1FHWA

Structure of the pleckstrin homology domain from grp1 in complex with inositol(1,3,4,5,6)pentakisphosphate
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
b'PDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GUANINE NUCLEOTIDE EXCHANGE FACTOR AND INTEGRIN BINDING PROT
publication title Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 26
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fhwA00
5DH9B 2VRWB 2DHIA 3TCAA 1XR0B 1FGYA 1WI1A 3TO1A 5KCVA 2COFA 2W2XD 2H7DA 3TVVA 2KCJA 4A6FA 2Y8FA 5KQ1A 2VSZA 1XCGA 1U5EA 3A98B 4KVGB 2D11A 5D3XA 2UZRA 2D10A 2LYDA 1XD4A 3D8EA 2D9YA 5C5BA 1ZM0A 2Y7BA 4EMOA 4DBBA 1MIXA 4HB4B 3ULBA 4A6KA 1MK7B 2QKLA 3P6AA 1ZVRA 5D3YA 1K5DB 3QBVB 4KHBB 4DXAB 4K17A 5C16A 1I7AA 2CAYA 2J0KA 1DDWA 4ZRKA 3UZTA 3ZDTA 4IAPA 1TQZA 2MKRA 4F7UP 3U8ZA 3HW2B 4F7HA 3HQCA 1J0WA 1UPRA 2D4QA 2J0JA 5HE0A 3ULCA 3FM8C 1WJ1A 4MY6A 4KHAA 3N7CA 2COCA 3F0WA 2LOZA 1Y19B 3QWMA 1V88A 1AQCA 1ZC3B 2RNRB 4IFSA 4IOYX 1AWEA 3KZ1A 3O96A 2R0DA 4H8SA 3TW1A 5HE1A 4YONA 1M7EA 3ODXA 2P0DA 1W1DA 4K81A 1NTVA 1H4RA 5LONB 3V5WA 4HDQA 1MIZB 4TYZA 2K00A 1EAZA 3ML4A 1X11A 3X23A 1Z87A 1WG7A 1QQGA 2DX1A 5J3YA 2Z0QA 2M38A 2ZPYA 4HAWB 4DX8A 2VKIA 3G9WA 2YRYA 1MKEA 2CRFA 2D9WA 4EKUA 2I1JA 1UPQA 2QKMA 1OMWA 4L6EA 2IYBA 1ZSQA 1MAIA 2J0MA 1FGZA 5C79A 2UVMA 2XQNM 3DXEA 2I1KA 2UZSA 2FJLA 1U5DA 3OANA 1WJMA 4HDOA 2RGNB 1XKEA 2ELBA 2IFSA 4HB3B 4GZUA 5EFXA 1BAKA 3WYFB 2EMTA 4D0NB 2YT0A 2CODA 1PMSA 1KI1B 4PNKA 1V61A 4HB0B 1FOEA 1GC7A 1N3HA 2Z0PA 2AL6A 5J3TA 3VOQA 4XWXA 2CY4A 1TXDA 3HK0A 1PLSA 3KRXA 2JP2A 4HHVA 1E5WA 2ADZA 2D9VA 4WVFB 2K2UA 2N23A 3T06A 5KQ4A 4GMXB 2EJ8A 2NZ8B 2W2WA 1V5UA 3GYPA 2HTHB 3ODWA 3AJ4A 5J3QA 3AU5A 3PVWA 4HAXB 1UNRA 1WGQA 3P7ZA 2DKQA 3D8DA 5C6RA 2RUKB 1X05A 4ZRJA 2LULA 2EC1A 1U2BA 1FB8A 2R09A 4EJNA 2DLWA 4A6FB 2BCJA 1UEFA 2DHKA 5FI0A 4F7GA 4MT7A 3BINA 5D3WA 2DN6A 1MPHA 4Z2NA 1FHXA 1OY2A 5C5BB 1XX0A 1RRPB 1U27A 2YT1A 2LOXA 1UNPA 3A8PA 1B55A 1XODA 2YS1A 1OQNA 4CYEA 2J59M 1EGXA 3PG7A 1BTKA 1W1GA 1BWNA 1GC6A 2GCLA 5HE2A 2HE7A 2CY5A 4HB2B 4B6HA 1V5PA 5CLQB 3PEGA 2YSZA 2RVBB 2G35A 4MK0A 4NSWA 4A5KA 3DXDA 1SGHA 5HE3A 1V5MA 5DI9B 4WJ7A 2YS3A 5DHAB 1DBHA 5LOPB 3RCPA 1WGUA 4PQ0A 1BTNA 4TKNA 2ELAA 1K5GB 1EF1A 2K2JA 3NSUA 3SNHA 3U7DA 2D9XA 3AU4A 1KZGA 2Z0OA 2W2XC 2I5CA 3TFMA 5DIFB 1QC6A 4DX90 2DKPA 1J19A 3D8FA 2NMBA 3PSCA 3DXCA 5GOWB 3ODOA 5L81A 2RSGA 1EVHA 1WVHA 3BJIA 3SV1A 3QIJA 1UNQA 2PZ1A 2N0YA 1DDVA 1RJ2A 1P3RA 1ISNA 3KSYA 1H10A 4CHMA 2M14A 1PFJA 2DX5A 1Y5OA 1SHCA 3SYXA 4HAUB 2L2IA 1W1HA 1FAOA 3CIKA 5D3VA 3LJUX 4HAVB 4BBKA 2RLOA 3F5RA 3KY9A 1Q67A 4K2PA 3KRWA 4K2OA 5JP4A 4Z2MB 2D9ZA 2YS5A 2YF0A 1IRSA 2EMSA 1LW3A 1X86A 4YL8A 1X1GA 2Y8GA 2GS0A 1TJ6A 2AEHA 3PP2A 1FHWA 4WSFA 4ZRIA 4CHJA 1DYNA 2X18A 4GMVA 1NI2A 1U5FA 1NU2A 2I5FA 4GXBA 3PVLA 3CXBB 3A8QA 3GYOA 3PVUA 1ZC4B 2COAA 5JLJB 4HAZB 2GCJA 2YVCA 5JHGA 5D27A 2V76A 3IVFA 3MPXA 2H7EA 2DYQA 3WA0A 3PZDA 2ROVA 2LKOA 3FSSA 1V89A 3FEHA 2D2QA 2Q13A 1P6SA 2OTXA 2DFKA 3ZVRA 1DDMA 4HATB 5JHHA 5FI1A 2DYNA 1I2HA 2GJYA 3SO6A 2OQBA 4GN1A 2DHJA 4NY0A 1U29A 2P0HA 2P0FA 2DTCA 3MDBC 4KHOA 1KZ7A 1GG3A 1M7RA 4Y94A 4GPTB 4A6HA 2KUPA 2DA0A 5CLLB 2LG1A 1P5TA 1MK9B 2MDXA 4KAXB 4C0AA 2MWNB 1FHOA 3VIAA 1DROA 2L1CA 2KGXB 2ROZB 4HAYB 5DHFB 3SUZA 1NTYA 4P7IA 1LB1A 3M1IB 2P8VA 1U5GA 2E2XA 2MFQA 1X1FA
