA 1JCTA 1F9CA 4IT1A 5FJTA 1SJAA 2P8CA 4IL2A 3TW9A 2PP0A 3I6EA 3R11A 1EBGA 2XH4A 2O56A 1ELSA 1P48A 3DEQA 1FHVA 3U4FA 1RVKA 4JHMA 3TWAA 1MDLA 2QJJA 1KD0A 2PP1A 3OTRA 5FJUA 2OQHA 2PGWA 1KKOA 3TOYA 3T4WA 3EEZA 4E5TA 3UCCA 3PWIA 3UJ2A 2GSHA 1YEYA 2PMQA 3CB3A 3H70A 3GY1A 3RGTA 2ZC8A 2OZ8A 3JW7A 4DN1A 3Q4DA 2XH7A 3SJNA 4HNLA 7ENLA 2P88A 1NELA 4GYPC 6ENLA 4GYPA 2NQLA 2PTXA 4GFIA 1TZZA 3N6JA 4DX3A 2PTYA 1NU5A 3NO1A 2PS2A 2POZA 3R0KA 3P93A 2OZTA 3CXOA 3OZMA 4H83A 3TCSA 3UXLA 4G8TA 2OG9A 3P0WA 3UJRA 4A35A 2OQYA 3SBFA 3ZVIA 3VA8A 3FXGA 4DYEA 3V5CA 1WUEA 4HCHA 3RRAA 2XH2A 2OO6A 3TTEA 4F4RA 1SJDA 3GD6A 2PPGA 4HCDA 1OEPA 1FHUA 3S47A 3FCPA 2OVLA 3KUMA 3UJFA 1BKHA 4DXKA 4K8GA 3S5SA 1MDRA 1P43A 3I6TA 1JDFA 3QLDA 1WUFA 3THUA 3VFCA 1EC9A 2GGHA 2PP3A 4J3ZA 1W6TA 3V4BA 2GGGA 4H1ZA 3STPA 3UCDA 3N4EA 3GC2A 2P0IA 3ZLFA 4GMEA 1BQGA 3CYJA 3P3BA 4GGHA 3Q45A 4HPNA 2GDQA 2HXTA 3D47A 1TKKA 1MRAA 2PODA 2I5QA 3U9IA 3OZYA 3DG7A 3VDGA 3TJ4A 3NXLA 3QTPA 3SN4A 3UJSA 3FJ4A 1JPMA 3CT2A 4E6MA 5BOEA 3TWBA 4E4FA 4IP5A 4HN8A 3RCYA 1JPDX 4H2HA 1ECQA 3N6HA 1EBHA 3VC6A 3B97A 3NZGA 2GGIA 2ONEA 2QGYA 1KCZA 1SJBA 2PU1A 3R0UA 1KKRA 3H12A 3DIPA 2AL2B 3JZUA 2QDEA 1XS2A 4IHCA 4K1WA 3MWCA 1E9IA 1PDZA 2ZADA 3UGVA 4DWDA 1IYXA 1MUCA 4A6GA 4FI4A 3GO2A 4GGBA 3IJLA 5EU9A 4KEMA 1R6WA 5FJPA 3T8QA 2XH0A 3NFUA 3D46A 3ZLHA 2QJMA 2PTZA 3DG6A 3ZVHA 3N4FA 4HCLA 2OZ3A 3UXKA 3DERA 2FYMA 3V5FA 3HPFA 2RDXA 3R10A 4J1OA 5J04A 1MNSA 5BOFA
chains in the Genus database with same CATH superfamily
2WMFA 5HANA 2OGJA 2QVHA 4UFMA 3V0UA 5H8MA 1BSIA 3T2QA 2E8YA 4V15A 3T09A 3GXFA 4LUTA 4HPHA 4YYFA 3NL6A 2XGZA 1TVNA 2ZICA 4S3CA 4XSMA 3MU7A 3OU8A 3WJSA 3W85A 2YA2A 5TD4A 3CASA 4BQ3A 3ANUA 3G6LA 1RHCA 3GDBA 4AZHA 2G3IA 2V2CA 4CQAA 2OYLA 4XZMX 2GGJA 4I7UA 4MFDA 4Z1BA 4N7QA 4DJFC 3QQ0A 3QY6A 2CDUA 1S38A 1CI1A 3FJLA 1RAKA 3CAVA 1US3A 3MMDA 5LGZA 1X2GA 1C92A 1BTMA 1AK5A 1J9YA 2ZX6A 4N9CA 4EQRA 3PZQA 1V4YA 1BWLA 3G1XA 1QHZA 2HK1A 1ZBCA 1KRCC 2EBNA 3FLUA 4HMDA 4Q32A 1UQZA 2VM8A 4C91A 2XWDA 2BCPA 2HRWA 3W75A 2R1MA 2UY3A 1HG3A 2KAUC 5DY2A 1Y5XA 5CC5A 2GQWA 3LXDA 3C0QA 3ID7A 4I6KA 3LCLA 1ZLPA 4HYRA 3BV4A 1WA3A 1MUWA 4QG8A 3KBVA 3UZYA 3O3RA 3BAYA 3CK5A 1I2PA 4AD3A 5FOOA 1HJUA 3QFEA 4PCNA 2XVPA 5EMYA 2G3MA 4BCEA 1S2WA 3P2VA 1UR9A 4PFMA 2V38A 3MSRA 2NW0A 2HNEA 4HNNA 2F2HA 4QCFA 1NFGA 1WKDA 5CAKA 2MUCA 3AIBA 3WJYA 3TN5A 2GZXA 4Q8PA 3UNDA 4GI9A 2YCJA 1K70A 1V02E 3JU2A 3NDYA 4HNCA 3SN1A 1KV8A 3QZ6A 4HN4A 3DK8A 2BS9A 4Q8UA 1OFEA 3SI9A 1PZ2A 3ABQA 1OIMA 3UA4A 5DRCA 2PDYA 3AWOA 2WMIA 3KHJA 1UA7A 1JI1A 3AMDA 5F4SA 3TXZA 3WK3A 4CN4A 1POKA 4O1BA 2H9AB 3OO2A 4HT3A 4MF4A 1MQPA 3O2LA 1E4NA 1P0DA 5F2LA 3HGOA 3FNDA 2Y7FA 5FEZA 3U4FA 4IG2B 3ARRA 3PPGA 4JTCA 3TP4A 3M0XA 2CLEA 4FO4A 5FJUA 3EEZA 3GD4A 1SW3A 1U1UA 2PRHA 2GSHA 1L6YA 1DIKA 4RDVA 1IZCA 2QEZA 2AAAA 6TIMA 2BMBA 3GBEA 3Q4DA 4HNLA 4H41A 2V63A 3I3BA 3SY8A 1SZRA 3P80A 3MUAA 3KXQA 2FDMA 3EBVA 1LBLA 3ZFHA 1VBJA 3TU9A 3AZTA 1SZNA 4HHPA 2BDQA 3P93A 4HPJA 3K8MA 3TCSA 1N60C 2Z1XA 5KSWA 4F2UA 1K1DA 1OYCA 1ALDA 3CGCA 3UPWA 5DMLA 2XFFA 3ZSSA 1JZ7A 3A4WA 1ZJIA 4X61A 2VC5A 5D37A 3W72A 3XISA 2GVYA 1GZ1A 4A8RA 1C9WA 5CBJA 4IOTA 4ZO9A 1QI5A 1F3XA 1Q6OA 2OO6A 3B40A 3URBA 1E0XA 1ZBWA 1V8EA 3E02A 4MIMA 1F6YA 4LXFA 4PBGA 1ONWA 1X6LA 1GUVA 4Q4QA 5EBUA 4B15A 3ANYA 4RE0A 5T91A 4WDTA 4K37A 3N2MA 3DZ1A 4K8GA 1P43A 4G7EB 2D0HA 1JDFA 4AX6A 3M46A 1GOOA 3S0CA 1PV8A 2PDGA 2PP3A 4S3DA 3BZGA 3UCDA 4RX0A 3TYZA 4Q4OA 2FDSA 2CKSA 1UZ4A 2WSRA 3FA3A 3SB0A 3KCLA 4DO6A 1X7IA 1QR7A 4HU8A 4QS5A 1GRFA 2C91A 5T8GA 3UZ5A 4DM1A 4DBUA 2XDFA 1FCBA 1WXYA 5T9CE 1TPVA 3TX9A 2JQXA 1AOGA 5EFDA 4B3ZA 1QOXA 4E6MA 4AXNA 1KWKA 1XH2A 3LPPA 3NZRA 4QE1A 2NX1A 3EOEA 3QHMA 1Z41A 4ZFCA 3H4XA 3H4GA 4GG9A 1XIMA 3ITCA 2F38A 4XVEA 1BPLB 5DELA 1LL7A 1FFUC 4E2VA 3N3MA 4ECLA 3THAA 5IDIA 1OYAA 4KH2A 3EGJA 3SRKA 3UY7A 5BWFA 1E9IA 3W81A 2IUZA 5B7YA 4CN1A 3APTA 2YLLA 1A3HA 3SUVA 3UW6A 4F9DA 2QZRA 1VPXA 3GVVA 2ZKMX 1XXXA 3NUKA 1UWUA 3NFUA 1EX5A 5HJYA 3BVJA 2FZMA 1J0HA 3QPZA 3N4FA 1LCOA 4C60A 3QSRA 1J79A 4FX6M 4O0KA 3V5FA 1H51A 3WDPP 2ICSA 2ZZ4A 4UTUA 3QZEA 1ZJHA 1W0MA 5I02A 4XIAA 3L4WA 1ZAJA 3AMCA 3OG3A 1F7BA 5AOUA 2X7WA 4IZGA 1POJA 4PN2A 3NDOA 3QF0A 4UCGA 3VU2A 1H7XA 2XVLA 3GXPA 1PX8A 5CC6A 1E6XM 2OKTA 1SO6A 3CAKA 3GKFA 1UWIA 4ZQCA 5HATA 4FR6A 1X1NA 1G6CA 5GNZA 2EPOA 3ZJKA 4EWJA 5LIWX 1NWSA 2VR4A 2I1OA 3TVAA 4G1KA 1VB9A 4BK9A 1FKXA 2QCHA 4MB1A 1PHQA 2Q02A 3NL5A 2D24A 1YBQA 3VD3A 3EA2A 4XG1A 3ZVHB 1OM0A 1JDEA 4NZ5A 4CLMA 4O53A 3DOPA 1Q6LA 3WY1A 1LWHA 4OBSA 1NHRA 4UNIA 1GVQA 2C15A 3GNOA 2XFRA 4MNJA 1ZZMA 4MAVA 5CXPA 1K9FA 4Z2GA 1GV4A 4HHMA 1XIGA 2P3ZA 2B81A 4L4LA 4PCSA 3TA9A 3W7KA 1OFAA 1L2QA 1K02A 2PDXA 4JS3A 2J7CA 3MCOA 1LL6A 2JBMA 1FUYA 4F0LA 2G0WA 2X8HA 2PLMA 3VKDA 1M1BA 1NHSA 1TIMA 4J3UA 5EMJA 3ES8A 1PWMA 1P0EA 3MBFA 1XW8A 2O4MA 3VILA 4MM1A 1AW2A 2XFYA 2WVTA 1TWSA 1BG9A 4H04A 1V3IA 