1FI2A

Crystal structure of germin (oxalate oxidase)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
201
Chain Sequence
TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germin is a manganese containing homohexamer with oxalate oxidase and superoxide dismutase activities.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords OXALATE OXIDASE
total genus 44
structure length 201
sequence length 201
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2000-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fi2A00
5I8SA 2XL7A 5FDBA 4O9GA 4HVQA 3DL3A 3TNQA 1FT9A 4HSLA 2PHLA 2VECA 4XFHA 1OD5A 2OA2A 3NKTA 3RPQA 2Q30A 3I54A 3BCWA 5LEKA 1J1LA 3EO6A 3NW4A 4RD7A 4CYDA 4KWJA 4QGLA 4ONUA 2O1QA 2GH2A 1ZRDA 2Z69A 3U11A 3BALA 3G7DA 5FCCA 3KMHA 4KU8A 2H0VA 4H7LA 1DGWA 3RZZA 1QXRA 5I0RA 3E5XA 1LB2A 1I6XA 1ZREA 4J1WA 3GBFA 3SMHA 1IPJA 5HI0A 1EP0A 2UY8A 3KCCA 5J48A 4IEQA 5EZWA 2BGCA 1X82A 3E6DA 4MV2A 3U0ZA 1O3TA 4LLOA 4YNIA 3EHKA 5I0TA 3CO2A 1X8EA 3H1WA 1L3JA 3QACA 2Q1ZB 4B29A 4UBGA 2HJIA 2WC2A 1J3PA 2ET7A 4HVRA 4IEOA 3ELNA 4QGMA 3B02A 4PIXA 3I7DA 4I02A 4K8FA 4MH0E 4BHPA 5FLIA 1ZVFA 1ZRFA 1QXJA 4E2QA 1YLLA 2XLGA 2PYTA 3E97A 5KHIA 2PA7A 4I0AA 3KGZA 3LWCA 3NL1A 4LUMA 2OYZA 3WW1A 4EWDA 4HMZA 3UKNA 3OGJA 4TLFA 2BNMA 2PAKA 1TQ5A 4Q0VA 4I2OA 2E9QA 4FT8A 2FQPA 1CAXB 3D82A 5KHJA 3N4MA 3FFQA 4AXOA 2BNNA 2VPVA 1ZZBA 4UBHA 3FZ3A 3M3IA 2XHKA 5J3UA 4F7ZA 1XRUA 4O9EA 3C3VA 3RYRA 2XKOA 2ZKLA 4FBFA 3IIAA 2I45A 3MYXA 5FPXA 2QJVA 5FQ0B 5BPXA 5KBFA 1YFYA 2B9UA 4PIZA 4HLTA 1FI2A 2KXLA 4AQ6A 5JAXA 1RUOA 3UKVA 5BY5A 4R52A 1Y9QA 4MUVA 5I93A 4I09A 2OZ6A 4Z07A 5I8YA 3ACLA 4AQ2A 5C8WA 4XFGA 4HSJA 4Q0SA 1NE6A 2GC2A 4JTOA 3IWZA 1ZZ8A 3H1YA 4LEJA 3H9AA 3LA7A 3SCHA 1O3SA 4I0BA 1ZZ9A 3RYKA 3PVBB 5KHHA 5FQ0A 4HN1A 2P17A 4IEWA 4EV0A 4ORFA 1NE4A 3HT1A 3IBMA 5CVRA 4YSFA 4EWEA 4XF3A 2CAUA 2IXLA 4XFAA 3H50A 1CAVB 3DN7A 1CGPA 1YFXA 3OF1A 3USSA 1CAXA 4ZU4A 4Q29A 5FLJA 4XF1A 1X7NA 1QWRA 2PQQA 2GC0A 1LRHA 2F4PA 2GC1A 4META 1ZNPA 3RNSA 4E2GA 1CAVA 4D7TA 3SHRA 3FWEA 3PNAA 4IEXA 1Q3EA 4PJYA 3WW4A 2BEOA 2EAAA 2IXJA 1CAUB 2N7GA 2VQAA 4I01A 3ES1A 1YUDA 1UCXA 3SCGA 1DGRA 5D1IA 4XF4A 4LTAA 1ZX5A 3U10A 3QOPA 5JSRA 3NVCA 3FHIB 4LULA 4OFGA 3E5QA 4D7SA 3FE5A 1XE7A 2H6CA 3UKTA 1SEFA 3MPBA 2IXIA 1RUNA 5I91A 1EPZA 3OCPA 1RC6A 4A2UA 3KGLA 3WW3A 1UIJA 1J3QA 4X6QB 1OFNA 4IETA 2B8MA 3H7YA 1YFUA 3E6CC 4JTNA 3M70A 5CU1A 2BYVE 1LR5A 2DCTA 4P9GA 4YARA 4N9IA 2QVSB 2MNGA 2K0GA 3FJSA 5AVPA 3RYPA 2B5HA 4WVZA 4XFFA 4LA2A 3D0JA 1Q5OA 4Q0PA 2MPFA 4PIYA 3CLPA 4GULA 1VJ2A 1EY2A 1I5ZA 2QCSB 4MGIE 4QM8A 4LA3A 2IC1A 2UYBA 3S7IA 1ZZCA 2WFPA 1ZRCA 1ZZ7A 4FAGA 2IXCA 1HW5A 3CEWA 1Y3TA 1PMIA 4MZUA 2D40A 4YRDA 4MGKE 1ZRRA 2PAEA 5LEJA 5KHGA 2Y0OA 5J7MA 2XGXA 3EQEA 1U12A 2PHDA 5I0UA 3JZVA 3LA3A 4IEVA 2XLFA 1IPKA 4KU7A 4ZU5A 2OZJA 4EROA 2ETEA 1O3QA 4F8AA 5JSOA 1FXZA 2EVXA 4QMAA 4NVPA 4FAHA 4N9HA 4BH9A 4KL1A 1H1IA 1G6NA 4WZCA 2ZCWA 3S7EA 5JCTA 3WW2A 4KWLA 4XF0A 1DZRA 4XFCA 2PFWA 3BB6A 4XFIA 1GQHA 1VP6A 5JR7B 4E2SA 2BNOA 2D5HA 3OD0A 1SQ4A 3H8UA 1YFWA 5K8SA 4QM9A 3H3UA 3OTFA 2QDRA 4MGYE 1RGSA 4UXAA 2XL9A 2C0ZA 5E16A 4AVCA 2H6BA 3BU7A 3ES4A 3IDBB 4IEPA 4EWAA 3I59B 4HVOA 5F1RA 2GZWA 2XKPA 3O14A 3DV8A 2D93A 1J58A 5BXXA 1X8MA 2EA7A 4IEYA 5FLHA 4YYOA 3EBRA 2ET1A 1J59A 4Z82A 2IXKA 3HQXA 3D0SA 5E1RA 1UD1A 3SXWA 3ROUA 2UY9A 1CAWA 4I3PA 1VR3A 5I0SA 1H1MA 2V09A 4HBNA 3L2HA 4XFBA 1CAWB 1JUHA 4IEZA 4AVAA 1UW8A 4QGNA 3H1MA 3KSCA 2Q0AA 5BUVA 4JVAA 4Q0QA 1NYWA 4MX3A 5JSPA 1Q43A 1O4TA 2CAVA 1V70A 4WBBA 3PLQA 4L2NA 4X6RB 4XEZA 2Z2SB 2XLAA 5T3NA 3VHRA 2GAUA 1NZCA 3SCFA 3LA2A 2UYAA 1WA4A 5I8TA 5C6CA 3FX3A 1CAUA 3H3ZA 4AVBA 4XF9A 1LKNA 2D5FA 3I59A 4JV4A 3HIFA 4J1XA 1PM7A 1O5UA 3LAGA 3RDIA 4HN0A 2QNKA 4BIFA 3R6SA 1UIKA 4L11A 4XETA 3ZDSA 3H7JA 3LZZA 1WGPA 2ATFA 1J3RA 3E5UA 3CF6E 3BPZA 2MHFA 1OMIA 3MDPA 4DINB 5BV6A 1RTVA 3E6BA 4QX5A 5LRRA 4ZU7A 2CGPA 2GC3A 4R8HA 1O3RA 1EYBA 3HT2A 1WLTA 4IEUA 5KHKA 3ETQA 1O7FA 4IESA 3EJKA 3NSTA 5FPZA 2GU9A 3DKWA 2HKXA 1NXMA 4Q0UA 1DZTA 3LOIA 1QY4A 1YHFA 4KWKA 3TNPB 2Q4SA 1GQGA 2O8QA 2CV6A 4BYYA 3ST7A 1CX4A 2FMYA 2IXHA 5CADA 5EFUA 3CL1A 3IDCB 1ZZ6A 4QXKA 2K9ZA 1O5LA 1XE8A 1YWKA 5LRSA 3CJXA 1RL3A 1UPIA 2PAMA 4MGZE 3S0MA 2OPKA 3GYDA 1OI6A 4HZFA 1SFNA 4IERA 2PTMA 3NJZA 3MZHA 4LUKA 4OLLA
chains in the Genus database with same CATH superfamily