chains in the Genus database with same CATH superfamily
5DH9B 2VRWB 2DHIA 3TCAA 1T77A 1XR0B 1FGYA 1WI1A 3TO1A 5KCVA 2COFA 2W2XD 2H7DA 3TVVA 2KCJA 4A6FA 2Y8FA 5KQ1A 2VSZA 1XCGA 1U5EA 3A98B 4KVGB 2D11A 5D3XA 2UZRA 2D10A 2LYDA 1XD4A 4OT1A 3D8EA 2D9YA 5C5BA 1ZM0A 2Y7BA 4EMOA 4DBBA 1MIXA 4HB4B 3ULBA 4A6KA 1MK7B 2QKLA 3P6AA 2R2YA 1ZVRA 5D3YA 1K5DB 4L1RA 3QBVB 4KHBB 4QXAB 4DXAB 4K17A 5C16A 1I7AA 2CAYA 2J0KA 1DDWA 4ZRKA 3UZTA 3ZDTA 4IAPA 1TQZA 2MKRA 4F7UP 3U8ZA 3HW2B 4F7HA 3HQCA 1J0WA 1UPRA 2D4QA 2J0JA 5HE0A 3ULCA 3FM8C 1WJ1A 4MY6A 4KHAA 3N7CA 2COCA 3F0WA 2LOZA 5I2MA 1Y19B 3QWMA 1V88A 1AQCA 1ZC3B 2RNRB 4IFSA 4IOYX 2K49A 1AWEA 3KZ1A 3O96A 2R0DA 4H8SA 3TW1A 2Z14A 5HE1A 4YONA 1M7EA 3ODXA 2P0DA 1W1DA 4K81A 1NTVA 1H4RA 5LONB 3V5WA 4HDQA 1MIZB 4TYZA 2K00A 1EAZA 3ML4A 1X11A 3X23A 1Z87A 1WG7A 3DCXA 1QQGA 2DX1A 3NWFA 5J3YA 2Z0QA 2M38A 2ZPYA 4HAWB 4DX8A 2VKIA 3G9WA 2YRYA 4D6WA 4GNKB 1MKEA 2CRFA 2D9WA 4EKUA 2FJUB 2I1JA 1UPQA 2QKMA 3NWDA 1OMWA 4CSQA 4L6EA 2IYBA 1ZSQA 1MAIA 2J0MA 1FGZA 3HIEA 5C79A 2UVMA 2XQNM 3DXEA 2I1KA 2UZSA 2FJLA 1U5DA 3OANA 1WJMA 4HDOA 2RGNB 5I2SA 1XKEA 2ELBA 2IFSA 4HB3B 4GZUA 5EFXA 1BAKA 3WYFB 2EMTA 4D0NB 2YT0A 2CODA 1PMSA 1KI1B 4PNKA 1V61A 4HB0B 1FOEA 1GC7A 1N3HA 2Z0PA 2AL6A 5J3TA 3VOQA 5IRSA 4XWXA 2CY4A 1TXDA 3HK0A 1PLSA 3KRXA 2JP2A 4HHVA 1E5WA 2ADZA 2D9VA 2Z59A 4WVFB 2K2UA 2N23A 3T06A 5KQ4A 4GMXB 2EJ8A 2NZ8B 2W2WA 1V5UA 3GYPA 2HTHB 3ODWA 3AJ4A 5J3QA 3AU5A 3PVWA 4HAXB 1UNRA 1WGQA 3B77A 3P7ZA 5M4YB 2DKQA 3D8DA 5C6RA 2RUKB 1X05A 1MI1A 2LULA 4ZRJA 2EC1A 1U2BA 2ZKMX 1FB8A 2R09A 4EJNA 2DLWA 4A6FB 2BCJA 1UEFA 2DHKA 5FI0A 4F7GA 4MT7A 3BINA 5D3WA 2DN6A 1MPHA 5LG4B 4Z2NA 2KUQA 1FHXA 1OY2A 3U12A 5C5BB 1XX0A 1RRPB 2Z4DA 1U27A 2YT1A 2LOXA 1UNPA 3A8PA 1B55A 1XODA 2YS1A 1OQNA 4CYEA 2J59M 2YT2A 1EGXA 3PG7A 1BTKA 1ZYIA 1W1GA 1BWNA 1GC6A 2GCLA 5HE2A 2HE7A 2CY5A 4HB2B 4B6HA 1V5PA 5CLQB 3PEGA 2YSZA 2RVBB 2G35A 4MK0A 4NSWA 4A5KA 3DXDA 1SGHA 5HE3A 1V5MA 5DI9B 4WJ7A 2YS3A 5DHAB 1DBHA 5LOPB 3RCPA 4HSIA 1WGUA 4PQ0A 1BTNA 4TKNA 2ELAA 1K5GB 1EF1A 3NW8A 2K2JA 3NSUA 2KIGA 3SNHA 3U7DA 2D9XA 3A58A 3AU4A 1KZGA 2Z0OA 2W2XC 2I5CA 3TFMA 2NBVA 5DIFB 1QC6A 4KHBA 4DX90 2DKPA 1J19A 3D8FA 2NMBA 3PSCA 3DXCA 5GOWB 3ODOA 5L81A 2RSGA 1EVHA 1WVHA 3BJIA 2KIEA 3SV1A 3QIJA 1UNQA 2RRFA 2PZ1A 2N0YA 1DDVA 1RJ2A 1P3RA 4GOUA 1ISNA 3KSYA 1H10A 4CHMA 2M14A 1PFJA 2DX5A 1Y5OA 1SHCA 2KR0A 3SYXA 4HAUB 2L2IA 1W1HA 1FAOA 3CIKA 5D3VA 3LJUX 4HAVB 4BBKA 2RLOA 3F5RA 3KY9A 1Q67A 4K2PA 