1FI2A

Crystal structure of germin (oxalate oxidase)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
201
Chain Sequence
TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXALATE OXIDASE
publication title Germin is a manganese containing homohexamer with oxalate oxidase and superoxide dismutase activities.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 44
structure length 201
sequence length 201
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2000-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fi2A00
5KBFA 3I59B 3PNAA 1X7NA 4LULA 2HJIA 3BPZA 1NYWA 1NXMA 2ET7A 3H7YA 4HN1A 4R52A 4IEXA 4CYDA 2FMYA 4WZCA 4FAHA 4QX5A 3ES4A 4J1XA 4UBHA 4KU8A 3S7IA 3WW3A 5I8SA 3RDIA 5AVPA 2QCSB 5CADA 2E9QA 1O5LA 3CEWA 1OD5A 4XFFA 5J3UA 2OA2A 3IDCB 4I09A 5I0SA 1O3SA 4QGLA 2K0GA 1GQHA 1EY2A 5F1RA 2OZ6A 5LRSA 2K9ZA 4TLFA 5FQ0B 4XF3A 3U0ZA 1ZRRA 4HBNA 4MGYE 2IXKA 5FLJA 5I0RA 4D7SA 1RUOA 2VECA 2XLGA 4LA3A 4B29A 2HKXA 3C3VA 3E5UA 4E2GA 2BYVE 1WA4A 4IEQA 1Q43A 4EROA 3FX3A 4L11A 2WFPA 4OFGA 3FHIB 3GYDA 2MNGA 1CAXB 4LTAA 3D0JA 4NVPA 1NE6A 1CAUA 1Y9QA 1OFNA 1I6XA 1YFWA 1QXRA 3OTFA 3USSA 2PHDA 2BEOA 3FZ3A 5D1IA 5KHJA 4Z82A 1ZRCA 1SQ4A 1GQGA 1OMIA 1RL3A 3LA2A 4IEYA 2FQPA 1EYBA 3EHKA 3SCGA 4MV2A 4QM9A 4XEZA 2GZWA 4Q29A 3H1MA 1X8MA 1H1MA 1I5ZA 5I91A 2Q0AA 5LRRA 3NVCA 3DV8A 5FPZA 2UYAA 4MGKE 4ZU4A 2CGPA 1LR5A 4IERA 1UCXA 3LA7A 5HI0A 3CF6E 4QGNA 4QMAA 3DKWA 4BYYA 3NKTA 5KHHA 1QY4A 4XFAA 3BB6A 1SEFA 2EAAA 3OCPA 4XFHA 1J3RA 2IC1A 1CX4A 4KL1A 2PA7A 4YSFA 2PAEA 2Y0OA 3KCCA 4I02A 2IXHA 4FT8A 4P9GA 3SHRA 5C6CA 1XRUA 2UYBA 4PIZA 3MPBA 2Q30A 2XGXA 1HW5A 1X8EA 3CO2A 4UBGA 5I8YA 1ZX5A 4Q0PA 1RTVA 3PVBB 5E1RA 2ET1A 3LAGA 4MH0E 1YWKA 2PFWA 3SCFA 3B02A 3ES1A 4JV4A 4XFIA 5FDBA 4HZFA 2B9UA 4XF0A 3UKTA 4ZU5A 2QNKA 4HVRA 3E5QA 1LB2A 4Q0UA 5KHGA 1J3PA 4N9HA 1FI2A 4FAGA 1JUHA 1ZZCA 4KWJA 4I01A 1EP0A 3BU7A 2BGCA 3I7DA 5BY5A 4LA2A 3TNPB 4YNIA 1SFNA 5T3NA 2ZCWA 2GC2A 2PYTA 3LOIA 3OGJA 3TNQA 4IESA 2B8MA 3SMHA 1UPIA 4MGZE 2UY8A 1UIKA 2XHKA 5FCCA 3UKNA 3SXWA 4X6QB 1U12A 4IEOA 4J1WA 1H1IA 1Q3EA 3LWCA 1DGRA 1QWRA 2PTMA 4DINB 2Z69A 1VP6A 4LEJA 4BH9A 4LLOA 2XL9A 5JSOA 2BNNA 2Q1ZB 2D5FA 4MGIE 3ROUA 1NZCA 3ACLA 2VPVA 4AQ6A 4A2UA 4HMZA 2EVXA 5LEJA 1ZZ8A 1YLLA 5FPXA 1ZRDA 3E5XA 3KGLA 3FJSA 5JAXA 4YRDA 4AXOA 4F8AA 1CGPA 2ZKLA 1ZZBA 4IEVA 2H6BA 3HQXA 3D0SA 2IXLA 3E6CC 5JSRA 3D82A 1YFUA 3CL1A 1CAWB 1J3QA 2ETEA 3E6DA 2OZJA 3U10A 4EWAA 3EBRA 4I2OA 2UY9A 2CAUA 1RC6A 4HSJA 2F4PA 5EZWA 4AQ2A 2EA7A 3NSTA 4XF4A 1ZVFA 4E2QA 3RPQA 4QGMA 2CAVA 3EJKA 3H50A 3H1YA 2VQAA 2GH2A 3WW4A 4UXAA 1LKNA 4HSLA 4EV0A 2BNOA 2PAMA 2QJVA 3M3IA 5FQ0A 1ZZ9A 4WBBA 3BCWA 3EQEA 2CV6A 3WW2A 1FT9A 2P17A 1J59A 1Q5OA 4L2NA 1ZNPA 4MZUA 2IXIA 5K8SA 4Z07A 1G6NA 3RYPA 3U11A 4XF9A 2V09A 4KU7A 3KSCA 1IPJA 3ETQA 3H1WA 5KHKA 2XKOA 4ONUA 4AVAA 3O14A 1CAXA 4E2SA 5J7MA 2QVSB 3DN7A 5BUVA 3NJZA 3H7JA 1CAVA 2B5HA 4HVQA 1FXZA 3IWZA 1YFYA 5JSPA 2QDRA 1VJ2A 2D93A 3PLQA 4LUMA 5BXXA 2PHLA 3DL3A 4EWEA 2Q4SA 3GBFA 4YARA 3CLPA 4KWLA 3IIAA 4HLTA 4IEPA 3RYRA 2OPKA 2OYZA 4HVOA 4JTNA 1CAUB 3S0MA 4Q0QA 3H8UA 4O9EA 1PM7A 5CU1A 2MHFA 3QACA 1TQ5A 1Y3TA 3N4MA 1PMIA 3H9AA 2H0VA 3JZVA 1UW8A 3ST7A 4PIYA 4I3PA 3HIFA 3NW4A 5E16A 1LRHA 4AVBA 1ZREA 1DGWA 4BHPA 5I0UA 2XLFA 3NL1A 4PIXA 3ELNA 3HT2A 3E97A 3LZZA 1OI6A 3QOPA 2IXJA 3MDPA 2C0ZA 1IPKA 4IEWA 1YHFA 1RGSA 3L2HA 4BIFA 3IBMA 1YUDA 4D7TA 1XE7A 3MZHA 2O1QA 4YYOA 4MUVA 2Z2SB 4FBFA 5KHIA 4I0BA 1O3QA 2H6CA 3M70A 3EO6A 3H3UA 4XFCA 3OF1A 3I59A 4EWDA 3S7EA 5C8WA 1J58A 2WC2A 3H3ZA 4GULA 5JCTA 4O9GA 4PJYA 3WW1A 5I0TA 5I93A 4XFBA 4Q0VA 1ZZ7A 1O7FA 2XKPA 1O3TA 4ZU7A 4XETA 1L3JA 4QM8A 5BPXA 4I0AA 1X82A 2GAUA 4IEZA 4LUKA 3KMHA 2GU9A 1EPZA 2PQQA 5EFUA 3ZDSA 4Q0SA 5FLHA 2PAKA 4JTOA 4IETA 5FLIA 2N7GA 1VR3A 1CAVB 5BV6A 5CVRA 1XE8A 4X6RB 4H7LA 4MX3A 5LEKA 2XLAA 3VHRA 3FE5A 2D5HA 4ORFA 2GC1A 1ZZ6A 2XL7A 1ZRFA 3SCHA 1DZRA 4KWKA 3I54A 3IDBB 1V70A 4F7ZA 3KGZA 3G7DA 4AVCA 2BNMA 4N9IA 3BALA 3RYKA 5J48A 3RZZA 2O8QA 1YFXA 2MPFA 5I8TA 3HT1A 5JR7B 4RD7A 3LA3A 3OD0A 4QXKA 1QXJA 4OLLA 2KXLA 4K8FA 4XFGA 1UIJA 3CJXA 1DZTA 3R6SA 2ATFA 4META 2I45A 4XF1A 3FWEA 4R8HA 3E6BA 4IEUA 3FFQA 2DCTA 1CAWA 1J1LA 1WLTA 1O4TA 4JVAA 2D40A 2IXCA 3RNSA 4HN0A 1O3RA 2GC0A 4WVZA 1O5UA 1UD1A 2GC3A 1RUNA 1WGPA 3MYXA 1NE4A 3UKVA
chains in the Genus database with same CATH superfamily