2MEV1 2XL7A 2P1BA 2A6VA 2ZBJA 3DPRC 4HVQA 1Y9MA 1HLCA 5FDBA 2WINB 4HSLA 4YW1A 3SKVA 2QDNA 5LATA 3RPQA 5LA2A 2AUYA 4Y1ZA 4UF0A 3OYWB 2JDHA 3CIHA 4L0PA 3SKJE 2AEYA 2YU1A 4TYSA 2RS12 1K12A 2FCTA 4RD7A 2AH2A 3KLSA 3VDCA 4CYDA 2ZGKA 5IVVA 4FO9A 4FTSA 2ZX3A 4KWJA 4NHYA 5DAQA 1UMHA 1I3HA 2R49A 3CNAA 4Y24A 4B1MA 2HWB3 2Z69A 5FZOA 1ZBA3 3GCWA 1JYCA 1QQP3 2W39A 1T6GC 5FCCA 4D6RA 3KM5A 2PMWB 3QLQA 3KMHA 4KU8A 1J1TA 5DAWA 2RR12 4NIHA 2Y34A 4OYUA 1WCSA 2P3JA 1DGWA 3U75A 1QNWA 2WQ8A 4YM1A 3HEIA 1ENQA 3K77A 3USUA 3GBFA 1SLTA 1UYPA 4UFHA 4DMIA 3I2GA 2HEWF 4L97A 3POBA 3NNGA 2CGNA 1BEV3 1BJQA 3WDYA 2BGCA 4E4HA 1FPN2 4QU1A 3CMGA 2KA3A 5FUIA 3K3NA 4YNIA 4RR3B 5CKNA 5I0TA 3CO2A 1HXS1 2ZACA 1AR93 4LBQB 3QACA 1AL0G 1POV1 1YJKA 2NZ9A 3M3EA 1YQ8A 1UY3A 4PQQA 2HJIA 1UX6A 3RWKX 3ACFA 2ET7A 4HVRA 4GJZA 1GBGA 2VW2A 3PHMA 3ELNA 3POYA 4WM8A 4GD4A 3LB9A 2C9KA 3LE0A 3I7DA 4I02A 4MH0E 1JBCA 3MF6A 5FLIA 2F17A 4GIQA 5BNNA 2XJQA 5AFEA 1RUH1 3AMMA 2VZSA 4OZOA 1XOYA 2V5YA 3C7OA 1I9RA 3ZN5A 5ABJB 2VZ1A 2HH9A 3LWCA 4LUMA 1SCRA 1DQ2A 3BOWA 2MEV3 2DCYA 5DQ0A 4R9CA 4EWDA 3PMSA 3IPVA 5GKAC 4QX8A 2VBPA 1FMD1 1TMF2 1TQ5A 4BDVB 4CEWB 2AGSA 4FI9A 3WUDA 1WCQA 3D82A 3N3HA 3N4MA 1ZYBA 5LW9A 4Q4X1 2ARBA 1H1AA 2PHUA 1CPNA 1ZZBA 2YDEA 2LALA 4CXWA 4GH4A 4YZ1A 1DG6A 4N8MA 1D7PM 1QJU1 1OFSA 1PVXA 1JXNA 2W46A 4XJWA 2CWMA 2D97A 5J3UA 1KFXL 2IVIB 4RQPC 1F4AA 2XKOA 2ZKLA 5FMBA 4JQRA 5FRAA 3IIAA 3MYXA 1EV13 1W05A 1WWYA 4LO5B 1MS4A 5FPXA 5JOZA 4A45A 5FQ0B 2ZX0A 3P6BA 5BPXA 1YFYA 2RJ2A 4AEDC 2WJSA 2Z42A 5JMOA 1XYOA 4RS5C 1OPOA 2CL2A 4Y33A 3D8CA 4ATFA 4HLTA 2KXLA 1BVP1 1QEXA 2VCBA 1UKRA 2Z5WA 3OEBA 4YVSC 4H2AA 1HXS2 3AMPA 3ZXLA 4Y22A 2F4LA 4AGGA 2AEZA 2YMZA 4K20A 3J7NA 3J8F3 4I09A 1HB2A 1JZ3A 2VOKA 5E6HA 1E5IA 3OBTA 4AQ2A 3A7QA 1DYKA 1XE0A 2ZHNA 1SLLA 2XUMA 3ME2A 4HSJA 3BYWA 4JTOA 2VVFA 3IWZA 5JOXA 3WQ0A 3ACIA 4PBPA 5CEHA 1ZZ8A 1FMD2 2Y8KA 3V65A 1UNBA 4ASLA 3GM8A 3MGUA 4YVWA 4AQSA 2VAUA 4LEJA 3ZXJA 1NZIA 3DPRB 3SEEA 3N7JA 1IKQA 1NOVA 1PGW2 1OF4A 2I74A 2PHFA 4LORA 3O1OA 2JG9B 3MPPG 3RYKA 4NIDA 3WY6A 5LBFA 1PGW1 3MIGA 5FQ0A 4HN1A 4P9YA 1UXXX 5J98B 2ZKNA 3INAA 2ZMLA 2HWE3 2B4KA 3WEZA 2V73A 2XBO1 2ZGSA 3PTYA 1NA1C 4MYEA 2EXJA 4A44A 2D6KA 5EIYB 2JJ6A 3HT1A 2ZOEB 5GLVA 3K4ZA 5JUVA 4XF3A 4PBOA 1X33A 1ULCA 5ACA2 1IGOA 3MV11 4MGQA 3AC0A 3H50A 3DN7A 5DG2A 2ORXA 3NQHA 1W3VA 1UU5A 2A6XA 4LBMA 4JHTA 5E89A 4Q29A 3ZFFB 4CEWA 2EAKA 2GC0A 2VTXA 1DQ4A 3PL0A 4UFLA 4I0WB 5DAXA 1DYOA 1VB2A 1XU2A 1ZNPA 3RG0A 2WZPP 1SLAA 2RS51 4NPRA 4IEXA 2ILMA 2ZMKA 3VHNA 1W8HA 2BEOA 3BTAA 5T5OA 4AFMA 5BYNA 2ZPXA 1CAUB 3I2KA 1HJFA 4AE2A 3ES1A 1G9FA 4LBJA 3SCGA 5LA0A 1DGRA 1IHMA 1VMJA 1CZTA 2YC4A 3VKMA 4XF4A 4ASKA 1JYWA 1A8MA 2R30A 1BHGA 1WW5A 1F5JA 3QOPA 4YZ3A 1TME3 3KF3A 4U2AA 4Q4Y1 2DVAA 3DPRA 1WA6X 4M00A 4M4RA 5FYYA 4OFGA 4DFSA 3BTZA 3E5QA 4FFFA 4N7UA 4LBQA 1C57A 1POV3 1AXKA 2A7AA 1CD3G 5JIAA 1RUNA 5C71A 3VGIA 1GSLA 1RC6A 4KGQA 5AVAA 5LZ6A 1N1SA 1JZ7A 4OQ9A 1AYN3 3WW3A 1IS6A 2D98A 1J3QA 3ACHA 4Y1YA 2OX0A 3J8F1 4X6QB 5L19A 3JU9A 4NAMA 3USUB 2WN2A 3VHOA 4BK5A 2FCUA 5DPNA 3N9LA 5A7NA 1W90A 3T4HB 3E6CC 3W21A 4JX0A 3FFZA 3PU3A 4FTBA 1TMF3 1LR5A 2DCTA 2VMGA 1CZVA 4IE5A 3JD73 1WMDA 4E9KA 4NUBA 4UOJA 3J7HA 2K0GA 3UK9A 1W2AX 2HYXA 1QJX3 1XPWA 5AC93 1MQTB 2FZ2A 1RJ7A 1PO22 3T08A 3ZYHA 2P3YA 4NIGA 4XVHA 1PGL1 1R081 5BNPC 5G05L 1ULGA 4M3CE 4CEYC 1WMEA 1SPPA 4JGYC 1M06G 5F37A 4PCRA 1HIXA 4L99A 3ZR5A 3CLPA 5GLWA 3P3NA 1PO13 1GWMA 3W5NA 1MEC2 5C9AC 1TE1B 2C9AA 4HKLA 4RFT0 1VJ2A 1I5ZA 4B4RA 2J1RA 2YB7A 4MGTA 4HKOA 2XVLA 2BZDA 4IV1B 1ZZCA 3S7IA 3GNEA 5FYHA 1XSQA 4Q5OA 1GKBA 2BBAA 5D21A 3O12A 1HW5A 3IPVB 3M1HA 4NJ4A 3R4UA 1PMIA 1DLCA 1JU3A 5GZFA 4CVUA 3MF9A 1PNGA 4MGKE 4CXXA 4KGGA 2X8KA 4NHXA 5E8AA 5ABJA 3BOPA 3RZGA 5A7WB 2BGOA 2BGPA 3SISA 3H0OA 1HRV2 1BXHA 1K3IA 1RUD2 3IMMA 1YJLA 2PHDA 4ISQA 4ZONA 3JZVA 3ZKYA 4BQ1A 3OBAA 1RUF3 4AEDB 2DBNA 1QHDA 3P5BA 4K8RB 2DFBA 1CVNA 2GMEA 1GV9A 4M0HA 3ZFFC 2DUPA 1LHWA 3MIEA 1TME1 3ZOIA 1URXA 3HNYM 3NNJA 3LEMA 4CDUA 2ID4A 4CCEA 4DXTA 1O3QA 4K1ZA 3UJOA 4OHYA 4JKKA 2JB4A 1RUE2 1S0IA 1OBNA 3AMQA 3HD8B 3IM0A 4LLFA 1WCUA 1BK1A 5T55A 4FAHA 4ZZ8A 2R043 1RVF3 3AJZA 1H1IA 5EJ1B 4AVTA 2L9LA 2ZCWA 3OUJA 3WG2A 3WW2A 4RHV1 1UMZA 3AKSA 4LBKA 3U1XA 3ZPYA 2KD7A 4DUXA 3VDDC 3O1UA 3BB6A 5FOBB 2UWBA 3D3AA 5F6KA 3TB0A 4NE9A 4A3ZA 5JR7B 3VD9A 4E2SA 4YFZA 1SLIA 1EAH2 2VMFA 1S1AA 2D43A 1GNHA 4QWNA 1MACA 4YFWA 1V6OA 3VBHC 2RR11 5JZGC 3IKWA 5FP3A 1NAEA 3OTFA 5EYXA 4UXAA 3C7HA 2XL9A 3WZ1A 4C91A 1ZBE3 1JZ5A 1O6UA 2WT0A 3BU7A 3ES4A 2W52A 5FPUA 1LHUA 2R0HA 2CDPA 4EWAA 1Z7S1 1ULFA 4QAWA 3VBOA 4XTMA 2XKPA 4CU7A 4FOYA 1DQ5A 3ETPA 2D93A 4R9BA 5GZEA 2O0OA 2XBO2 5IVCA 4GMP1 4IE4A 1NQJA 1XJAA 1HRV1 3RZLA 1JW6A 2AENA 3OY8B 5HCBA 5KXDA 1PVC3 1UY1A 3OGSA 5KXEA 1HX6A 2GNTA 5CYYA 5FLHA 3EBRA 2HWE2 1MVQA 3K4DA 2VZOA 3TN92 3VD4A 1AR63 3QCWA 5FYTA 2WWSA 4ES8A 2R7EB 3WP5A 1WCDJ 2KR2A 3HQXA 5E1RA 3SXWA 4IE0A 4AI0A 4COZA 2QFEA 4CE8A 3I2FA 1GZ9A 4OI0A 2Y60A 1VBA2 4QPGB 4S2FA 4CXYA 3UYJA 3RSJA 1LESA 1AYM2 4PDWC 5FO9B 4N53C 3L2HA 4DEVA 5FV3A 1CAWB 2XPJA 3W20A 4P9IA 4AVAA 1UW8A 4COWA 1OC1A 4BLJA 1LODA 2Q0AA 2WO1A 1OPMA 4Q0QA 2VMHA 2VW1A 2W1QA 1VAMA 4MX3A 1NA1B 4OHVA 3K75B 1AVBA 1Q43A 4PF5A 2CAVA 3RZKA 4R9DA 1V70A 1IPSA 5A3TA 1HRI2 4LNVA 4RR3C 4Y20A 3MLKA 1AR91 1X9TA 3MLLA 5FZGA 4A7KA 2GH8A 5FREA 2WZR2 4AEMA 3A22A 3LA2A 1OUSA 3NV1A 3ZYFA 3FX3A 3FHQA 2O14A 3H3ZA 1N3OA 4LBNA 4XF9A 2VZRA 2D5FA 5IVEA 1EPWA 2JG8A 5IW0A 3FBYA 5B2GB 2OUJA 1PM7A 2PN5A 2P37A 4QHZA 4MOAA 4QXHA 2W08A 3J8F2 3LAGA 4QKBA 5F2WA 3RDIA 5IATA 4HN0A 1BZWA 1QMJA 4LO8A 1PHMA 3OBRA 3KVAA 3QBQA 1GZWA 3H7JA 3HJRA 2BRTA 3LZZA 4OI4A 3BPZA 2ATFA 3T1LA 1DGWX 4EN9B 2MHFA 4BQXA 2GNMA 3MDPA 3MHZA 3O5SA 5IT6A 4DINB 1UYZA 2NPIA 2ADEA 3D4KA 2YY1A 3OPWA 1OVPA 3VZMA 5BV6A 2QQNA 1Q8SA 3C8XA 1RTVA 3DUIA 