3KRWA 4K2OA 5JP4A 4Z2MB 2D9ZA 4DIXA 2YS5A 2YF0A 2GUMA 1IRSA 2EMSA 1LW3A 1X86A 4YL8A 1X1GA 2Y8GA 2GS0A 1TJ6A 2AEHA 3PP2A 1FHWA 4WSFA 4ZRIA 4CHJA 1DYNA 2X18A 4GMVA 4QJ4B 1NI2A 1U5FA 1NU2A 2I5FA 4GXBA 3PVLA 3CXBB 3A8QA 3GYOA 3PVUA 4OSNA 1ZC4B 2COAA 3FVCA 5JLJB 4HAZB 2GCJA 2YVCA 5JHGA 5D27A 2V76A 3IVFA 3MPXA 2H7EA 2DYQA 3HSAA 3WA0A 3PZDA 2ROVA 2LKOA 3FSSA 3NWAA 1V89A 3FEHA 2D2QA 2Q13A 1P6SA 2OTXA 2Z13A 2DFKA 3ZVRA 1DDMA 4HATB 4QJ5B 5JHHA 5FI1A 2DYNA 1I2HA 2GJYA 3SO6A 2OQBA 4GN1A 2DHJA 4NY0A 1U29A 2P0HA 2P0FA 2DTCA 3MDBC 4KHOA 1KZ7A 1GG3A 1M7RA 4Y94A 4GPTB 4A6HA 2KUPA 2DA0A 5CLLB 2LG1A 1P5TA 1MK9B 2MDXA 4KAXB 4C0AA 2MWNB 1FHOA 3VIAA 2K8EA 1DROA 3OHMB 2L1CA 2KGXB 2ROZB 4HAYB 5DHFB 3SUZA 1NTYA 4P7IA 1LB1A 3M1IB 2P8VA 4QJ3B 1U5GA 2E2XA 2MFQA 1X1FA
chains in the Genus database with same CATH topology
5DH9B 2VRWB 2DHIA 3TCAA 1XR0B 1FGYA 1WI1A 3TO1A 5KCVA 2COFA 2W2XD 2H7DA 3TVVA 2KCJA 4A6FA 2Y8FA 5KQ1A 2VSZA 1XCGA 1U5EA 3A98B 4KVGB 2D11A 5D3XA 2UZRA 2D10A 2LYDA 1XD4A 3D8EA 2D9YA 5C5BA 1ZM0A 2Y7BA 4EMOA 4DBBA 1MIXA 4HB4B 3ULBA 4A6KA 1MK7B 2QKLA 3P6AA 1ZVRA 5D3YA 1K5DB 3QBVB 4KHBB 4DXAB 4K17A 5C16A 1I7AA 2CAYA 2J0KA 1DDWA 4ZRKA 3UZTA 3ZDTA 4IAPA 1TQZA 2MKRA 4F7UP 3U8ZA 3HW2B 4F7HA 3HQCA 1J0WA 1UPRA 2D4QA 2J0JA 5HE0A 3ULCA 3FM8C 1WJ1A 4MY6A 4KHAA 3N7CA 2COCA 3F0WA 2LOZA 1Y19B 3QWMA 1V88A 1AQCA 1ZC3B 2RNRB 4IFSA 4IOYX 1AWEA 3KZ1A 3O96A 2R0DA 4H8SA 3TW1A 5HE1A 4YONA 1M7EA 3ODXA 2P0DA 1W1DA 4K81A 1NTVA 1H4RA 5LONB 3V5WA 4HDQA 1MIZB 4TYZA 2K00A 1EAZA 3ML4A 1X11A 3X23A 1Z87A 1WG7A 1QQGA 2DX1A 5J3YA 2Z0QA 2M38A 2ZPYA 4HAWB 4DX8A 2VKIA 3G9WA 2YRYA 1MKEA 2CRFA 2D9WA 4EKUA 2I1JA 1UPQA 2QKMA 1OMWA 4L6EA 2IYBA 1ZSQA 1MAIA 2J0MA 1FGZA 5C79A 2UVMA 2XQNM 3DXEA 2I1KA 2UZSA 2FJLA 1U5DA 3OANA 1WJMA 4HDOA 2RGNB 1XKEA 2ELBA 2IFSA 4HB3B 4GZUA 5EFXA 1BAKA 3WYFB 2EMTA 4D0NB 2YT0A 2CODA 1PMSA 1KI1B 4PNKA 1V61A 4HB0B 1FOEA 1GC7A 1N3HA 2Z0PA 2AL6A 5J3TA 3VOQA 4XWXA 2CY4A 1TXDA 3HK0A 1PLSA 3KRXA 2JP2A 4HHVA 1E5WA 2ADZA 2D9VA 4WVFB 2K2UA 2N23A 3T06A 5KQ4A 4GMXB 2EJ8A 2NZ8B 2W2WA 1V5UA 3GYPA 2HTHB 3ODWA 3AJ4A 5J3QA 3AU5A 3PVWA 4HAXB 1UNRA 1WGQA 3P7ZA 2DKQA 3D8DA 5C6RA 2RUKB 1X05A 4ZRJA 2LULA 2EC1A 1U2BA 1FB8A 2R09A 4EJNA 2DLWA 4A6FB 2BCJA 1UEFA 2DHKA 5FI0A 4F7GA 4MT7A 3BINA 5D3WA 2DN6A 1MPHA 4Z2NA 1FHXA 1OY2A 5C5BB 1XX0A 1RRPB 1U27A 2YT1A 2LOXA 1UNPA 3A8PA 1B55A 1XODA 2YS1A 1OQNA 4CYEA 2J59M 1EGXA 3PG7A 1BTKA 1W1GA 1BWNA 1GC6A 2GCLA 5HE2A 2HE7A 2CY5A 4HB2B 4B6HA 1V5PA 5CLQB 3PEGA 2YSZA 2RVBB 2G35A 4MK0A 4NSWA 4A5KA 3DXDA 1SGHA 5HE3A 1V5MA 5DI9B 4WJ7A 2YS3A 5DHAB 1DBHA 5LOPB 3RCPA 1WGUA 4PQ0A 1BTNA 4TKNA 2ELAA 1K5GB 1EF1A 2K2JA 3NSUA 3SNHA 3U7DA 2D9XA 3AU4A 1KZGA 2Z0OA 2W2XC 2I5CA 3TFMA 5DIFB 1QC6A 4DX90 2DKPA 1J19A 3D8FA 2NMBA 3PSCA 3DXCA 5GOWB 3ODOA 5L81A 2RSGA 1EVHA 1WVHA 3BJIA 3SV1A 3QIJA 1UNQA 2PZ1A 2N0YA 1DDVA 1RJ2A 1P3RA 1ISNA 3KSYA 1H10A 4CHMA 2M14A 1PFJA 