1FI2A

Crystal structure of germin (oxalate oxidase)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
201
Chain Sequence
TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXALATE OXIDASE
publication title Germin is a manganese containing homohexamer with oxalate oxidase and superoxide dismutase activities.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 44
structure length 201
sequence length 201
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2000-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fi2A00
2DCTA 4IETA 4MH0E 1X7NA 3H3UA 4YNIA 2CGPA 5BPXA 2GC0A 4NVPA 4KU8A 2PAEA 2XLGA 4WBBA 2O1QA 3PVBB 3I7DA 3LZZA 5HI0A 4AVBA 1FT9A 3U11A 1FXZA 2IXHA 1O3RA 1O4TA 3RNSA 3EHKA 4D7SA 4E2GA 5C8WA 2QJVA 3CL1A 3D82A 4UXAA 3NJZA 1NZCA 4XFIA 4L11A 4XETA 4I09A 3U10A 5CADA 4IEXA 1O7FA 4ZU4A 1RGSA 1QXRA 1RTVA 1QXJA 2GZWA 3MDPA 5I8YA 2PA7A 1JUHA 2F4PA 4Z82A 2OYZA 2PAKA 4KWKA 5CU1A 3N4MA 3EO6A 4OFGA 3S7IA 4QGNA 5JSPA 3FWEA 3UKVA 4MZUA 2FMYA 2EAAA 3ES4A 4P9GA 2IXCA 3NVCA 2IC1A 4A2UA 4B29A 3RYKA 1Q5OA 2GU9A 1CGPA 4I2OA 1VR3A 4I3PA 4FAGA 3SHRA 1ZRCA 4AXOA 1UCXA 3LOIA 4HZFA 4XFBA 4JVAA 3RPQA 4KU7A 3UKNA 4Q29A 3LAGA 1LRHA 3OF1A 2XL9A 4JTNA 3EBRA 1J3PA 1LKNA 5FPZA 2GC2A 3MYXA 1UIKA 2PFWA 1YFUA 4L2NA 2B9UA 4BIFA 1CX4A 1J3RA 1XE8A 2D5HA 4IEQA 1NYWA 3DN7A 4HVOA 1V70A 3H8UA 1ZZ8A 4XF1A 2EA7A 4IEWA 4YSFA 4LUMA 3IDBB 4I0BA 4LUKA 3NSTA 2GAUA 4J1XA 5J3UA 2GH2A 3ELNA 4I01A 3ACLA 4ORFA 1ZZBA 5EZWA 1YFYA 4LTAA 1ZRRA 1H1IA 2UYBA 2PYTA 2VQAA 3PLQA 3IIAA 4R8HA 4F8AA 2Q4SA 2QCSB 4CYDA 1YUDA 3GBFA 1QWRA 5BY5A 3H1WA 1YFXA 3E6CC 1LB2A 4LEJA 5FLHA 3IDCB 4AQ6A 2C0ZA 4IEVA 3DKWA 4FT8A 2VECA 5FLJA 2I45A 2N7GA 3CEWA 4Q0VA 2IXKA 3H1MA 4RD7A 3E5QA 4QMAA 5BUVA 1HW5A 4I02A 4O9EA 2H6CA 1RUNA 4KWJA 