2X5IB 5LRRA 1QNYA 4ASMB 4Q26A 4D69A 5ACA1 2GC3A 3AVRA 4JZRA 2G9ZA 3RMXA 4BQ3A 4URAA 4FP3A 1WLTA 5IUQA 3MUY1 1SZBA 1O7FA 3ALQA 3EYPA 4MSVA 3T09A 3WNKA 1RUH2 2K46A 5ANNA 5FZAA 1R082 5FZEA 4HOOA 4ZY9A 3THTA 2JXAA 1OA2A 4Q0UA 2Q5TA 3DEMA 3QD6A 5FJHA 4ZXEA 1YHFA 1HRV3 1WUVA 3AVSA 4KWKA 5CFDB 3MIHA 5JXIA 2D3SA 2XVKA 3T0DA 3K46A 4NIAA 1IQAA 4HG6B 5DZFA 1OUXA 1YI9A 4BYYA 3ZN6B 3LOBA 1IZ3A 1ND3C 1CX4A 4BQ2A 3IIIA 1LOGA 1W2UA 3KV6A 3GZTB 3RZHA 1EAH1 3CL1A 1NLQA 3IDCB 3POJA 4YZ4A 2J1AA 5FKBA 4XJ8A 5L73A 1ZZ6A 3I3BA 1RVF2 3PJYA 1YWKA 4QXKA 3ZXKA 1VBB1 1RB8G 3TEXA 2PAMA 2GMPA 4LKSA 5F6LB 4RYDA 1LHVA 2YFZA 3VUOA 5CFCA 5FYIA 4ZPIA 1UX7A 4QKNA 3ZDVA 1NQDA 2NM1A 4KQ7A 4W50A 2WNOA 2VCCA 4Q4W2 3CJIB 2X05A 4Q2FA 3VKFC 1H9WA 2PLV1 4FPGA 4Q4V2 3S57A 4O9GA 5FBZA 4BJ0A 3WUCA 3DL3A 2A75A 1RUE1 5T5PA 1FT9A 3B5LB 1KGYA 2D6NA 3NKTA 1S0GA 2Q30A 1UU6A 1ZBA1 1AR83 3BCWA 4GJYA 1VBD1 4TLGA 3RJ2X 5LEKA 1J1LA 2RM21 1PIV3 1RUJ1 3GJBA 3EO6A 4XW3A 3UNPA 1MS3A 4AGRA 5J96B 4GZ9A 4DXSA 1RUF1 4ONUA 2DVDA 2R32A 2PHWA 4AYUA 2J1SA 1NCQB 1XNAA 1HDKA 4MXWB 3H8XA 3NV2A 2YG0A 1S0FA 1AR72 2YBKA 3GXUA 1Z78A 4QX0A 3HN3A 4YZ5A 1WLDA 2GMMA 1BEV1 1ODMA 1HB3A 2A3YA 4KBZA 2J22A 5A6XA 2H0VA 4H7LA 4E8CA 3RZZA 4D6QA 4NOTA 5I0RA 1LGBA 3T1MA 4AEKA 3E5XA 4AI2A 5EP9A 1LB2A 2HWC2 4XOGA 1ZREA 3R0RA 1WD3A 3SMHA 3A21A 1QJZA 2A6YA 2RDNA 1GLHA 2ZEYA 3VBHA 5HI0A 5J48A 5CIRA 3ZFEB 3E6DA 3KHBA 1W9SA 3LSEA 3Q8BA 4QKDA 4LLOA 1JHJA 5CKQA 1OA4A 3EHKA 1ZA7A 1RXFA 5IVFA 4FOVA 2QE3A 2P5BA 5J09A 4DUVA 3T2QA 1N47A 1R091 5C3RA 5EPAA 3BTXA 3IT8A 1XNTA 2XJRA 1UOJA 4X8NA 4W65A 5FMOS 2ES3A 4CP9A 5JVVA 1IOAA 5A3MA 5IK8A 1XC6A 2BUKA 3SH3A 4QGMA 2XBO3 3B02A 5J36A 1W6QB 2BU9A 3J26N 4PIXA 4C8DA 1UXZA 4OI1A 3K3OA 2XJVA 2ZGPA 1YQ5A 4Q4X3 1G8WA 4PLOA 1S0EA 1ND2B 4TN7A 4E2QA 5A6QA 5KHIA 5T5LA 3GZAA 4I0AA 3WINE 3GBWA 4EE2A 2YYOA 3KCYA 3POGA 3TN93 1W0PA 2OYZA 5JZGB 5FPBA 3JQXA 2PLV3 2Y0IA 2GNDA 3WG1A 3VKLA 3WD5A 3UKNA 1CJPA 3OGJA 4TLFA 1AL23 4W4ZA 4N53A 5FR3A 3ZN4A 4I2OA 1GOHA 3WCRA 3OOXA 5ISLA 4JDMA 5KHJA 4S2HA 4NHKA 1Q8VA 1V9U2 4AXOA 1RUD3 2BNNA 4D6SA 1B09A 4Q4Y2 3V0BA 3AL6A 1YQ6A 1QXPA 1RUG1 2WYFA 1LJ7A 2Y6JA 2YPDA 2ZGQA 2VW0A 4NPMA 5JI9A 3HQRA 1ACCA 4PI2A 3C7EA 5HCAA 3O1RA 4XC9A 4WVMA 5C3PA 3WP6A 1RHI2 2O8OA 4F3JA 4FFHA 5K0UC 4FBFA 1UKGA 4UT5A 1S0CA 1LNSA 4A4AA 1T2XA 4G4FA 2JWPA 2QJVA 4H55A 5KBFA 4DRRA 4UW3A 2FD8A 5HV4A 1CJDA 1G9BA 4AQ6A 1AR73 1QIQA 1RUOA 1GWLA 4RGAA 2VCMA 3VBUA 2DCJA 4AVVA 5E88A 4AZZA 5FXXA 2W2IA 4YGEA 5BY5A 3NNLA 5IYYA 1Y9QA 2QQMA 2JECA 3RWNA 1TVGA 4GWIA 3RQ0A 5I93A 2VQ0A 2ZJCA 4XMAA 5LBCA 5DZGA 2R073 1GANA 2VNGA 1U5YA 1EUTA 5F5QA 2E6VA 4FPYA 2VMDA 3B9IA 3OGGA 4KI5M 4CDXB 2DBIA 1RMU1 2QQVA 4IGQA 1NE6A 2GC2A 4IV1C 4Q0SA 1Y7BA 2Y6LA 4K9SA 4XJ9A 3PJQA 5JDBA 4SBVA 1JYXA 1XXNA 1XYPA 2JENA 1D2QA 4FPCA 3BI3A 1UZWA 1OF3A 3ZN6A 5F3GA 4Y5SA 5ABJC 3PVOA 2VBBA 3NMBA 4CDQB 5KWRA 3MO4A 1ONAA 5LASA 1HB1A 1R093 3B9CA 4Y26A 1O3SA 4I0BA 4BE3A 1DGLA 1PZ9A 1RUH3 3PVBB 1J83A 4FOWA 2YZ4A 5CFDA 1H8TC 1S0DA 3EMRA 5CKMA 4NRMA 4KMQA 5FZIA 1UAIA 3AYDA 1GICA 1GOFA 3QH7A 1G7YA 4EV0A 1AR82 1NE4A 2C6SA 2DUQA 5CVRA 1NT0A 2V72A 5FMCA 1JOBA 4EWEA 2CAUA 2JDMA 5FZLA 2XWBB 1QJY2 1YIPA 1WW6A 1VBD3 1PMJX 2X5IA 2W92A 4QX7A 5DUUA 1CAVB 5FYUA 3VL9A 2VY0A 2SLIA 2JD9A 1MS8A 1XNBA 2W1UA 2WSVA 4OQ8A 5F3EA 2RDRA 1CAXA 3S6PA 3TOJA 3WCSA 4J25A 1JYTA 2G1MA 3B3QE 5FLJA 4OI2A 4XF1A 2EALA 1QWRA 4QX1A 1QH6A 4FTEA 3AKQA 4NWWA 2F4PA 4Q1PA 4QDSA 5D8AB 3WX5A 4IV3C 4RFRB 3RNSA 4E2GA 1QJEA 3SHRA 4IE6A 3VN4A 5FYBA 1Q3EA 2HWF3 2IXJA 2EAAA 1YIFA 2UWCA 3MFAA 1BMV2 3NNFA 2N7GA 3AP7A 4MADA 3KV5A 4P9XA 3TRSB 5C3OA 1UCXA 1YNAA 4UFMA 5FZHA 4FXGB 3LSDA 4U36A 3VZLA 4EJRA 3U4XA 1DP0A 1W6OA 2D3RA 1EV11 2WNVC 1K5MB 3LGRA 4LTAA 3DYMA 4YG6A 4XZPA 5FP8A 1OLRA 3FHIB 4LBLA 4RGGA 2DCZA 5C70A 1AX1A 3KT7A 4D7SA 1RITA 3I3DA 3K4AA 4K3UA 1VBC3 4UW6A 4IGOA 3VKNA 2RS11 3U14A 3LIHA 3AB0A 1RMU3 4QPGC 4WM8C 1X50A 3ZYBA 1LENA 3LF7A 3KGLA 1VBB3 1UIJA 5BNPB 4FXKB 3I2IA 1W8FA 5FO8B 1N1YA 4XJZA 2A3WA 4BISA 2CTVA 2GDFA 3FL7A 4S2GA 1OFNA 3R4DB 3JB4C 4FPOB 3KB5A 4A7YA 2WFF3 1LOFA 4IETA 3U78A 2B8MA 1UOBA 2PXJA 3POEA 3H7YA 4IV3A 4M3CA 5FZ0A 2RVAA 4D8MA 4LT5A 4BCUA 4CCLA 3AYCA 3CBNA 1OLQA 2DDUA 4XDQA 2B9VA 3QH6A 4G9SB 2EIBA 5DAVA 4XAAA 5SV5A 5EYYA 4N9IA 2HWE1 2QVSB 3ASIA 4UYBA 3PURA 2MNGA 2YC2A 2BFUS 5C4WB 5IFPA 3O1PA 1H8TB 1H6XA 5F39A 3FJSA 1SBFA 1KS5A 2EXHA 1UPSA 1XNDA 5AVPA 4WVZA 1UZ0A 4XFFA 1G9DA 4LO7A 1VLNA 2HWF1 3D0JA 1VRH3 1Q5OA 2VXJA 3BGAA 2C1FA 3BVCA 3VBOB 2H0BA 4OZXA 1TME2 3WNMA 2LROA 4LK6A 5EJZB 1EV12 2VTXJ 1COV2 2OW4A 1PM4A 4YGBA 3SH5A 2R6QA 2WLQA 3IDAA 1L7QA 2QCSB 3FLPA 3OG2A 2IC1A 3VDDB 1WMFA 5JR2A 3KCXA 1ZRCA 3LFIA 2WS91 3P3PA 2DYCA 3F2ZA 4CCDA 3MW2A 4LKEA 5LBEA 2E26A 1U5ZA 4EN6B 1C1LA 2D40A 1W03A 5BNPA 1DZQA 4FPKA 1YQ2A 4TXWA 2QTWB 1FAYA 3HR9A 1JUIA 2OUHA 4L92A 2Y0OA 3R05A 5IAVA 4D0QA 2BV4A 1H0BA 2WA4A 5J7MA 1XBFA 2PHXA 3O1MA 3LPFA 5I0UA 1KDMA 3SC7X 4IEVA 4UFJA 1LEDA 1OH3A 2AR6A 2JE9A 5FZ7A 2IVJA 1W8ZA 1GP4A 1C8M3 2ZAHA 1V6NA 3N7KA 1K5MA 1DGRN 2ZS6B 2WQZC 4Q27A 2NLRA 1W6OB 4F8AA 1FXZA 3GALA 