4RHV2 1W6OB 3I59B 5GZDA 5FWEA 2AR6A 3ABZA 5ERLA 3BPZA 1XC6A 1RUJ2 2ET7A 3GF6A 4K40A 4QQ2A 1JZ3A 5J1XA 1RUH1 5BNOA 1OOPA 1ND2A 3U75A 2AH2A 2O0OA 1HRI1 1NCQC 3OBAA 2ZS6B 3ES4A 1LOCA 2P1BA 2VCMA 4UBHA 4TN7A 3QD6A 5I8SA 3S5AA 3WG2A 4IDZA 3ASIA 1O5LA 2VOXA 5FMOS 3ZYPA 4Z92B 4FPKA 1RUI1 3NV1A 4XFFA 3PHMA 4CDWB 5I0SA 3VD4A 4M4PA 4D6SA 1S0FA 2Z5WA 2QBXA 1A78A 3BUCA 3DXUA 5FYMA 1GQHA 3KQRA 4Q4X3 1UMIA 3PL0A 3Q8FA 3KQ4B 2R1DA 2OZ6A 2PHWA 5F1RA 1S0IA 3OUIA 1ZRIA 1HLCA 1UL9A 5FQ0B 1ENRA 4OCTA 2Q8CA 1MS1A 2ZMLA 3POWA 4Q27A 4XQ4A 4JQTA 3WNXA 4CCKA 1RUOA 2LS6A 3M4FA 1LU1A 5D2AA 5C70A 4QPIB 1Q8SA 5AVAA 2BERA 5JZGA 1VBD1 3AKQA 4E2GA 1PO23 2WR9A 4IEQA 3AKPA 1CPMA 1L7LA 1RMU2 3NV3A 2GN3A 4GQ7A 1W6NB 3GM8A 4EROA 4L11A 1ZYBA 2IVJA 4KQ7A 3ZDVA 3BKZA 1ASJ1 3PIJA 4CDUA 3WZ1A 3GYDA 4AI3A 1KEXA 5IT6A 1WCQA 1XOYA 4LTAA 5DUWA 5KC5A 3J8F2 1TME1 1M4WA 4E4ZA 1DFQA 4YM3A 1PK6B 1S55A 1XNAA 1OFNA 1OQDA 5CFCB 4WM8B 2YG0A 1QU0A 2VM9A 2Z42A 3PJYA 3USSA 2DUQA 3WY6A 1AXKA 5DUUA 4MGQA 2JDKA 5FRAA 5FY1A 1R091 2YC4A 4A3XA 1SQ4A 4B1LA 5FPUA 5KHJA 3MLKA 1RVF2 3O1TA 1BEV2 1OMIA 2R043 3WF3A 1DG6A 1Q8VA 2VCCA 4P5YA 3V0AB 4C0BA 2FQPA 1JZ6A 2AYHA 1LNSA 4E4HA 1QJFA 1QH6A 5AFBA 4QM9A 3MIGA 4UI9L 2ZGSA 1H9WA 3ZFFB 3JBG1 2P3YA 1OOPC 5BNOC 4C1WA 4CEWB 3IAPA 1IOAA 5C33A 5C7GA 3AP5A 4ZPIA 5I91A 2RM23 2Q0AA 1APNA 3AYCA 3WP5A 4COVA 3DV8A 1WZXA 2UYAA 1VRBA 3SEEA 1MQTA 3S5QA 4ZU4A 2JDYA 2VW1A 2WA4A 3J7LA 3ACIA 1B35A 3C7EA 2Y6LA 1UYZA 5FO7B 3ZFGA 2QQLA 3DXTA 5FTTC 3DKWA 1UXXX 2Y0IA 1LHOA 5LK7B 3BB6A 3OCPA 2CYFA 1ND2B 3K3NA 4LJHA 4P5HA 1DZQA 3UK9A 3ZFEB 1O4YA 5G04L 1UY2A 5FAXA 4QPGC 2UURA 2B39A 2WRAA 2RMU1 4YSFA 3O1MA 2B45X 2PAEA 1JOJA 3UT0A 4I02A 2ZX3A 4EYUA 3W59A 3MPPG 4FT8A 1RUG2 4Q1PA 4ISQA 2VZ1A 3LFMA 4UW3A 4W6YA 1S2KA 1GLHA 1OUXA 5DDJ2 5C6CA 3PUSA 3WDTA 3V0BB 1UMZA 4LO6B 4OZOA 3T3YA 3VBHC 2Q30A 2RS12 1QJU1 1WMFA 4OI4A 2JD9A 1AR92 2YGLA 2C9AA 3CO2A 4UBGA 5I8YA 4CXWA 4EZ4A 2GN7A 4NIDA 1W2AX 3OJBA 2ET1A 4IE7A 4MH0E 4QQHA 4NIIA 3VZNA 1DLLA 3SCFA 2ES3A 5JMOA 1BYHA 1EAH2 3KB5A 4KGGA 4NPMA 4RGKA 3ZMOA 1VB2A 3VBUC 4XF0A 5DZEA 3UKTA 3RG0A 5K0UC 4Y1VA 1N1YA 1XJAA 3E5QA 1RHI2 1RMU3 4QKDA 5FZLA 1ULPA 2RJLA 1PX4A 4UWDA 4L92A 1JHJA 1FATA 2F17A 4NWVA 3AJZA 1JUHA 4GZ9A 4KWJA 4ISRA 3RWKX 5FP8A 2NMNA 2WINB 5JOXA 1MVQA 1FX5A 2W1WA 4YNIA 1SFNA 1GKBA 2ZCWA 2DCYA 4A44A 4MGTA 2A5ZA 2X5IB 4CDXA 2XVGA 3SC7X 2Y6FA 1JU3A 4IESA 1EPWA 5FY7A 1REDA 3ZYFA 2DF7A 3N9QA 3USUA 3AC0A 3U4SA 1MQTC 4AZZA 2PHTA 1VIWB 2BZDA 1UIKA 5FYTA 1NQDA 3BTYA 4Y5TA 2ZGTA 4AFBA 1VBB2 4X6QB 1OD3A 3IPVB 4Q2FA 4RSUA 3M8LA 3BOWA 4JKKA 3KV9A 1Q3EA 2WWUA 1F35A 5FWJA 2PTMA 4P9XA 4CXYA 1GUIA 2BVVA 4GH4C 2E26A 1NQJA 4BH9A 4LEJA 5FMOL 2JENA 5CZKA 5JSOA 2QQJA 3POIA 2BNNA 2LUWA 1YIFA 2NQYA 2XQRA 4HT1T 2DWRA 3ZFGB 2Z4FA 1YQ2A 3GZEA 3MO4A 1TNFA 4MLOA 3ACLA 2WSVA 4LBJA 4ES8A 1AVBA 3LEIA 4XIOA 4A2UA 3K4DA 2Q1MA 3DYMA 2EVXA 4AAXA 3HBKA 4YVWA 1ZZ8A 1W0NA 1YLLA 5LEJA 3HEIA 3VDAA 1ZRDA 3KGLA 3FJSA 5JR2A 1SBFA 1VRH1 3IAQA 5EJZB 2DTWA 3APBA 2VBPA 3UGHA 4F8AA 1GMMA 3Q8AA 1S0GA 2EIGA 3P5BA 5J98B 2C4XA 3KWVA 3AKRA 4QXCA 2IZWA 2XQXA 3I2IA 2X05A 1MZ5A 3D0SA 2IXLA 4Y20B 2B42B 4SBVA 5JSRA 3D82A 4IQPA 4QX3A 1C8M1 1BJQA 2CDOA 2ETEA 2YBKA 5DDJ3 1UMHA 3UYJA 3WNNA 5IATA 1F5FA 1UOBA 4EWAA 5KC6A 1W0OA 1RC6A 2CAUA 2E7QA 4LBLA 4E9KA 2F4PA 1BVVA 4LO8A 5A7WB 1QJEA 5F5IA 1OVSA 1JW6A 3HR9A 3NSTA 1AR93 1DU3D 3JB4C 4QAWA 4XF4A 3VGIA 4AHWA 5JOWA 1W05A 5C3RA 4OHZA 2EIDA 3EJKA 2B7YA 4XCBA 2GH2A 1O8PA 3AZZA 4BQXA 3LPGA 4B3NA 3B7MA 2BNOA 2PAMA 3NNJA 1XNCA 1YEWA 1ZZ9A 3ZXKA 3T2OA 5LA0A 1MACA 3B3QE 4QQLA 3WW2A 1UN1A 5LATA 4LPLA 1V0AA 2P17A 1RHI3 2E6VA 4A4AA 1BXHA 1J59A 4CDXC 5L36A 4PBOA 2CDPA 2Z79A 3ZYIB 2NMOA 1VBA3 4Z07A 3B9IA 3U11A 5T5LA 4FTEA 4XE9A 4TXWA 1AR62 1X9PA 2R32A 4KU7A 4XHXA 2TUNA 4O7XA 3U14A 1JI6A 1U5IA 4ARXA 1B09A 5LA1A 3B9CA 4RHV1 5FYYA 1FOD3 1TEIA 1JYVA 4HFSA 4QX2A 1EV12 4D7YA 2BV4A 1CAXA 2J1UA 2QUOA 1RUJ1 2VAUA 3AMHA 4UAPA 1PVC2 2CU5A 3USUB 5H9SA 1M06G 1NLRA 1CWPA 3WG1A 2YC2A 1T6BX 1NA1A 5BUVA 1G8WA 2ZGLA 2RHPA 5FUPA 1N3PA 2B5HA 4K1YA 4N7UA 3VB9A 3PU3A 4Y24A 1VBB3 4HVQA 5LWBA 4BWOA 1AX0A 3JB8A 4M3CA 5F9TA 1YFYA 3VDDC 4B7KA 5JSPA 1V6KA 4HPKA 4WZFA 1VJ2A 2D93A 4GD4A 1YQCA 4LUMA 4XJ9A 5FZ7A 5IVJA 2PHLA 3DL3A 4GIQA 4QKBA 4Y3OA 4AAPA 1K12A 3GBFA 1W9SA 1V6MA 3DYOA 2ERFA 3OPTA 3TYJA 2E33A 5FJKA 3IIAA 1KQRA 3MLLA 4IEPA 1ODNA 4L9BA 1S0EA 4XJUA 2WQ4A 4JTNA 3OD4A 3S0MA 1GYKA 1Q8OA 4O9EA 1W8NA 1PM7A 3MIDA 1AR82 2BUKA 2IFRA 2MHFA 1GZWA 4YVWB 3QACA 4XBQA 3AB0A 4UF0A 4JDOA 4PLOA 1H9PA 1H2NA 3ORJA 1R1A3 1S2EA 3OBZA 3PU8A 1UKGA 2H0VA 2HH9A 4EN9B 4BU2A 3ST7A 4PIYA 4I3PA 1OFSA 4IV3B 5IK8A 1X33A 1OSGA 1V9U2 1QJZA 3HIFA 3O1VA 1GP6A 4B4RA 5E16A 5FJHA 1UOJA 1W2OA 3LIGA 1LRHA 2OKXA 4AVBA 4DIQA 2R1BA 1ZREA 5C4WC 3VKFC 1PNFA 2RS53 1R64A 3O5SA 3DECA 2D98A 3LEKA 1VMFA 3J8F1 3PJQA 2L9LA 2QQKA 3ME2A 4A6OA 4QX7A 1UYPA 4PIXA 2HWD2 3GGLA 3RI8A 1L7RA 3WINE 1PIV3 3ELNA 4GWNA 3E97A 3RZGA 1U0AA 4IGOA 1OA2A 1W3XA 4AE2A 2HWE3 3BYWA 4CRQA 1D7PM 4NRPA 4Y26A 1REEA 4IEWA 4Q4V3 1RGSA 4Q8LA 2HWC2 1RVF1 5FZIA 5EWSA 2WAAA 4BIFA 1FV2A 1D4M1 2W91A 2P37A 3OBTA 5FK8A 5CISA 4URTA 5F3EA 1KDMA 2BP6A 4W50A 2X29A 3VBOC 3FUQA 2Y38A 4E4SA 5GLWA 4RS5A 4FBFA 3N7LA 3BTXA 2WNVA 2WS93 4CCCA 4HONA 4QKNA 2J1RA 2ZHLA 3OEAA 2BOJA 3VHOA 1CQ9A 1NA1C 3WP4A 1JYCA 1SPPA 3AMNA 3I2KA 4GULA 5DABA 5ANQA 1WCDJ 1LGNA 3TN91 1KDKA 2W1QA 1QQP2 4O65A 5EYYA 1XSRA 4XBLA 1GU3A 3SKJE 3GZUC 1PX3A 1IZ3A 3AZWA 3TB0A 4FTSA 1L3JA 3ZYRA 1KFXL 1W8TA 2J1SA 5FKBA 1OQ1A 1HXS1 4LUKA 3KMHA 2VE1A 2VTFA 2GU9A 2XUMA 1EPZA 5EFUA 1V6LA 3OBRA 1PVC3 4BPZA 5A6ZA 2ZZQA 5FLIA 2R062 2PXJA 4OQ8A 3LOBA 3TRSB 2RDQA 4K1ZA 3MV01 1LAJA 3VBFC 1O59A 3T4HB 1I1EA 4H7LA 3IB3A 5LEKA 1UY0A 2BGOA 5CYYA 4A41A 4XHBA 4H14A 4AFCA 2VO5A 1LHWA 3FE5A 1RUG1 4CU9A 2VBDA 4GXLA 5FOJB 5DUVA 