4X6RB 4ZU5A 5D1IA 4META 1CAVB 4XF4A 5EFUA 2O8QA 5FDBA 1LR5A 5C6CA 3B02A 3IWZA 3WW1A 5JCTA 2PQQA 4AQ2A 3ES1A 1OMIA 1ZNPA 3OGJA 5I93A 4IEYA 4N9HA 3S7EA 3LA7A 3RYPA 5KHHA 2XHKA 5F1RA 2D93A 4HN0A 4HSLA 1SFNA 3HIFA 3KGLA 5LEJA 2IXLA 1DGRA 1RC6A 3MZHA 4AVCA 4XF9A 2P17A 3KSCA 1Q43A 2IXJA 4TLFA 5LRSA 4WVZA 3E6BA 4PJYA 1CAVA 5T3NA 1X82A 3WW3A 4QX5A 5JSOA 2Z69A 3D0JA 4XFFA 3RDIA 4E2QA 1GQHA 4PIZA 2XLAA 4QM9A 1ZREA 4IEPA 4BHPA 4EROA 4R52A 3DL3A 1IPJA 3LA2A 3VHRA 4XFAA 1Q3EA 5K8SA 5BXXA 3FFQA 3KMHA 2CAVA 3IBMA 2HKXA 4Z07A 1X8EA 2UY9A 3BB6A 2BEOA 4KL1A 1YHFA 1XRUA 3BALA 3TNPB 4HMZA 4HSJA 4FAHA 4GULA 2QNKA 1GQGA 4HLTA 3FZ3A 3FHIB 5I0TA 3O14A 1PM7A 1QY4A 2OPKA 3BCWA 2ET1A 4QXKA 5CVRA 4KWLA 5AVPA 4WZCA 1SQ4A 4MGZE 5J7MA 4YRDA 3KGZA 1UPIA 4ZU7A 1RUOA 1CAXB 4HBNA 5JR7B 3FJSA 1O3TA 3QACA 4MGKE 4XFHA 3D0SA 3H7YA 1WLTA 3H50A 4UBHA 5I91A 1PMIA 3OCPA 5BV6A 2B8MA 5KHJA 4MV2A 4H7LA 1SEFA 2H6BA 1EPZA 4Q0PA 1J3QA 3USSA 3QOPA 1VP6A 3H1YA 1IPKA 4XFGA 5I0UA 1CAXA 2XL7A 5FPXA 1CAWA 1ZVFA 4BH9A 1CAUB 3I59A 2BNOA 4LA2A 4UBGA 2PHDA 2Q0AA 1WA4A 2MPFA 4MGYE 2GC1A 2QVSB 4HVRA 2XKPA 2D40A 4Q0SA 2H0VA 4K8FA 4QGLA 4BYYA 3UKTA 1EY2A 5JAXA 1L3JA 1G6NA 3KCCA 4IERA 4OLLA 5KHGA 1RL3A 2Q30A 1O5LA 5I8SA 4IEOA 4ONUA 1ZZ9A 4PIXA 3ST7A 5FCCA 3ZDSA 1ZZ7A 3HQXA 5E1RA 4YARA 5LRRA 5J48A 3DV8A 1CAUA 2B5HA 5FLIA 1DZTA 4FBFA 1EP0A 3SCFA 3CLPA 4AVAA 2UY8A 1YFWA 1ZZCA 2MNGA 4MGIE 2FQPA 4LLOA 2CV6A 2QDRA 2BYVE 5FQ0B 2ATFA 2MHFA 4MX3A 1FI2A 1YWKA 2ZKLA 3I54A 1NE4A 1O5UA 1Y9QA 5JSRA 4DINB 2OA2A 3CJXA 3PNAA 5E16A 4D7TA 1H1MA 4QGMA 2ETEA 3E5UA 4O9GA 3NL1A 3E6DA 1UD1A 3SCHA 1OI6A 1VJ2A 1OD5A 2OZ6A 4EWAA 3C3VA 3FX3A 3G7DA 4X6QB 2ZCWA 3M3IA 5FQ0A 1ZX5A 5I0SA 3OD0A 2BGCA 3RZZA 3SMHA 3ROUA 2K0GA 3JZVA 4E2SA 4QM8A 2XKOA 2ET7A 4IEZA 2UYAA 