1QDOA 1JOJA 5DDJ1 4AEDA 4DO0A 4N9HA 4MG2A 1UQXA 4KL1A 4CEYA 5J37A 4WZCA 2Q8CA 2CU5A 1CN1A 1OHFA 3JCIA 4K21A 2Q8DA 1VBD2 4XF0A 1DZRA 1C4RA 5A3UA 5FUNA 3AZZA 2VUDA 5DUXA 3LEGA 4JCKA 4CUCA 4JC1A 1UZYA 2DVBA 3VBSA 2E63A 4A7ZA 1Z7S3 2WN3A 4GWJA 2WFF1 4MGSA 4LKFA 1VP6A 3I2HA 1ZBE1 1LECA 1N3PA 1OURA 2BVBA 1HQLA 1H4HA 5A33A 2P3IA 1JU4A 4IV1A 4CTEA 1F35A 2HYKA 1G9CA 3ZPOA 1CPMA 1JYIA 2FDKA 3D6EA 4ATEA 1A3KA 3Q8EA 4CUAA 2ORZA 2WWUA 4P00B 4Q4W3 5GALA 5TSWA 3FC0A 1RGSA 1VBE1 5FZMA 4GWMA 2C0ZA 2QQLA 4Z2AA 1W6NA 1P8JA 3ZLIA 2VNOA 1HJGA 3BIWE 4IEPA 5K9YA 1XNKA 1SPPB 3AMHA 4N43A 3I59B 4HVOA 4YW2A 2RS33 1FNYA 1K45A 2VL4A 4QX3A 3I4IA 4GALA 2AREA 5H9PA 5BXXA 5A6ZA 5LWBA 1D0GA 3K51A 4GKYA 2FDGA 4EN0A 3PU8A 1VAVA 4EZHA 1RUE3 2EA7A 4IEYA 2WWJA 4OULA 4AI8A 1W28A 2W1SA 3OSDA 4O7XA 4EYUA 1PO12 2B46X 5T5JA 2RS31 1AL21 1OKQA 3THPA 3HMYA 5BNOA 1J59A 4GB31 1UD1A 2ZABA 4B4QA 5C3QA 5F3CA 5A3OA 2JDNA 4BB3A 4OMCA 3FLTA 2VG9A 1X9PA 2DU0A 3POSA 2G4IA 1C8NA 4RHV3 5CNAA 2V09A 3OPTA 3VBFA 4YGCA 2CNAA 2W68A 2WNUB 5FK8A 1JUHA 4IEZA 3THDA 4KBBA 2HWB1 4QGNA 2DURA 2C24A 3KSCA 1YI7A 3MI8A 2DUOA 4ISRA 2WLPA 3K2OA 1JYVA 3VBUB 4OHWA 5K7PA 1MVEA 4Q1RA 5JSPA 4IUGA 5F8PA 4QHBA 2DTWA 4EN8B 4WBBA 5JOYA 2YV8A 3L2YA 2OQ7A 1FV3A 2XLAA 2RMU3 1SCSA 2BP6A 3SCFA 5FY8A 1OSGA 5D2AA 4CP0A 2UYAA 4QPWA 1WA4A 4XABA 3H8RA 5GLZA 1QJX2 4RS5B 3A4UA 1CAUA 3FN9A 1UU4A 4IE7A 1LKNA 2UURA 2ZTNA 4H7MA 3LEKA 5ACA3 3ZSKA 3HIFA 4QXCA 5A7PA 1MZEA 4QB2A 3V0BB 3KQ4B 2CY6A 3VD7A 4BIFA 4AGVA 2DVFA 3WLUA 1RUC1 1GNZA 4P9LA 5AFBA 2TEPA 4YM0A 1J3RA 2P6CA 1APNA 3OUHA 5F32A 4EQVA 1VBC1 3KT1A 2HEYF 1ODNA 3VKOA 2VZTA 4QX5A 2V5DA 4RGKA 2RJKA 5HCHA 4M0NA 1O3RA 3HT2A 5KHKA 1RUI2 4IESA 3EJKA 5FPZA 4QX2A 1SBDA 3ZO0B 3B00A 3WF4A 4UFKA 4AFDA 2HKXA 1NXMA 3SEPA 1BVVA 1QY4A 1BBT2 3ZYGA 2BOJA 3VDBA 2YBPA 4FQ4A 1H30A 1I5PA 5LY2A 2ZX2A 3I97A 3CQOA 5FPVA 5A1LA 4XDOA 4ITCA 1UY2A 3DKQA 4DY3A 4QKFA 4YVWB 3SITA 3OJBA 3IAPA 1Y43B 2FMYA 2IXHA 5CADA 3PTRB 2Z79A 5FO7B 5EFUA 3WF1A 1DQ1A 5DABA 3ZXAC 1B35B 3V0AB 2VZVA 5FOJB 2K9ZA 1F8VA 3CJXA 4LO6B 1PZ7A 1US3A 2X10A 2VE1A 4HONA 5FFOC 2WO7A 1VB4A 2OPKA 4YVWC 2YC0A 3GYDA 1D4M1 1AUYA 1R1A3 1SFNA 2YU2A 4HZFA 5C7GA 1W9TA 3VZJA 3KD4A 1H2KA 3MZHA 1HQWA 3URFA 1HQNA 5L7OC 4Y22B 5I8SA 4Z2WA 2UWAA 1VALA 2WZEA 3Q8FA 3KZ4C 2SBAA 1FOD1 3Q8CA 4GWNA 5FY0A 3TNQA 2OKXA 4BK4A 2PHLA 4LHNA 4XAEA 5K0UB 4XIKA 1OD5A 2XUEA 1W0NA 3GZUC 4KG0A 3I54A 2QQUA 1WBLA 4MXWA 5EXOA 2PQSA 4LK7A 1IS4A 4MO3M 1K5MC 4LE3A 4Y4YA 1WZXA 3NW4A 3BUCA 1AX2A 1RUJ2 2WUHA 3WG4A 3B69A 4AOCA 5FZKA 4QGLA 1BMV1 5J1XA 2O1QA 1V6KA 1UOGA 1ZRDA 2YUEA 1UYXA 1RMU2 2ZA9A 3AL5A 3N35A 3T4VA 3U11A 4JHZA 1FV2A 3BALA 2ZEXA 5HXMA 2E7TA 5JXHA 1W06A 5FY5A 5C8CA 3VBSC 5GZCA 2JDAA 2GN7A 4LHSA 4OUEA 3CJIA 2E51A 1QXRA 1F9KA 2A6WA 2J1VA 4KH9A 5D8AC 4BWOA 1BEV2 1CX1A 2UY8A 5F7UA 3KCCA 3HNBM 1VIWB 4IEQA 1H2MA 4MV2A 1X82A 3DXTA 5EZWA 5FYZA 2XDVA 4CZSA 2VQTA 4RHV2 5LK7B 3U0ZA 4AHWA 2A70A 2VNRA 2A5ZA 3KHCA 5C8CC 4CU9A 1X8EA 3WQBA 4CP1A 3M4FA 4ZHNA 2QQOA 1SFYA 2Q1ZB 3HOBA 2VZUA 2VXRA 1VRH1 2DV9A 3B94A 5IHRA 2WC2A 1J3PA 3DXUA 1OA3A 2JKXA 4IEOA 3V56A 3VV1A 3ZXDA 3AZYA 3ZIXA 4RL7A 2QBXA 2ZHMA 3W5MA 4OVEA 1RUD1 1ZVFA 2FCVA 1XU1A 1QXJA 2I07B 3MIDA 2EXIA 5L9RA 4ES9A 4RR3A 1ZRFA 2ZHLA 5BNOC 2ZZQA 1YEWA 1YLLA 2XLGA 2IUWA 2WBKA 1AF9A 1POV0 2LUWA 2ZEZA 3DECA 3UGGA 5K8SA 3WW1A 2JDZA 3AKPA 2WT2A 3OBZA 1G86A 1UMIA 4HMZA 3HQUA 4XUOA 1F2NA 4Q4V1 2WAAA 2ERFA 2WNEA 1NKGA 1D4M3 4PI0A 2GSYA 1HB4A 4TSVA 4Q0VA 1GZWB 2E9QA 2W9XA 4FT8A 3BTYA 3FFQA 4PHZA 5FUPA 5C33A 4FOQA 4AF9A 1MS0A 3ABZA 1WW7A 2X29A 4XHBA 2OXBA 1FPN3 3FZ3A 2ARXA 4QT6A 4XUTA 5FZOB 3M3IA 4CDWC 1C8M2 2PHTA 4AL9A 2JG8B 4JGYA 3ZFEC 1K42A 2BW8A 1HV0A 2B39A 3RYRA 2WAOA 3CHXA 1D4VB 4K6BA 1QU0A 1TNFA 3A0KA 4PLNA 5A7OA 1OQEA 2CGOA 2QZ3A 2HWD2 2VJXA 2WZR3 4AK3A 1ULDA 2JDPA 4MHUA 2JX9A 3CJIC 4PLMA 2B9UA 4XHXA 4O61A 4PIZA 2Y6FA 1FI2A 2YROA 4LR4A 5JAXA 3UKVA 2Z4FA 2ZEWA 3I3EA 5FKCA 3MIBA 3KS7A 3NAPA 4QQOA 4R52A 4WM7B 4CU8A 5C4WC 3C2UA 4MUVA 3RVHA 4JGZA 5EV7A 3ZVXA 4XCAA 3MEPA 2OZ6A 1AJKA 5FMDA 1QJU2 1R1A2 5FY1A 4HL0A 4D3WA 5CAZA 1LGNA 1V6LA 3ACLA 5FZFA 4PQ9A 5H9RA 3ZFGB 3KV4A 5L36A 5KXBA 2VBDA 4FFIA 1RUC3 4BQ4A 2JICA 4WM7A 3NJYA 3O0WA 5DG1A 5IWFA 1ZBE2 4Q4Y3 4DQAA 1YQCA 3VHPA 1XSRA 4ZZ5A 2X53S 3RMYA 4NPLA 3H9AA 1AR61 4RN5A 3NV3A 4YW4A 4CCNA 5IVJA 1W6PA 5KHHA 1Q8PA 1GNYA 1JTZX 2EIEA 2JEMA 4XJUA 3OY8A 4AWDA 4CDWB 4AI3A 4FPLA 1AJOA 4P08A 2Y38A 5A3WA 1ND3A 5GZGA 3IBMA 5ANQA 3AXEA 4YSFA 1RJ8A 4D94A 5FTTC 2BBVA 4GQ7A 3WQ7A 3VLBB 2ZGNA 2IXLA 1HRI1 1GR3A 4HPKB 2VU9A 2VULA 1YFXA 4MHRA 1JYNA 3OF1A 3PIGA 3PVNA 1DCSA 4XQDA 3GCXA 3D5OA 3JD71 4ZU4A 1TMF1 3W9AA 4CCJA 1LRHA 3OEAA 4DZGA 4META 4FSJA 2WYSA 4Q8KA 4FVVA 4HK9A 1HN1A 5L7OA 4GA9A 4HFSA 4PT6A 1GMMA 3FWEA 1C5HA 3FBMA 4FP2A 3VBRB 5DZEA 3T0AA 5JSOA 1RUI3 4PJYA 4QQHA 4NIIA 3WW4A 2C26A 1F5FA 2ZGUA 4DPNA 2Y64A 3FMGA 4C0HA 2EIDA 2VZQA 2D6LX 3O1VA 5AC92 4I01A 1YUDA 2HEVF 3GGLA 2VNVA 3ZX7A 1ASJ2 4CDWA 2YGLA 3AM2A 3AKRA 2HWD3 1B35C 2WO3A 1A8DA 1W6PB 3WNOA 3U10A 4W6YA 1FNZA 3ENRA 4XTPA 3W58A 5JSRA 1YRZA 1H9PA 2VQUA 