1U5XA 1FMD2 2GC1A 2VGDA 4RQPA 1COV2 1ZA7A 1ZRFA 1O8SA 1UZYA 3LDRA 1NCRA 2RS31 1KFUL 4NIHA 3LSEA 4BQ3A 2WLQA 2VZUA 2FCUA 4NR1A 5FYVA 3IDBB 4YGEA 1V70A 2JE7A 4NPLA 2MEV3 1XPWA 1KJLA 1LOFA 1VE0A 2Y34A 4BDVB 5A7PA 4IE0A 4N53A 1EAH1 5D21A 1JYXA 2VZQA 4FXKB 2JG8A 1KS4A 1BHGA 3W21A 1H8TC 2OXBA 3I3QA 1UWWA 3Q8BA 1QNYA 1FPN2 1SLBA 2VQTA 4YM2A 5JR7B 3LA3A 3V65A 1LECA 1R082 1V9U3 5C3PA 1MS4A 4QXKA 4ZY9A 1DQ1A 1JHNA 2BU9A 4OLLA 1QNWA 1RXGA 4K8FA 4XUOA 1GWKA 1HIXA 1HJGA 4Y4YA 5C71A 3WCSA 2ZX4A 4JRAA 5FREA 5FZCA 1TMF3 2VOWA 2WT0A 3KVBA 2JIGA 3WOGA 2HWF3 4BISA 1YI9A 4CP1A 1AR72 4R8HA 1MS3A 2ZKNA 4YFWA 4IEUA 3S30A 4LHNA 5K9YA 2DCTA 3PIGA 3AX4A 4QX0A 4NPRA 2SLIA 3SH3A 4YVSB 2D40A 1OH3A 4ZZ5A 3ZO0B 1VLNA 2A6WA 3CJIA 2ZAHA 1C5HA 1BK0A 1UD1A 2XJUA 1WGPA 1QIQA 3N7KA 5FZ1A 4RS5B 2P6CA 3WNLA 4AHZA 4COYA 3VZKA 4ARYA 1DP0A 2QZ2A 1E57A 5GLTA 1RUF2 1LENA 1WWYA 4GAZA 3PNAA 3H0OA 4C90A 1PGW1 1GNYA 1SPPB 1GOFA 3OUHA 4G9SB 4LBKA 4AVVA 4P9LA 1IS4A 3U07A 3ZXGA 4R52A 5C3SA 2J1TA 1U5ZA 3TAYA 4BOWA 4CCJA 1ZBE3 3S7IA 1CN1A 3RDIA 2QCSB 2JD4A 5CADA 5FIXA 1WW6A 4FOYA 3N3HA 4N43B 3AM2A 4NIAA 4BQ1A 3URFA 1AYM2 1NCRC 1YQ8A 1S0JA 4HKLA 5CBLA 2HEWF 4K7JA 2K0GA 1JXNA 1UY1A 1GOHA 5CIRA 4B7EA 1F2NA 2WA3A 2PN5A 2ZMKA 2WDBA 3POSA 4CUCA 2K9ZA 4J25A 4TLFA 4BK5A 2VZVA 4XF3A 3U0ZA 4XC9A 3I2FA 1MS9A 1ST8A 4HBNA 4MGYE 4TZDA 2JG8C 5FUIA 4RQPB 5FLJA 5BNNB 1FMD3 1F4HA 3U4XA 1XB9A 3MIBA 1COV3 2QQOA 2VECA 4LA3A 4XJAA 4A7ZA 4IXLA 1ND3A 5H9QA 3WVJA 5E88A 3C3VA 2JB8A 4Y4RA 4D3WA 4JGZA 1WA4A 2DU1A 2WNUC 4YWAA 3TWIA 3ZXFA 4BLIA 2PHUA 1QGLA 3POYA 4Y22A 4H2AA 4PBPA 1W2NA 3K48A 2VMGA 2ZHKA 3MFAA 4NO4A 4HXCA 4N53B 4Q4Y2 3A0NA 4NMIA 3FHIB 4DEVA 3VV1A 2W39A 3I2DA 4NVPA 4CEYB 3B93A 2LALA 3OG2A 5ACA3 1I6XA 4JGYA 3VBSC 2ZGNA 3OTFA 1AXYA 1VAMA 3T09A 4AQSA 2BEOA 2WAOA 1SLIA 3FZ3A 4Y5SA 5EJ3A 1AR61 3PVNA 4Y1UA 2VUDA 4MXWB 2R6QA 4CDQB 4FOWA 2XDVA 5IYYA 2TNFA 4JKMA 1VPHA 5T5JA 3BIWE 1GP5A 1NAEA 1BVP1 2VXJA 2BGPA 3OGVA 4EQVA 2BFUS 3SCGA 3KLSA 4MV2A 4V2WA 1MEC2 5F3IA 3RGBA 1TZOA 3MFCA 1ULOA 3PUQA 4XZPA 1H8VA 4XEZA 5H9RA 1G9DA 2XHNA 3D6EA 1X8MA 1H1MA 5CKMA 1CIYA 1JYIA 4XUNA 4CUGA 2VTXJ 4UFKA 3MBWA 2VNOA 1S0BA 3OGGA 4U2AA 3JU9A 4QDSA 2VNVA 2E63A 2JG9B 4CVUA 2CGPA 1RUF3 3K46A 4IERA 1XQNA 5FYIA 2JE9A 1MPXA 1UCXA 3HAGA 4YZ1A 3HNYM 5HI0A 3B00A 4QGNA 4BYYA 2C6SA 1IQAA 5C9AC 1ULCA 4N7IA 4XFHA 4UFJA 4XAAA 4AF9A 1MR5A 4JC1A 2ZA9A 4ZS2A 4DUWA 2VZTA 5LA9A 4HETA 1CX4A 2Y6KA 2PA7A 4FPCA 2ORXA 2FDFA 1HX6A 2WUHA 1H0BA 2I2SA 4AK3A 3NAPC 3IT8A 1HKDA 2QQVA 2R042 4M0NA 5G05L 1AR81 5LBEA 5JMCA 3MI8A 2G9ZA 5L7OA 1ENSA 2Q8EA 4IE4A 2KD7A 1QMJA 4P9GA 2BTVC 4ZXEA 4Q8KA 5APAA 2GMMA 3GHMA 4EN8B 1WW4A 3EB7A 3MPBA 2ZHMA 5A33B 2OQ7A 2W46A 2GMEA 4DQAA 1A34A 1W8UA 2P5BA 2XGXA 2YZ4A 4GMP0 5HXVA 1OPMA 4XURA 3T4VA 3ZN5A 1XE0A 2ZEWA 4LMFA 4AEJA 4EN6B 3PVBB 4N8MA 3J9SA 4FP3A 3LAGA 3BTZA 4FPGA 2PFWA 1J83A 4Q4W1 3AP6A 2D3SA 3BPSA 3MF6A 4KGQA 1MS0A 1KITA 1OKQA 1PZ8A 4QKFA 4XFIA 2HWD1 1F5JA 2PLV1 3UESA 4JGYC 1FAYA 4A42A 2B9UA 2W92A 3AYDA 4JGZB 3TEWA 4W8JA 3KF3A 2QQWA 4FXGB 2D43A 1JZ5A 3ZKUA 4QDQA 5KHGA 1YNAA 5BNQA 2HWC1 4M01A 5LA2A 2ZGRA 4QHZA 1OUSA 4Q4Y3 1GWLA 4COZA 1N1TA 1FI2A 4Y5Z0 4OULA 1QJY1 1ZZCA 1SBEA 3BN6A 3ON7A 5F2WA 5J37A 2PHXA 2QQMA 2YU2A 3VKMA 3C7GA 4I01A 4Z1VA 2BGCA 1ULGA 5FZBA 2ZJCA 3W58A 1WW5A 4FOQA 4LKEA 3UL2A 1DQ5A 4XDPA 3D5OA 2VH9A 4CDWC 2ORZA 4KWUA 3M7AA 3LOIA 3OGJA 4YZ2A 3I3DA 2YHJA 3OGRA 1NCQB 4GMP1 1QQP1 4XQDA 3TNQA 3N7JA 4QPGA 3O1PA 2ZZJA 2W9XA 3GNEA 4MGZE 1H2KA 5F39A 1F31A 2XHKA 5A1FA 1W9WA 4CCMA 3OPZA 5GALA 2JDAA 1U12A 1YJKA 4KNCA 2VOVA 4B4QA 3RZKA 3GZTB 1MEC3 1DYKA 1LHUA 2Y26A 4TLGA 5TSWA 1VBC3 2JECA 2R061 1DGRA 1POV1 3LWCA 3FLRA 4LXLA 5A7OA 3ZYGA 2VG9A 3VBHA 1GFF2 4ATEA 4LLOA 4AI1A 4FPOB 3E1F1 2FZ2A 4AEDA 4UYBA 5DAPA 2Q1ZB 3KT7A 2D5FA 4MGIE 3ROUA 1OHFA 1MZEA 3WF1A 1NZCA 1YIPA 4JDMA 5L7OC 3ALQA 3WP3A 1JZ2A 3ATGA 4XTMA 4YGDA 1UYYA 2VPVA 2FDGA 1RUE3 2VMEA 4CE8A 2ADDA 4HMZA 3VBUA 1K5JA 4AL9A 5K0UA 4QPWA 1XYOA 5A32B 1PK6C 1G9CA 1URXA 2DCJA 3T0AA 3PUAA 4AXOA 5ABJB 1LOGA 2VUJA 4DMIA 3NO8A 2CNAA 1ZZBA 3AP9A 3HN1A 5T54A 4GB32 3HQXA 1TVGA 1IG0A 2XBO3 1PGSA 4L97A 4QHOA 4QX1A 1HRV2 1YFUA 3CL1A 1CAWB 1F4AA 2RR12 3E6DA 5IAVA 2OX0A 1Q56A 3EBRA 2UY9A 3KHBA 4DOUA 4CCDA 4PT6A 3D8CA 4S2DA 5LK5A 4FPHA 2A6ZA 3VZOA 1N3OA 2YPJA 3ZXLA 3VHPA 4E2QA 5FO8B 4HK9A 1BCXA 2HWB1 2VZ3A 5FP7A 1EUUA 2J1AA 3H50A 3LCPA 3LQCA 3VD7A 5KR7A 3OB8A 3GCWA 3WW4A 4CSWA 1LU2A 5IVEA 5FY5A 2BOIA 3O0WA 4IE6A 5IK5A 5B4NA 3QCWA 5FYZA 3EQEA 5JOYA 1AR71 5GZEA 4QXBA 1FT9A 2JKBA 4BQYA 1WW7A 2G1MA 1OOPB 5BNOB 5IVBA 1KXGA 4R9CA 5FXZA 3WQ1A 1QHDA 1HDKA 4GH4A 4MOAA 4XF9A 2BFUL 5FP9A 4GKXA 1QF3A 5FPLA 1W99A 1NY71 2GSYA 1SLCA 4MGSA 3KSCA 3JD72 4TWTA 3R4SA 3WXPA 1PVXA 3ETQA 2BWCA 4YGCA 3RWNA 2CWSA 3KZ4C 4CU6A 5KHKA 3N35A 4CP2A 1WUVA 2SBAA 3O14A 3CU7A 4CP9A 2KR2A 1UZ0A 1VMHA 3DGTA 1QDCA 4AEDC 3DN7A 2WWJA 1ZA4A 3WG4A 3UGGA 4EZHA 1H6XA 4WVWA 1C5IA 1CAVA 3H7JA 1DYOA 3N9OA 4DUXA 1Z7S3 5IWFA 1Y9GA 5A70A 5HCAA 2ZEXA 1UOFA 1A6CA 5FXXA 2RVAA 1NT0A 1OVPA 2DVBA 2BBAA 5JZGB 4FSJA 2QDRA 1AYM1 3CKHA 4EWEA 