4HSOA 3QOKA 4JDRA 3RLGA 3AUOA 3NGFA 1DJYA 2G3NA 2CZFA 4FP1A 2ZC1A 2J4GA 4LNYA 1X8FA 1F8WA 1RD5A 3B0YA 3QLLA 2A3EA 1GOIA 3U7BA 4X63A 5FL0A 1KGWA 2NXGA 1NOFA 4P7RA 4PTVA 1OJXA 1SFTA 3S4TA 3LTPA 5CPNA 3VZZA 5C55A 1SPQA 3LRKA 3VDHA 1I2OA 3W1UA 3PULA 3LCXA 3AYTA 4EMWA 5DANA 4HOZA 1JZ8A 3EWWA 2Q8XA 3H53A 4H8VA 1N55A 1V0MA 3ZXWA 1E0VA 4LS1A 3STGA 2AKZA 2X1SA 3EPNA 4IPLA 5A8PA 3Q2DA 3DJGX 2XVGA 2WKGA 3P62A 2OMAA 1JCTA 1H49A 3WQVA 1ZCCA 4GD0A 1SO4A 3GU9A 4IL2A 2J9ZA 2A6LA 4I7WA 3EKZA 3V0TA 1GGOA 2J74A 4XZNX 4AYGA 4EANA 4LUIA 1SU5A 4F79A 1ONFA 3STFA 3AHYA 5FS9A 1P48A 2YX0A 1K8XA 3VIPA 4H4ZA 1CNVA 5A95A 2GSEA 1VFUA 3MO4A 4U5KA 3NM3A 4UTIA 3TK7A 2VFIA 4LAOA 1XRSA 3H70A 5E6ZA 1OSEA 3PBWA 4DLFA 4KEUA 5JCMA 3L2IA 3C61A 1QK0A 1B3ZA 1TV3A 1YX1A 5BRQA 2UWFA 5FMHA 5I5RA 1A3XA 2NXHA 3RR4A 5AN7A 3O0KA 4ADUA 2YL8A 2WV8A 3G0UA 3R5EA 1EPXA 1VZWA 2WSQA 3PF3A 2VVSA 3BCJA 5G2IA 1UC5A 2WLZA 3VKBA 2DZTA 1U30A 4NJGA 3PFMA 3C2YA 4H4SA 1RA0A 2CETA 3VA8A 1K4GA 5A8GA 4PUNA 4QEHA 4JNYA 4IIGA 1K7XA 5C71A 4W4QA 1W5QA 3T2OA 4MNMA 1RBLA 5LHFA 4J3SA 1VJZA 4FLOA 4MY1A 2Y7EA 1MWOA 3T0CA 2J7BA 4AZ5A 3BXWA 2A7PA 3HFYA 4JPGA 3THQA 1OEPA 3DXIA 1H60A 3PTDA 3D3FA 2Z2UA 3CZGA 3O1NA 1W3NA 4O17A 2BVTA 1E40A 1M04A 1SB3B 1OFRA 3TYEA 4PRTA 4ZO6A 3N4EA 3WD1A 4OBTA 3VIMA 1UP3A 2OXNA 2I5GA 1CXKA 1VENA 3EDKA 4B2DA 5CSUA 3GNRA 3M07A 4B5WA 2FTPA 3HN3A 2R8WA 4HIBA 4LT9A 4YXGA 1B9BA 5C54A 3TOPA 1TJPA 2J62A 4NJJA 3UWQA 3UFYA 3T42A 5FEWA 4LEQA 5CPLA 5A5WA 4LVAA 4KGJA 3AHZA 3JR2A 1G1YA 3P5ZA 2E7FA 1O1ZA 5CPOA 3WJZA 3G8RA 1IIGA 4UTWA 2QUTA 1DXFA 4EXAA 3PJXA 1KV5A 2J78A 4GKTA 5AHMA 2PCQA 4XIMA 3AYSA 5CCZA 1JROA 4WCJA 4JL2A 3TLQA 4CD6A 2XSAA 1HKJA 4D6CA 3KRUA 4YTQA 2W63A 2WBKA 2RJGA 1J2WA 3QV9A 5LIYX 2Y5EA 5LGXA 2J3NA 3SZ8A 1HP4A 4I5RA 1B90A 1QOQA 2J13A 3LLFA 4IMEA 6XIAA 4DYKA 1UASA 2Y8UA 5A94A 1T8QA 3T8LA 4DYJA 1NF7A 4GQQA 4Q3MA 3GDKA 4JTQA 3EWZA 3CWHA 2ALRA 2PDNA 1WXZA 1DYSA 2VCBA 5CZJA 2FHFA 4G9PA 4F2BA 3TJIA 1AJ0A 3WG6A 1G0CA 3N12A 3WMLA 2JKPA 3SRFA 1CTNA 3VIHA 4HSHA 3H7VA 5ECUA 5HNRA 3P14A 1KM0A 1UIPA 4R27A 3K5XA 4ZA0A 3B0XA 2NXIA 3B8VA 1QW9A 4AG0A 1SMAA 1GKPA 3W7LA 2P53A 2D23A 3VKKA 4NAEB 5J5RA 2Z1KA 5BZAA 2Y7GA 4ZCWA 1F8IA 3U48A 3HG5A 1SO3A 2EPKX 3CWNA 3DGBA 4POCA 1W8SA 4Q7NA 5F7UA 3PSWA 4PMQA 1ZDLA 4RE4A 4EXQA 3F4NA 4UNLA 2GVLA 3NQFA 3CTTA 3A5FA 1UUMA 1CXFA 1XHGA 3DK4A 2QF7A 4XQ6A 4EPDC 2QS8A 4DLMA 1ODUA 5BXSA 1E1EA 4C6LA 3PTQA 4GQBA 2BC0A 1SSGA 4B4HA 1B57A 3FX4A 3RRXA 4BQ4A 1YNYA 2GOKA 2GGEA 1AJ2A 4GISA 3BO9A 3HMCA 2QAPA 3TQ0A 3M0YA 4Z2KA 1TWWA 1GONA 1J8VA 2H6RA 2Y4SA 4M1BA 4GYKA 2TRSA 3AMZA 5BRPA 4HTYA 4LCQA 2H9AA 4PMUA 1DHKA 3LV6A 4KRZA 4FAMA 2O0TA 3QN3A 3TONA 5IXEA 2D2GA 2TAAA 4CCCA 1V6UA 3WL1A 2IKIA 4IX2A 4JIQA 3CZEA 4KW2A 1DBTA 1TPB1 4Q8OA 1A5NC 2CZVA 2YKKA 4UQEA 4A3RA 3EOSA 1R87A 3HZ3A 4JTGA 3DI0A 4OGZA 3S83A 4HYVA 1XYAA 2ZZCA 1UBSA 4U28A 3L0NA 4MYAA 2VENA 4E4PA 4RE2A 3W2NA 4A8NA 5GRTA 5H8PA 4I8DA 5D9OA 4V1YA 4IQLA 3CQKA 1GOXA 1EXPA 4YMZA 3WNPA 1NPXA 2DVUA 1ME8A 1HW6A 2MNRA 1XIJA 1E73M 2B31A 3TYBA 3WD2A 1JPHA 4GIRA 2C18A 4GKLA 5A6BD 1XP3A 1AG1O 1JR1A 4DELA 5JUVA 1WP6A 3O0FA 4GCAA 3LS9A 2WSKA 1KFEA 3EB3A 1F9CA 4GX8A 4JTSA 4L1GA 4NI3A 2DEPA 3T08A 3TW9A 4O4VA 1TPH1 2WM1A 2R1LA 3QFBA 1X2HA 2XZ7A 3A3XA 1EBGA 2G97A 4H9YA 3MP5A 3KRBA 1NFBA 4JFUA 3B9DA 1MDLA 3S1GA 1XKYA 4WSHA 1UPPA 1KKOA 2BXVA 4MPKA 2PC8A 1OADA 1YEYA 1TRDA 3N15A 3WQOA 1R2TA 3RDKA 3GTHA 1EJWC 1AD1A 1WBHA 1FWTA 5C2GA 2VC7A 1CEOA 2HQAA 3ARTA 1DXLA 4MB5A 1RCOB 3WN6A 1I2QA 3GVRA 3K30A 2E6YA 1M03A 2FFIA 3IUHA 1QJWA 2WZMA 1REQA 3M9YA 3EPMA 1MZHA 2VD9A 1YNPA 1TZZA 1G69A 2GSJA 4BQ2A 4K8EA 2WSPA 4DNHA 3NDZA 3CGEA 1JEZA 1A5MC 5G4WA 4BEQA 2DJLA 1EO5A 1OF6A 4CU8A 4CVWA 8TIMA 4UTTC 4F0KA 5JMUA 1GQKA 1QFEA 4E38A 4JNMA 3H2MA 4QLKA 4Q8VA 3SM0A 1L9WA 3GX9A 1MEHA 1T41A 2AQWA 3PHAA 5HMDA 3C2EA 4NX0A 3AWNA 4OV9A 1IXQA 2BLEA 4GE8A 4Q4MA 3UGRA 2ANUA 1PIIA 5D4YA 1GRGA 3MHFA 1XI3A 3H2EA 1O6IA 1GG1A 1ZRQA 1GQLA 5FEXA 2UV8G 3QMSA 3W02A 2QUUA 2J9YA 4P7LA 1JZ6A 2Q8LA 1FHUA 3CIWA 1U22A 2FJKA 3EDDA 3KUMA 2RDTA 1RBAA 1ADDA 1KBKA 2ACQA 1AL8A 1HIZA 1WAUA 3BURA 4N6EA 4BEUA 3Q58A 4TX9A 4F0RA 3H6OA 4W8AA 4GWEA 3H7UA 2HXTA 7XIMA 4P61A 3WLNA 1H0GA 2QCFA 3GKAA 2PODA 1HXJA 3FKKA 3KX6A 4ZQMA 3INPA 1WDDA 4OUEA 4XZ9A 2B7NA 3LN3A 4I9JA 3RMEA 3LX9A 4AIEA 1IXPA 2PDBA 2GDVA 3RCYA 1I0DA 4PA8A 3DHFA 3G1SA 3WJXA 5B80A 3G1VA 2WAGA 3M7SA 1XLLA 3P0XA 4LW7A 4PCPA 3T2PA 1UP2A 3T1GA 4PTXA 2QDEA 2FB2A 1PDZA 3WQ5A 2VC6A 4IMAA 1PWLA 5E93A 2F7FA 1IYXA 1JF6A 1Y0EA 1LLWA 2CIPA 4JTHA 3FHAA 4M24A 4PGLA 4L61A 3GVQA 2Q01A 1OFQA 1R9XA 3B06A 3IJLA 5EYWA 5EU9A 4Z2HA 1RR2A 3BGJA 4U5IA 3D3AA 1R6WA 4ATLA 3WNKA 4D72A 3FN9A 4ZTYA 4JYDA 4QLLA 1CECA 1BVZA 3N4AA 3HPZA 1UH3A 3H55A 1AUSL 1RM6B 1A50A 4FNPA 1Q6GA 1TTPA 1LG1A 2YL9A 5AHEA 1QI0A 3ZT6A 4B3LA 3IVSA 3DCPA 3WDQA 3HM7A 1OX5A 3PFRA 2RUSA 3H2FA 5MF5A 1OCJA 1HP5A 2QUMA 