4LULA 1IS5A 4ZS2A 5CBLA 3WF2A 1UL9A 4FCAA 1JZ4A 1ZM1A 4MVTA 2VZPA 1MEC3 1UZVA 3UKTA 1SEFA 4BA6A 5T54A 2IXIA 2NQYA 2RM22 4BXSV 1ZRIA 5A7WA 3SQOA 4AI1A 2VR4A 1EPZA 1FATA 4W6WA 4F83A 4GKXA 1W8WA 2ENRA 1DYPA 2LTNA 2W5FA 2W3JA 3IMNA 3WVJA 1W6MB 1NCRC 3PMEA 1O91A 3U4SA 1RINA 2YBSA 5FPLA 2D6PA 4JGZB 3V64A 3ZSMA 2Q1MA 3ILFA 5A32A 2IFRA 4BPZA 5LCWL 4XUPA 3C7GA 1YFUA 1QKQA 3WF3A 1W8UA 3M70A 1FYUA 5CU1A 2BYVE 1D4M2 4PDWA 3X29B 1OH4A 3T30A 4CRQA 4P9GA 4YARA 2ADDA 3L9JT 5C8CB 4XUQA 5BNQA 5LY1A 2R041 3T2TA 2GP3A 2VMCA 2Y6GA 1PK6B 1DIWA 1V9U3 2NP0A 4Y1VA 1RYYA 1CWPA 1MZ6A 3VZNA 2QQWA 3WOGA 3I3QA 3OD4A 3RYPA 2LW8A 3VBRC 4Y1UA 1VPHA 1JZ2A 1FX5A 1H6YA 3KQRA 4XIOA 1BCXA 2P6HA 1MQTA 1NY72 1UOFA 2GP5A 4JGYB 1FPN1 4Q0PA 5FZ3A 2MPFA 1JS9A 4PIYA 1K5JA 2CYFA 3H3LA 4XBLA 2VZ3A 5FXVA 2RMU1 5K0UA 2J1EA 3KV9A 1AZDA 2A71A 2ZGMA 5IK5A 4MGIE 4QM8A 2Q8EA 2QQIA 2VUJA 2MEV2 2XR4A 4LA3A 1AX0A 2G9GA 1A6CA 3WNXA 4AFCA 4CSWA 1ZZ7A 5HCFA 5LK5A 5DUWA 4CCCA 1XQNA 3E1F1 5B4NA 2IXCA 2PELA 3TBDA 3CEWA 1BKZA 1GZTA 4DUWA 1Y3TA 5CA6A 3VBUC 4Z8BA 2J7MA 4MZUA 4E4DX 1AR71 2JE8A 4C0BA 1O4YA 1BLZA 1S55A 2NMNA 4NHLA 3B7MA 1ZRRA 5JXJA 5L9BA 2PAEA 1ENSA 2RDSA 2A73B 1B35A 5LEJA 5KHGA 2CSGA 4YW3A 2Q1FA 1MR5A 3I2OA 1JN2P 2XGXA 3EQEA 2GN3A 3KT4A 4WVWA 4AFBA 2R061 3AFKA 2DU1A 3ZXEA 3LA3A 2LS6A 5LBBA 1W9WA 2W95A 4XMIA 4GMP3 3ZMNA 5A3LA 2BDRA 3RFRA 1W2OA 2W87A 4AHZA 1QJY1 4KU7A 1LTEA 1PO23 4EROA 1BBT3 2VMEA 3JQWA 1N1VA 3AP6A 2QUOA 2EVXA 3AZVA 4J6GA 4NMIA 4NROA 1PK6C 4Q4X2 4OCTA 4UWDA 1V9U1 4BH9A 1F31A 3SLIA 4UFIA 1G6NA 3S7EA 2XB6C 5JCTA 4UW4A 2WZR1 5JPMB 1WLWA 3N7LA 1E57A 2VVDA 3M3CA 5IK4A 5FWJA 1OD3A 2P4EA 2VTFA 4LIUA 1RXGA 4XFIA 5JWPA 5JOWA 1GQHA 1CZSA 1TG7A 2LM3A 2XH6A 4AAPA 2BNOA 2D5HA 3C7FA 5CISA 4NRQA 3OD0A 3ZFFA 5F5CA 1H2LA 2XONA 4NWVA 1A78A 1S0BA 5FIXA 4BQ5A 5CG8A 2EXKA 4FPEA 3K48A 3H3UA 2QDRA 4MGYE 2FDFA 1SDWA 3OGVA 2XVGA 4AVCA 3ORJA 5FYMA 2RS13 3VZKA 1MQTC 1C5IA 1HRI3 4ZS3A 1MZ5A 1ASJ3 5FP4A 4CCOA 3O14A 3DV8A 2V4VA 3AZXA 3WHUA 3DGTA 4TTGA 1LHNA 2R1BA 2J1UA 5IVBA 1STMA 4QHOA 3CZJA 1X8MA 3NO8A 4LMFA 1KDKA 5DMYA 1C3HA 4A42A 2RHPA 3TEWA 2EF6A 4IQPA 2JG9A 3AP4A 5DDJ3 1UY4A 5CZKA 4YYOA 2CWSA 1GU3A 2EIGA 4LITA 4C1XA 2ET1A 1COV3 1OOPA 4LQRA 3NRUA 4QQLA 2R062 2WS92 4Z82A 2WNVA 3A0NA 4OUMA 4YWAA 1ENXA 3KWVA 1ULEA 1DLLA 1ST8A 5H9QA 3ZXGA 2Y6KA 4BOWA 4QPIB 4COVA 5CFDC 1ND2C 2VMIA 1VR3A 2WIIB 3DCQA 2FDHA 3OGRA 1H1MA 2A6ZA 2TUNA 4RA0A 1S0JA 4P5YA 3N7MA 1VBB2 4BMEA 1D2SA 3V0AA 1OQ1A 2FDIA 3H1MA 1GUIA 3F95A 4YM2A 3M7AA 1KS4A 4JVAA 2HWF2 3LIGA 2VC9A 4BZ4A 5KR7A 1GZCA 3AK0A 4AFAA 2RMU2 1O4TA 2WDBA 3RRDA 1KFUL 4L2NA 4XEZA 5T3NA 2GAUA 1KJRA 3OPZA 2Y6HA 4YGDA 5EHDA 2EICA 3WDVA 2ZX4A 2AC1A 5JPNB 1PGL2 5HBAA 1SBEA 1X36A 1KEXA 4AVBA 3HBKA 4DXZA 4FPJA 3I59A 1UO9A 1VAKA 1PNFA 1DQ6A 1Q8QA 4JV4A 1W6NB 1V6MA 1AR62 1O5UA 4GH4B 2BVVA 1QJU3 2A1XA 5GLUA 2OT7A 4NO4A 1UIKA 1CR7A 1LAJA 4L11A 4XETA 4AHXA 4A6OA 4KNCA 4FQZA 2BFUL 3ZDSA 1RIRA 3ZIWA 1WGPA 4CCKA 3E5UA 5FZ1A 3CF6E 1KXGA 4Q4V3 5FZ6A 1MEC1 5A80A 1C1FA 3O0VA 3CKHA 4M3CF 4DY5A 4ZU7A 2CGPA 4R8HA 2HWC1 1EYBA 4IEUA 4LOTA 2BOIA 5FBJA 2BWAA 2GU9A 4LJHA 2JG9C 3KVBA 5C9AB 4WVVA 5BNNB 4RS5A 4CEYB 1RHI1 2RS32 3VD3A 3LOIA 4INDA 2BQPA 3FUOA 4WM8B 3MBWA 5F3IA 4B7EA 3B01A 1LOCA 3TNPB 3WP4A 3I49A 2Q4SA 2ZMNA 5FZ4A 1GQGA 2O8QA 2OQ6A 2CV6A 2G19A 5FXWA 3WNPA 5A6YA 1O4ZA 3ST7A 3ZYPA 4IDZA 2WRAA 3PUQA 1NXD1 2XG3A 4UI9L 1QOOA 2VD7A 3M3QA 5AC91 4Z92B 1NLRA 3GHNA 4LHLA 4Y4RA 1SLCA 4R9AA 2WNUA 1MPXA 1UPIA 1OOPC 2RS52 1POQA 4MGZE 3JBG2 2UU8A 5FXZA 3VBFB 5IJRA 2ZGOA 1OI6A 1XYNA 5H9SA 3ZSEA 1YO8A 2PTMA 3GF6A 3NJZA 2JIGA 5FJKA 2DTYA 3VDDA 3WXPA 4TWTA 4W8JA 5BNOB 4LBQD 3PUHA 4JKMA 5FYVA 5CG9A 4QB6A 2FHRA 2VECA 2VOVA 1L7RA 2GNBA 2OA2A 4XFHA 2WO2A 5JXGA 1UN1A 2WSUA 1GFF2 2BWCA 3POWA 1LOEA 3ZYJB 4AQTA 4IW3A 4YM3A 1MZFA 1CQ9A 1V0AA 3HN1A 1W8TA 3WG3A 3MIFA 4O65A 1F15A 3LDRA 3MW4A 5DDJ2 3SNMA 4DNYA 4N43B 2GH2A 3OYWA 4N43C 4UF0B 1H8TA 4XURA 1VBE3 4NHMA 5C4WA 4CP2A 1DBNA 2DWRA 3TEZA 1L7LA 2R063 3G7DA 4N7IA 4BQYA 5JMCA 3POIA 1VE0A 3ILNA 4CU6A 4R4XA 3UV9A 5JI7A 4E4SA 1UF2C 5FP9A 5FZBA 4DB5A 1AYN2 2D7FA 2WNUC 3AMNA 1LU1A 4IV3B 3U37A 5A33B 1US2A 1QH7A 4LIVA 3UL2A 1SMVA 4OUSA 1I6XA 4J1WA 4QPIC 1H4GA 1IPJA 1COV1 3JBG1 1EP0A 3VBSB 4HANA 4HK8A 5HXVA 5A3PA 1QF3A 2WT1A 4XCBA 1O59A 1SLBA 2D6OX 1O3TA 2C5DA 1M4WA 3H1WA 3HVDA 1L3JA 3DYOA 1V6JA 4B29A 1JMUB 3WQ1A 1PX3A 2I2SA 1F4HA 3AP9A 4P5HA 4UBGA 2JDYA 4CPBD 3OB8A 2E31A 1S2EA 1C8M1 2RE9A 5A1FA 5SV8A 3UGHA 4OHXA 1N1TA 4ARXA 3N9OA 5DUVA 4B4PA 1AR81 5FZ8A 4K8FA 4BHPA 3UESA 1LCLA 1W9FA 4YW6A 3H8OA 1E5SA 1WCKA 4LBOA 4YVSA 4A6SA 2VVEA 3E97A 2PYTA 1QOTA 4Y3OA 2PA7A 5F5IA 3IDEA 4B8EA 4CUGA 3BU0A 3KGZA 4H3WA 4QQPA 3NL1A 4NAOA 1NG0A 1XB9A 4NR1A 2WS93 1R1A1 1SFPA 4IXLA 4W6XA 4CPBA 2QQPA 5D8AA 4FPFA 2JG8C 2BNMA 2Y26A 2PAKA 3AYAA 2YFUA 4H14A 4ARYA 3CDZB 4Q4W1 1OQDA 1AYN1 4OHZA 4GB32 3ZFGC 5A1AA 2FQPA 2VCAA 1CAXB 3UT0A 4P14A 2VPVA 2CDOA 4AAXA 1PX4A 4P02B 1NUKA 1LOFC 4UBHA 5IVYA 3UGFA 4EN7B 3IZOA 5FPAA 1XNCA 3HWJA 2XHKA 5IFTA 1H8VA 4F7ZA 1RUF2 1SG3A 1XRUA 3ATGA 2J1TA 3C3VA 4O9EA 