1XE7A 5I0RA 3WW4A 3ETQA 3E5XA 3RYRA 2BNNA 5KHIA 1J58A 2KXLA 1X8MA 4XEZA 1I6XA 2WC2A 2V09A 3H9AA 3EJKA 3FE5A 4EV0A 1CAWB 3BPZA 2D5FA 1TQ5A 3U0ZA 3I59B 4F7ZA 1ZRFA 3NKTA 4IESA 2VPVA 1ZRDA 2IXIA 2Q1ZB 3H7JA 3OTFA 4LA3A 2Y0OA 2HJIA 3HT2A 4PIYA 4XF0A 2EVXA 3LA3A 3TNQA 4HN1A 5KHKA 4EWEA 4XF3A 1UW8A 1YLLA 1UIJA 1DZRA 4JV4A 4HVQA 5I8TA 5LEKA 1EYBA 1I5ZA 3LWCA 1NXMA 2BNMA 3CO2A 3HT1A 2OZJA 2WFPA 2E9QA 3SCGA 4YYOA 2K9ZA 3BU7A 3MPBA 4Q0QA 3H3ZA 4JTOA 1Y3TA 2PAMA 4LULA 4Q0UA 3R6SA 4J1WA 2XGXA 3E97A 1OFNA 2XLFA 4EWDA 3S0MA 1J1LA 3L2HA 1WGPA 3SXWA 2CAUA 3EQEA 1DGWA 4IEUA 4I0AA 1ZZ6A 2PTMA 1O3QA 4N9IA 2Z2SB 3CF6E 3NW4A 4XFCA 1O3SA 3M70A 3WW2A 1NE6A 3GYDA 4MUVA 2PHLA 1J59A 2GC3A 1U12A 5KBFA
chains in the Genus database with same CATH superfamily
4BQ4A 4KGQA 5FKCA 3AFGA 1AJKA 1Q8OA 2D3SA 1PM4A 2CSGA 1WZXA 5JOWA 4YW4A 2Y6HA 3JU9A 5GLTA 3R05A 4GWMA 4KU8A 4CDUA 4Q4V1 5JI9A 4WBBA 2O1QA 3PVBB 3I7DA 4LIUA 1LHUA 4RHV2 4XMAA 1FT9A 4AVBA 3IZOA 2IXHA 3POYA 1IS3A 4FVVA 4LK6A 4D7SA 3PHMA 1AX2A 3KZ4C 1YQ2A 1S0IA 2C9KA 3ILFA 1QEXA 4NN0A 3D82A 5HCBA 1PNFA 1WBLA 1H6YA 4QB1A 1OT5A 2VCBA 3ASIA 4CXXA 3I97A 4AFBA 1GU3A 4LJHA 2DYCA 3WV6A 1O7FA 1QXRA 1RTVA 4XJUA 2OW4A 1Z7S2 1IHMA 2ZABA 3LFIA 3FBMA 3MDPA 1W6QB 4GB31 3P1IA 4Y26A 5I8YA 5A7WA 1JUHA 2YBPA 2DWRA 4Z82A 4YM2A 1SBEA 3UV9A 2VUCA 2PAKA 5CU1A 5FY8A 4LBMA 3EO6A 3W9AA 3S7IA 4QGNA 3BTXA 2HWC1 4CCNA 4COWA 3O0WA 1CR7A 3T2PA 2IXCA 3NVCA 3KQ4B 4HPKB 4PDWC 4B29A 4GWIA 3RYKA 1Q5OA 5K7PA 4I2OA 5IVVA 1SBFA 3OEBA 2BGOA 1PO13 4FAGA 4AQSA 4ZZ5A 4BQ2A 3J7LA 4AXOA 4I3GA 5A7OA 2ES3A 5HCHA 1RUD1 4B7KA 1LRHA 4IUGA 1UZZA 4JKKA 4CCCA 2XL9A 1AR61 1CONA 3K77A 2Q8CA 1TVGA 4Q26A 1WLWA 2XOMA 2GC2A 3VL9A 4IV1C 4C91A 4LR4A 2PFWA 1W8FA 5LA0A 4D69A 5BNOB 2WKKA 5G05L 2P5BA 4DEVA 