4YTSA 1O60A 3L7RA 4QQ3A 2W0UA 1WV2A 3GDRA 4WSJA 4K6AA 3OIHA 4GQRA 1QNOA 2FPYA 4YCOA 4QJ1A 2GQ3A 1PTAA 3G5EA 2QCDA 3N34A 3HURA 2E5BA 4UFIA 2WQDA 1LRNA 2EJAA 4HNTA 1GHRA 4D6EA 2C13A 3NVZB 1D7KA 4DHGA 3CL7A 4PUUA 2DSZA 1AA1B 2A21A 4QAIA 3WLRA 5JRBA 5KETA 2E77A 1VPQA 1YDVA 2BVDA 4CGTA 1GREA 2XN0A 2G50A 3LD5A 2OT0A 2WOQA 5DLCA 4F3HA 1KFJA 3MYOA 3BOLA 1FXPA 5HAOA 1R85A 1NHQA 4LNCA 1VD6A 1UZHA 1UH2A 4CCEA 1GW9A 1P7TA 3EXTA 4M6QA 1LRTA 3II4A 5I3KA 4BI5A 3R8HA 2CBJA 1W1TA 5GVJA 1UD4A 1PBGA 5HR6A 4XZHA 4YHGA 3IS4A 4QQUA 3AFBA 1KO0A 2O55A 4PUDA 4IIFA 2PUZA 2RAGA 4FPSA 1Q7ZA 1ODZA 5CQ1A 3ITVA 2WBAA 1BGAA 4KKXA 1HVXA 1A5LC 4U2ZA 3RUBL 2WC4A 3TMLA 2WPFA 3GFYA 3OEXA 3LOTA 4GQ0A 1I60A 1JVNA 3QJAA 3UJEA 4Q8WA 4BI6A 1PAMA 4Q4KA 1BYBA 5E5CA 4US5A 3HJZA 4H4YA 3RO6A 3RM9A 1GESA 2INFA 4K1GA 3UR2A 1EWDA 3NURA 1UH4A 4YNGA 4LBUA 3T07A 2W62A 3PPFA 3B8UA 1BXBA 4J3TA 2J9XA 4PTDA 1KFWA 1MW3A 3I65A 3RM8A 2E3TA 2XM1A 3LK6A 3WQ4A 1B54A 3SCVA 1LDCA 4FX7A 4TVUA 4EPKA 2ZCGA 3EAUA 5AYIA 5G5HB 4DF1A 3W0KA 3G1DA 5LA1A 3CV6A 1RALA 1O1HA 3G6MA 4PMXA 4PMJA 1Q4NX 3GAYA 2CLFA 5D30A 2Z0IA 1EXBA 3NOYA 4CEXC 2OEKA 1G4EA 4LJ3A 3R11A 2G41A 4XX6A 1FHDA 1F05A 3SCWA 1OD0A 1S5MA 4AWTA 5LA2A 1KD0A 2BY3A 4KRTA 3C2OA 1UIOA 2VQUA 4JTRA 2X09A 2PMQA 2QJHA 3CAQA 1I0BA 4O1AA 1DWJM 2E3ZA 4DJEA 4Z2LA 3AIRA 2ZOXA 4H3DA 1UOZA 2VVNA 4DN1A 1BXCA 2ZRUA 2EF9A 3KCJA 1YTEA 5CAHA 2CLHA 3L2LA 3NA8A 4KEZA 3AS3A 5IBXA 3H24A 2WCSA 4P7QA 5AHIA 2ISDA 2P88A 1NELA 3IIXA 4CD5A 3W7GA 4L65A 1E55A 1XLBA 1YYAA 4HVXA 3WLQA 4UNKA 3QKZA 1NU5A 4I3GA 3HPXA 5JIWA 1NIUA 4GUJA 3W7PA 3RCMA 5EGRA 3VGGA 5FAJA 5JQ9A 4BURA 3TEVA 2VGIA 3HGSA 1RP9A 3W7OA 3WQ6A 1UWQA 3VDAA 3UP8A 1GRAA 4INFA 2WVVA 2X16A 1KW1A 2Z2BA 4AISA 5AHFA 3R2GA 1W3IA 3PM6A 2NVCA 1KQZA 2GWNA 1C7SA 3CM4A 4G1NA 1YQZA 5EBKA 4NAFB 4ZQNA 4WF7A 5D33A 1YE6A 2YVFA 2J7FA 4ZZ9A 1S2TA 1S3TC 2WMIB 5HK4A 3T0AA 5AECA 2H8ZA 1WUFA 1U1HA 2GJRA 2V5DA 3GRTA 4GC4A 1TWIA 1MSSA 4OECA 1GTHA 4O14A 2W6RA 2C3DA 1R3WA 1DJNA 3K4DA 5I2UA 1QK2A 3GRSA 1IGWA 4TX8A 2BHUA 1LF1A 3MO7A 1LM1A 3WD4A 1JYXA 3E2RA 3BQ5A 1NEYA 4FOJA 5A6MA 4PYSA 5AZ1A 1B9ZA 4HQVA 1LQAA 2I5QA 3N9RA 4Q6XA 3EUB3 1RPXA 1UC4A 3PUDA 3SN4A 3UJSA 1JPMA 3F4DA 1YPIA 3ITXA 2A2IA 3W70A 1I8JA 3RAOA 3CHDA 2YYUA 4S3FA 1RCQA 4AC1X 3E2SA 3PZNA 5MKGA 3ANVA 4QP0A 3W83A 3PZGA 3R07C 2ONEA 5JCIA 1W3KA 3WLTA 3GTFA 3NSMA 3TH6A 1OCNA 2CZ5A 4R88A 2CFFA 4PMOA 3DIPA 1OT2A 2NQHA 2VMFA 3MSDA 1BWKA 3SDOA 2ADAA 3CUJA 1J5SA 3G22A 2V3AA 2DUZA 2R14A 4MNKA 4JFTA 5HJLA 3D9XA 1STZA 2ZUNA 3F1QA 2YDSA 4JCLA 3VGDA 2OGYA 3BCDA 2W67A 3ARPA 4NY2A 1GK8A 4NVTA 2HVNA 1W31A 3E0WA 2VRJA 3MW7A 1XDIA 4MG4A 1K9DA 2ZUVA 1DJXA 1OX4B 4MWAB 5D2WA 3D46A 3GQYA 1K4HA 2WOWA 1G5AA 1E6PA 1A53A 1OYBA 4DM2A 5KINA 4NSBA 3L4ZA 1B4KA 4L64A 2PGFA 4WD0A 4HZ6A 1FBAA 2VGBA 4Q7IA 2A85A 3SJ3A 4O1EA 5DX7A 4I8YA 3EX6A 4GI8A 4AD2A 2YW3A 3CAWA 3AUJA 1S1PA 3DESA 3QPEA 2BBFA 3LQGA 5DXXA 5K4XA 1NDVA 4NEWA 2C16A 3VIJA 3U2ZA 3U4AA 4FIQA 3VIFA 3S9IA 3FIGA 2PB1A 4DWSA 5M2FX 2OKOA 3PUGA 1BYCA 4N9EA 2Q6ZA 1WOAA 3NPUA 1JFXA 2CESA 2R24A 3DFHA 2OB3A 4QLJA 5HQEA 4XD3A 1FWAC 2NUXA 4MB3A 2VP8A 4LAZA 5I3HA 2E8ZA 1EHAA 4UOJA 4DBEA 1TFVA 3VNMA 2V9DA 3ABZA 4H4IA 2HBXA 4OWGA 2P8BA 4GH3A 4AWEA 4L4OA 1HL2A 1UZ1A 2DH2A 2TMDA 2ACRA 4NASA 3IANA 2R91A 4YLWA 3VK5A 1EJSC 1Q8JA 2UY5A 4C6EA 2C7FA 2WWCA 1PCWA 4AVNA 5I09A 3V7PA 4JIPA 1LLZA 1EWEA 3SCQA 3EWDA 3V1PA 3UXAA 1E1CB 1H41A 1LJYA 4AZ6A 4EQSA 1RK6A 1A5AA 3ABSA 3M7WA 4FR1A 4IIEA 1NSJA 4G56A 4AB4A 3T6CA 5U1OA 4ORIA 4H9XA 2JK2A 4D6GA 4C6KA 4JL1A 3PBMA 1J93A 5CBIA 3WFLA 4OT7A 1Q66A 3K8KA 4PBEA 1ZJAA 2HMCA 5D2YA 1EDQA 1AFSA 1VR6A 5BMWA 4WRHA 4UFJA 4E2OA 2W54A 1QASA 4TTGA 5DEZA 3CJPA 1VRDA 3WF3A 4R7OA 2Z6IA 3DFYA 4JOMA 1W5MA 3L5AA 3EA3A 1JDAA 1XG4A 5EL1A 1IR2A 5DN1A 1J01A 4O13A 4C6MA 3W23A 2NUWA 5TIMA 4JQ9A 5TAOA 1CGVA 3L0GA 4GZEA 2DSUA 5FJTA 2D3NA 2DH3A 1H09A 1H61A 3E5PA 3A7UA 2X30A 2W0HA 3GTIA 1W9DM 4YU1A 1T0OA 2HBVA 2ZZBA 1W9BM 5D32A 1V03A 4DJDC 4J56A 3ZZ1A 2O56A 1NH6A 3LZ3A 4DWSD 3VOGA 1E43A 1OT1A 3KS6A 1LT8A 5I78A 3HQOA 3UJ2A 1J4EA 3S1WA 3CB3A 2R82A 4GHRA 4PMRA 4TVYA 3ARVA 1W2PA 1ISYA 2FFCA 1FTXA 4H4VA 2DSVA 1RQHA 4NNCA 1KCXA 3OZOA 1VBRA 1V97A 4N9BA 3MV11 1TWZA 1X96A 3QC3A 3TR9A 3U7VA 4C90A 1H5VA 2DIKA 2E1WA 3GNPA 1QPKA 1V3LA 3NO1A 3G1HA 5HULA 2CWXA 3A13A 1NWTA 1YRRA 1MUMA 1TX0A 2ZXAA 4RW5A 3RX2A 4O16A 3VXGA 2ZUWA 1E4MM 2NV2A 2GK1A 2ZE3A 3LRLA 2EKCA 3AJXA 4QDMA 4QR6A 1A4MA 2Q71A 4UC5A 3WK0A 1ZKQA 3CPGA 1ZAHA 4RNFA 2V2HA 1UUQA 2WW5A 2ZZ2A 4IQJA 2QNEA 1TV5A 2Z27A 4YYCA 3NYZA 1SMDA 2Z1WA 1W3HA 4PCFA 4GABA 3SQPA 3VPLA 4WX2A 3YPIA 5HINA 3KTXA 4DXVA 2EJ1A 2QW5A 5C6MA 1SJDA 3MBDA 1S39A 3M6DA 3U5YA 3EWCA 1TR1A 3TTYA 4DF2A 1UA3A 4B16A 1BKHA 4DXKA 4JQ2A 1D7YA 2XU2A 1Q4WA 3TYUA 1EC9A 3PBYA 4DWSB 4H1ZA 4ASTA 4U31A 2I9EA 2BY1A 2B7PA 4ZBCA 1H62A 3ME3A 2DZXA 3HB9A 3L68A 3GW3A 1UMYA 5EMUA 2NLYA 3AM9A 2DT2A 