3VBHB 3VZLA 1SDDB 2BPA2 5T5OA 2Q4SA 1IKPA 1VBA2 1SDWA 4L0PA 5FZGA 2GNBA 4QB2A 5FXVA 2VOKA 1YI7A 4AVSA 4KWLA 4CDUB 4HLTA 3RRDA 3RYRA 4D8MA 1PO13 4H7MA 5E6HA 1Z0HA 2V72A 3NQHA 3H8UA 1UY4A 1D4VB 3VBUB 3OY8A 2ZOEB 3THTA 1FOD2 5K0UB 1TQ5A 2CTVA 2GP5A 1Y3TA 2XWBB 3UGFA 4P9JA 5J96B 5FZ4A 4ASLA 3I2GA 2HBUA 4QU2A 4XMIA 3T2TA 2A70A 4AOCA 2VMHA 2WYFA 4AYUA 4JCKA 3EMRA 1UW8A 3JCIA 5LZ6A 2X5IC 2WZR2 4RR3A 2RV9A 4GB33 3WR0A 4RFRB 1NZIA 3AVRA 2GH8A 4DUVA 3WNKA 1HRV3 1YQ6A 2RR13 2YBSA 1DGWA 4RFT0 4RN5A 4BHPA 4BMEA 3AVSA 4DZGA 1SZBA 4DY5A 3IKWA 4BQWA 3NL1A 4CTEA 4LHSA 4OUMA 3LZZA 3QOPA 4GWMA 3M3CA 2C0ZA 4UFMA 4Q4X1 3T2QA 1MQTB 1UZVA 3L2HA 1B35B 1NOVA 3B69A 3IBMA 1YUDA 2FHRA 1XE7A 4GWJA 4JDNA 5FP4A 3TEXA 2O1QA 5C5TA 1H30A 3KVAA 3AYAA 2Z2SB 3MHZA 1E5SA 4S2GA 4XMAA 1BBT2 3VDDA 2IVIB 2H6CA 2Y60A 3EO6A 4PHZA 4UOJA 4DXZA 3MUY1 4GH4B 1DYPA 2ZBJA 3S7EA 2A7AA 1PO21 1J58A 2XMLA 5C8WA 1EUTA 1R1A2 4QB1A 2AUYA 4A7KA 5GZFA 2Q8DA 1JN2P 3FFZA 4O9GA 3JD73 4PJYA 5I0TA 4UW5A 3AZVA 1ZZ7A 4AFMA 1O3TA 1RUD2 1QJX3 4OMDA 5BNPA 2RS52 5BPXA 2XVKA 1CZVA 2WSUA 4IEZA 4NN0A 4UFIA 2BJSA 1AL23 1PIV2 4K20A 1BMV1 3IM0A 2PAKA 4IETA 2N7GA 1VR3A 2HWE2 1CAVB 1DGLA 2I07B 5BV6A 2OQ6A 2VQUA 3SLIA 3JQWA 5CVRA 2V4VA 2JE8A 2WL1A 3LDKA 4Q4V2 3L2YA 4MX3A 2GNTA 2ZAAA 2EIEA 2J1EA 2R041 2VOTA 5AC93 2D5HA 4RGAA 4NAMA 5C4WA 5LY2A 1HQLA 2IWGB 4OHWA 5DZFA 5C8CC 5LBFA 1STMA 3ZYBA 1UNBA 1S0DA 1ZZ6A 2WS92 2EICA 2VD7A 2XL7A 2R073 2ZABA 5FFOC 3SCHA 1DZRA 4P9YA 3OEBA 4DEQA 4RR3C 2RM21 5CG9A 3NNMA 5IVFA 1E5HA 3KGZA 3G7DA 4FQZA 4CA9A 2W0XA 3VD5A 4N9IA 3OY8B 3OYWA 1LTEA 3P3PA 2W94A 1VBE2 3ILNA 3RYKA 3VKOA 5KXEA 3VBOA 4URAA 1RB8G 3WDWA 4C91A 1W3VA 1HJFA 3MEPA 5J48A 4CDXB 5DXDA 5FYBA 2O8QA 4CP0A 1UAIA 3H8OA 5L73A 2MPFA 5T52A 3OD0A 4DY3A 1W04A 4K9SA 3RZJA 2WFF3 4HKOA 2WZR3 2VU9A 5GLZA 1JZ4A 2R0HA 2Y6JA 5EQUA 1BZWA 3BIEA 1HN0A 4XJZA 4LIVA 5IVYA 3S57A 1Y43B 3NWKA 1A3KA 5JXGA 1DQ0A 3UV9A 2CL2A 2E51A 3UETA 1WMEA 4META 2BRTA 4HKWA 3SH4A 4XF1A 3ZSLA 3FWEA 3O1SA 2XOMA 1JTZX 3AL6A 4XXPA 5JXJA 1AYN2 4JKLA 2ZPXA 4OI2A 2VXRA 1SLTA 4K3UA 4JVAA 3WNOA 4NAOA 3I4IA 4ZZ8A 3RNSA 5CG8A 4HN0A 2GC0A 2CGOA 5BYNA 4XOGA 1HB3A 3ILRA 2VCAA 3VBFA 2MEV2 1H4GA 3THPA 1RUNA 3NNFA 4CCOA 5BNPC 2UU8A 1W9TA 2ZGKA 1BK1A 3VDDB 2DYCA 1XYPA 3N9PA 1LGCA 1PM4A 1BBT3 2A3WA 4E8DA 2AEZA 2WN3A 2EXJA 2C26A 4LULA 2VY0A 3AJYA 1RXFA 4XDOA 1FV3A 1NYWA 1NXMA 1J84A 1RMU1 1WLCA 3FHQA 1UO9A 2YFZA 5FKCA 5CEHA 4BK4A 1RUC3 5A3LA 1OQEA 1ZBA2 4QX5A 4WZCA 1RUD3 4J1XA 2JWPA 1IS5A 3LGRA 3F2ZA 1N1VA 1S4CA 3JUUA 3WW3A 1UU4A 1WLDA 1TMF2 3L9JT 3R4UA 4C1XA 1G9FA 3O12A 4Z2AA 3A0KA 4XABA 2E9QA 3CEWA 1CESA 1OD5A 4A45A 2HWF2 2RDNA 2D3RA 1RITA 2P3KA 4IV1C 4I09A 1H8TA 2VZRA 3IDCB 5J3UA 4OHYA 3I2OA 3O1UA 4JRLA 5JDBA 1EY2A 2B4KA 3RJ2X 3V56A 2NN8A 4D6RA 4CUBA 4R9DA 1BEV1 2XVLA 2EXHA 3I3EA 1YXWA 3J7MA 4LE3A 2R16A 5LRSA 2WQZC 4P00B 1GZCA 1YRZA 1XNBA 1N1SA 1ZRRA 4H55A 2QQUA 4LKFA 4PDWA 1HV1A 2DUOA 3KCXA 4QHBA 3O1OA 2IXKA 3BODA 3OGSA 3U78A 4D7SA 5I0RA 4FFFA 3AFKA 5DAXA 4Y1YA 5FYHA 3RMXA 1G9BA 2XLGA 3HNMA 4K6BA 3WLUA 3A23A 5CAZA 4B29A 1GNHA 3UJOA 4DPNA 3RJRA 2QQNA 4LNVA 1L7QA 4YZ5A 4LBQA 3HWJA 3SKVA 2BYVE 3BTAA 5DG1A 1RIRA 1IS6A 3O0XA 2W08A 4MHRA 1G86A 4KG8A 3BOPA 2DVAA 1HQNA 4UT5A 3OYWB 5JI9A 2WFPA 1HRI2 4OFGA 2VNRA 3WF4A 1ZBE2 2AENA 3VBOB 1VBE3 2K2SA 3B94A 3F95A 2XPJA 2MNGA 1CAXB 4LOSA 3SEPA 1JH5A 3D0JA 4D69A 1ALYA 1IGOA 1NE6A 1CAUA 1UF2C 2P34A 3MIFA 3LD8A 1RUI2 4J6GA 1NA1B 3VBRC 3SNMA 1YCIA 3LB9A 5DAQA 2W47A 4Z82A 5EV7A 3RS6A 1ZRCA 3R05A 3WDYA 5JIUA 2P4EA 4BXSV 4COUA 4CXXA 1GQGA 1RL3A 4M3CB 3VKNA 2FCVA 4HPKB 3LA2A 3M1HA 5CNAA 2FDJA 4CPBD 4IEYA 2P6HA 3THDA 5DDJ1 1EYBA 4MVTA 4OVEA 3EHKA 4KMQA 1AYN3 2QFEA 2X09A 4LBMA 5JIAA 2XH6A 1GQPA 3NMBA 4FPJA 4ET7A 2E32A 2ID4A 2RS11 3LDBA 3GJBA 4GWIA 2GZWA 1AR91 4K8RB 4XBNA 4Q29A 3H1MA 4WM7C 3VBFB 1KS5A 1I5ZA 1ULEA 3BGAA 2XONA 1D2SA 3FLPA 3NVCA 5FZOA 2CGNA 1GZWB 4MGKE 5A7NA 5IVCA 1OC1A 1Q8QA 4UF0B 3ZR5A 4EE2A 2WYSA 3WHTA 5F3CA 1FNYA 4QMAA 3WQ0A 1LULA 1RHI1 2VC9A 3NKTA 5KHHA 2W95A 2OUHA 1TME2 3CDZB 1SEFA 2EAAA 4K21A 4XFAA 5ACA2 2WNOA 2AEYA 3ZLIA 3H8XA 1UZZA 1VBA1 2J22A 5FYSA 2DU0A 1HV0A 1ZBA3 2WNUA 3TOJA 4A6SA 1WMXA 4KL1A 2FDIA 3VHNA 4PI0A 4PDWC 3LEMA 2DV9A 5A7QA 3CQOA 2C5DA 2JDZA 3B01A 5C5UA 2HYKA 1FOD1 4BM8A 1H8TB 2NLRA 2WN2A 1Y9MA 1XRUA 2D6PA 3K51A 2OS2A 2G4IA 2UYBA 1UXZA 4PQQA 4I3GA 3VBSA 3I2JA 2ARCA 5F6KA 4GJZA 5FZ6A 1UZWA 1HW5A 1OKOA 2ZX1A 3JBG2 2G9GA 2V73A 4FI9A 4NRMA 5EYXA 1LODA 1W8WA 4Q0PA 1GANA 5L19A 1RTVA 1UX6A 2Y33A 3WDVA 1RYYA 3C7OA 1VBB1 3T0DA 1YWKA 2WNVB 3T08A 4Q4W3 2ZX2A 2WIIB 2P3JA 3UNPA 2GMPA 3T2PA 2RG4A 4LBQB 4L99A 5IK4A 1PZ9A 1N3QA 2QNKA 4NE9A 2JICA 4FFIA 1ACCA 1HB4A 1JOBA 2QKDA 1VALA 4H3WA 3RQ0A 5IAXA 1GSLA 1UKRA 1RUH3 2WO7A 4Q0UA 3VDCA 1W8FA 2VMCA 2JKXA 2ZGMA 1AL0G 3ENRA 1OA4A 1HRI3 5FZKA 3WQBA 5CFDC 4UFHA 4N9HA 2RMU2 2VUAA 1AJOA 1EP0A 5EHDA 3RZMA 5E89A 5BY5A 5HPOA 4HANA 3VZJA 2RDSA 4AEKA 3K77A 1UQXA 5CKNA 3K4AA 1RUI3 5C3OA 2WLPA 1C8NA 1W6MA 5C9AA 2GC2A 2FZ1A 2QZ3A 1R1A1 4GKYA 4ASKA 3KCYA 4LR4A 4OI0A 4E4DX 1W2UA 3ZXEA 2B8MA 2O14A 1UPIA 