4FFGA 5A3WA 2XJRA 2ZGOA 4PDWB 3CJIB 1H2MA 2C6SA 2D5HA 2DTWA 4IE6A 2MEV1 4IEQA 1N1YA 1U5XA 4PLOA 3ZYJB 3GCXA 5CA6A 4CSWA 1TEIA 3NV1A 4NRQA 1CQ9A 2J42A 3U07A 1OFSA 2WINB 3OYWA 2WFF3 4LUKA 3GDBA 2QTWB 5B2GB 1RUI3 2XBO3 2A3YA 2XG3A 5ISLA 5FMOS 4Z8BA 5A1AA 1V6IA 3FUQA 3HBZA 1Q8SA 5J3UA 1STMA 3QD6A 4XIOA 2RMU3 5F3EA 4GMP1 5CISA 2HWD2 4OMCA 4H2AA 1UMIA 1W6OA 4N7UA 3VDDA 4NPLA 2WT1A 1JBCA 1K5JA 3C7GA 2Y64A 3H8OA 4GALA 4WM7B 1RXGA 4RSUA 1RVF1 2NLRA 4CDXB 3HBKA 1JI6A 3IIAA 4MLOA 1OPOA 3AL5A 4V1PA 2Q8DA 3UT0A 4JDNA 4ARXA 3LB9A 2YFZA 1U5ZA 4LPLA 1MVEA 2VW0A 3R0RA 4XVHA 1EPWA 5KXBA 3VBHA 1D4M2 1PVC1 3MI8A 3FHAA 5BY5A 1H4GA 1VBE2 2Y34A 2Y38A 2KR2A 1H6XA 1OQ1A 3AMQA 4LEJA 4RQPC 1LB2A 2JDNA 4YGBA 2C0ZA 3LPGA 4FT8A 4AQ6A 3TEWA 4LO8A 2I45A 4XTMA 3CEWA 3WNKA 3H1MA 1O6UA 1P8JA 1VMFA 1OLME 2VUJA 3DXUA 1UMHA 1Z7S3 4AEDA 4NAMA 5T55A 3ZVXA 3CNAA 4EN9B 5AC91 2RM22 4Y5TA 1VMJA 4P02B 4QPIA 1GYKA 4FCAA 5E89A 1RUNA 3ZN6B 2NZ9A 2BTVC 2V73A 3D3AA 3K4AA 4ZU5A 5DUWA 5CNAA 3IT8A 3ITQA 5D1IA 1LOBA 1VBD2 4OQ9A 3AMHA 4LBNA 3ZN5A 2VQTA 5FDBA 1LR5A 2CHHA 3VGIA 2OPWA 4RQPB 5HCFA 3VD7A 3WW1A 2VTFA 3AVRA 4AI1A 5JCTA 4AQ2A 4QAWA 1ND3C 1Q56A 5A6ZA 1RUH1 4N8MA 4HOOA 4JC1A 2QQWA 4WVWA 1J83A 4NPRA 2HH9A 3DXTA 3WSOA 1SFNA 2ZEYA 1G9CA 4B8EA 4HK8A 5LEJA 3AP5A 4OUSA 1FOD1 3Q8AA 1ZBE1 1VBC1 1NCRB 1Z0HA 4OUEA 5FZFA 4K20A 1OQEA 1AR82 4KG0A 4AFCA 2WNVC 2A1XA 1RUE1 4JGYB 1Q43A 2IXJA 4HKWA 2BWCA 4Q27A 1TMF3 2JG9C 1MS4A 2VMEA 4XJAA 3E6BA 4FPYA 2I07B 2R7EB 1CAVA 4K7JA 4PJYA 1ND3B 5T3NA 4FTBA 4Q4Y1 1AR71 1X82A 1A3KA 5JXIA 2ZZQA 3CBNA 1IPSA 3VBSA 3IMMA 5JSOA 2Z69A 3I2IA 3MFCA 4Q2FA 3MFAA 1GQHA 4E2QA 5JXHA 4PIZA 5CG8A 2D44A 1GV9A 1PO23 4QHZA 4ZXKA 1US2A 3C8XA 4Y4RA 5EYXA 1JZ2A 4IEPA 4CP9B 4EROA 5C8CB 3GZEA 3AYAA 3DL3A 1O91A 1FNYA 