2DX5A 1Y5OA 1SHCA 3SYXA 4HAUB 2L2IA 1W1HA 1FAOA 3CIKA 5D3VA 3LJUX 4HAVB 4BBKA 2RLOA 3F5RA 3KY9A 1Q67A 4K2PA 3KRWA 4K2OA 5JP4A 4Z2MB 2D9ZA 2YS5A 2YF0A 1IRSA 2EMSA 1LW3A 1X86A 4YL8A 1X1GA 2Y8GA 2GS0A 1TJ6A 2AEHA 3PP2A 1FHWA 4WSFA 4ZRIA 4CHJA 1DYNA 2X18A 4GMVA 1NI2A 1U5FA 1NU2A 2I5FA 4GXBA 3PVLA 3CXBB 3A8QA 3GYOA 3PVUA 1ZC4B 2COAA 5JLJB 4HAZB 2GCJA 2YVCA 5JHGA 5D27A 2V76A 3IVFA 3MPXA 2H7EA 2DYQA 3WA0A 3PZDA 2ROVA 2LKOA 3FSSA 1V89A 3FEHA 2D2QA 2Q13A 1P6SA 2OTXA 2DFKA 3ZVRA 1DDMA 4HATB 5JHHA 5FI1A 2DYNA 1I2HA 2GJYA 3SO6A 2OQBA 4GN1A 2DHJA 4NY0A 1U29A 2P0HA 2P0FA 2DTCA 3MDBC 4KHOA 1KZ7A 1GG3A 1M7RA 4Y94A 4GPTB 4A6HA 2KUPA 2DA0A 5CLLB 2LG1A 1P5TA 1MK9B 2MDXA 4KAXB 4C0AA 2MWNB 1FHOA 3VIAA 1DROA 2L1CA 2KGXB 2ROZB 4HAYB 5DHFB 3SUZA 1NTYA 4P7IA 1LB1A 3M1IB 2P8VA 1U5GA 2E2XA 2MFQA 1X1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DH9 B;  2VRW B;  2DHI A;  3TCA A;  1XR0 B;  1FGY A;  1WI1 A;  3TO1 A;  5KCV A;  2COF A;  2W2X D;  2H7D A;  3TVV A;  2KCJ A;  4A6F A;  2Y8F A;  5KQ1 A;  2VSZ A;  1XCG A;  1U5E A;  3A98 B;  4KVG B;  2D11 A;  5D3X A;  2UZR A;  2D10 A;  2LYD A;  1XD4 A;  3D8E A;  2D9Y A;  5C5B A;  1ZM0 A;  2Y7B A;  4EMO A;  4DBB A;  1MIX A;  4HB4 B;  3ULB A;  4A6K A;  1MK7 B;  2QKL A;  3P6A A;  1ZVR A;  5D3Y A;  1K5D B;  3QBV B;  4KHB B;  4DXA B;  4K17 A;  5C16 A;  1I7A A;  2CAY A;  2J0K A;  1DDW A;  4ZRK A;  3UZT A;  3ZDT A;  4IAP A;  1TQZ A;  2MKR A;  4F7U P;  3U8Z A;  3HW2 B;  4F7H A;  3HQC A;  1J0W A;  1UPR A;  2D4Q A;  2J0J A;  5HE0 A;  3ULC A;  3FM8 C;  1WJ1 A;  4MY6 A;  4KHA A;  3N7C A;  2COC A;  3F0W A;  2LOZ A;  1Y19 B;  3QWM A;  1V88 A;  1AQC A;  1ZC3 B;  2RNR B;  4IFS A;  4IOY X;  1AWE A;  3KZ1 A;  3O96 A;  2R0D A;  4H8S A;  3TW1 A;  5HE1 A;  4YON A;  1M7E A;  3ODX A;  2P0D A;  1W1D A;  4K81 A;  1NTV A;  1H4R A;  5LON B;  3V5W A;  4HDQ A;  1MIZ B;  4TYZ A;  2K00 A;  1EAZ A;  3ML4 A;  1X11 A;  3X23 A;  1Z87 A;  1WG7 A;  1QQG A;  2DX1 A;  5J3Y A;  2Z0Q A;  2M38 A;  2ZPY A;  4HAW B;  4DX8 A;  2VKI A;  3G9W A;  2YRY A;  1MKE A;  2CRF A;  2D9W A;  4EKU A;  2I1J A;  1UPQ A;  2QKM A;  1OMW A;  4L6E A;  2IYB A;  1ZSQ A;  1MAI A;  2J0M A;  1FGZ A;  5C79 A;  2UVM A;  2XQN M;  3DXE A;  2I1K A;  2UZS A;  2FJL A;  1U5D A;  3OAN A;  1WJM A;  4HDO A;  2RGN B;  1XKE A;  2ELB A;  2IFS A;  4HB3 B;  4GZU A;  5EFX A;  1BAK A;  3WYF B;  2EMT A;  4D0N B;  2YT0 A;  2COD A;  1PMS A;  1KI1 B;  4PNK A;  1V61 A;  4HB0 B;  1FOE A;  1GC7 A;  1N3H A;  2Z0P A;  2AL6 A;  5J3T A;  3VOQ A;  4XWX A;  2CY4 A;  1TXD A;  3HK0 A;  1PLS A;  3KRX A;  2JP2 A;  4HHV A;  1E5W A;  2ADZ A;  2D9V A;  4WVF B;  2K2U A;  2N23 A;  3T06 A;  5KQ4 A;  4GMX B;  2EJ8 A;  2NZ8 B;  2W2W A;  1V5U A;  3GYP A;  2HTH B;  3ODW A;  3AJ4 A;  5J3Q A;  3AU5 A;  3PVW A;  4HAX B;  1UNR A;  1WGQ A;  3P7Z A;  2DKQ A;  3D8D A;  5C6R A;  2RUK B;  1X05 A;  4ZRJ A;  2LUL A;  2EC1 