1QJU2 4GMP3 2JB4A 4YFZA 2JDHA 2VZSA 3LE0A 4AGGA 2KM2A 2UY8A 1GNZA 4G3YC 4YM1A 5DAWA 5FK7A 1JYTA 2RS51 3NAPA 2YYOA 5J36A 3W5NA 4LT5A 1SMVA 4Y1ZA 2XXZA 1IG3A 5JUVA 4J1WA 5BNNC 1K5MC 1NCRB 1NG0A 1PIV1 2B9VA 5FBJA 4AGVA 1H1IA 4QPYA 3BU0A 3A7QA 1QWRA 2FDKA 2HWE1 1VBD3 2XJVA 2XB6C 1OT5A 2Z69A 1XNTA 4YW7A 4YW4A 2J7MA 3ZIWA 2WQ8A 2P3IA 2ZACA 3LSDA 3M2MA 2H0BA 4XPVA 2OVUA 4Q4V1 5KXDA 2I74A 5HCFA 2JG8B 3MICA 4CUAA 2ZEZA 1ASJ3 5T50A 3CMGA 3RI9A 2VVDA 1ODMA 3M3OA 3AXEA 5FP3A 4XUTA 2D97A 4S2FA 5K4LA 4AQ6A 2WS91 1TNRA 1TME3 2GNMA 2Y6GA 4CEYC 5JVVA 2WNUB 2DTYA 4PF5A 1V00A 4PCRA 1PMJX 2XJTA 4OHXA 4YRDA 3I97A 4AWDA 2YGMA 3PUIA 1R093 4NJ4A 4IUGA 1G9AA 2GALA 3HQUA 4FQ4A 4OUEA 3RZLA 3DF0A 4XQWA 2QDNA 2XJQA 1O4ZA 1J3QA 1EV11 3SITA 2OZJA 4XUPA 4LIUA 1W9YA 4FCAA 3VBSB 3AXDA 3T1MA 4I2OA 4ASMB 1PVC1 4LBOA 3CJIB 5H9PA 5EZWA 5A1LA 1VBC2 3JBG3 2EA7A 5FMCA 3GXUA 5JI7A 4BQ5A 1ZVFA 3ZXDA 2ARBA 2DVGA 3AP7A 4CDWA 3RPQA 4COWA 4Q1RA 4QX8A 1HB2A 4YZ4A 2CAVA 3BI3A 4YW5A 4NWWA 1DQ6A 2HWB3 3ACFA 3VKLA 3H1YA 2VQAA 4XIKA 1QOTA 5FZ3A 3JXSA 1LKNA 4YW2A 5A6QA 1Y7BA 4HSLA 1I9RA 2A71A 2QJVA 3M3IA 3N9MA 3RMYA 2ADEA 2JG9C 3BCWA 4A7YA 5FQ0A 2OUJA 1CD3G 2CV6A 3DYPA 1IPSA 3FBMA 1RUE2 4ZS3A 4AQTA 4B8EA 3SISA 3POJA 3DCQA 1OXCA 2VL4A 5EPAA 3HJRA 1ZNPA 2DFBA 2EAKA 4LOTA 2PHRA 4NOTA 2LTNA 5F3GA 1G6NA 2E31A 1IHMA 3DPRC 4JQRA 4MYEA 4QPIA 5FMBA 2A1XA 1VRH2 2RMU3 5ANNA 2V09A 4QB6A 4AFAA 2HBTA 3ZYJB 2JDUA 2NP0A 3VUOA 1XU2A 3ZYHA 2DBIA 5KXCA 2XBO2 1S0CA 2CSGA 3MV11 1A8MA 4YW1A 1W6MB 1MS8A 2XKOA 3PTYA 5C9AB 1C8M2 5D8AC 5E8AA 2VUCA 5JXHA 5LY1A 1US3A 1Z78A 1JZ8A 2QQPA 2WKKA 3CHXA 2WZPP 2QVSB 1V9U1 1PK6A 1CVNA 1QJU3 1YQ5A 2YDEA 5CFCA 3NJZA 4JX0A 3ZSKA 2AZ5A 2G9FA 5A6XA 5FZEA 1JS9A 4IE5A 1TMF1 4XTPA 1FXZA 3IWZA 1AHSA 1ND3B 2DVFA 2W5FA 1UU6A 1MVEA 2BVBA 4M3CF 3ZM8A 3IN9A 3V0AA 5JOZA 4QT6A 4Y22B 1POV0 1JU4A 1SBDA 4YARA 3ACHA 1VMJA 2EIBA 3EXUA 3GALA 2ARAA 4LO7A 3ZFFA 5A6YA 1AX1A 2CWMA 2OPKA 5IHRA 4HVOA 3KV4A 4Q0QA 4B1MA 4XILA 4AEMA 4JGYB 1O6UA 1W03A 3N4MA 1SCRA 3PDQA 2FBEA 3H9AA 3M3EA 2ZGOA 2ZHNA 4YG3A 3WHUA 3NW4A 3ZFEA 4LKSA 5F32A 3AMMA 3LPFA 5F5AA 1AX2A 3ZIXA 1ZBE1 5A7SA 5DUXA 3POEA 3TBDA 4BMBA 1Z7S2 1NLQA 2YB7A 3IDEA 3ZXAC 3SQOA 4M4RA 5IK7A 1IQDC 2RJ2A 2XLFA 5I0UA 2RJKA 1MZFA 4DB5A 3HT2A 4AW7A 2ILMA 4YM0A 1CIWA 5FZ8A 1PNGA 2IXJA 3MDPA 4QPIC 1ENQA 1REFA 2IUWA 4Z8BA 3V0BA 3KF5A 2A6VA 3IMNA 3KM5A 5JWPA 1PHMA 5FYUA 3KS7A 2KA3A 1BKZA 3QLQA 1PO12 3I2HA 4L8QA 4R4ZA 4LBNA 2WABA 1FMD1 3C7FA 3VN4A 3HD8B 4N90A 1PMHX 2VNGA 1COV1 3N9LA 1XU1A 2YY1A 3OF1A 4U36A 1DQ4A 4F3JA 1JOPA 2YV8A 1YYNA 4EWDA 2A6XA 5SV5A 4WM8C 5A1AA 5CFCC 4B4PA 1VRH3 4M0HA 3MIHA 4QXHA 5JCTA 1AUYA 4XFBA 4Q0VA 4XXAA 5ABJC 3DEMA 2XKPA 3J7HA 2OIIA 5L7OB 2W68A 1LCLA 1WBLA 4JZRA 4QM8A 2Y6HA 1C8M3 2E53A 1DIWA 3ZVXA 4R9AA 1W6QA 3ZXJA 1JMUB 3P6BA 1FPN1 5ACA1 3VDBA 1D0GA 2VULA 4M00A 4UW6A 1R081 3LIHA 5FLHA 1CPNA 1NLSA 1WMDA 2D7FA 4OI1A 2VMDA 3ZDSA 4QD2A 3ZFFC 3TEZA 3ITQA 4C0HA 5DPNA 2K46A 4CEWC 3POFA 1XE8A 1CJPA 1J1TA 2X5IA 2XLAA 4LORA 1OLMA 2W2IA 4AHXA 2HYXA 5A3UA 1D4M2 3U37A 2E7AA 1CONA 3BVCA 1NUKA 4FPLA 3ZOIA 4AI0A 5FPVA 3VD9A 4PI2A 3AZXA 2WZ8A 2ZMNA 3N9NA 3IPVA 1QKQA 2YU1A 1SLLA 3KV5A 4P08A 1ND2C 1W6PA 1OURA 3ZFEC 1UYXA 2F4LA 5HBAA 1LOEA 3WX5A 4LE4A 4F7ZA 3GDBA 3TN92 4AVCA 3HOBA 3WCRA 5JPMB 2FD8A 2QE3A 4ZKTB 1RUF1 4INDA 1QJX2 2TEPA 4P02B 5FZAA 4RHV3 1S1AA 5FY8A 4MO3M 5IUQA 1QOOA 2NM1A 3D3AA 3Q8CA 4AI8A 4G4FA 2ZXQA 5GZGA 3AKSA 1DDLA 1HXS2 1RUJ3 2J1VA 4AR2A 1YFXA 1AL22 4QPGB 5SV8A 3O1RA 4AVTA 4CCEA 4PQ9A 1GICA 3AFGA 2R7EB 3K3OA 4CU7A 1W2TA 1AJKA 1V6NA 2KXLA 4NHYA 4XFGA 3H3LA 4JHZA 4W65A 4MHUA 2BWAA 2OW4A 3P1IA 1HQWA 1LHNA 1DZTA 2GP3A 3R6SA 5AC92 5A80A 1WD4A 2I45A 5A3WA 4YW6A 3MUZ1 4FPYA 3CNAA 1H2MA 5F8PA 1DQ2A 4BQ2A 3NKGA 3E6BA 4Y20A 3N36A 5JZGC 3FFQA 2R072 4AEDB 4D0QA 3HN3A 1IS3A 3X29B 4MSVA 2IXCA 4NROA 1O3RA 2RS32 4QU1A 5A7WA 3ZPOA 1BLZA 4F83A 1X9TA 2GC3A 5A3TA 5KWRA 4CDUC 3MYXA 3C8XA 1NE4A 4GALA 4BB3A 4YLZA 5GJ6A 5LB6A 3OOXA 2CHHA 4JAAA 5KBFA 5C8CA 1X7NA 3O0VA 5DAVA 2HJIA 5FPBA 2R49A 4LBQD 2YMZA 3CZUA 5LCWL 2VW0A 3H7YA 4BJ0A 4HN1A 2D6MA 3TEYA 1BQPA 2J42A 3CZJA 4IEXA 3MW3A 2ZEYA 4CYDA 2FMYA 2WFF2 4FAHA 3ZN6A 4Q4Y1 5EJ1B 3IDAA 4ZONA 4KU8A 1KRIA 5HCBA 2ZTNA 1W6QB 3VL8A 5AVPA 4YPJA 3RZHA 1WBFA 3J8F3 3I3BA 4LLFA 3SH5A 3MW4A 4V1PA 3LEGA 4XCAA 2OA2A 3FL7A 3A4UA 3H8RA 1O3SA 2D6OX 3IIIA 1YO8A 3FC0A 3J26N 4QGLA 4YW3A 3K75B 2Y8KA 4D6QA 5DMYA 1RVF3 1BEV3 2DCKA 2VW2A 1D4M3 5T5PA 5IJRA 1B35C 3ETPA 3ZFGC 3R4DB 1QH7A 4DS0A 4YZ3A 5EIYB 2VVEA 3T30A 1MEC1 1C3HA 2AC1A 2ARXA 2VVFA 1W6PB 1VBC1 1V6JA 2DFCA 5J09A 2HKXA 3E5UA 1PGW2 4A3ZA 1F8VA 5L9BA 5A3PA 2GDFA 1LOAA 3LFIA 4QQPA 1XXNA 3PUHA 3TN93 1Q43A 2Q5TA 4DFSA 1RUC2 3FX3A 4LHLA 2JX9A 3J7NA 4XJ8A 1W90A 3ZSEA 1JBCA 4OYUA 3INAA 5T55A 4CP9B 1W28A 1RUE1 4EJRA 1MZ6A 4ATFA 1HXS3 1AXZA 2EXKA 4NUBA 1Y9QA 2JDMA 5FZ9A 4AI2A 4RYDA 1YFWA 2AACA 4AGRA 1QXRA 3C7HA 2PHDA 1WCSA 2WT1A 3AL5A 3T0BA 5D1IA 3W9AA 1UPSA 3ACGA 1UOGA 4PLNA 5LASA 2EXIA 1WLWA 3GJAA 4IV3A 1NXD1 4P9WA 1C57A 1DGRN 2W87A 2YUEA 1RUG3 2XBO1 2AGSA 4LK7A 4BA6A 3ILFA 4LQRA 