2JDHA 3O1UA 5A3UA 2HWD3 1O8PA 4XFAA 4Y1XA 1AUYA 3T2TA 3IBMA 2HKXA 3WNXA 2WNVB 3BB6A 2HBTA 2D6LX 3W59A 4EYUA 4KL1A 2JKXA 1XRUA 3ZMNA 2JDUA 3I3MA 2WQZC 4XHXA 3ZFFA 2D3PA 5A70A 5CKMA 1YNAA 5A32B 4RS5A 4HMZA 4HSJA 4D6SA 5A7NA 4XQDA 4AGGA 3IM0A 4Y20A 4NHLA 1HRV3 1MVQA 1WLCA 3GALA 4FQ4A 1WW6A 4RR3A 3LEIA 2PELA 5FKBA 2DV9A 5JR2A 3A0NA 2EIEA 3PDQA 3POFA 5FY1A 1K5MA 1QMJA 3K51A 2RE9A 4QXKA 2VNGA 5AVPA 2D43A 1J84A 3OPWA 4QXBA 4NRPA 1GWMA 4AAXA 2C24A 5KWRA 5E8AA 1DZQA 2XJPA 1ZBA1 2VQ0A 5C33A 1O4ZA 2BVVA 5FOBB 1WMXA 2WR9A 4AHYA 1BK0A 1OURA 5L9VA 4NHKA 1OOPB 2BV4A 2HWB1 5CFCA 4FTEA 1POV3 1W3VA 3IAQA 5BYNA 4MGKE 1PIV1 2VOTA 3D0SA 1NCQC 4XFHA 5DXDA 3H7YA 3PJQA 4IGPA 3RMYA 2FDIA 1LOAA 3J26N 2YGLA 4OI4A 2YB7A 3O1OA 1UX6A 2P3IA 1VBD3 3O1MA 3Q8CA 3JD72 4UBHA 3RG0A 3BTAA 3T09A 4BB3A 2LRPA 3CHXA 2V4VA 1PMIA 3IB3A 5D8AB 5DN2A 3T4HB 3ZMOA 4CTEA 3EMRA 2E6VA 4LBQA 5L19A 5A3NA 2JE7A 3LSEA 1V00A 3F2ZA 1PX3A 4SLIA 4AZZA 2KD7A 5ACA2 2WNUC 1JZ8A 4A4AA 4CDUC 2VZQA 1SEFA 5LBEA 3ZIWA 5A3LA 4FP3A 2Q1MA 3VKOA 1QJY2 1PK6C 2B46X 4XQWA 1QJU2 1HV0A 1WMDA 2EICA 2R071 3QOPA 5CAZA 3H1YA 2B9VA 4CPBA 4XFGA 2XJQA 4YZ3A 5FPXA 3AMPA 1W05A 5CKQA 5AFEA 3PMEA 1SFPA 1ZVFA 3C7OA 4CDQB 4XZPA 3I59A 4OI1A 4OMDA 1XNKA 3J4UH 4FFIA 2NYYA 1LGNA 4H7MA 1OF4A 1WA4A 2D6KA 2XVLA 2V72A 5FMOL 4HVRA 3NO8A 3VKNA 4E9KA 4WZFA 3JXSA 1Z78A 1AF9A 2ZMKA 3HQUA 5CEHA 1GUIA 2BDRA 4QGLA 4K8FA 4K3UA 1HRI2 2RR13 1WW5A 3NAPB 3NKGA 4CCMA 1L3JA 3ZSEA 3AYEA 2KM2A 3BGAA 2JDZA 3DCQA 4UF0B 5T52A 4E4HA 1OQDA 2VO5A 3MIHA 1WCKA 1O5LA 4CE8A 4GAZA 3A7QA 4MHUA 1IQAA 1KS5A 2G9ZA 2D98A 4NRMA 1OA4A 1V9U2 2VUAA 5DAQA 1NLRA 5A6YA 4INDA 1LESA 5FZGA 2RHPA 3OG2A 5C4WC 3L2YA 5FR3A 3POBA 3DV8A 1CAUA 1UYZA 3ZYGA 2ERFA 1RUJ3 1ND2C 1SACA 2XXZA 4BK5A 3RZMA 5DAVA 2VZTA 