A;  1U2B A;  1FB8 A;  2R09 A;  4EJN A;  2DLW A;  4A6F B;  2BCJ A;  1UEF A;  2DHK A;  5FI0 A;  4F7G A;  4MT7 A;  3BIN A;  5D3W A;  2DN6 A;  1MPH A;  4Z2N A;  1FHX A;  1OY2 A;  5C5B B;  1XX0 A;  1RRP B;  1U27 A;  2YT1 A;  2LOX A;  1UNP A;  3A8P A;  1B55 A;  1XOD A;  2YS1 A;  1OQN A;  4CYE A;  2J59 M;  1EGX A;  3PG7 A;  1BTK A;  1W1G A;  1BWN A;  1GC6 A;  2GCL A;  5HE2 A;  2HE7 A;  2CY5 A;  4HB2 B;  4B6H A;  1V5P A;  5CLQ B;  3PEG A;  2YSZ A;  2RVB B;  2G35 A;  4MK0 A;  4NSW A;  4A5K A;  3DXD A;  1SGH A;  5HE3 A;  1V5M A;  5DI9 B;  4WJ7 A;  2YS3 A;  5DHA B;  1DBH A;  5LOP B;  3RCP A;  1WGU A;  4PQ0 A;  1BTN A;  4TKN A;  2ELA A;  1K5G B;  1EF1 A;  2K2J A;  3NSU A;  3SNH A;  3U7D A;  2D9X A;  3AU4 A;  1KZG A;  2Z0O A;  2W2X C;  2I5C A;  3TFM A;  5DIF B;  1QC6 A;  4DX9 0;  2DKP A;  1J19 A;  3D8F A;  2NMB A;  3PSC A;  3DXC A;  5GOW B;  3ODO A;  5L81 A;  2RSG A;  1EVH A;  1WVH A;  3BJI A;  3SV1 A;  3QIJ A;  1UNQ A;  2PZ1 A;  2N0Y A;  1DDV A;  1RJ2 A;  1P3R A;  1ISN A;  3KSY A;  1H10 A;  4CHM A;  2M14 A;  1PFJ A;  2DX5 A;  1Y5O A;  1SHC A;  3SYX A;  4HAU B;  2L2I A;  1W1H A;  1FAO A;  3CIK A;  5D3V A;  3LJU X;  4HAV B;  4BBK A;  2RLO A;  3F5R A;  3KY9 A;  1Q67 A;  4K2P A;  3KRW A;  4K2O A;  5JP4 A;  4Z2M B;  2D9Z A;  2YS5 A;  2YF0 A;  1IRS A;  2EMS A;  1LW3 A;  1X86 A;  4YL8 A;  1X1G A;  2Y8G A;  2GS0 A;  1TJ6 A;  2AEH A;  3PP2 A;  1FHW A;  4WSF A;  4ZRI A;  4CHJ A;  1DYN A;  2X18 A;  4GMV A;  1NI2 A;  1U5F A;  1NU2 A;  2I5F A;  4GXB A;  3PVL A;  3CXB B;  3A8Q A;  3GYO A;  3PVU A;  1ZC4 B;  2COA A;  5JLJ B;  4HAZ B;  2GCJ A;  2YVC A;  5JHG A;  5D27 A;  2V76 A;  3IVF A;  3MPX A;  2H7E A;  2DYQ A;  3WA0 A;  3PZD A;  2ROV A;  2LKO A;  3FSS A;  1V89 A;  3FEH A;  2D2Q A;  2Q13 A;  1P6S A;  2OTX A;  2DFK A;  3ZVR A;  1DDM A;  4HAT B;  5JHH A;  5FI1 A;  2DYN A;  1I2H A;  2GJY A;  3SO6 A;  2OQB A;  4GN1 A;  2DHJ A;  4NY0 A;  1U29 A;  2P0H A;  2P0F A;  2DTC A;  3MDB C;  4KHO A;  1KZ7 A;  1GG3 A;  1M7R A;  4Y94 A;  4GPT B;  4A6H A;  2KUP A;  2DA0 A;  5CLL B;  2LG1 A;  1P5T A;  1MK9 B;  2MDX A;  4KAX B;  4C0A A;  2MWN B;  1FHO A;  3VIA A;  1DRO A;  2L1C A;  2KGX B;  2ROZ B;  4HAY B;  5DHF B;  3SUZ A;  1NTY A;  4P7I A;  1LB1 A;  3M1I B;  2P8V A;  1U5G A;  2E2X A;  2MFQ A;  1X1F A; 
#chains in the Genus database with same CATH topology
 5DH9 B;  2VRW B;  2DHI A;  3TCA A;  1T77 A;  1XR0 B;  1FGY A;  1WI1 A;  3TO1 A;  5KCV A;  2COF A;  2W2X D;  2H7D A;  3TVV A;  2KCJ A;  4A6F A;  2Y8F A;  5KQ1 A;  2VSZ A;  1XCG A;  1U5E A;  3A98 B;  4KVG B;  2D11 A;  5D3X A;  2UZR A;  2D10 A;  2LYD A;  1XD4 A;  4OT1 A;  3D8E A;  2D9Y A;  5C5B A;  1ZM0 A;  2Y7B A;  4EMO A;  4DBB A;  1MIX A;  4HB4 B;  3ULB A;  4A6K A;  1MK7 B;  2QKL A;  3P6A A;  2R2Y A;  1ZVR A;  5D3Y A;  1K5D B;  4L1R A;  3QBV B;  4KHB B;  4QXA B;  4DXA B;  4K17 A;  5C16 A;  1I7A A;  2CAY A;  2J0K