1KGYA 1JZ7A 4ZHNA 4QDRA 1OA3A 1A8DA 4IW3A 4RA0A 4IV1A 1H4HA 3AKTA 2RS13 2RS33 2A6YA 1W8OA 3NJVA 4XDQA 3W20A 3N7MA 2VR4A 1GV9A 4CU8A 5LRRA 2V5DA 5A3OA 4D94A 5FPZA 2YFUA 2O8OA 1XNKA 3WEZA 1LR5A 5FZMA 1EAH3 2PELA 5C8CB 1CJDA 4PF1A 3LA7A 1W0PA 3PVEA 2D6NA 3CF6E 5FZHA 5CA6A 1T6GC 1QY4A 2D6KA 3HPNA 4LITA 1J3RA 2GNDA 4RR3B 3ZN6B 1K3IA 2IC1A 5L9VA 5FZ0A 4DRRA 5EP9A 2HLEA 3WD5A 2IFWA 3O7OA 1C1FA 2ENRA 4AG4A 4Y1XA 4I0WB 3S6PA 2Y0OA 1KD7A 3IZOA 3KCCA 2UWCA 4IGPA 2IXHA 1G7YA 2JDPA 2X53S 1K42A 4BZ4A 2WNEA 4XZUG 3SHRA 1IKQA 3VZMA 3Q8EA 1W9FA 2DURA 2WT2A 3ZX7A 2QTWB 3C2UA 3WUCA 4PIZA 3WV6A 1GP4A 2D3PA 3WQ7A 3VBRA 4MG2A 1NX9A 3HQRA 3KT1A 1X8EA 1OPOA 2Q8OA 1ONAA 1ZX5A 1PGL2 1CZSA 1Z7S1 5E1RA 5FZFA 2C24A 2C9KA 2BQPA 4YG0A 5F37A 2W1SA 2LW8A 1E5RA 4FPFA 2OPWA 3B02A 3ES1A 4JV4A 2R0FA 1P8JA 1UY3A 3AMPA 2ZGUA 2F6BA 4HZFA 5FDBA 4YVWC 3ZSMA 4ZU5A 2PHFA 3NNLA 1I5PA 1X50A 4HVRA 4DO0A 4LO4B 5DN2A 5FV3A 4X8PA 1KJRA 5L9RA 1LB2A 3HBZA 1TE1B 4X8NA 5EXOA 2OT7A 5IW0A 2VCBA 4WM7A 4XVHA 4IV3C 3WG3A 4RGGA 5BNPB 2XR4A 1J3PA 4ES9A 1WD3A 1PO11 2VZOA 3VD3A 1V6IA 3I8TA 4FAGA 1WA6X 2E7TA 2JEMA 2VMIA 3B5LB 3BU7A 3I7DA 4XUQA 2XJPA 1NKGA 3MW2A 4LA2A 3TNPB 5T3NA 5DZGA 2PYTA 2LROA 4FFGA 3U1XA 2A75A 3SMHA 3WSOA 2YXSA 5C4WB 4MADA 1D2QA 4GB31 1QDOA 2G19A 1SFPA 1GWMA 1HRV1 5FCCA 3I49A 3UKNA 2RR11 3SXWA 3MLJA 2UWAA 4NRQA 4IEOA 2ZX0A 4Q4W2 3HVDA 4DNYA 3KHCA 4IV1B 4AFDA 5I0DA 2PLV2 3WNMA 3D4KA 2BBVA 3K4ZA 5KXBA 4MXVA 4KH9A 2QQIA 4DINB 3K2OA 5JXIA 1GBGA 3AK0A 3J4UH 4Y33A 1VP6A 5FYCA 1RUH2 2XL9A 5FZDA 2FDHA 2JXAA 4KG0A 4YVSA 4FPEA 1TG7A 4W6XA 4ZXKA 3P3NA 5K7PA 4XAEA 5LW9A 1QJY2 2RDRA 3ZSJA 2VZPA 5FPXA 1C1LA 3E5XA 2LRPA 5JAXA 3RSJA 3ZKYA 5F5CA 5A3MA 1AR63 4EN7B 3WDUA 4EN0A 1CGPA 2ZKLA 3JD71 4GA9A 2DUPA 2VBBA 4LHKA 4WVVA 1W06A 2H6BA 4IEVA 5CFDA 1QJX1 2ZGQA 4OQ9A 1RJ7A 1V6OA 3WP6A 3E6CC 1H2LA 3CIHA 1OLME 1EV13 4XW3A 3U10A 3VBRB 4OZXA 3ZN4A 1AL21 4HSJA 1C4RA 4N43A 4AQ2A 1XNDA 3H42B 2BW8A 1VBD2 4UFLA 3WNPA 3I3MA 3PVOA 3MGUA 2VJXA 2D44A 2P2KA 4QGMA 1GR3A 3G6JB 1UU5A 4OHVA 1MS5A 3NRUA 1CR7A 5AC91 4UXAA 4FFHA 4FVVA 1ASJ2 3OSDA 4EV0A 1H6YA 4WBBA 3QH7A 5LBBA 1OLQA 5BNNA 1K5MA 2R071 1Q5OA 4L2NA 5B2GB 2DCZA 2ZGPA 4WM7B 4MZUA 2IXIA 1XSQA 5K8SA 2XWJB 1LEMA 4IL7A 1AZDA 2DDUA 1DCSA 3RYPA 2EALA 5ISLA 1R092 3GBWA 1LHVA 4NHKA 4KI5M 1IPJA 2RE9A 3IMMA 2VTXA 1AR83 4BQ4A 1HB1A 4LKDA 5HV4A 3H1WA 4NIGA 3HMYA 2UWBA 4ONUA 1C28A 4AVAA 1RINA 4LO5B 3T1LA 4E2SA 5FXWA 4FO9A 2CY6A 5J7MA 4CEYA 3PMEA 1WKYA 2LM3A 5LBCA 5IVVA 2WFF1 2W3JA 5FMDA 2WZR1 4YVSC 2PMWB 4S2HA 4CCLA 4E27A 4PDWB 4P14A 5M0TA 1POQA 2BDRA 3OUJA 2HWB2 4DXTA 1F15A 2XJRA 3ECQA 3POGA 4CZSA 5FO9B 4MXWA 4FP2A 4CDQA 1K45A 3AP4A 4RS5C 3V64A 2WNVC 1VB4A 1D0HA 3QH6A 2HWD3 2PLV3 4YGBA 3PLQA 5BXXA 2WBKA 3GZAA 2W52A 3MF9A 3NJXA 4DXRA 3FBYA 4XYXA 1AF9A 1W8ZA 3VL9A 2VQ0A 2YROA 3WDXA 4PLMA 1DLCA 4NHMA 3KD4A 2HWC3 5DG2A 3CLPA 3R0RA 4W4ZA 4QQOA 2EF6A 4ITCA 1NY72 2OYZA 1GOGA 4HG6B 1QJY3 3WF2A 1RJ8A 1CAUB 1DBNA 4TYSA 3PTRB 2X10A 3VLBB 5GZCA 2WO2A 5CU1A 3LKJA 3ZPYA 5AFEA 1BBT1 3DKQA 2VMFA 2B46X 1JYWA 1SCSA 2JG9A 5FY9A 3ZR6A 1ENXA 1VAKA 4N43C 1OH4A 3PURA 4WVMA 5IFPA 1LEDA 4UW4A 2XUEA 5HV0A 1PMIA 1JUIA 3UJQA 3JZVA 1YJLA 5FOBB 2V5YA 1DGWX 3MIEA 1QQP3 1RUC1 4TSVA 1DF0A 3DPRA 5CFDB 1RUD1 3POBA 3JQXA 4BXFA 3W5MA 1QOSA 3DUIA 1DHKB 4DRVA 5FR3A 3CBNA 4V2VA 4BCUA 4RQPC 1FYUA 1LOBA 1U5YA 2WZEA 4SLIA 2YPDA 4LK6A 4P9IA 4WV8A 4TTGA 1OI6A 5D8AA 5JLVA 2R063 1POV3 5GM0A 1R1ZA 5FZOB 2Q1FA 1X36A 1XYNA 2WO1A 5B4XA 1IPKA 1YHFA 3GHNA 5A33A 4NHLA 1LOFC 4KBBA 4D7TA 3GCXA 4N53C 3MZHA 3WT3A 4RL7A 3NNGA 4YG6A 4HK8A 4IGQA 5GLVA 4YYOA 5A3NA 4BLJA 4MUVA 3OPWA 1K5MB 3AYEA 5KHIA 1VAVA 3LF7A 1O91A 4I0BA 4BE3A 2NYYA 1O3QA 3NJYA 3M70A 2NZ9A 3AZYA 3H3UA 4XFCA 1US2A 1W6OA 4DXSA 3EYPA 3I59A 2JDNA 3QBQA 1W39A 3RFRA 1QXPA 1GZ9A 1ULFA 4OUSA 2WC2A 3H3ZA 5GKAC 5I93A 3WW1A 1GZTA 5HXMA 1CZTA 1O7FA 4CDQC 4ZU7A 4E8CA 4XETA 4CCNA 1VBE1 1Y4WA 5GLUA 2YC0A 1OLRA 5C3QA 5F5QA 1CX1A 1LGBA 1ULDA 4I0AA 1X82A 2GAUA 4AI9A 1OBNA 1FPN3 2PQQA 2XJSA 3GBGA 4Q0SA 4JTOA 1R083 1XBFA 2D6LX 4O61A 1F9KA 1LJ7A 1SACA 3CJIC 2V4AA 2A73B 1LESA 2R30A 1ZM1A 1FNZA 4Q4X2 4X6RB 2PQSA 5F2SA 4Z2WA 1OF4A 3M3QA 3VHRA 4AHYA 1NCQA 4BIOA 3HNBM 3AMQA 2JIJA 5F6LB 4FTBA 3NV4A 2AREA 1SG3A 5CB7A 1AR73 1AYN1 4ORFA 5DQ0A 3KT4A 1JODA 1T2XA 2XG3A 4NHXA 4Q26A 3FLTA 1WCKA 1Q8PA 4QWNA 4KWKA 3I54A 2C1FA 4OMCA 1PO22 1SFYA 2MEV1 2FCTA 1PGL1 1I3HA 4HL0A 4JHTA 2DVDA 1W6NA 2BNMA 1OF3A 4KBZA 2HEVF 3BALA 5HCHA 2WJSA 4R9BA 3RVHA 4HOOA 1S2BA 3FHAA 4WVMB 4C8DA 3WUDA 5JPNB 1E5IA 1SHWB 4FOVA 3RZZA 2X8KA 3WF0A 4Q5OA 4I30A 5I8TA 3HT1A 4RD7A 3DPRB 2HEYF 2A3XA 2Y64A 1BMV2 5IFTA 1ZBA1 2JJ6A 4WM8A 2NPIA 1H1AA 5FY0A 5A32A 1QXJA 3NAPB 4W6WA 1UIJA 5FPAA 2FMDA 3CJXA 4GJYA 5ABJA 2WWSA 3PMSA 3FMGA 1QEXA 1UX7A 2ATFA 2HWF1 2A3YA 5D8AB 4CPBA 1ND3C 5CKQA 1W8HA 2YBPA 1JYNA 1AYM3 3THCA 3KV6A 5F7UA 3NV2A 1CAWA 4JGZC 1J1LA 4XJWA 5FUNA 4M3CE 1WLTA 4XACA 1O4TA 3FN9A 2W1UA 3A22A 3Q9OA 2WO3A 4WVZA 1PZ7A 1SLAA 1N47A 3A21A 1O5UA 4CEWA 2DBNA 2RM22 3FUOA 5FBZA 1YC61 2TBVA 3ZMNA 1HN1A 4R4XA 1WCUA 3UKVA 5FY4A