2ZGRA 4LHKA 4QDQA 4CA9A 2I45A 3APBA 4BM8A 2ARCA 4LO4B 1PVC1 4I30A 1JZ8A 1W04A 4D7YA 3N36A 2OIIA 1PVC2 4CDQA 1UWWA 3WP3A 3CU7A 4MLOA 2X09A 1AHSA 2VUCA 4CDXC 2GALA 3I2JA 2R16A 1WBFA 3Q8AA 4B1LA 2B7YA 2RS53 4BMBA 4M3CB 1D0HA 1Z7S2 4DRVA 3HNMA 3WV6A 2JDUA 1W8NA 2R1DA 5K4LA 4CEWC 4Z07A 5I8YA 2HBTA 5FYSA 5C8WA 3IB3A 4OMDA 5IAXA 2ARAA 2W47A 4WV8A 4XFGA 4AHYA 3MFCA 3JBG3 4XYXA 1LU2A 5FY7A 3LD8A 5F9TA 3WSOA 2VO5A 3LKJA 1OXCA 4SLIA 4YZ2A 1NCRA 1PGSA 3S5QA 3H1YA 3ACGA 3AKTA 3AX4A 5DXDA 3LA7A 3SCHA 4JAAA 5BNNC 2D44A 3N9MA 3VBOC 1NLSA 1ZZ9A 1SDDB 2WABA 4DIQA 2P17A 1RHI3 1S4CA 2HLEA 2OVUA 1H2NA 5DAPA 3RJRA 3M3OA 3GZEA 4IEWA 4ORFA 3LQCA 5T52A 4AG4A 2BPA2 3RS6A 5C9AA 4WVMB 1PO21 5APAA 3AZWA 1DQ0A 2DCKA 1BK0A 3PUSA 4YLZA 2RG4A 4R4ZA 1PIV1 1RUJ3 2XMLA 3TAYA 4WM7C 4X8PA 4XFAA 1AYM1 4DS0A 2Q8OA 3O1SA 1CGPA 5HV0A 1HN0A 3USSA 1LGCA 1VBA1 2YGMA 4Q8LA 1WLCA 1LHOA 1X7NA 1WW4A 1SHWB 2PQQA 4N53B 4Y1XA 4GMP0 2GC1A 3NJVA 2OPWA 1CAVA 4D7TA 3SH4A 5F2SA 2E33A 3PNAA 4XE9A 5I0DA 1NX9A 1JHNA 1EUUA 5EJ3A 3LDKA 5JIUA 2XQXA 4MXVA 3ZSJA 3TYJA 2HWD1 5HPOA 2QKDA 1ULOA 2VQAA 2WQ4A 1REEA 5ERLA 4QQ2A 1S2BA 5B4XA 3G6JB 1PO11 3WNLA 1W6QA 1IKPA 4LE4A 4N90A 1JH5A 3T0BA 1CONA 1W9YA 4XDPA 5D1IA 1CIYA 4IGPA 5FMOL 3WDUA 4B3NA 5FZCA 1E5HA 2LRPA 1ZX5A 3R4SA 4RQPA 2AYHA 3NVCA 2YXSA 3Q9OA 1KD7A 2XOMA 4AR2A 1ASJ1 1OT5A 3FE5A 3GHMA 4XQWA 2NN8A 1XE7A 2H6CA 2VOTA 3PUIA 2XJSA 3MPBA 4CUBA 5KXCA 1Y9GA 4K1YA 3ZR6A 3DYPA 2HWB2 1KRIA 5I91A 3OCPA 1ZBA2 3S5AA 2V4AA 4JRLA 3T2OA 4A2UA 2B45X 1PMHX 1GYKA 4CDXA 2BJSA 2WFF2 3HAGA 4I3GA 3VBHB 1V6IA 1O8SA 2W0XA 3N9QA 4LXLA 2HWC3 4E4ZA 1TZOA 4QPIA 2WZ8A 1VMFA 3VD5A 5M0TA 4URTA 2WNVB 4BXFA 1W39A 3AXDA 3J7MA 4JTNA 4QD2A 2XJTA 1OOPB 3VBFC 5FP7A 3LEIA 2E53A 2JIJA 2JDKA 1LEMA 4XPVA 3J9SA 3RGBA 4DEQA 1NCQA 1RVF1 3ZM8A 1S2KA 5EQUA 1VRH2 1BYHA 2C4XA 3GJAA 1WMXA 2B5HA 1W2NA 2NMOA 3DF0A 3NKGA 5FAXA 3VB9A 4JRAA 4CDUC 4LA2A 3BODA 2WKKA 2HBUA 3MUZ1 4BU2A 2XXZA 4CCMA 4P9WA 2FZ1A 2P34A 1YYNA 3LDBA 1V00A 3N9PA 1HXS3 1Y4WA 1VBC2 2VOXA 1QQP2 1QOSA 1FOD2 2DVGA 3A23A 3LCPA 3WF0A 4GULA 1EY2A 1W8OA 3I2DA 1VMHA 2PLV2 4V1PA 4COUA 2UYBA 1WKYA 5L9VA 1W99A 2WFPA 1RUI1 3UETA 5FZDA 3RI9A 3GBGA 4FAGA 5A7SA 1AL22 1QJFA 2W1WA 1T6BX 3MW3A 1U0AA 4Y5TA 2W94A 5CFCB 5CFCC 1A34A 3TN91 4B7KA 3WDXA 1CIWA 3MV01 4YRDA 5FWEA 1LOBA 4YPJA 3ON7A 3TWIA 4JKLA 4BLIA 5JZGA 3I8TA 1U5IA 4AEJA 3AYEA 4XJAA 2R071 1ND2A 2ZGLA 2OS2A 3ITQA 4XUNA 1U12A 5GLTA 3FHAA 1KITA 3OUIA 2XLFA 4NN0A 4QXBA 1IG3A 1IPKA 4FPHA 1AXYA 1DF0A 2IWGB 4IL7A 1I1EA 2E7QA 3RZMA 2DFCA 3PDQA 3WDTA 4RQPB 1PIV2 4ZU5A 2OZJA 1GQPA 3IN9A 4CP9B 2AACA 2ETEA 3EXUA 4L8QA 1CESA 1VBE2 2RV9A 3WT3A 4NVPA 4XBNA 1OVSA 1QJX1 1SACA 2X5IC 4RSUA 4XXAA 2IZWA 5IK7A 4DOUA 3POFA 2WL1A 5T50A 1UZZA 2CHHA 2FDJA 4HKWA 4KWLA 2VOWA 1YC61 4XFCA 2QQKA 4V2WA 1UY0A 3BPSA 5A7QA 3PVEA 2PFWA 3ZFEA 2BERA 1VRBA 1RUG2 5LA1A 4HETA 1DFQA 1QGLA 2W91A 4C1WA 4KWUA 2D6MA 3NNMA 3RZJA 5EWSA 3WHTA 2WA3A 4M01A 4YW5A 1OLME 4KG8A 4DXRA 4YG3A 2WR9A 5GJ6A 1IS3A 1SQ4A 4CDQC 3H8UA 2JE7A 3N9NA 1RUC2 1R64A 1YFWA 2B42B 2IFWA 3ZSLA 1YCIA 2R0FA 2F6BA 3HPNA 4QM9A 2FBEA 3NWKA 4LPLA 1W2TA 4LOSA 1GP6A 2XHNA 4XILA 5E16A 2KM2A 3MLJA 2H6BA 3IDBB 3T2PA 2G9FA 5C3SA 3O7OA 2XWJB 5F1RA 5A3NA 1R083 2GZWA 1R092 2QZ2A 1JOPA 2BTVC 3JXSA 4YW7A 5JLVA 3AJYA 1J58A 4Z1VA 4K40A 2RJLA 1OLMA 1NCQC 1LOAA 2ZXQA 3THCA 1U5XA 3PUAA 3I3MA 1PK6A 1Q8OA 1TEIA 2RR13 3M8LA 3UJQA 3T3YA 4GAZA 4L9BA 1BBT1 5GM0A 2K2SA 1N3QA 4PDWB 1QJY3 4Y5Z0 1NCRB 4QU2A 5FYCA 1AXZA 4HT1T 4XACA 1W3XA 2XQRA 2IXKA 3ZKUA 3D0SA 4JQTA 3ZMOA 3PIJA 4XZUG 3WNNA 1MS9A 1JZ6A 5A32B 3ROUA 2UY9A 5LA9A 3O1TA 1HV1A 1CAWA 1JI6A 4I3PA 4YG0A 1DDLA 5FY9A 1TNRA 1W6MA 5I0SA 1VBA3 1GWKA 4AW7A 4HBNA 4XFBA 2XJUA 1R1ZA 4QPGA 1O8PA 4UW5A 5DN2A 1YXWA 1ENRA 1AYM3 4UAPA 5BUVA 2E7AA 3JD72 3NJXA 1KJLA 1NYWA 4AI9A 1J84A 2XJPA 3HBZA 1UYYA 4JDOA 4XXPA 4GXLA 2YPJA 3VDAA 3ILRA 1G9AA 1AR92 3PLQA 4X6RB 4EZ4A 2FMDA 2Z2SB 2ZX1A 4NRPA 5F5AA 3VHRA 1NZCA 2ZHKA 1ALYA 3AFGA 2AZ5A 3GDBA 3BKZA 2PHRA 3BIEA 5I8TA 4WZFA 2TBVA 5G04L 3S30A 5C6CA 2QQJA 4G3YC 4E27A 5C5UA 3VL8A 2J42A 2ZZJA 1GOGA 2RM23 4J1XA 3VBRA 4C90A 2JB8A 3TEYA 4HXCA 5C5TA 4ET7A 4ZKTB 1RUG3 1ULPA 2QNKA 5L7OB 3R6SA 3IAQA 4LKDA 1E5RA 1BQPA 3B93A 3JB8A 5FZ9A 3J4UH 5KC6A 1C28A 1MS1A 3ECQA 2Y33A 2R072 2ZAAA 1QDCA 4QDRA 1OMIA 3LFMA 5FY4A 2TNFA 3ZYIB 1WD4A 3H42B 4QPYA 3ZXFA 2NYYA 4HPKA 2A3XA 3E6BA 4GB33 1W0OA 1Q56A 2VGDA 2ZGTA 4A3XA 3JUUA 5GZDA 1GP5A 4BIOA 1HKDA 1IG0A 3ETQA 3U07A 3NSTA 2JKBA 4YVSB 4E8DA 1LULA 1ND3B 3KF5A 3P1IA 3RI8A 1OKOA 4XBQA 3DKWA 1DZTA 4XQ4A 3O0XA 4QB1A 1QQP1 2VM9A 3AP5A 2P2KA 5CB7A 1DU3D 3WR0A 4CDUB 3NAPC 4Y20B 2YHJA 5A70A 2P3KA 2R042 4JDNA 4AVSA 1REDA 1NY71 1JODA 4PF1A 2D3PA 1NA1A 1Z0HA 3FLRA 3W59A 3WDWA 5KC5A 4P9JA 3CZUA 3M2MA 2DF7A 2VUAA 3ZYRA 1KQRA 1ZA4A 1MS5A 2RDQA 4BQWA 1IQDC 1O5LA 1XE8A 2JD4A 2VH9A 4V2VA 4FFGA 1RL3A 3VZOA 5LRSA 4COYA 3FUQA 1FOD3 4M4PA 4S2DA 5LB6A 3ZFGA 3S0MA 4ZXKA 1REFA 4QMAA 4A41A 1EAH3 4K7JA 3EB7A 1FMD3 3J7LA 3MICA 5FK7A 2E32A 4TZDA 3LPGA 3BN6A 4GH4C 1PZ8A 4IERA 4JGZC 4LUKA 1DHKB 4OLLA 3NAPB 3NV4A