1K9TA 4HPNA 4EM3A 3QMTA 3D47A 1R2SA 2WHKA 3PANA 3CH0A 2Y6ZA 1SFJA 2D69A 3NJ3A 2CXEA 5BOEA 3JZEA 3VDBA 3S5NA 2WKJA 3VMOA 3W9ZA 1PKLA 4XO7A 3GR7A 1NVMA 2ZUSA 3KDOA 1DQUA 1ECQA 3O6AA 2YA1A 4P8WA 2GQAA 2ALDA 3WELA 1W3TA 1ZB5A 4CVUA 3KL0A 2FB3A 1CXHA 1JQVA 2IQTA 2WPBA 1XD0A 2E5CA 5K7JA 1R47A 2FH6A 1G7VA 2VCCA 4M19A 6ALDA 3ZJ8A 1K8CA 4QFUA 1ZP4A 4FALA 4PTWA 5I79A 1VAHA 2WCAA 1CB7B 4D1IA 1YIXA 1OFOA 3AISA 3ZMRA 3LHTA 3B8WA 1U33A 3P61A 5KEZA 5HWJA 3ZLHA 3DG6A 1A0DA 3ZVHA 4IP7A 2OJPA 2VZOA 1QPQA 1X1ZA 4HA4A 1IR1A 2ZA2A 3DI1A 4DQWA 1JOAA 1E0TA 3E0VA 3FA4A 5CSRA 3OGSA 2E9MA 3R8GA 5BOFA 5G1YA 3AO0A 1IHIA 3F5LA 4LX4A 3FYYA 4KIEA 3L66A 1E1CA 4UTKA 2WMKA 4IPIA 1BEUA 1DQWA 2HXUA 1QTWA 4N4QA 4MZ1A 3EKGA 1AH0A 3BANA 4Y9PA 2ZFAA 3BLEA 2YB4A 3SSZA 3VZYA 4OKDA 2YAUA 4H8HA 4WIWA 1VFLA 1GORA 5I3DA 5REQB 2CLOA 2WZHA 3Q67A 4A4AA 2IKJA 2QCMA 2XN2A 1H7RA 3WQCA 5FSEC 5D9NA 4KS0A 4NZ3A 1FDZA 3VD5A 2HISA 1YHTA 2PWVA 3W4RA 3LUTA 1N2VA 3UCQA 1ENUA 3I3DA 1GYLA 2VT0A 4ZVJA 3W6YA 4KT2A 2FPTA 1NAL1 1ONXA 3RCNA 3H4WA 4Z17A 1GOWA 4Z42C 3ZO9A 4AZCB 3DH9A 1X8CA 4UWMA 3GC5A 4OOZA 1YQ2A 4HP5A 4RNJA 1RLCL 3G1RA 1XFCA 3BMXA 4TX6A 3VDCA 1XJBA 4MSSA 1RP8A 2CHRA 3MP3A 4R33A 4EOUA 1J5TA 1TZ9A 1W1B1 4OFCA 2VDHA 3GDTA 1H50A 3SSJA 3NEVA 2XIIA 3LQLA 4W87A 4AZBA 2CNCA 4OJYA 2QV4A 3CMJA 2JGQA 2RABA 1C8YA 1UPMB 3OJGA 2X05A 3UT0A 4UTTA 2WMGA 1MEWA 2Z1SA 4NZFA 2CZDA 3BJSA 3LGEA 4JN7A 1A4LA 2P50A 1IZJA 5CC7A 1GCYA 3T7VA 3IIZA 4XZWA 1GJPA 3IRDA 4D1JA 1OVDA 1F73A 1E70M 1U5VA 3NQDA 4ICNA 4I90A 4IJBA 2PTWA 3DDMA 1Z9AA 4PMZA 3SCUA 1ZALA 3CHEA 3M1ZA 3U0HA 4X2RA 1CXIA 2WBGA 3RPDA 1L8PA 2ACUA 5K2ZA 2VWSA 3EKLA 1SJAA 3KWXA 1B3WA 2ZQ0A 1EIBA 4YVXA 4N4PA 1T5AA 1EGVA 1Q6DA 3KW3A 4QJ4B 2HS8A 3HJEA 4M8UA 3WFZA 2ZTKA 5LNRA 3NVTA 1B30A 1TPC1 4MLJA 4F48A 3ITLA 4FXRA 1WDWA 1XRFA 4HA3A 4JTDA 2PGWA 1KM5A 2EKGA 1QXLA 2VDIA 2VX5A 1F3PA 2J79A 4IMDA 1KXTA 1O5XA 2X99A 3NL3A 1ZUAX 3BJTA 2FIQA 4DAIA 1PEZA 4PUEA 2VNCA 4TV6A 1PX3A 1FWWA 7ENLA 2E9LA 4NI8A 4O28A 1S46A 1QUMA 3KM8A 1TTIA 1TPFA 4GO9A 2NQLA 4RZ4A 3S1XA 3N6JA 3NCOA 3OBKA 5LIXX 1VCFA 3DN5A 2OZ0A 3OGVA 4X0NA 3S1VA 1ZBKA 1EYEA 1YDYA 1AQMA 3P8JA 2QDGA 1UP0A 1M7PA 2JIEA 5AHLA 4H8UA 1T8XA 1OC5A 1OG6A 1QNRA 3RM4A 3GIPA 3LCGA 4XZIA 3LG3A 2WOVA 2OQYA 4QTGA 1ZJBA 1C3FA 4U4MA 4J2MA 4E3TA 1RXOB 5D04C 3NIYA 3NQVA 1D8CA 4GIEA 4R34A 3TW6A 3IIPA 3AS2A 1XR2A 2DIJA 4F4RA 2WPEA 1Q7MA 4CNPA 3GBDA 4TQTA 3HG3A 3AC0A 1XBZA 3TJLA 1E9YB 1GSNA 1XUZA 5FESA 1F8MA 3VKJA 4LS2A 5E6YA 3M4HA 3BCFA 3H26A 4GI6A 3BAXA 3BAKA 2Q3OA 1GYNA 3VFCA 1XLIA 3V18A 3N2TA 4QBXA 4OHQA 4WDWA 1HZYA 5AC6A 1XQLA 2O9RA 3CYJA 5EPDA 2WCGA 1MRQA 1MW0A 1VBGA 2GVJA 3VGBA 3H4KA 4RZ5A 3T55A 2I16A 3BMWA 3G3DA 2FZ9A 3W7MA 2FZNA 4A3HA 3W1TA 3LNMA 4CUCA 4XD5A 2Y24A 1SZEA 4C6QA 4D6DA 5BNKA 1GZJA 3VE9A 3HF3A 4EMIA 5JCKA 7TAAA 3NZGA 4ERGA 2QGYA 3TC3A 3KBWA 3LM7A 4GZ7A 3O05A 3A5VA 3MDWA 3RPMA 4YVVA 3F4VA 2BX7A 3NQ7A 2WHJA 1E71M 1E9ZB 1HX0A 3KRZA 4IPNB 4DZHA 8A3HA 2VURA 5IFPA 5XINA 1JGIA 4BR1A 1ZSXA 2CPUA 1TYGA 3ABOA 3TMQA 1YW1A 3DC0A 1FWCC 3S2LA 5CZSA 2VX7A 2PTZA 3IGUA 4CCZA 3DGZA 1N82A 3E0LA 4HCLA 5I23A 3R89A 4D6HA 4BS0A 4UR9A 3A64A 3TYDA 1FECA 4ICMA 3T78A 3W27A 4ZL1A 3M0VA 4CU6A 4LBRA 1PCKA 4IIHA 3LHWA 2QAEA 4ACZB 3OIXA 1DIOA 3RF9A 3H22A 4KFPA 3ETRB 2D0FA 5IDZA 3CUXA 4J3VA 3RILA 4L6OA 3FVMA 3GDMA 1AZ1A 4H19A 2E5AA 1VCGA 4F40A 2PRLA 2WB5A 5IOBA 1QCWA 4S3JA 4DRSA 2WLYA 4QSFA 3M0HA 1G4PA 1Z32X 1GYMA 3K13A 3POCA 4WKHA 2QF8A 1PZ1A 1A80A 5I3FA 1DHPA 2REQA 1H7WA 1U5HA 3THDA 3W24A 3O07A 4K2SA 2W3SA 4FDCB 3WLKX 3T9PA 4ZXOA 1W56A 3TIMA 1EZ2A 1DWAM 4H8NA 4AZGA 4EF8A 3NG3A 4MKVA 3CXBA 4L4MA 1JRCA 3BSHA 4RV3A 2OODA 3MSYA 7CGTA 3LV5A 2PFHA 2YW4A 3AJ7A 1TMHA 4CQCA 2ISSA 2HROA 3LHYA 4NYUA 3W22A 3N1AA 1GOQA 2PD5A 1L0PA 3II1A 5I3JA 3QSTA 2AMXA 3AS1A 3GHTA 4ZQRA 2PF0A 4JDBA 5FCZA 4MWAC 3PWAA 3ENLA 1R30A 4KCWA 3WLHA 4GO8A 5FKYA 1E3ZA 5A2CA 1YLVA 3BLIA 3A3HA 4ADTA 4EKJA 1O4UA 3I3EA 3AU2A 5D9PA 5CPMA 2PU0A 5AVHA 4LY4A 4GJJA 3M5ZA 7PTDA 2QLYA 4GPNA 4H4QA 3CPRA 3BJFA 2YGYA 3M0LA 2J7DA 4LVDA 1SQ7A 4J9JA 5EMLA 4UFKA 1AVAA 5DQPA 3OYZA 3MTWA 2KX9A 1ESWA 3SCTA 5FS6A 4QGCA 5I07A 3W00A 4QEEA 5FS8A 2Y2WA 1MNZA 2X40A 3DYMA 2BP1A 1MXGA 4YTUA 4KMQA 3MJYA 4IL0A 5FSDC 2W55A 1N8WA 3GNNA 4MWAE 4FZIA 1LWIA 1XV8A 4O10A 4PL2A 3NQ8A 3PBUA 2VELA 3KAOA 3BUVA 2C0HA 3WBEA 2J7HA 6REQA 1SJCA 3GG1A 3MZ2A 4XKYB 2GVGA 1W91A 3VCCA 4X0VA 3HU7A 1FH7A 2E6FA 2ZZ6A 1EGZA 2E67A 2FH8A 4AY7A 2V30A 3G0SA 3KVMA 1UKOA 4LYRA 1XM3A 3MVTA 1TQJA 4ACZA 3O8AA 4QROA 2Z26A 3DEQA 1WZAA 3CT7A 3SUWA 4UFLA 3R13A 3R43A 3RO8A 1RY0A 4DXXA 1LUCB 3LRMA 1B2YA 5ABEA 1D3CA 1EF3A 1QVBA 4N9DA 3E5BA 4HBKA 4NJKA 1IIHA 1JYNA 1J0IA 5DXYA 1S5VA 4HHLA 1E72M 1LVLA 1RLDA 4Z1CA 2Y5SA 4GYPA 2GRTA 5AB3A 1G4SA 2RHGA 5KVIA 3I6RA 4D71A 3B04A 4LCSA 2A4AA 2H3DA 4FLQA 3SCNA 1XBVA 4QRNA 1OGGA 5GNXA 2PDWA 3FA5A 5FD0A 3S46A 4DO5A 3OZMA 1C91A 1T99A 