chains in the Genus database with same CATH topology
4RHV2 1W6OB 3I59B 5GZDA 2AR6A 3BPZA 1RUJ2 2ET7A 3GF6A 4K40A 4QQ2A 1RUH1 5BNOA 1OOPA 1ND2A 2AH2A 2O0OA 1HRI1 1NCQC 4YGBA 2ZS6B 3ES4A 1LOCA 4UBHA 3QD6A 5I8SA 3WG2A 3ASIA 1O5LA 2VOXA 5FMOS 3ZYPA 4Z92B 4FPKA 1RUI1 3NV1A 4XFFA 3PHMA 4CDWB 5I0SA 1S0FA 2Z5WA 1A78A 1GQHA 3KQRA 4Q4X3 5F1RA 2R1DA 2OZ6A 2PHWA 1S0IA 1HLCA 1UL9A 5FQ0B 1ENRA 1MS1A 2ZMLA 3POWA 4Q27A 4XQ4A 3WNXA 1RUOA 3M4FA 1LU1A 4QPIB 1Q8SA 5AVAA 5JZGA 1VBD1 3AKQA 4E2GA 1PO23 4IEQA 3AKPA 1CPMA 1RMU2 3NV3A 2GN3A 4GQ7A 1W6NB 4EROA 4L11A 1ZYBA 4KQ7A 1ASJ1 4CDUA 3WZ1A 3GYDA 4AI3A 5IT6A 4LTAA 5DUWA 5KC5A 3J8F2 1TME1 1M4WA 4E4ZA 1DFQA 4YM3A 1PK6B 1S55A 1OFNA 1OQDA 5CFCB 4WM8B 1QU0A 2Z42A 3PJYA 3USSA 2DUQA 3WY6A 1AXKA 5DUUA 5FRAA 5KHJA 1R091 4A3XA 1SQ4A 3MLKA 1RVF2 1BEV2 1OMIA 2R043 1DG6A 1Q8VA 3V0AB 4C0BA 2FQPA 2AYHA 1QH6A 5AFBA 4QM9A 3MIGA 3ZFFB 2ZGSA 1H9WA 3JBG1 5BNOC 1OOPC 4C1WA 4CEWB 1IOAA 5C33A 3AP5A 5I91A 2RM23 2Q0AA 1APNA 3AYCA 3WP5A 4COVA 3DV8A 2UYAA 1MQTA 4ZU4A 2WA4A 2VW1A 1B35A 5FO7B 3ZFGA 5FTTC 3DKWA 2Y0IA 1LHOA 5LK7B 3BB6A 3OCPA 2CYFA 1ND2B 3UK9A 4P5HA 3ZFEB 1DZQA 1O4YA 5FAXA 4QPGC 2UURA 2B39A 2RMU1 4YSFA 2B45X 2PAEA 1JOJA 4I02A 2ZX3A 3W59A 3MPPG 4FT8A 1RUG2 4Q1PA 4ISQA 4UW3A 4W6YA 1S2KA 1GLHA 5DDJ2 5C6CA 3V0BB 3WDTA 1UMZA 4LO6B 3VBHC 2Q30A 2RS12 1QJU1 1WMFA 4OI4A 1AR92 2YGLA 2C9AA 3CO2A 4UBGA 5I8YA 2GN7A 3OJBA 2ET1A 4MH0E 4QQHA 3VZNA 1DLLA 3SCFA 2ES3A 1BYHA 1EAH2 3KB5A 4KGGA 3ZMOA 1VB2A 3VBUC 4XF0A 5DZEA 3UKTA 3RG0A 5K0UC 4Y1VA 1N1YA 3E5QA 1RHI2 1RMU3 2RJLA 4L92A 1FATA 4NWVA 3AJZA 1JUHA 4KWJA 4ISRA 2NMNA 2WINB 5JOXA 1MVQA 1FX5A 4YNIA 1SFNA 1GKBA 2ZCWA 2DCYA 2A5ZA 2X5IB 4CDXA 2XVGA 4IESA 1EPWA 1REDA 2DF7A 3USUA 1MQTC 2PHTA 1VIWB 1UIKA 1NQDA 2ZGTA 4AFBA 1VBB2 4X6QB 3IPVB 4Q2FA 4RSUA 3M8LA 3BOWA 1Q3EA 2PTMA 4P9XA 2BVVA 4GH4C 1NQJA 4BH9A 4LEJA 5FMOL 2JENA 5JSOA 2BNNA 2LUWA 1YIFA 2NQYA 4HT1T 2DWRA 3ZFGB 1TNFA 4MLOA 3ACLA 2WSVA 4LBJA 4ES8A 1AVBA 4XIOA 4A2UA 2Q1MA 2EVXA 4YVWA 1ZZ8A 5LEJA 1YLLA 1ZRDA 3KGLA 3FJSA 1SBFA 1VRH1 2DTWA 3APBA 4F8AA 1S0GA 2EIGA 5J98B 3AKRA 2IZWA 1MZ5A 3D0SA 2IXLA 4Y20B 2B42B 4SBVA 5JSRA 3D82A 4IQPA 5DDJ3 1C8M1 1BJQA 2ETEA 1F5FA 4EWAA 5KC6A 1W0OA 1RC6A 2CAUA 2E7QA 4LBLA 4E9KA 2F4PA 1BVVA 4LO8A 3HR9A 1JW6A 4AHWA 3NSTA 1AR93 1DU3D 3JB4C 4XF4A 3VGIA 5CAZA 5JOWA 4OHZA 3EJKA 2B7YA 2GH2A 3AZZA 4B3NA 3B7MA 2BNOA 2PAMA 1XNCA 1ZZ9A 3ZXKA 1MACA 3B3QE 4QQLA 3WW2A 1UN1A 2P17A 1RHI3 2E6VA 1BXHA 1J59A 4CDXC 5L36A 4PBOA 2Z79A 3ZYIB 2NMOA 1VBA3 4Z07A 3B9IA 3U11A 5T5LA 4FTEA 4XE9A 1AR62 2R32A 4KU7A 4XHXA 2TUNA 1U5IA 1B09A 3B9CA 4RHV1 1FOD3 1TEIA 4HFSA 1EV12 4D7YA 1CAXA 2QUOA 1RUJ1 3AMHA 1PVC2 1M06G 3USUB 5H9SA 1NLRA 3WG1A 1NA1A 5BUVA 1G8WA 2ZGLA 2RHPA 1N3PA 2B5HA 4K1YA 4N7UA 4Y24A 1VBB3 4HVQA 4BWOA 1AX0A 3JB8A 4M3CA 5F9TA 1YFYA 3VDDC 4B7KA 5JSPA 1V6KA 4HPKA 4WZFA 1VJ2A 2D93A 4LUMA 4XJ9A 2PHLA 3DL3A 4GIQA 3GBFA 1V6MA 2ERFA 3TYJA 3IIAA 1KQRA 3MLLA 4IEPA 4L9BA 1S0EA 4XJUA 2WQ4A 4JTNA 3OD4A 3S0MA 1GYKA 1Q8OA 4O9EA 1PM7A 3MIDA 1AR82 2BUKA 2IFRA 2MHFA 1GZWA 4YVWB 3QACA 4XBQA 3AB0A 4JDOA 4PLOA 1H9PA 1H2NA 1R1A3 1UKGA 2H0VA 4EN9B 5IK8A 3ST7A 4PIYA 4I3PA 1OFSA 4IV3B 1X33A 1OSGA 1V9U2 1QJZA 3HIFA 4B4RA 5E16A 1LRHA 4AVBA 2R1BA 1ZREA 5C4WC 3VKFC 1PNFA 2RS53 4R4ZA 3O5SA 3PJQA 2D98A 3J8F1 3ME2A 4PIXA 2HWD2 3RI8A 3WINE 1PIV3 3ELNA 4GWNA 3E97A 1U0AA 1OA2A 4AE2A 2HWE3 4CRQA 4Y26A 1REEA 4IEWA 4Q4V3 1RGSA 4Q8LA 2HWC2 1RVF1 5EWSA 4BIFA 1FV2A 1D4M1 2P37A 3OBTA 4URTA 1KDMA 2X29A 3VBOC 3FUQA 2Y38A 4E4SA 5GLWA 4RS5A 4FBFA 3N7LA 2WNVA 2WS93 2ZHLA 3VHOA 1CQ9A 1NA1C 3WP4A 1JYCA 3AMNA 4GULA 3TN91 1WCDJ 1LGNA 1KDKA 1QQP2 5EYYA 4XBLA 3GZUC 1IZ3A 3AZWA 3TB0A 4FTSA 1L3JA 3ZYRA 1KFXL 1OQ1A 1HXS1 4LUKA 3KMHA 3ZX7A 2GU9A 2XUMA 1EPZA 5EFUA 1V6LA 3OBRA 1PVC3 4BPZA 2ZZQA 5FLIA 2R062 3LOBA 3TRSB 4K1ZA 3VBFC 1I1EA 4H7LA 5LEKA 4XHBA 4H14A 4AFCA 3FE5A 1LHWA 1RUG1 5FOJB 4GXLA 5DUVA 1U5XA 1FMD2 2GC1A 2VGDA 4RQPA 1COV2 1ZRFA 1UZYA 1NCRA 2RS31 1KFUL 3LSEA 2WLQA 4NR1A 3IDBB 4YGEA 1V70A 2JE7A 2MEV3 1KJLA 1LOFA 4N53A 1EAH1 4FXKB 2JG8A 1KS4A 1H8TC 1QNYA 1FPN2 1SLBA 4YM2A 5JR7B 3LA3A 3V65A 1LECA 1R082 1V9U3 1MS4A 4QXKA 1DQ1A 1JHNA 4OLLA 1QNWA 4K8FA 1HIXA 4Y4YA 3WCSA 2ZX4A 4JRAA 5FREA 1TMF3 2VOWA 2WT0A 3WOGA 2HWF3 1YI9A 4CP1A 1AR72 4R8HA 1MS3A 2ZKNA 4YFWA 4IEUA 3S30A 4LHNA 5K9YA 2DCTA 3AX4A 4NPRA 2SLIA 3SH3A 4YVSB 2D40A 3ZO0B 1VLNA 2A6WA 3CJIA 2ZAHA 1C5HA 1UD1A 3N7KA 2XJUA 1WGPA 4RS5B 4COYA 4AHZA 3VZKA 2QZ2A 1E57A 5GLTA 1RUF2 1LENA 3PNAA 3H0OA 4C90A 1PGW1 4G9SB 4AVVA 4LBKA 4P9LA 1IS4A 3U07A 3ZXGA 4R52A 1U5ZA 3TAYA 4BOWA 1ZBE3 3S7IA 1CN1A 3RDIA 2QCSB 2JD4A 5CADA 1WW6A 4FOYA 3N3HA 4N43B 3AM2A 4BQ1A 3URFA 1AYM2 1NCRC 1S0JA 4HKLA 5CBLA 2HEWF 4K7JA 2K0GA 1JXNA 5CIRA 4B7EA 1F2NA 2WA3A 2PN5A 2ZMKA 3POSA 2K9ZA 4TLFA 4XF3A 3U0ZA 4HBNA 1MS9A 4MGYE 4TZDA 2JG8C 4RQPB 5FLJA 5BNNB 1FMD3 3U4XA 3MIBA 1COV3 4XJAA 2VECA 4LA3A 4A7ZA 4IXLA 1ND3A 5H9QA 3WVJA 5E88A 3C3VA 4D3WA 4JGZA 1WA4A 2DU1A 2WNUC 3TWIA 4BLIA 3ZXFA 2PHUA 1QGLA 3POYA 4Y22A 4PBPA 3K48A 2VMGA 2ZHKA 3MFAA 4NO4A 4N53B 4Q4Y2 3A0NA 3FHIB 3VV1A 