chains in the Genus database with same CATH topology
2MEV1 2XL7A 5FDBA 2A6VA 2ZBJA 3DPRC 4HVQA 1HLCA 2WINB 4HSLA 4YW1A 2QDNA 3RPQA 2AUYA 4Y1ZA 3OYWB 4TYSA 2RS12 4RD7A 4CYDA 2AH2A 3KLSA 2ZGKA 4FO9A 4FTSA 2ZX3A 4KWJA 3CNAA 1I3HA 2R49A 4Y24A 2HWB3 2Z69A 1ZBA3 1JYCA 1QQP3 2W39A 1T6GC 5FCCA 3KM5A 3QLQA 3KMHA 4KU8A 1J1TA 2RR12 1WCSA 2P3JA 1DGWA 1QNWA 4YM1A 1ENQA 3USUA 3GBFA 1SLTA 4DMIA 2HEWF 4L97A 2CGNA 1BEV3 1BJQA 3WDYA 2BGCA 1FPN2 2KA3A 4YNIA 4RR3B 5I0TA 3CO2A 1HXS1 2ZACA 1AR93 4LBQB 3QACA 1AL0G 1POV1 1YJKA 2NZ9A 3M3EA 2HJIA 1UX6A 2ET7A 4HVRA 1GBGA 2VW2A 3PHMA 3ELNA 3POYA 4WM8A 3LB9A 3I7DA 4I02A 4MH0E 1JBCA 3MF6A 5FLIA 4GIQA 5BNNA 2XJQA 5AFEA 1RUH1 3AMMA 2V5YA 1I9RA 3ZN5A 5ABJB 3LWCA 4LUMA 1SCRA 1DQ2A 3BOWA 2MEV3 2DCYA 4R9CA 4EWDA 3PMSA 3IPVA 5GKAC 1FMD1 1TMF2 1TQ5A 4CEWB 2AGSA 3WUDA 3D82A 3N3HA 3N4MA 1ZYBA 4Q4X1 2ARBA 1H1AA 2PHUA 1CPNA 1ZZBA 2YDEA 2LALA 4GH4A 4YZ1A 1DG6A 1QJU1 1OFSA 1PVXA 1JXNA 4XJWA 2CWMA 2D97A 5J3UA 1KFXL 4RQPC 2XKOA 2ZKLA 4JQRA 5FRAA 3IIAA 3MYXA 1EV13 4LO5B 5FPXA 1MS4A 5JOZA 5FQ0B 2ZX0A 5BPXA 1YFYA 4AEDC 2WJSA 2Z42A 1XYOA 4RS5C 1OPOA 2CL2A 4ATFA 3D8CA 4HLTA 2KXLA 1BVP1 1UKRA 2Z5WA 4YVSC 1HXS2 3AMPA 3ZXLA 4Y22A 4AGGA 2YMZA 4K20A 3J8F3 4I09A 2VOKA 3OBTA 4AQ2A 1DYKA 2ZHNA 1SLLA 2XUMA 3ME2A 4HSJA 4JTOA 2VVFA 3IWZA 5JOXA 3WQ0A 4PBPA 1ZZ8A 1FMD2 3V65A 4ASLA 3MGUA 4YVWA 4AQSA 4LEJA 3ZXJA 3DPRB 3N7JA 1IKQA 1NOVA 1PGW2 2I74A 2PHFA 2JG9B 3MPPG 3RYKA 3WY6A 1PGW1 3MIGA 5FQ0A 4HN1A 4P9YA 5J98B 2ZKNA 3INAA 2ZMLA 2HWE3 2V73A 2XBO1 2ZGSA 3PTYA 1NA1C 4MYEA 2EXJA 2D6KA 2JJ6A 3HT1A 2ZOEB 5GLVA 4XF3A 4PBOA 1X33A 1ULCA 5ACA2 1IGOA 5DG2A 3H50A 3DN7A 1UU5A 2A6XA 4LBMA 5E89A 4Q29A 3ZFFB 4CEWA 2EAKA 2GC0A 1DQ4A 4I0WB 1ZNPA 1VB2A 1XU2A 3RG0A 2WZPP 1SLAA 2RS51 4NPRA 4IEXA 2ILMA 2ZMKA 3VHNA 2BEOA 3BTAA 5T5OA 4AFMA 5BYNA 2ZPXA 1CAUB 4AE2A 3ES1A 1G9FA 4LBJA 3SCGA 1DGRA 1IHMA 3VKMA 4XF4A 1A8MA 2R30A 1WW5A 1F5JA 3QOPA 4YZ3A 1TME3 4U2AA 4Q4Y1 2DVAA 3DPRA 4M00A 4OFGA 4DFSA 3E5QA 4N7UA 4LBQA 1C57A 1POV3 1AXKA 2A7AA 1CD3G 5JIAA 1RUNA 3VGIA 1GSLA 1RC6A 4KGQA 5AVAA 1N1SA 1AYN3 3WW3A 1IS6A 2D98A 1J3QA 4Y1YA 3J8F1 4X6QB 5L19A 3JU9A 3USUB 3VHOA 3E6CC 3FFZA 4FTBA 1TMF3 1LR5A 2DCTA 2VMGA 3JD73 1WMDA 4E9KA 2K0GA 3UK9A 1QJX3 5AC93 1MQTB 2FZ2A 1RJ7A 1PO22 1PGL1 1R081 5BNPC 1ULGA 4M3CE 4CEYC 1WMEA 4JGYC 1M06G 4PCRA 1HIXA 4L99A 3CLPA 5GLWA 3P3NA 1PO13 1MEC2 1TE1B 2C9AA 4HKLA 4RFT0 1VJ2A 1I5ZA 4B4RA 4HKOA 2XVLA 4IV1B 3S7IA 1ZZCA 3GNEA 1GKBA 3O12A 1HW5A 3IPVB 3M1HA 3R4UA 1PMIA 5GZFA 3MF9A 1PNGA 4MGKE 4KGGA 2X8KA 5E8AA 5ABJA 3BOPA 3SISA 3H0OA 1HRV2 1BXHA 1RUD2 4BQ1A 1YJLA 2PHDA 4ISQA 3JZVA 1RUF3 4AEDB 1QHDA 2DFBA 1CVNA 2GMEA 1GV9A 4M0HA 3ZFFC 2DUPA 1LHWA 3MIEA 1TME1 4CDUA 1URXA 4OHYA 1O3QA 4K1ZA 3UJOA 4QMAA 1RUE2 1S0IA 3AMQA 3HD8B 3IM0A 4LLFA 4FAHA 1BK1A 5T55A 2R043 1RVF3 3AJZA 1H1IA 4AVTA 2ZCWA 3WG2A 3WW2A 4RHV1 1UMZA 3AKSA 4LBKA 3ZPYA 3VDDC 3BB6A 5FOBB 2UWBA 5F6KA 3TB0A 5JR7B 4E2SA 4YFZA 1SLIA 1EAH2 1S1AA 2D43A 1GNHA 1MACA 4YFWA 1V6OA 3VBHC 2RR11 5JZGC 3IKWA 3OTFA 5EYXA 4UXAA 2XL9A 3WZ1A 4C91A 1ZBE3 3BU7A 2WT0A 3ES4A 2W52A 1LHUA 2R0HA 4EWAA 1Z7S1 1ULFA 3VBOA 4XTMA 2XKPA 4FOYA 1DQ5A 4R9BA 2D93A 5GZEA 2O0OA 2XBO2 4GMP1 1NQJA 1HRV1 1JW6A 2AENA 3OY8B 5HCBA 5KXDA 1PVC3 5KXEA 1HX6A 2GNTA 5FLHA 3EBRA 2HWE2 1MVQA 3TN92 1AR63 3QCWA 2WWSA 4ES8A 3WP5A 1WCDJ 3HQXA 3SXWA 5E1RA 4AI0A 4COZA 2QFEA 4OI0A 1GZ9A 1VBA2 4QPGB 4S2FA 3RSJA 1LESA 1AYM2 4PDWC 5FO9B 4N53C 3L2HA 2XPJA 1CAWB 4P9IA 4AVAA 1UW8A 4COWA 4BLJA 1LODA 2Q0AA 1OPMA 4Q0QA 2VMHA 2VW1A 1VAMA 4MX3A 1NA1B 4OHVA 1AVBA 1Q43A 4PF5A 2CAVA 4R9DA 1V70A 1HRI2 4LNVA 4RR3C 4Y20A 3MLKA 1AR91 3MLLA 4A7KA 2GH8A 5FREA 2WZR2 4AEMA 3LA2A 3NV1A 3FX3A 3H3ZA 1N3OA 4LBNA 4XF9A 2D5FA 1EPWA 2JG8A 5B2GB 3FBYA 2OUJA 1PM7A 2PN5A 2P37A 2W08A 3J8F2 3LAGA 3RDIA 4HN0A 1BZWA 1QMJA 4LO8A 1PHMA 3OBRA 3QBQA 1GZWA 3H7JA 3LZZA 4OI4A 3BPZA 2ATFA 3T1LA 1DGWX 4EN9B 2MHFA 2GNMA 3MDPA 3O5SA 5IT6A 4DINB 3D4KA 2NPIA 3VZMA 2YY1A 5BV6A 1Q8SA 3DUIA 1RTVA 4ASMB 2X5IB 5LRRA 1QNYA 4Q26A 4D69A 5ACA1 2GC3A 3RMXA 4FP3A 1WLTA 5IUQA 3ALQA 1O7FA 4MSVA 1RUH2 1R082 3THTA 2JXAA 1OA2A 4Q0UA 2Q5TA 3QD6A 1YHFA 1HRV3 1WUVA 5CFDB 4KWKA 3MIHA 2D3SA 2XVKA 1IQAA 5DZFA 1YI9A 4BYYA 3ZN6B 3LOBA 1IZ3A 1ND3C 1CX4A 1LOGA 1W2UA 3GZTB 1EAH1 3CL1A 4YZ4A 3IDCB 5L73A 4CZSA 4F3JA 4XJ8A 3ZXKA 1ZZ6A 3PJYA 1RVF2 4QXKA 1YWKA 1VBB1 1RB8G 2PAMA 2GMPA 5F6LB 1LHVA 3VUOA 5CFCA 1NQDA 2NM1A 4KQ7A 4Q4W2 3CJIB 3VKFC 4Q2FA 1H9WA 2PLV1 4FPGA 4Q4V2 4O9GA 5FBZA 3WUCA 3DL3A 2A75A 1RUE1 5T5PA 1FT9A 3B5LB 2D6NA 3NKTA 1S0GA 2Q30A 1UU6A 1ZBA1 1AR83 3BCWA 1VBD1 3RJ2X 5LEKA 1J1LA 2RM21 1PIV3 1RUJ1 4XW3A 3EO6A 1MS3A 4AGRA 5J96B 1RUF1 4ONUA 2DVDA 2R32A 2PHWA 4AYUA 1NCQB 1HDKA 4MXWB 3NV2A 1S0FA 1AR72 4YZ5A 1Z78A 1WLDA 2GMMA 1BEV1 2A3YA 2H0VA 4H7LA 3RZZA 4NOTA 5I0RA 1LGBA 3T1MA 4AEKA 3E5XA 4AI2A 1LB2A 2HWC2 4XOGA 1ZREA 3R0RA 1WD3A 3SMHA 1QJZA 2A6YA 1GLHA 5HI0A 3VBHA 5J48A 5CIRA 3ZFEB 3E6DA 3LSEA 4LLOA 1OA4A 3EHKA 4FOVA 2QE3A 5J09A 1N47A 1R091 3IT8A 2XJRA 4X8NA 5FMOS 4W65A 2ES3A 5JVVA 1IOAA 5A3MA 5IK8A 2BUKA 3SH3A 4QGMA 2XBO3 3B02A 5J36A 