1BYAA 1Z48A 4QAWA 1GRTA 1TA3B 4N0RA 3BLFA 4G8TA 4JEQA 3UJRA 4UQ9A 1JCYA 5A8MA 4LIIA 4XBKA 2C79A 4PFHA 1PE1A 2WP5A 5TQLA 5DCEA 2D2JA 1TG7A 1AD4A 3I10A 4N6FA 3M64A 1RK5A 2IQ0A 5AC5A 2ZIDA 3T0DA 2XN1A 3QV8A 1BRLA 3TZNA 4RXGA 2GQ9A 1EHNA 1HKMA 4ZOAA 1W3LA 2YDRA 2R1PA 2R6OA 2IPGA 5I06A 3W86A 3FKRA 3IAQA 1FFRA 4UMCA 3UJFA 1CT5A 4RUBA 3UZXA 3I7QA 1KQYA 3PY2A 4DZIA 5E70A 5HMSA 4AIUA 3ALGA 4GZJA 3QY8A 5BWAA 4GK8A 2P0IA 4UXDA 3KZPA 4BQ5A 4DZ5A 3WQGA 4TMBA 1VYSX 3P8IA 3ONCA 1TB3A 3RLVA 1KFKA 3DUGA 1TKKA 1XCWA 1A49A 1A5KC 4US5D 3UYIA 3A9BA 3DG7A 3RU6A 4PEEA 4PR4A 1GHSA 4H4RA 4E4FA 4IP5A 5FACA 5J5DA 4JY8A 4IXXA 4DBDA 3LNPA 3WYZA 2P1FA 1BZLA 2FVKA 2GWGA 2WJEA 4H2HA 1WE5A 4ZSUA 2O9PA 3REQA 3SR6B 2Y5JA 3W7IA 4NEVA 2DP3A 4YL2A 3SFWA 4IFKB 1XYFA 5G1TA 3UPBA 2YXGA 1HO1A 1GZGA 2GJXB 3H12A 4PZVA 1R9ZA 1V7YA 1VQZA 4UTLA 4C6CA 1IEIA 3GXTA 4K1WA 5U25A 1S5NA 3IV8A 2XPKA 1PZ3A 3COTA 4C6IA 4ZQPA 1TR9A 2CCRA 2YYTA 3BG5A 4DJEC 1I4NA 3NPVA 2PDKA 1KRAC 5EBAA 3CGDA 4OBRA 1HJSA 1L6FA 3AYRA 3SQMA 3WEMA 5EB8A 2OT1A 5AY7A 2XH0A 3PAOA 1MZRA 2J75A 1DWHM 4BF9A 3MI2A 1P1XA 4AAJA 3BH4A 1UJPA 2Y62A 1KGUA 4IICA 4RPPA 1YXDA 1R3VA 1JI2A 3WEOA 1W1YA 1H7NA 1N63C 3W37A 3VIOA 1KM2A 3OLIA 1WDPA 4YIWA 3OP2A 4MMWA 1XCFA 5C2CA 4K7YA 2B0MA 2CZEA 3BDKA 3QMRA 3DX5A 2GDUA 4ILSA 3PR2A 4PUJA 5G1MA 3EB2A 1CB2A 4PB5A 4IJRA 5HBFA 1CBGA 2HJPA 2XJ7A 4AEOA 1E6ZA 1B0IA 1J96A 3QPYA 2EPHA 3L4XA 3BOXA 4HGXA 3WFAA 1M5WA 4M29A 2YBTA 3WD0A 3NQ2A 1JFHA 3CH9A 3GLCA 1C7TA 3IK4A 3OW1A 1TMLA 1FX6A 4NYYA 1KCKA 1YPXA 4ZTXA 3TYCA 2W4XA 1Q8AA 3NVVB 5C7VA 3KHDA 2WZIA 4PRWA 2Z24A 1EC7A 3RFAA 3UVIA 3DFNA 4RZ6A 4QJ3B 1I6NA 2GQ8A 3VUSA 2DZBA 4WHBA 3ARSA 4AUBA 3A12A 1TREA 2BY0A 3W1NA 2VGGA 4WEVX 5H2ZA 1XQKA 4S3AA 1GQJA 3V3WA 2BODX 4EQXA 3PNZA 3PN8A 3W25A 5HA7A 2D3LA 3GXMA 1OQFA 4KPLA 4UTMA 2QCDB 4IGNA 4GRTA 1GRHA 1K7FA 3F03K 2AAQA 1M68A 4Q4PA 4IX0A 2WJDA 2J47A 1ZTVA 3CGTA 3URNA 1A5CA 2YR1A 2F6XA 1Q6CA 1R3TA 1O94A 4KCUA 4TV5A 4M7SA 1CIUA 2J27A 2Z4GA 5G2WA 3IJ8A 3OODA 2GR2A 3UA3A 1TUXA 1UHVA 2V5CA 3BLLA 3WLLA 5BCAA 1V3HA 2OFJA 3C56A 3TW7A 1PKYA 1W5NA 1WZMA 4LSBA 1F3TA 4RJEA 4H4TA 5D02A 5CGQA 3FGCB 3ONBA 1ZMCA 2DZWA 3MMWA 3WX7A 1OZMA 1SO5A 2VI0A 1JXJA 1DIEA 1TQXA 2CBIA 2YXXA 2G37A 3C0LA 2AMGA 2W91A 3LHUA 4ZR8A 4O12A 4O15A 1EPVA 2SFPA 1S2CA 5F2IA 1HFBA 4LV4A 1KLZA 2ZZ7A 3SIZA 1NTHA 1US0A 4ZOCA 1E5NA 1WXJA 5FEPA 3CYVA 1XIIA 1GVEA 4J40A 5CSSA 2OYMA 3MVIA 3NQEA 1I45A 3A21A 1ELSA 3HQ1A 1W5OA 2D22A 2ASHA 3GXIA 4MB4A 1WX0A 3SY1A 4ADSA 2YLAA 3G18A 2ZBTA 3PUOA 4LC8A 5HOSA 3VGFA 4GZIA 5LNUA 4C6DA 2HNHA 3GY1A 3WBYA 2OZ8A 2V5JA 4C1LA 1PVNA 5DCDA 4QIUA 1BG4A 2Y1HA 3LYEA 4NNAA 1FDJA 1CPUA 3L65A 1GG0A 3DAQA 5DMMA 4QJ5B 2C1GA 4B91A 1B1YA 3LCHA 3BOFA 4NKCA 2JGYA 3UZJA 2V3GA 4DWSC 3UWVA 3R0KA 2A3CA 1EKOA 1X97A 3HQPA 3WH7A 1XLGA 3GIQA 4JIEA 2WXDM 5LNSA 1E4IA 1XBYA 1MQQA 3ALFA 4B5UA 4OU1A 4GNVA 3QV6A 4S23A 1TTQA 3CPUA 3H2CA 2BWGA 3BMVA 3NR0A 4IGHA 4JHZA 1QNSA 3A3WA 1PJ9A 4K7ZA 3SCRA 3TSDA 3UERA 4P8VA 3VOIA 3WQPA 2GJPA 3GYEA 3EMCA 3VAVA 1IEXA 2ZUMA 3CL8A 3BICA 3F5KA 3LBCA 3M43A 3GD6A 3DC8A 4QDWA 3WNMA 2A3LA 3WIJA 1DWGM 4HCDA 3WJWA 1S3HA 4ICCX 4X3ZA 1GT8A 5A2BA 4H7CA 2QR6A 1ICSA 3I6TA 5HWNA 3OVPA 3S2NA 2INZA 5G4HC 2I56A 1A0EA 4U3CA 1EGMA 3U6WA 3WENA 3P3BA 1KA9F 1V0NA 3B8TA 3PBGA 3UF9A 4QSHA 4KQNA 1BSLA 3U9IA 4NAFA 4AMAA 3NXLA 2CITA 2KZHA 5I24A 2RDUA 2J6XA 3NSNA 2WYSA 2QCCA 2OWCA 3R79A 5CG7A 1DNCA 5E09A 1F5ZA 3WF1A 2NQJA 3IARA 4HPGA 1CZ1A 3B97A 2F5ZA 2ZRXA 2F6KA 1V51A 3EXSA 4Q8MA 2WC3A 1EF2A 4AEFA 4LYKA 2NV9A 3B05A 5LKYA 4PODA 2MANA 4ONVA 3TQVA 1XH1A 3MWCA 2Z2AA 1S5TA 2I14A 3QGVA 2ZRYA 3MUZ1 1JCLA 3HFTA 1WZKA 3TDFA 5K9CA 4KPRA 1VIZA 1OC7A 3SGGA 4I5XA 4US6A 1GVRA 4JYFA 3NWRA 5I6SA 1E3XA 4MJMA 2W3ZA 4J7RA 2QJMA 4GIYA 2PDMA 3DERA 2POTA 4G5DA 4LF2A 4ACYA 4QITA 2V8ZA 2OR2A 5D05A 4CCDA 1VIWA 4LVBA 3AMKA 3GC4A 3PB0A 5BU9A 4JTJA 1VRXA 3W6LA 1YNQA 3N17A 3PJTA 3APYA 1E51A 2BFGA 1U2YA 5C9ZA 2WNZA 3VNDA 3WK2A 4LCRA 4IPJA 1TYTA 4LB3A 1P5BA 1AODA 1PDYA 5LIKX 5HUOA 3DJJA 3V36A 2DZVA 2VC9A 3NAVA 3AIVA 2FTWA 4Y90A 4KWOA 2YCEA 2BV9A 2BHYA 3OPSA 4WQ6A 4NZJA 4FXSA 3QKEA 4GJ1A 2PDHA 1T3QC 1X39A 3MI3A 5TR3A 4GC3A 2WANA 1N7KA 5FA5A 5C5YA 1UR1A 3LPOA 4GRSA 4DJED 3USZA 3GK0A 4Y6GA 3IK2A 4PSRA 1LP6A 1KWGA 3OQEA 2OU4A 3ARXA 5TF0A 4JFSA 4C6OA 1WYGA 3CLWA 2FVLA 1VJSA 2DSKA 3PJUA 3G2GA 1VFMA 2PZ0A 3DK9A 4R5EA 3NNTA 1X98A 3P67A 1TUFA 4B9YA 2PLJA 4W7WA 2EQ7A 1WOBA 4NHVA 4GY1A 4QG9A 4GXWA 3M5XA 2ZX8A 4WY0B 2VCAA 3UR7A 3HGRA 3FS2A 5FAGA 2R9RA 2IS7A 1BAGA 3O63A 4JFWA 3SUSA 2VRQA 3V1HA 2PSNA 3WUGA 2QPXA 3NM1A 2JFEX 1XLDA 4S2CA 3WL0A 3DG3A 4BF5A 1GOKA 3UZZA 4O50A 2E0PA 3DBNA 2JK6A 3S42A 3QY7A 3UD6A 3HIJA 1OCQA 1SYTA 4JR5A 5XIMA 5LNVA 3WSUA 1Z7AA 2XIMA 1A5OC 4ZO8A 3PTMA 4J35A 4RDYA 2ZA1A 1VFOA 3GH4A 3CB8A 3SADA 1B5TA 4XO6A 3BC9A 4GR1A 4H6QA 1E6RA 1P6WA 4IWWA 3VCNA 2J7GA 1MO0A 5E0CA 1E6SM 1ZQ5A 4J3XA 