A;  1DDW A;  4ZRK A;  3UZT A;  3ZDT A;  4IAP A;  1TQZ A;  2MKR A;  4F7U P;  3U8Z A;  3HW2 B;  4F7H A;  3HQC A;  1J0W A;  1UPR A;  2D4Q A;  2J0J A;  5HE0 A;  3ULC A;  3FM8 C;  1WJ1 A;  4MY6 A;  4KHA A;  3N7C A;  2COC A;  3F0W A;  2LOZ A;  5I2M A;  1Y19 B;  3QWM A;  1V88 A;  1AQC A;  1ZC3 B;  2RNR B;  4IFS A;  4IOY X;  2K49 A;  1AWE A;  3KZ1 A;  3O96 A;  2R0D A;  4H8S A;  3TW1 A;  2Z14 A;  5HE1 A;  4YON A;  1M7E A;  3ODX A;  2P0D A;  1W1D A;  4K81 A;  1NTV A;  1H4R A;  5LON B;  3V5W A;  4HDQ A;  1MIZ B;  4TYZ A;  2K00 A;  1EAZ A;  3ML4 A;  1X11 A;  3X23 A;  1Z87 A;  1WG7 A;  3DCX A;  1QQG A;  2DX1 A;  3NWF A;  5J3Y A;  2Z0Q A;  2M38 A;  2ZPY A;  4HAW B;  4DX8 A;  2VKI A;  3G9W A;  2YRY A;  4D6W A;  4GNK B;  1MKE A;  2CRF A;  2D9W A;  4EKU A;  2FJU B;  2I1J A;  1UPQ A;  2QKM A;  3NWD A;  1OMW A;  4CSQ A;  4L6E A;  2IYB A;  1ZSQ A;  1MAI A;  2J0M A;  1FGZ A;  3HIE A;  5C79 A;  2UVM A;  2XQN M;  3DXE A;  2I1K A;  2UZS A;  2FJL A;  1U5D A;  3OAN A;  1WJM A;  4HDO A;  2RGN B;  5I2S A;  1XKE A;  2ELB A;  2IFS A;  4HB3 B;  4GZU A;  5EFX A;  1BAK A;  3WYF B;  2EMT A;  4D0N B;  2YT0 A;  2COD A;  1PMS A;  1KI1 B;  4PNK A;  1V61 A;  4HB0 B;  1FOE A;  1GC7 A;  1N3H A;  2Z0P A;  2AL6 A;  5J3T A;  3VOQ A;  5IRS A;  4XWX A;  2CY4 A;  1TXD A;  3HK0 A;  1PLS A;  3KRX A;  2JP2 A;  4HHV A;  1E5W A;  2ADZ A;  2D9V A;  2Z59 A;  4WVF B;  2K2U A;  2N23 A;  3T06 A;  5KQ4 A;  4GMX B;  2EJ8 A;  2NZ8 B;  2W2W A;  1V5U A;  3GYP A;  2HTH B;  3ODW A;  3AJ4 A;  5J3Q A;  3AU5 A;  3PVW A;  4HAX B;  1UNR A;  1WGQ A;  3B77 A;  3P7Z A;  5M4Y B;  2DKQ A;  3D8D A;  5C6R A;  2RUK B;  1X05 A;  1MI1 A;  2LUL A;  4ZRJ A;  2EC1 A;  1U2B A;  2ZKM X;  1FB8 A;  2R09 A;  4EJN A;  2DLW A;  4A6F B;  2BCJ A;  1UEF A;  2DHK A;  5FI0 A;  4F7G A;  4MT7 A;  3BIN A;  5D3W A;  2DN6 A;  1MPH A;  5LG4 B;  4Z2N A;  2KUQ A;  1FHX A;  1OY2 A;  3U12 A;  5C5B B;  1XX0 A;  1RRP B;  2Z4D A;  1U27 A;  2YT1 A;  2LOX A;  1UNP A;  3A8P A;  1B55 A;  1XOD A;  2YS1 A;  1OQN A;  4CYE A;  2J59 M;  2YT2 A;  1EGX A;  3PG7 A;  1BTK A;  1ZYI A;  1W1G A;  1BWN A;  1GC6 A;  2GCL A;  5HE2 A;  2HE7 A;  2CY5 A;  4HB2 B;  4B6H A;  1V5P A;  5CLQ B;  3PEG A;  2YSZ A;  2RVB B;  2G35 A;  4MK0 A;  4NSW A;  4A5K A;  3DXD A;  1SGH A;  5HE3 A;  1V5M A;  5DI9 B;  4WJ7 A;  2YS3 A;  5DHA B;  1DBH A;  5LOP B;  3RCP A;  4HSI A;  1WGU A;  4PQ0 A;  1BTN A;  4TKN A;  2ELA A;  1K5G B;  1EF1 A;  3NW8 A;  2K2J A;  3NSU A;  2KIG A;  3SNH A;  3U7D A;  2D9X A;  3A58 A;  3AU4 A;  1KZG A;  2Z0O A;  2W2X C;  2I5C A;  3TFM A;  2NBV A;  5DIF B;  1QC6 A;  4KHB A;  4DX9 0;  2DKP A;  1J19 A;  3D8F A;  2NMB A;  3PSC A;  3DXC A;  5GOW B;  3ODO A;  5L81 A;  2RSG A;  1EVH A;  1WVH A;  3BJI A;  2KIE A;  3SV1 A;  3QIJ A;  1UNQ A;  2RRF A;  2PZ1 A;  2N0Y A;  1DDV A;  1RJ2 A;  1P3R A;  4GOU A;  1ISN A;  3KSY A;  1H10 A;  4CHM A;  2M14 A;  