2W39A 3I2DA 4NVPA 4CEYB 3B93A 2LALA 5ACA3 1I6XA 4JGYA 3VBSC 2ZGNA 3OTFA 1AXYA 1VAMA 4AQSA 2BEOA 1SLIA 3FZ3A 5EJ3A 1AR61 3PVNA 4Y1UA 4MXWB 2R6QA 4CDQB 4FOWA 2TNFA 5T5JA 3BIWE 1BVP1 2BFUS 3SCGA 3KLSA 4MV2A 1MEC2 3MFCA 4XZPA 5H9RA 1H8VA 4XEZA 1G9DA 3D6EA 1X8MA 1H1MA 1JYIA 2VNOA 1S0BA 3OGGA 4U2AA 3JU9A 2E63A 2JG9B 2CGPA 1RUF3 4IERA 1XQNA 2JE9A 1UCXA 3HAGA 4YZ1A 5HI0A 3B00A 4QGNA 4BYYA 1IQAA 5C9AC 1ULCA 4N7IA 4XFHA 4AF9A 1MR5A 4JC1A 2ZA9A 4HETA 1CX4A 2PA7A 4FPCA 1HX6A 1H0BA 2I2SA 4AK3A 3NAPC 3IT8A 1HKDA 2R042 4M0NA 1AR81 5JMCA 3MI8A 5L7OA 1ENSA 4P9GA 4Q8KA 1QMJA 2BTVC 4EN8B 2GMMA 3GHMA 1WW4A 3MPBA 2ZHMA 5A33B 2GMEA 4DQAA 2XGXA 2YZ4A 4GMP0 5HXVA 1OPMA 4AEJA 3ZN5A 4EN6B 3PVBB 3J9SA 4FP3A 3LAGA 4FPGA 2PFWA 4Q4W1 3AP6A 2D3SA 3MF6A 4KGQA 1MS0A 1KITA 1OKQA 1PZ8A 4XFIA 2HWD1 1F5JA 2PLV1 4JGYC 1FAYA 2B9UA 3AYDA 4JGZB 4FXGB 2D43A 5KHGA 1YNAA 5BNQA 2HWC1 4M01A 2ZGRA 4Q4Y3 4COZA 1N1TA 1FI2A 4Y5Z0 4OULA 1QJY1 1ZZCA 1SBEA 5J37A 2PHXA 3VKMA 4Z1VA 4I01A 2BGCA 1ULGA 2ZJCA 3W58A 1WW5A 4FOQA 3UL2A 1DQ5A 3D5OA 2VH9A 4CDWC 3M7AA 3LOIA 3OGJA 4YZ2A 2YHJA 3TNQA 1NCQB 4GMP1 1QQP1 4XQDA 3N7JA 4QPGA 2ZZJA 3GNEA 4MGZE 1H2KA 1F31A 2XHKA 3OPZA 5GALA 1U12A 1YJKA 4KNCA 2VOVA 4B4QA 3GZTB 1MEC3 1DYKA 1LHUA 2Y26A 5TSWA 1VBC3 2JECA 2R061 1DGRA 1POV1 3LWCA 3FLRA 3ZYGA 2VG9A 3VBHA 1GFF2 4ATEA 4LLOA 4AI1A 4FPOB 2FZ2A 4AEDA 2Q1ZB 3KT7A 2D5FA 4MGIE 3ROUA 1OHFA 1MZEA 1NZCA 1YIPA 4JDMA 5L7OC 3ALQA 3WP3A 3ATGA 4XTMA 4YGDA 2VPVA 1RUE3 4HMZA 3VBUA 5K0UA 1XYOA 5A32B 1PK6C 1G9CA 1URXA 2DCJA 4AXOA 5ABJB 1LOGA 2VUJA 4DMIA 3NO8A 2CNAA 1ZZBA 3AP9A 3HN1A 5T54A 4GB32 3HQXA 2XBO3 1PGSA 4L97A 1HRV2 1YFUA 3CL1A 1CAWB 2RR12 3E6DA 1Q56A 3EBRA 2UY9A 4DOUA 3D8CA 4S2DA 5LK5A 4FPHA 2A6ZA 3VZOA 1N3OA 2YPJA 3ZXLA 3VHPA 4E2QA 5FO8B 4HK9A 1BCXA 2HWB1 3LCPA 3H50A 3WW4A 1LU2A 3O0WA 5IK5A 3QCWA 3EQEA 5JOYA 1AR71 5GZEA 1FT9A 2JKBA 1WW7A 5BNOB 1OOPB 1KXGA 4R9CA 3WQ1A 1QHDA 1HDKA 4GH4A 4XF9A 2BFUL 4GKXA 1QF3A 1NY71 2GSYA 1SLCA 3KSCA 3JD72 4TWTA 3R4SA 3WXPA 1PVXA 3ETQA 2BWCA 4YGCA 3RWNA 2CWSA 3KZ4C 5KHKA 3N35A 4CP2A 1WUVA 2SBAA 3O14A 3CU7A 3DGTA 1QDCA 4AEDC 3DN7A 3WG4A 1ZA4A 4WVWA 1C5IA 1CAVA 3H7JA 1Z7S3 5HCAA 1A6CA 2DVBA 5JZGB 4FSJA 2QDRA 1AYM1 4EWEA 3VBHB 3VZLA 2BPA2 5T5OA 2Q4SA 1IKPA 1VBA2 1SDWA 2GNBA 2VOKA 1YI7A 4AVSA 4KWLA 4CDUB 4HLTA 3RRDA 3RYRA 1PO13 4H7MA 1Z0HA 3H8UA 1D4VB 3VBUB 3OY8A 2ZOEB 3THTA 1FOD2 5K0UB 1TQ5A 2CTVA 1Y3TA 2XWBB 4P9JA 5J96B 4ASLA 4QU2A 4XMIA 3T2TA 2A70A 2VMHA 4AYUA 4JCKA 1UW8A 3JCIA 2X5IC 2WZR2 4RR3A 4GB33 3WR0A 2GH8A 1HRV3 2RR13 4RFT0 1DGWA 4BMEA 4BHPA 4DZGA 4DY5A 3IKWA 3NL1A 4CTEA 4OUMA 3LZZA 3QOPA 4GWMA 3M3CA 2C0ZA 4Q4X1 1MQTB 3L2HA 1B35B 1NOVA 3B69A 3IBMA 1YUDA 2FHRA 1XE7A 4JDNA 2O1QA 1H30A 3AYAA 2Z2SB 4S2GA 4XMAA 1BBT2 3VDDA 2H6CA 4DXZA 3EO6A 4GH4B 1DYPA 2ZBJA 3S7EA 2A7AA 1PO21 1J58A 5C8WA 1R1A2 2AUYA 4A7KA 5GZFA 1JN2P 3FFZA 4O9GA 3JD73 4PJYA 5I0TA 4UW5A 3AZVA 1ZZ7A 4AFMA 1O3TA 1RUD2 1QJX3 5BNPA 2RS52 5BPXA 2XVKA 4IEZA 2WSUA 4NN0A 1AL23 1PIV2 4K20A 1BMV1 3IM0A 2PAKA 4IETA 2N7GA 1VR3A 2HWE2 1CAVB 1DGLA 2I07B 5BV6A 3SLIA 3JQWA 5CVRA 2WL1A 4Q4V2 3L2YA 4MX3A 2GNTA 2ZAAA 2R041 5AC93 2D5HA 4RGAA 5C4WA 1HQLA 2IWGB 4OHWA 5DZFA 5C8CC 1S0DA 1ZZ6A 2WS92 2XL7A 2R073 2ZABA 5FFOC 3SCHA 1DZRA 4P9YA 4RR3C 2RM21 5CG9A 3KGZA 3G7DA 4FQZA 2W0XA 4N9IA 3OY8B 3OYWA 1LTEA 3P3PA 1VBE2 3ILNA 3RYKA 3VKOA 5KXEA 3VBOA 1RB8G 3WDWA 4C91A 3MEPA 5J48A 4CDXB 5DXDA 2O8QA 4CP0A 1UAIA 5L73A 2MPFA 5T52A 3OD0A 4DY3A 4K9SA 2WFF3 4HKOA 2WZR3 2VU9A 5GLZA 2R0HA 1BZWA 4XJZA 1Y43B 3NWKA 1A3KA 1DQ0A 3UV9A 2CL2A 2E51A 5JDBA 1WMEA 4META 3SH4A 4HKWA 3ZSLA 4XF1A 3FWEA 1JTZX 4XXPA 1AYN2 2ZPXA 4OI2A 2VXRA 1SLTA 4K3UA 4JVAA 3I4IA 3RNSA 5CG8A 4HN0A 2GC0A 2CGOA 5BYNA 4XOGA 3ILRA 3VBFA 2MEV2 1H4GA 3THPA 1RUNA 5BNPC 2UU8A 2ZGKA 1BK1A 3VDDB 2DYCA 1XYPA 1LGCA 1BBT3 2A3WA 2EXJA 4LULA 2VY0A 3AJYA 1FV3A 1NYWA 1NXMA 1RMU1 1WLCA 1RUC3 5A3LA 1OQEA 1ZBA2 4QX5A 4WZCA 1RUD3 4J1XA 3LGRA 1IS5A 1N1VA 3JUUA 3WW3A 1UU4A 1WLDA 1TMF2 3L9JT 3R4UA 4C1XA 1G9FA 3O12A 3A0KA 2E9QA 3CEWA 1CESA 1OD5A 2HWF2 2D3RA 1RITA 2P3KA 4IV1C 4I09A 1H8TA 3IDCB 5J3UA 4OHYA 4JRLA 1EY2A 3RJ2X 3V56A 2NN8A 4R9DA 1BEV1 2XVLA 2EXHA 1YXWA 4LE3A 5LRSA 2R16A 2WQZC 1GZCA 1YRZA 1XNBA 1N1SA 1ZRRA 4H55A 4PDWA 1HV1A 2DUOA 3KCXA 4QHBA 2IXKA 3BODA 5I0RA 4D7SA 3AFKA 4Y1YA 3RMXA 1G9BA 2XLGA 4K6BA 3WLUA 4B29A 1GNHA 3UJOA 4DPNA 3RJRA 4YZ5A 4LNVA 4LBQA 3HWJA 2BYVE 3BTAA 5DG1A 1RIRA 1IS6A 3O0XA 2W08A 1G86A 4KG8A 3BOPA 2DVAA 1HQNA 5JI9A 3OYWB 2WFPA 1HRI2 4OFGA 2VNRA 1ZBE2 2AENA 3VBOB 1VBE3 2K2SA 3B94A 2XPJA 2MNGA 1CAXB 1JH5A 3D0JA 4D69A 1ALYA 1IGOA 1NE6A 1CAUA 1UF2C 2P34A 3MIFA 1RUI2 4J6GA 1NA1B 3VBRC 3SNMA 1YCIA 3LB9A 4Z82A 5EV7A 3RS6A 1ZRCA 3R05A 3WDYA 5JIUA 4COUA 1GQGA 1RL3A 4M3CB 3VKNA 4HPKB 3LA2A 3M1HA 5CNAA 4IEYA 5DDJ1 1EYBA 4MVTA 4OVEA 3EHKA 5JIAA 1AYN3 2QFEA 4LBMA 2XH6A 4FPJA 2RS11 2GZWA 1AR91 4XBNA 4Q29A 3H1MA 4WM7C 3VBFB 1KS5A 1I5ZA 1ULEA 3FLPA 1D2SA 3NVCA 2CGNA 1GZWB 4MGKE 1Q8QA 3WHTA 1FNYA 4QMAA 3WQ0A 1LULA 1RHI1 3NKTA 5KHHA 2OUHA 1TME2 4K21A 1SEFA 2EAAA 4XFAA 5ACA2 1UZZA 1VBA1 2DU0A