1LUCA 1XYBA 4ZB5A 1HGYA 1VFSA 2W9MA 5DY3A 3WLSA 1H1YA 2YDQA 3V5OA 4J28A 3MANA 1XUUA 1C8XA 2DPEA 4HD5A 1RD6A 3EOLA 3QZAA 3U3HA 3A4JA 3L4VA 2W92A 3U5UA 1FWGC 4PEKA 2EEXA 1VFTA 3K4AA 2XZ9A 1RZMA 3D0CA 5DF0A 4LAMA 4GX9A 4K39A 1CGUA 3GNDA 1K9EA 4KWUA 3TE9A 3TTQA 2GH5A 5D2XA 1ADSA 4O1FA 1G67A 4DO4A 1RVKA 1W1PA 3ABXA 4P5UA 1JCMP 5FF3A 5C9UA 4E8CA 2WNWA 5I03A 2XGBA 3W38A 3UCCA 4PSPA 5H1WA 4C1NA 3GU1A 3UNTA 1Y8BA 1PXGA 5KZEA 4KRUA 4I5UA 2YL5A 2D73A 3OQ8A 4HJFA 2O7QA 3UU0A 2HTMA 1GOMA 3MYPA 3PAJA 3WK1A 1RSCA 2VZUA 1VHNA 3SR7A 3ZSTA 2OOFA 4Q4RA 2NSXA 3WQ8A 5HNNA 5C9WA 1XLCA 2IPFA 2C19A 3G1YA 4DX3A 1E6NA 3GU2A 1DORA 1JYVA 4MYXA 1V93A 3T40A 4Q8QA 1A5UA 3QYSA 3U8GA 1GERA 4OTKA 3BLDA 1EP1A 3W84A 3G8EA 3NQCA 2J77A 3AI0A 4MADA 1B3XA 2YFNA 3IEBA 1KTCA 3OBAA 2P10A 4WDXA 2JEPA 2PC4A 4JXCA 4FNUA 3S6DA 3TN6A 3IIOA 3QHOA 3AAMA 3QM3A 4DYEA 2CU0A 4UR8A 1F61A 1FQ0A 1J11A 2OLHA 4UR7A 4BHYA 1CYGA 7REQB 2V3EA 3R8RA 3LEPA 5E9XA 4O1DA 4TVDA 4Q4SA 4UOZA 1AZ2A 4YWOA 3AXXA 2BXYA 2WK2A 4K8DA 3B0PA 2DT0A 3QC0A 3A4AA 3IV3A 4W7VA 1FWDC 3K46A 2Z00A 3MUXA 3UEQA 4LA1A 1M7XA 3WDJA 3EWXA 4H9VA 3IVUA 4KEVA 4GOAA 2FHBA 3VMPA 3GHUA 5HQMA 2DT3A 2YSWA 4WKAA 3HA1A 3IUDA 2EHHA 4EM4A 3E6EA 4L1WA 3OLDA 2G5WA 4L4PA 2JKAA 3H2AA 3RNMA 3SUTA 4GGHA 2DVXA 3RJYA 3P84A 4LUTB 2BSLA 3WQFA 1BQCA 4DUVA 5L9FA 3MS8A 2JEQA 3FK4A 2TPRA 3WMSA 1TV8A 3LENA 5LZLA 3OG2A 3TLLA 3W2LA 2QJIA 4J2PA 3TWBA 4LOCA 4Z1AA 2V69A 3KFTA 2P76A 1XYCA 4XBSA 4GUGA 1G7UA 3EAOA 3N6HA 3K4WA 3VC6A 3TNOA 4AQLA 2X50A 3GVGA 3W2KA 2VFGA 4JFVA 1AW5A 5FJIA 4C6BA 4FX9A 2YPIA 3AROA 1RJQA 1L6WA 4BZYA 2NQ9A 5D2TA 2XIQA 1V6VA 2E40A 3L2MA 3P60A 3ZWSA 1QWGA 3S8HA 3N9KA 4UQAA 2A3AA 4LBSA 3VMNA 3ITOA 3LTSA 1PIGA 2VYOA 3SFKA 2B7OA 3U2EA 2ZDRA 1SW7A 4R9OA 3VD7A 4IM4A 3VX1A 3WMBA 3VVGA 2OSYA 2CHNA 4RK8A 2PDQA 3FDKA 3P5YA 5E9AA 1BHGA 3FXYA 4A8LA 2H8XA 4AVFA 4XD6A 4LUSB 4C1KA 1NDAA 2AKMA 3VGHA 3I4EA 3BLOA 1TE6A 1BYDA 1YPFA 2FMNA 3HMJG 4UZUA 4RDWA 3QR0A 1XHCA 2QIIA 3CS2A 3ZWTA 4WVXA 2G4JA 3ZR5A 4A22A 1KLYA 5CEWA 2OX4A 1OGSA 3OC4A 1G4TA 5AYYA 4A3UA 1TPUA 2D20A 4JIRA 3AXHA 1GPWA 1L6GA 4S2BA 4YTRA 5EMMA 2I17A 3A4XA 5G4EA 1HTIA 1H3GA 1JUKA 4PUMA 2YZRA 4REQB 2VR2A 2IW0A 3U57A 3CU2A 3NOEA 2XSXA 4A2RA 3FSUA 4E0CA 1S2VA 1TCMA 1JEHA 1BD0A 2J8TA 3TFXA 1P4CA 2XWEA 3M6YA 4IQEA 2CLMA 3VABA 4O11A 3U2OA 3I7RA 1CGYA 2ZX9A 4DUXA 4WJEA 5G5GB 4NQ1A 2OSXA 2V3BA 3W2JA 3E1F1 1AW1A 3CTLA 1GJUA 2AL1A 3QR1A 1TPWA 3N2BA 3LADA 2F8QA 4AF0B 3FV9A 3QW4B 5IHRA 2ZVIA 1U83A 2NT0A 3STCA 2FKPA 1VYRA 2J24A 3LLXA 5IHSA 5BRBA 3EYPA 1MFVA 2ZWYA 1IZKA 1Y65A 5XIAA 1XYMA 3W7DA 2C1HA 4LEFA 2VDGA 4ZENA 2Z29A 3SRDA 1OX4A 4YVPA 1FP8A 4Y9AA 1ZAIA 2G3FA 4MFEA 1P0BA 4RKAA 3H23A 3LDVA 1JF5A 3ZLGA 4JQ1A 4ZOEA 3N04A 4NAEA 4R9XA 2CLIA 4WXZA 3B4YA 1VH7A 2QQ6A 4D6IA 3LI1A 2ZUTA 3WLMA 4S1FA 1UD8A 2AAMA 3LCIA 2XHYA 3QW3A 3VNJA 3S5OA 1JD9A 3TN4A 1W37A 1JULA 1PS9A 2IQDA 3CHFA 2GUYA 1KXQA 3QTGA 1BRLB 4ZE5A 3WDIA 5ECVA 1HGWA 1ZHAA 1E4LA 4IMFA 4W84A 3FG2P 4D6FA 4EP8C 1JUBA 1NQ6A 1KM6A 2VRKA 1ECEA 2XH4A 3M0JA 4PULA 2EPLX 3PZUA 2X7VA 2BTMA 4KFOA 5IM51 3GVWA 2OWXA 2YCIX 4URIA 4TVWA 3S6TA 1PX4A 1A0CA 3C4UA 1SUXA 2Y70A 4Y7EA 4A3YA 4HMEA 1AQ0A 4AZIA 3PB2A 3W1QA 1B4EA 3E38A 4LH8A 4UMAA 4FHAA 4S3KA 3HTWA 4FB7A 2ABBA 1GWJA 3OVGA 4GFIA 4H4XA 4O0QA 4Z0JA 3DHDA 5CPQA 2VOTA 5A6KA 2EAWA 1JRBA 3MJMA 5U4NA 5CJNA 3DYPA 3CXOA 4K7VA 2Z7KA 4H7VA 1K03A 4CQBA 1JYWA 1KN0A 3LXCA 2QGHA 1UROA 3L21A 1Q2SA 1ITCA 2E6AA 5M3WA 3S9ZA 2QKFA 4W5ZA 3SBFA 3VOJA 2QMJA 3FXGA 4HHHA 3V5CA 1JD7A 4LC6A 3KP0A 3C2FA 5A8QA 3O0HA 4C5YA 4UQBA 1IT0A 9CGTA 3BTNA 3R6IA 4XZBA 1S7MA 1V02A 1B3YA 4YJ5A 2YCLB 3UG5A 4NXKA 5LSMA 1FP9A 5CC3A 1TZ7A 4EX4A 3WQEA 2QV5A 2J8FA 5EFFA 4CNSA 2WZTA 2PPGA 3IJ7A 4MNLA 2F2KA 4DPQA 1W17A 1KBLA 4RZBA 4DJFA 2QPUA 4MWAA 1GVFA 3QLDA 1OK6A 5F4XA 3Q37A 5FL1A 1XL9A 2ZWZA 2GGGA 4N02A 2DU2A 2IPWA 2ZRVA 1WAWA 3D5HA 3QR3A 5E0KA 2VWTA 2YIHA 3PP7A 2GDQA 3B8DA 3IRSA 1O5KA 1ZY9A 3ZS4A 3LU2A 1EYWA 3OZYA 3TJ4A 2OEMA 3FJ4A 1IF2A 1UKQA 1K4QA 4QXIA 1W54A 4HYWA 2VFDA 1F4HA 3T0BA 1ZX9A 5DBTA 1FFVC 1V0KA 1B3OA 3A7AA 3LI0A 2CFYA 1AQHA 1NDZA 2F9RA 2Y7DA 2HS6A 1KCZA 3KLKA 3LPFA 1VJIA 2XIBA 3PG6A 1WBJA 4HOWA 1EUNA 3JZUA 4V1XA 3W88A 1GVYA 4WY0F 2FZBA 4UTFA 4H2CA 2Q3RA 1D2KA 3XINA 1KXVA 3W3OA 2ZADA 4WOZA 1QHPA 4PH6A 1O5QA 4ZB2A 3F2CA 1BXNA 1Q13A 1UZDA 1RV8A 1XLEA 4FOUA 3O7UA 1OWQA 2NWSA 2OO0A 4CKQA 4QNWA 4AX7A 2IPJA 1H63A 1UG6A 5CLWA 4K36A 1FOBA 1IE7C 5C8BB 3EA1A 3MT1A 3IACA 3EWBX 2DIEA 3W7HA 3C8NA 3N3TA 3PTKA 3S2JA 3ITYA 2ISWA 3AHTA 1BKSA 5DT7A 1TELA 1E6QM 2OLSA 4QDPA 2D2OA 2V2DA 3ATZA 4LRTA 1JRPA 2BC1A 2ZX5A 4QE4A 4LUYA 4DAFA 3WNOA 1OGBA 1P1MA 3MY9A 3P81A 4O52A 5FIPA 3B9OA 3FW6A 5KZDA 1EP2A 2HDJA 3WNNA 4MJZA 2DZAA 2F6UA 1QW7A 1XISA 1DQXA 1S5WA 2YFOA 1HL8A 2O9OA 4PMYA 4OIFA 3VIIA 3RNDA 2BOGX 2G96A 3F4CA 1MO9A 4IFKA 3MUY1 3KOFA 4GH1A 1FCUA 3PZMA 1HJXA 1JZ3A 2BY2A 4LYPA 2HWGA 