1PFJ A;  2DX5 A;  1Y5O A;  1SHC A;  2KR0 A;  3SYX A;  4HAU B;  2L2I A;  1W1H A;  1FAO A;  3CIK A;  5D3V A;  3LJU X;  4HAV B;  4BBK A;  2RLO A;  3F5R A;  3KY9 A;  1Q67 A;  4K2P A;  3KRW A;  4K2O A;  5JP4 A;  4Z2M B;  2D9Z A;  4DIX A;  2YS5 A;  2YF0 A;  2GUM A;  1IRS A;  2EMS A;  1LW3 A;  1X86 A;  4YL8 A;  1X1G A;  2Y8G A;  2GS0 A;  1TJ6 A;  2AEH A;  3PP2 A;  1FHW A;  4WSF A;  4ZRI A;  4CHJ A;  1DYN A;  2X18 A;  4GMV A;  4QJ4 B;  1NI2 A;  1U5F A;  1NU2 A;  2I5F A;  4GXB A;  3PVL A;  3CXB B;  3A8Q A;  3GYO A;  3PVU A;  4OSN A;  1ZC4 B;  2COA A;  3FVC A;  5JLJ B;  4HAZ B;  2GCJ A;  2YVC A;  5JHG A;  5D27 A;  2V76 A;  3IVF A;  3MPX A;  2H7E A;  2DYQ A;  3HSA A;  3WA0 A;  3PZD A;  2ROV A;  2LKO A;  3FSS A;  3NWA A;  1V89 A;  3FEH A;  2D2Q A;  2Q13 A;  1P6S A;  2OTX A;  2Z13 A;  2DFK A;  3ZVR A;  1DDM A;  4HAT B;  4QJ5 B;  5JHH A;  5FI1 A;  2DYN A;  1I2H A;  2GJY A;  3SO6 A;  2OQB A;  4GN1 A;  2DHJ A;  4NY0 A;  1U29 A;  2P0H A;  2P0F A;  2DTC A;  3MDB C;  4KHO A;  1KZ7 A;  1GG3 A;  1M7R A;  4Y94 A;  4GPT B;  4A6H A;  2KUP A;  2DA0 A;  5CLL B;  2LG1 A;  1P5T A;  1MK9 B;  2MDX A;  4KAX B;  4C0A A;  2MWN B;  1FHO A;  3VIA A;  2K8E A;  1DRO A;  3OHM B;  2L1C A;  2KGX B;  2ROZ B;  4HAY B;  5DHF B;  3SUZ A;  1NTY A;  4P7I A;  1LB1 A;  3M1I B;  2P8V A;  4QJ3 B;  1U5G A;  2E2X A;  2MFQ A;  1X1F A; 
#chains in the Genus database with same CATH homology
 5DH9 B;  2VRW B;  2DHI A;  3TCA A;  1XR0 B;  1FGY A;  1WI1 A;  3TO1 A;  5KCV A;  2COF A;  2W2X D;  2H7D A;  3TVV A;  2KCJ A;  4A6F A;  2Y8F A;  5KQ1 A;  2VSZ A;  1XCG A;  1U5E A;  3A98 B;  4KVG B;  2D11 A;  5D3X A;  2UZR A;  2D10 A;  2LYD A;  1XD4 A;  3D8E A;  2D9Y A;  5C5B A;  1ZM0 A;  2Y7B A;  4EMO A;  4DBB A;  1MIX A;  4HB4 B;  3ULB A;  4A6K A;  1MK7 B;  2QKL A;  3P6A A;  1ZVR A;  5D3Y A;  1K5D B;  3QBV B;  4KHB B;  4DXA B;  4K17 A;  5C16 A;  1I7A A;  2CAY A;  2J0K A;  1DDW A;  4ZRK A;  3UZT A;  3ZDT A;  4IAP A;  1TQZ A;  2MKR A;  4F7U P;  3U8Z A;  3HW2 B;  4F7H A;  3HQC A;  1J0W A;  1UPR A;  2D4Q A;  2J0J A;  5HE0 A;  3ULC A;  3FM8 C;  1WJ1 A;  4MY6 A;  4KHA A;  3N7C A;  2COC A;  3F0W A;  2LOZ A;  1Y19 B;  3QWM A;  1V88 A;  1AQC A;  1ZC3 B;  2RNR B;  4IFS A;  4IOY X;  1AWE A;  3KZ1 A;  3O96 A;  2R0D A;  4H8S A;  3TW1 A;  5HE1 A;  4YON A;  1M7E A;  3ODX A;  2P0D A;  1W1D A;  4K81 A;  1NTV A;  1H4R A;  5LON B;  3V5W A;  4HDQ A;  1MIZ B;  4TYZ A;  2K00 A;  1EAZ A;  3ML4 A;  1X11 A;  3X23 A;  1Z87 A;  1WG7 A;  1QQG A;  2DX1 A;  5J3Y A;  2Z0Q A;  2M38 A;  2ZPY A;  4HAW B;  4DX8 A;  2VKI A;  3G9W A;  2YRY A;  1MKE A;  2CRF A;  2D9W A;  4EKU A;  2I1J A;  1UPQ A;  2QKM A;  1OMW A;  4L6E A;  2IYB A;  1ZSQ A;  1MAI A;  2J0M A;  1FGZ A;  5C79 A;  2UVM A;  2XQN M;  3DXE A;  2I1K A;  2UZS A;  2FJL A;  1U5D A;  3OAN A;  1WJM A;  4HDO A;  2RGN B;  1XKE A;  2ELB A;  2IFS A;  4HB3 B;  4GZU A;  5EFX A;  