1W6QB 3J26N 4PIXA 4OI1A 2ZGPA 2XJVA 4Q4X3 1G8WA 4PLOA 1S0EA 1ND2B 4E2QA 5KHIA 5T5LA 3GZAA 4I0AA 3WINE 3GBWA 2YYOA 3KCYA 3TN93 1W0PA 2OYZA 5JZGB 3JQXA 2PLV3 2Y0IA 2GNDA 3WG1A 3VKLA 3WD5A 3UKNA 1CJPA 3OGJA 4TLFA 1AL23 4N53A 3ZN4A 4I2OA 3WCRA 4JDMA 5KHJA 4S2HA 4NHKA 1Q8VA 1V9U2 4AXOA 1RUD3 2BNNA 1B09A 4Q4Y2 3V0BA 1QXPA 1RUG1 1LJ7A 2ZGQA 2VW0A 5JI9A 5HCAA 4WVMA 3WP6A 1RHI2 2O8OA 5K0UC 4FBFA 1UKGA 1S0CA 4G4FA 2QJVA 4H55A 5KBFA 4DRRA 4UW3A 1CJDA 1G9BA 4AQ6A 1AR73 1RUOA 4RGAA 3VBUA 4AVVA 2DCJA 5E88A 5BY5A 4YGEA 1Y9QA 2JECA 3RWNA 3RQ0A 5I93A 2VQ0A 2ZJCA 4XMAA 5DZGA 2R073 1GANA 2VNGA 1U5YA 5F5QA 2E6VA 4FPYA 3B9IA 3OGGA 4CDXB 1RMU1 4IV1C 4Q0SA 1NE6A 2GC2A 4XJ9A 5JDBA 1Y7BA 4K9SA 3PJQA 4SBVA 1XXNA 1XYPA 2JENA 1D2QA 4FPCA 3ZN6A 5ABJC 3PVOA 5KWRA 4CDQB 1ONAA 1R093 3B9CA 4Y26A 1O3SA 4I0BA 4BE3A 1DGLA 1PZ9A 1RUH3 3PVBB 4FOWA 2YZ4A 5CFDA 1H8TC 1S0DA 1UAIA 3AYDA 1GICA 3QH7A 1G7YA 4EV0A 1AR82 1NE4A 2DUQA 5CVRA 4EWEA 2CAUA 2XWBB 1QJY2 1YIPA 1WW6A 1VBD3 2X5IA 5DUUA 1CAVB 3VL9A 2VY0A 2SLIA 1MS8A 1XNBA 2WSVA 1CAXA 3S6PA 3TOJA 3WCSA 3B3QE 5FLJA 4OI2A 4XF1A 2EALA 1QWRA 1QH6A 4FTEA 3AKQA 4NWWA 2F4PA 4Q1PA 5D8AB 3WX5A 4IV3C 3RNSA 4E2GA 3SHRA 3VN4A 1Q3EA 2HWF3 2IXJA 2EAAA 1YIFA 2UWCA 3MFAA 1BMV2 2N7GA 3AP7A 3TRSB 4P9XA 1UCXA 1YNAA 4FXGB 3LSDA 4U36A 3VZLA 4EJRA 3U4XA 1W6OA 1EV11 2D3RA 2WNVC 1K5MB 3LGRA 4LTAA 4YG6A 4XZPA 1OLRA 3FHIB 4LBLA 4RGGA 2DCZA 1AX1A 3KT7A 4D7SA 1RITA 4K3UA 1VBC3 4UW6A 3VKNA 2RS11 3AB0A 1RMU3 4QPGC 4WM8C 1X50A 1LENA 3KGLA 1VBB3 1UIJA 5BNPB 4FXKB 5FO8B 1N1YA 4XJZA 2A3WA 2CTVA 2GDFA 4S2GA 1OFNA 3R4DB 3JB4C 4FPOB 3KB5A 4A7YA 2WFF3 1LOFA 4IETA 4Z2WA 2B8MA 3H7YA 4IV3A 4M3CA 4LT5A 4BCUA 3AYCA 1OLQA 4XDQA 3QH6A 4G9SB 5SV5A 5EYYA 4N9IA 2HWE1 2QVSB 3ASIA 2MNGA 2BFUS 5C4WB 1H8TB 3FJSA 1SBFA 1KS5A 1UPSA 1XNDA 2EXHA 5AVPA 4WVZA 4XFFA 1G9DA 4LO7A 1VLNA 2HWF1 3D0JA 1VRH3 1Q5OA 2C1FA 3VBOB 2H0BA 4OZXA 1TME2 1EV12 1COV2 2OW4A 4YGBA 3SH5A 2R6QA 2WLQA 2QCSB 3FLPA 2IC1A 3VDDB 1WMFA 3KCXA 1ZRCA 2WS91 3P3PA 2DYCA 3MW2A 1U5ZA 4EN6B 1C1LA 2D40A 5BNPA 1DZQA 4FPKA 1FAYA 3HR9A 1JUIA 2OUHA 4L92A 2Y0OA 3R05A 5J7MA 2WA4A 1H0BA 2PHXA 5I0UA 1KDMA 4IEVA 1LEDA 2AR6A 2JE9A 1C8M3 2ZAHA 1V6NA 3N7KA 2ZS6B 1K5MA 1DGRN 2WQZC 4Q27A 2NLRA 1W6OB 4F8AA 1FXZA 3GALA 1QDOA 1JOJA 5DDJ1 4AEDA 4N9HA 4KL1A 4CEYA 5J37A 4WZCA 1CN1A 1OHFA 3JCIA 4K21A 1VBD2 4XF0A 1DZRA 1C4RA 3AZZA 5DUXA 4JCKA 4JC1A 1UZYA 2DVBA 3VBSA 2E63A 4A7ZA 1Z7S3 2WFF1 1VP6A 1ZBE1 1LECA 1N3PA 2BVBA 1H4HA 1HQLA 5A33A 2P3IA 4IV1A 4CTEA 2HYKA 1G9CA 1CPMA 1JYIA 3D6EA 4ATEA 1A3KA 5K8SA 4Q4W3 5TSWA 5GALA 3FC0A 1RGSA 1VBE1 4GWMA 2C0ZA 1W6NA 5K9YA 2VNOA 3BIWE 4IEPA 1XNKA 3AMHA 4N43A 3I59B 4HVOA 4YW2A 2RS33 1FNYA 3I4IA 4GALA 2AREA 5H9PA 5BXXA 1D0GA 3K51A 4GKYA 4EN0A 1VAVA 1RUE3 2EA7A 4IEYA 4OULA 4AI8A 1PO12 2B46X 5T5JA 2RS31 1AL21 1OKQA 3THPA 3HMYA 5BNOA 1J59A 4GB31 1UD1A 2ZABA 4B4QA 3FLTA 2VG9A 2DU0A 3POSA 2G4IA 1C8NA 4RHV3 5CNAA 2V09A 3VBFA 4YGCA 2CNAA 2W68A 2WNUB 1JUHA 4IEZA 4KBBA 2HWB1 4QGNA 2DURA 3KSCA 1YI7A 3MI8A 2DUOA 4ISRA 2WLPA 3VBUB 4OHWA 5K7PA 1MVEA 4Q1RA 5JSPA 4EN8B 4QHBA 2DTWA 4WBBA 5JOYA 2YV8A 3L2YA 1FV3A 2XLAA 2RMU3 1SCSA 3SCFA 1OSGA 4CP0A 2UYAA 1WA4A 5GLZA 1QJX2 4RS5B 3A4UA 1CAUA 1UU4A 1LKNA 2UURA 2ZTNA 4H7MA 5ACA3 3ZSKA 3HIFA 1MZEA 3V0BB 2CY6A 4BIFA 4AGVA 2DVFA 3WLUA 1RUC1 1GNZA 4P9LA 5AFBA 2TEPA 4YM0A 1J3RA 1APNA 1VBC1 3KT1A 2HEYF 3VKOA 4QX5A 2RJKA 4M0NA 1O3RA 3HT2A 5KHKA 1RUI2 4IESA 3EJKA 5FPZA 1SBDA 3ZO0B 3B00A 4AFDA 2HKXA 1NXMA 1BVVA 1QY4A 1BBT2 3ZYGA 4FQ4A 1H30A 2ZX2A 4ITCA 5C9AC 4DY3A 4YVWB 3SITA 3OJBA 1Y43B 2FMYA 2IXHA 5CADA 2Z79A 5FO7B 5EFUA 1DQ1A 3ZXAC 1B35B 3V0AB 5FOJB 2K9ZA 1F8VA 3CJXA 4LO6B 1PZ7A 5FFOC 1VB4A 2OPKA 4YVWC 2YC0A 3GYDA 1D4M1 1AUYA 1R1A3 1SFNA 4HZFA 3VZJA 3KD4A 1H2KA 3MZHA 1HQWA 3URFA 1HQNA 5L7OC 4Y22B 5I8SA 2UWAA 1VALA 4GWNA 3KZ4C 2SBAA 1FOD1 3TNQA 5K0UB 2PHLA 4LHNA 4XIKA 1OD5A 3GZUC 4KG0A 3I54A 4MXWA 1WBLA 5EXOA 1IS4A 1K5MC 4LE3A 4Y4YA 3NW4A 1AX2A 1RUJ2 3WG4A 3B69A 4QGLA 1BMV1 2O1QA 1V6KA 1ZRDA 2YUEA 1RMU2 2ZA9A 3N35A 3U11A 1FV2A 3BALA 2E7TA 5C8CA 3VBSC 5GZCA 2GN7A 3CJIA 2E51A 1QXRA 1F9KA 2A6WA 5D8AC 4KH9A 4BWOA 1BEV2 2UY8A 3KCCA 1VIWB 4IEQA 1H2MA 4MV2A 1X82A 5EZWA 5LK7B 3U0ZA 4RHV2 4AHWA 2A70A 2VNRA 2A5ZA 1X8EA 4CP1A 3M4FA 1SFYA 2Q1ZB 2VXRA 1VRH1 2DV9A 3B94A 2WC2A 1J3PA 1OA3A 4IEOA 3V56A 3VV1A 3ZXDA 3AZYA 3ZIXA 4RL7A 2ZHMA 4OVEA 1RUD1 1ZVFA 2I07B 1XU1A 1QXJA 3MIDA 4ES9A 2EXIA 1ZRFA 4RR3A 2ZHLA 5BNOC 2ZZQA 1YLLA 2XLGA 1AF9A 1POV0 2LUWA 3WW1A 2JDZA 3AKPA 2WT2A 1G86A 4HMZA 1F2NA 4Q4V1 2ERFA 2WNEA 1D4M3 2GSYA 4TSVA 4Q0VA 1GZWB 2E9QA 4FT8A 3FFQA 5C33A 4FOQA 4AF9A 1MS0A 1WW7A 2X29A 4XHBA 1FPN3 3FZ3A 2ARXA 4QT6A 4CDWC 3M3IA 1C8M2 2PHTA 2JG8B 4JGYA 3ZFEC 2BW8A 1HV0A 2B39A 3RYRA 1D4VB 4K6BA 1QU0A 1TNFA 3A0KA 4PLNA 1OQEA 2CGOA 2QZ3A 2HWD2 2WZR3 4AK3A 1ULDA 2JX9A 3CJIC 4PLMA 2B9UA 4XHXA 4PIZA 4LR4A 1FI2A 2YROA 5JAXA 3UKVA 3MIBA 3KS7A 3NAPA 4QQOA 4R52A 4WM7B 5C4WC 3C2UA 4MUVA 4JGZA 5EV7A 3ZVXA 3MEPA 2OZ6A 1AJKA 5CAZA 1QJU2 1R1A2 4D3WA 4HL0A 1LGNA 1V6LA 3ACLA 5H9RA 4PQ9A 3ZFGB 5L36A 5KXBA 1RUC3 2JICA