1ZP3A 3WQDA 4ZO7A 3IJDA 2XUCA 5C9RA 1CCWB 1FWRA 4XWUA 4DEFA 2FTYA 1EUAA 1OC6A 2HE5A 3CEUA 4A21A 1V3KA 4ZODA 2PDPA 1VDVA 1SR9A 1M6IA 3FDGA 4GYFA 1VBUA 4FF7A 1UD6A 3FY1A 3FSTA 2VO5A 4W8BA 3WUEA 2W61A 2YOCA 1A5BA 2CERA 3K1DA 5EKYA 5FF4A 1J0ZA 4LRSA 3EXRA 3SW6A 4E8GA 5CJ5A 2ZZ1A 4AZ7A 1AQFA 3C86A 4I9TA 4B5VA 4O54A 1XX1A 3SQSA 1G9HA 4MTVA 5HR7A 1NP2A 2DUXA 4GUHA 3MP4A 4TMCA 2WWDA 2EG6A 1J0KA 3NL2A 1EBDA 4NZCA 1V59A 1XIDA 1H7OA 6XIMA 3THCA 3PPCA 4KF1A 1VS1A 2R9ZA 4HU0A 4WK9A 1JUEA 2Z6JA 4QE5A 3LHVA 3RU8X 3GTNA 3RIKA 1ML1A 4MKSA 3MUIA 3NSXA 5GQBA 3W7RA 4DBSA 1SVDA 1XLMA 4MOZA 1O68A 4LAUA 2EQ6A 1AH3A 1WPCA 2XIOA 3BE7A 1R86A 3W71A 3ZOAA 3LCFA 2V5BA 5I00A 2DV0A 2FMOA 3MPGA 1GEQA 2CW6A 3S5YA 1GVIA 4YHEA 3AMGA 3FAXA 3EF6A 1KXHA 1QHOA 1L6SA 1WDQA 2QCEA 3ECQA 2PI6A 1TPEA 1IXOA 3N2XA 4NIRA 1FWFC 3VGEA 3OOQA 3BZJA 1EH9A 4QNEA 1PTDA 4H9TA 2CHOA 4RL3A 3GW0A 3T4WA 3GG0A 4E5TA 3A24A 5KMYA 2YDAA 1RUSA 3B3DA 3GZAA 1VC4A 2HSAA 3E49A 2OX1A 2WO5A 3L8KA 4H6KA 3NTYA 4XKYA 3WBXA 4YS1A 1EEPA 1EDGA 4FX8A 4F8XA 5DFAA 1Y7VA 4NF7A 2PTXA 3GUWA 3GXDA 3LERA 5J8LA 3NYDA 2YBUA 4CNNA 4XB3A 1GQNA 1VEOA 1Z3NA 1MQRA 3MMUA 7REQA 1OK4A 2H90A 4DJDD 4WUIA 3DFQA 4DB7A 1C8VA 1XYLA 2GR0A 2DZSA 3WDRA 1UR8A 1VEMA 3SQLA 3IGSA 1RJRA 5D09A 1LBFA 2RGMA 4EIVA 3EDJA 1KNWA 1J0YA 1VKFA 2INEA 2J88A 2X0SA 5ABFA 4ERAA 1R3RA 1DJQA 5HMFA 2ZUUA 4JHOA 4ADWA 4ML4A 1QU4A 3V0SA 3UG3A 1XKJA 1JZ2A 3LB8A 3GFZA 3BQ6A 2OWWA 2QPSA 4DF0A 2C1IA 5CG0A 4ZOBA 2TODA 2XM2A 3WLOA 4PTNA 3OLGA 2C0AA 2UY4A 3AS0A 1T96A 2PLCA 4O4WA 1CXLA 4W85A 4TIMA 2VEMA 1MVYA 2GGHA 3KL3A 3V4BA 4RPQA 3NPXA 3QXBA 8XIAA 3B9JB 1FWJC 2E28A 5I3IA 4HZ8A 1FRBA 4D2JA 4J4KA 5I0DA 4XZLX 4ATWA 3AZSA 2YA0A 1HKWA 3WO8A 3VOHA 2V3FA 1UOKA 3Q45A 2ZVRA 3DHPA 4AC7C 1RQBA 3RMJA 1ZNNA 3NPWA 4FEZA 1EEXA 2Y63A 2XVKA 1LOSA 2NX9A 1XLJA 4IQDA 4JTUA 3RX3A 4XISA 4JIIX 3V16A 3QQ1A 2Z1BA 2YQUA 5DBUA 1O95A 4CQDA 5FF0A 4AF0A 5CZ0A 2IKGA 2NV1A 1QW8A 1XWYA 3MA8A 2QJGA 3R58A 1WKYA 4L56A 3B8SA 2I57A 1D3HA 3C0SA 1XIHA 4BY3A 5GJNA 2ODOA 3CUZA 1T40A 3WLPA 3I68A 2OTDA 5CGTA 1N8FA 4ZSTA 1WDRA 1XLKA 4B92A 2PD9A 4Q6JA 1I1WA 2BZNA 4WGHA 7A3HA 1MUCA 2DQXA 4MY9A 3B9EA 1TJ2A 4NNBA 2PWEA 1TX2A 5LNWA 1IV8A 3E3HA 3PG8A 3CUHA 3DFOA 4XAZA 5FJPA 1N5XA 1UW9A 4R7JA 3CUGA 1DP0A 1XC6A 3IGXA 4JQAA 1KFLA 3UXKA 3GR8A 1Q65A 2PWFA 1NOWA 4ROQA 4TTUA 4Y9MA 2BGNE 4ATDA 3NVWB 3RJXA 4JEJA 2RDXA 3O6DA 3R10A 1I2NA 5H91A 4ZOHB 1ZCOA 1J2BA 1FH9A 3OZPA 4G7FA 2A8XA 4LVFA 1JNDA 2A6NA 3N14A 5BXPA 1V08A 1Y5VA 2G8ZA 3IJ6A 3H2OA 3FVDA 3W1MA 4AVOA 1EQPA 1UD5A 2PLKA 2V68A 3GH5A 4JGDA 1SM9A 4HU3A 1SFSA 3VZXA 4GNKB 2IMRA 4ROPA 4R85A 3EEGA 4AD5A 5BOOA 3VD4A 3H8AA 2YVGA 1ONEA 1QO5A 1GKRA 1C93A 4HNVA 4IPPA 3RITA 1EIXA 3QBUA 4IP4A 4JKLA 3E2QA 3M0IA 1XIBA 1EO7A 2L5HA 4NT0A 2DW7A 2VUYA 4MWAD 2XINA 3UG8A 1M01A 5K9DA 4FMVA 5FJRA 3E0IA 4WKFA 2FZ8A 4GXMA 1J12A 2PTDA 4HJWA 4AYSA 1LPFA 2IXVA 3LBMA 3PBVA 2CKRA 5JBEA 4AD1A 1RBOB 1XGZA 3Q65A 4FK9A 1QMLA 4O18A 1ISZA 2QCGA 2YCLA 4Q22A 1DXIA 4L9YA 3W1XA 4FA3A 3XIMA 3F2BA 2Y88A 2DUAA 1DTNA 4J27A 4M3PA 5HJXA 4C6FA 2OOGA 4GY0A 1XSJA 4UOQA 3H54A 3WF4A 1Q6RA 1DE6A 1HVQA 3UWZA 4ES4A 1FFQA 2ZZ3A 3WZ0E 4JQ4A 3K8LA 5FI8A 3PVFA 1RPKA 2V82A 1Q3NA 4DPPA 1SR0A 4W8LA 3ZYZA 1KFCA 4XTIA 1GVSA 3H2NA 1FY6A 3AMLA 4LWWA 3UVAA 3OA5A 3QFAA 1ZBVA 2NQZA 2VOMA 3W7QA 3DBPA 2FGBA 2PGEA 2PA6A 3GSMA 2WPCA 3VIGA 3N13A 2CLPA 1FKWA 3G3MA 4AEEA 4YN5A 1DKWA 2D2HA 1R7OA 3TTOA 1LROA 5F4WA 5GJMA 1W1IE 3G77A 4LGXA 4K38A 2G95A 3RG6A 3URAA 4ZMGA 3CUIA 3R1ZA 2BG5A 5DMNA 3EWUA 5C7HA 4FNSA 4PMNA 4HA1A 4AIOA 5C9XA 3JVAA 2CBVA 3BV7A 3TN3A 3BSGA 3CWOX 3VX0A 2HPIA 1IEWA 4LU0A 4IT1A 2JE8A 1RA5A 2DDXA 2BHZA 4CNUA 3CZKA 1DWFM 3I6EA 1EQCA 3VOFA 1O5RA 1XRVA 4PMDA 5K9XA 2J6VA 3F5JA 4JHMA 2CLLA 2PP1A 4EVZA 5BROA 5A6AA 3LHZA 3VI2A 2HVMA 1EX1A 3C3NA 5FS7A 3DH7A 3SGZA 3O06A 2BGQA 1HL9A 3KL5A 3OVRA 2R94A 1BVNP 2JF6A 3OB8A 2VX6A 1HKKA 3SURA 2V5KA 1XICA 5A2AA 3G1AA 1OJTA 1FVPA 5EMKA 4IIDA 1NY1A 3ZT7A 4AD4A 1PPIA 1TV4A 4GYPC 1FCQA 3W1RA 3W28A 1OBAA 1W9XA 3O16A 3GR4A 1TCDA 3MKKA 2QAFA 1N8IA 3TJXA 5I7GA 2DORA 1KTNA 5D2VA 4Z1DA 2Z7GA 2ON3A 4FSAA 3UXLA 1RJPA 3WUFA 5F1VA 5JCLA 3VFLA 5ABHA 3LCWA 4M52A 1H5YA 4A35A 4NZ1A 1DV7A 3M0MA 3NRZB 5JCNA 1ME7A 1H4PA 1OINA 4HCHA 4FF5A 3WNLA 1OD8A 5F2MA 2FPVA 4Y9OA 3ARYA 2XH2A 4N2YA 5AKQA 4ZE4A 3BW2A 1YE4A 4KIRA 2QIWA 3HV8A 4CD7A 3UWUA 1F6PA 1KCLA 1HKIA 1GNXA 4H7ZA 2ZXDA 1V6XA 3EDEA 4UBPC 3CUFA 4UUIA 2OVLA 4B3KA 3QGKC 3NZQA 3C6CA 2A0NA 2CLKA 3RHGA 5FF2A 4K8HA 3UBPC 3R94A 4EXBA 2O92A 1W6TA 5CBBA 1QOPA 3W73A 1OIFA 1V6WA 1V3MA 4NJIA 3TA6A 4NU7A 4KERA 1IEQA 4HOXA 2QCNA 1RH9A 2ZXQA 1US2A 1QRQA 5BW6A 4NILA 1CGXA 4Y8EA 1KBIA 4KWVA 4LYQA 1MXDA 1RY8A 3T4CA 3HO8A 4GCXA 3QTPA 4RNHA 1LYXA 3VNZA 1C90A 2X1TA 4IUGA 1XF0A 1TE1A 1JZ4A 5HMEA 4HN8A 4L7ZA 3SCPA 2PWHA 1JL8A 3CIVA 3T05A 3W1LA 3RYSA 4J57A 3KBMA 1EBHA 4LPCA 3SCSA 4XTDA 1O7AA 1KKRA 2R1NA 3RX4A 