1BAK A;  3WYF B;  2EMT A;  4D0N B;  2YT0 A;  2COD A;  1PMS A;  1KI1 B;  4PNK A;  1V61 A;  4HB0 B;  1FOE A;  1GC7 A;  1N3H A;  2Z0P A;  2AL6 A;  5J3T A;  3VOQ A;  4XWX A;  2CY4 A;  1TXD A;  3HK0 A;  1PLS A;  3KRX A;  2JP2 A;  4HHV A;  1E5W A;  2ADZ A;  2D9V A;  4WVF B;  2K2U A;  2N23 A;  3T06 A;  5KQ4 A;  4GMX B;  2EJ8 A;  2NZ8 B;  2W2W A;  1V5U A;  3GYP A;  2HTH B;  3ODW A;  3AJ4 A;  5J3Q A;  3AU5 A;  3PVW A;  4HAX B;  1UNR A;  1WGQ A;  3P7Z A;  2DKQ A;  3D8D A;  5C6R A;  2RUK B;  1X05 A;  4ZRJ A;  2LUL A;  2EC1 A;  1U2B A;  1FB8 A;  2R09 A;  4EJN A;  2DLW A;  4A6F B;  2BCJ A;  1UEF A;  2DHK A;  5FI0 A;  4F7G A;  4MT7 A;  3BIN A;  5D3W A;  2DN6 A;  1MPH A;  4Z2N A;  1FHX A;  1OY2 A;  5C5B B;  1XX0 A;  1RRP B;  1U27 A;  2YT1 A;  2LOX A;  1UNP A;  3A8P A;  1B55 A;  1XOD A;  2YS1 A;  1OQN A;  4CYE A;  2J59 M;  1EGX A;  3PG7 A;  1BTK A;  1W1G A;  1BWN A;  1GC6 A;  2GCL A;  5HE2 A;  2HE7 A;  2CY5 A;  4HB2 B;  4B6H A;  1V5P A;  5CLQ B;  3PEG A;  2YSZ A;  2RVB B;  2G35 A;  4MK0 A;  4NSW A;  4A5K A;  3DXD A;  1SGH A;  5HE3 A;  1V5M A;  5DI9 B;  4WJ7 A;  2YS3 A;  5DHA B;  1DBH A;  5LOP B;  3RCP A;  1WGU A;  4PQ0 A;  1BTN A;  4TKN A;  2ELA A;  1K5G B;  1EF1 A;  2K2J A;  3NSU A;  3SNH A;  3U7D A;  2D9X A;  3AU4 A;  1KZG A;  2Z0O A;  2W2X C;  2I5C A;  3TFM A;  5DIF B;  1QC6 A;  4DX9 0;  2DKP A;  1J19 A;  3D8F A;  2NMB A;  3PSC A;  3DXC A;  5GOW B;  3ODO A;  5L81 A;  2RSG A;  1EVH A;  1WVH A;  3BJI A;  3SV1 A;  3QIJ A;  1UNQ A;  2PZ1 A;  2N0Y A;  1DDV A;  1RJ2 A;  1P3R A;  1ISN A;  3KSY A;  1H10 A;  4CHM A;  2M14 A;  1PFJ A;  2DX5 A;  1Y5O A;  1SHC A;  3SYX A;  4HAU B;  2L2I A;  1W1H A;  1FAO A;  3CIK A;  5D3V A;  3LJU X;  4HAV B;  4BBK A;  2RLO A;  3F5R A;  3KY9 A;  1Q67 A;  4K2P A;  3KRW A;  4K2O A;  5JP4 A;  4Z2M B;  2D9Z A;  2YS5 A;  2YF0 A;  1IRS A;  2EMS A;  1LW3 A;  1X86 A;  4YL8 A;  1X1G A;  2Y8G A;  2GS0 A;  1TJ6 A;  2AEH A;  3PP2 A;  1FHW A;  4WSF A;  4ZRI A;  4CHJ A;  1DYN A;  2X18 A;  4GMV A;  1NI2 A;  1U5F A;  1NU2 A;  2I5F A;  4GXB A;  3PVL A;  3CXB B;  3A8Q A;  3GYO A;  3PVU A;  1ZC4 B;  2COA A;  5JLJ B;  4HAZ B;  2GCJ A;  2YVC A;  5JHG A;  5D27 A;  2V76 A;  3IVF A;  3MPX A;  2H7E A;  2DYQ A;  3WA0 A;  3PZD A;  2ROV A;  2LKO A;  3FSS A;  1V89 A;  3FEH A;  2D2Q A;  2Q13 A;  1P6S A;  2OTX A;  2DFK A;  3ZVR A;  1DDM A;  4HAT B;  5JHH A;  5FI1 A;  2DYN A;  1I2H A;  2GJY A;  3SO6 A;  2OQB A;  4GN1 A;  2DHJ A;  4NY0 A;  1U29 A;  2P0H A;  2P0F A;  2DTC A;  3MDB C;  4KHO A;  1KZ7 A;  1GG3 A;  1M7R A;  4Y94 A;  4GPT B;  4A6H A;  2KUP A;  2DA0 A;  5CLL B;  2LG1 A;  1P5T A;  1MK9 B;  2MDX A;  4KAX B;  4C0A A;  2MWN B;  1FHO A;  3VIA A;  1DRO A;  2L1C A;  2KGX B;  2ROZ B;  4HAY B;  5DHF B;  3SUZ A;  1NTY A;  4P7I A;  1LB1 A;  3M1I B;  2P8V A;  1U5G A;  2E2X A;  2MFQ A;  1X1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...