2AOSA 2PDUA 4OZOA 3VD9A 3S6OA 3HBLA 1XS2A 1X7FA 3CHCA 3WLJA 4DY1A 3T44A 1FWIC 4ZB0A 4DWDA 5H8UA 3URQA 2GYIA 3ARWA 4FI4A 3V75A 3CHVA 4K68A 3ARQA 1V5XA 1DVJA 3M41A 3AZRA 2BXZA 1J0JA 4LB4A 1R3YA 4PCTA 3GWQA 3M0ZA 3HPAA 1K77A 3HPFA 4DIAA 3AQUA 4IG2A 1LQ2A 1Z44A 3BAWA 4V27A 4HZ7A 3WH8A 1ME9A 4TUFA 3GHRA 1SZFA 4CEUC 4QS6A 3TQPA 2OQLA 4F66A 1TV2A 2DW6A 4JYEA 5B7ZA 2A79A 5M5DA 2BOEX 1LOLA 2WVVB 2OELA 4EPEC 5HPOA 3I4KA 2QUNA 4HK7A 3FEQA 4KESA 4X2PA 4MAZA 3R25A 1EC8A 2ZRZA 4BF7A 4C6PA 2OPJA 3T81A 4C7GA 4GJIA 4KCVA 4MZYA 4IFOA 5HNTA 3H21A 1UMLA 3G24A 1M7OA 3GS6A 2QMKA 2QVNA 2V81A 1R3SA 1V7AA 4LANA 4F2TA 1ZY8A 3KP1A 3B03A 3AN1A 3F4WA 1UBPC 3AIWA 1GETA 4REQA 3S2CA 2NLIA 3GAKA 4I6VA 5KVHA 1QDSA 4JTLA 1DJHA 2WSYA 3PWGA 3M16A 7ODCA 3SAZA 1GW1A 1OB0A 4ENLA 3IAPA 4JTEA 1OFPA 1GQIA 4HTBA 2PGRA 2XTKA 3BAIA 1GRBA 2XIJA 1GEUA 2GVEA 3IC9A 3TR2A 3RLUA 1UD2A 4XBJA 1MW1A 3KCOA 4J5NA 4M0XA 3CZJA 3CZLA 2PURA 3NEHA 3KRSA 4S3EA 4F0SA 4DUWA 3UPMA 2FZDA 2I9UA 1R0MA 1H6VA 4WLCA 3NQMA 5HNUA 4IGMA 1K3UA 4AH7A 5AYXA 1V6YA 1MEIA 5TBOA 1JDDA 2VEIA 4H50A 1BTCA 3N73A 1OF8A 2PDIA 3IJIA 1IT8A 3UZWA 8XIMA 3L23A 1XYZA 3CEPA 2JIWA 3DKLA 1QNQA 2YXOA 4YCPA 1LRQA 1PZ0A 2HZGA 4TOQA 4S3GA 4C1NB 1RCXB 1R5YA 4KFNA 2TPSA 1KC7A 4MHBA 3RLHA 4JQ3A 5ABTA 2VHLA 1I2RA 2HPMA 3ES7A 1PIFA 3MDUA 4GNJA 1QT1A 4FS9A 2IKHA 2HV5A 1BFNA 3W07A 4RR4A 1N5WC 4HKPA 4YTTA 1LG2A 3BSMA 4GBUA 1ISVA 4H6EA 5FJOA 1KBBA 1X6NA 6CGTA 5JBFA 4NX5A 4W9TA 2A3BA 3CZ8A 1BGGA 1QBAA 3NVYB 2P8CA 5A8OA 2A5HA 2WQPA 5K3VA 1NDWA 3ATYA 4HMCA 4HU4A 2QT3A 2B7QA 5CPSA 4OVXA 4OUIA 2V6AA 3PZTA 1EB3A 2NVAA 4I9AA 2HE8A 3EMZA 5HWMA 3F7JA 5A6JA 2GR1A 3AXKA 2EQ8A 3QHNA 4FIRA 4DVOA 2WP6A 1VHCA 1ICQA 4JX6A 3P6LA 3KDNA 3TKFA 4RLIA 3MSGA 1E0UA 3NQGA 3OHMB 3W26A 3O9NA 3GUGA 2V0TA 2VZTA 1UWAA 3ZR4A 3KE0A 3HW2A 4NRSA 2XFWA 5C2XA 3B0UX 1KRMA 3L5MA 1GXFA 1XSIA 2XG9A 4XAFA 3DKJA 1CW2A 4WR3A 1TSIA 1DJWA 2PTYA 1Q1RA 1B31A 2POZA 1M9HA 2YZ5A 4U2YA 3HG2A 5ABFB 3APGA 2OZTA 2FJUB 4AWSA 1NM9A 4TU1A 4B5XA 5CH9A 5HDRA 2NVKX 3HPSA 1YDOA 3NO5A 5LA0A 3DHUA 2OYKA 4GVIA 3F2DA 3JS3A 1EZWA 1H2JA 4PMVA 3EOOA 4U33A 4P2VA 1OCBA 4TXEA 3PPHA 5AYZA 8RUCA 1DEDA 3TC7A 1UQYA 4EAMA 9XIMA 4RW3A 3R7MA 3TXVA 3BW4A 1OX6A 3V35A 3WKZA 1YKWA 1E56A 3EMQA 1TO3A 5AVNA 3C3UA 4KETA 5A69A 4CU7A 1GEHA 1DOSA 4JIHA 1XLHA 4PB4A 2BGSA 4W5UA 2DFAA 3A6OA 2WVSA 5M03A 4R7WA 1WYIA 1KTBA 4N42A 4J3ZA 4AFYA 1GPFA 3NGJA 3STPA 4EMJA 8CGTA 3GD3A 1O66A 2DSWA 3GHSA 4GMEA 4S39A 1MYRA 2G4FA 3GZ3A 1EFZA 1L2UA 2Z25A 1CDGA 1Q63A 1XLFA 4M56A 1CLVA 2O9TA 3KLJA 2RJHA 2BASA 3A47A 4PRRA 4ML9A 3VDGA 4B90A 2YBVA 2WKLA 1YTKA 3WBWA 5FF7A 1D9EA 1DIDA 4AY8A 3CO8A 1JPDX 1ZENA 4Y2WA 1IXNA 1H2IA 4FXFA 1NFPA 3OVQA 4UTHA 2GJLA 1DXEA 1LZOA 2QXWA 4UTWC 3R0UA 4AMCA 2PF8A 4EACA 3I7SA 1VYPX 2Y8KA 4W89A 1YMYA 2E4TA 1ZS2A 5JH2A 2GR3A 1PKNA 5M17A 4IHCA 2PAJA 5I77A 3USBA 4L1XA 5CPTA 4AXKA 1QWKA 4X22A 3VE7A 4L9XA 4JKMA 5CZTA 3CLMA 4CQ9A 2EG8A 1AL7A 3OHIA 1E15A 4KEMA 4DBWA 4M82A 3PZOA 4ZFMA 1FIQB 1JCJA 3OGRA 1UD3A 1TVPA 1VEPA 1MMFA 3BG3A 2OZ3A 1XDLA 4CNTA 4BKNA 2EQDA 2BOFX 3A22A 2YJQA 3L4TA 1ISXA 2CEQA 2WZEA 2Y8VA 1JCNA 1J6OA 1VBHA 3L4YA 2WJZA 1W3JA 4Z1YA 1THFD 4JTKA 1ITUA 3VC5A 1SSDA 1NWRA 1HT6A 3B0VC 2WHMA 3C2VA 1UKTA 1A5SA 3MV01 4O57A 4UFHA 4JICA 4CNOA 4W7UA 4G2DA 4XAGA 4WXYA 1CENA 1W2VA 2IXUA 3LY0A 4GA8A 2OCZA 5C0QA 1NHPA 3PUEA 1OG0A 3ZR6A 2V5LA 2WMJA 4Z2JA 3TYAA 1J10A 1EOKA 3NXFA 3CQIA 2VEKA 4JN8A 1E5JA 5AC8A 4LVGA 2NQ5A 1TTJA 1TMQA 1H0IA 5TNVA 5F2GA 4MGGA 2EPNA 1DJIA 4RCXA 1V0LA 3CC1A 3SY5A 5LHEA 2QHAA 2X1RA 4YWSA 2YCKX 4WDUA 3WBAA 3IGHX 3W2UA 1CLKA 3DGHA 1OHLA 4NZ4A 2PDCA 3KLLA 1XPYA 2QJNA 1TJ1A 3A7RA 1LOQA 1KM4A 1Q6FA 3BLKA 4UMBA 3RR1A 2RFGA 2QUVA 4S3BA 4MUPA 1VCVA 3MI6A 4NG3A 1M53A 4NL1A 3S2MA 2HCVA 4FLRA 1UR3M 4IXHA 3UQNA 1FCVA 4WOQA 1K6WA 4XSLA 2AL2A 2WMHA 2QDDA 1ISWA 4IMCA 3M5YA 3N6QA 5D38A 4Y8FA 2Y61A 4L5ZA 3QGAC 4RNIA 3PZIA 3IIVA 5K4ZA 4C7FA 3TCEA 1EA0A 3KWSA 3W74A 4OE7A 3UETA 3M44A 3TAKA 4AHPA 3L0KA 4F0HA 1R3QA 1G94A 1NP0A 4OQVA 4JN6A 2RH9A 1MW2A 1QNVA 3LGGA 1F6KA 4NXSA 2ISVA 3KVKA 4A29A 4BI7A 2DZPA 3VM7A 4UZSA 1EP3A 3VYLA 3K1GA 3BWWA 1Y5WA 5KITA 5D8ZA 3L5LA 4ALDA 5A6LA 2CYGA 2BVYA 1Z42A 2UZ9A 2VXNA 5CZKA 2PWDA 2J7EA 1F3EA 3W29A 1C9DA 3MZNA 5F1UA 3QFWA 4HA0A 5HQLA 3MQTA 1Q7QA 7TIMA 4JAWA 5GPRA 1SZGA 3BPWA 3AIQA 5MKGB 4FNTA 4A2SA 1I1XA 3LXBA 1JNEA 2NWRA 2W5FA 1YADA 4X60A 4PUKA 1HN1A 1EJXC 2WHLA 3EPOA 3DFPA 5L6UA 1IQ8A 4QM1A 1TYPA 1LBMA 2VQTA 1N62C 4LALA 2JKEA 5HXMA 1HJVA 4XV0A 3HOJA 4JDYA 2E25A 3P74A 2QJJA 5T26A 5JIPA 2OQHA 5D8WA 4BWLC 4WJXA 1HF6A 5DO8A 3M47A 3PWIA 4IF2A 2VTFA 5RUBA 1UJQA 2ZRWA 3FAWA 4NJHA 3P7YA 1K8ZA 3UYCA 1P0KA 3AXIA 3VNKA 4OV4A 4XK2A 3KTCA 4PBFA 3U2CA 3VM5A 4GACA 3W7EA 2XGIA 4MPQA 3MCNA 1I9CB 1AH4A 1FHLA 4GI4A 4F9JA 4NUWA 4PB3A 2XISA 2ZDSA 4IJCA 3TV8A 5G2HA 1GTEA 2YVJA 3NQAA 2F84A 3C52A 1P6BA 1F4AA 1R8LA 2PWGA 1C29A 1AMYA