3CLPA 3V0AA 4LK7A 3PMSA 3ZX7A 2UY8A 1HXS2 4N43A 1OKOA 1AYN2 3LDRA 1HN1A 2MNGA 1QQP1 3LIGA 3PTRB 2FQPA 4AGRA 1K3IA 2ZGQA 3N9LA 2G9FA 2FDJA 2VZOA 3ETPA 4P9JA 3THTA 4MX3A 4XUQA 1AJOA 2A71A 2B45X 1NA1C 2VOKA 2YPDA 4DY5A 1S0GA 1KJRA 3I3EA 1XYNA 2ZA9A 1ZYBA 5IHRA 2UWCA 2E31A 5ERLA 2QZ2A 5JSRA 1COV2 1DHKB 2BW8A 4DINB 5C4WB 4DFSA 1JZ7A 1GZTA 5IK5A 3ZYIB 1W8HA 4QDRA 4TSVA 4Q4X3 1JYCA 1RITA 5IFPA 2JIGA 4BCUA 4HKOA 4AE2A 1C57A 4JRAA 4EN7B 1OVPA 3QBQA 3SISA 3BIWE 3LE0A 1OD5A 1XNTA 1ULGA 3JD73 4G4FA 3DGTA 4BISA 3FX3A 3RJRA 1W99A 1QOSA 1VBB2 1NA1B 2OX0A 3JUUA 4M3CE 3WOGA 4CEYA 4D0QA 5FQ0A 3FMGA 4OHYA 3USUB 3ZIXA 5ACA3 2ZX0A 5GZGA 5IK8A 4FPFA 1NOVA 1OBNA 3UGGA 1UL9A 4LBJA 1YIFA 3VZKA 5CKNA 5KC6A 5LW9A 3M8LA 2K0GA 3ZFEC 4KNCA 3JZVA 1PVXA 4CCKA 2G9GA 4M0NA 1F2NA 1T2XA 4QXCA 3WW4A 2ZJCA 1LHOA 3E5XA 4XTPA 4CCEA 2BNNA 1W6QA 1J58A 1JYTA 1W9YA 4CU9A 2KA3A 3UGHA 5J37A 3JBG1 2R041 3VBUB 3MUZ1 2JD9A 4CXWA 4ES9A 5IT6A 5F3IA 2D5FA 1ZM1A 2V4AA 2YMZA 3PUHA 4LMFA 4XIKA 5LA1A 4P5HA 1ODNA 4F7ZA 4NUBA 1ZRFA 2PHFA 5T5LA 1GNZA 2GSYA 3WXPA 1HRI3 4HPKA 5J36A 2HEVF 2YPJA 5T5JA 3H0OA 4BQYA 5J09A 4B4QA 3OTFA 3ZFEB 4DIQA 1CPMA 4LA3A 5FZKA 1RIRA 1VRH3 2IVJA 2W1SA 3MIDA 1UY3A 3WF2A 3MO4A 3AKSA 5KHKA 4GB32 1XNAA 3L9JT 5GZCA 3LF7A 2W0XA 5FIXA 1IS4A 2A6WA 3RJ2X 3ZXKA 3ON7A 3DF0A 3PUQA 4HFSA 4HETA 2E32A 1OH4A 2WNEA 2WZR3 3O1RA 4JDOA 1DZRA 2HWC2 2LM3A 4HVQA 3I3DA 1REFA 3LEMA 1FPN2 2VD7A 4DY3A 2XHNA 3R4SA 4YVSC 1NXMA 1GMMA 1HN0A 1MEC3 4E8DA 5BNOA 4MYEA 3TEZA 3K48A 3BUCA 5HCAA 1W8TA 3CO2A 3ZXFA 4L8QA 4B4PA 5ABJA 3CJIA 3SCGA 5FXWA 4YYOA 2LUWA 2K9ZA 4QPGA 1WCDJ 3BU7A 3MPBA 1G86A 1RUD2 1GLHA 1PHMA 5GLWA 3WHTA 3WY6A 4Q1RA 4FPOB 2PAMA 4CA9A 3VBRA 4Q0UA 3Q9OA 1S4CA 5A3TA 1MS1A 3MW4A 3WDXA 5BNNB 2EAKA 4LBKA 4ZY9A 1OFNA 4RL7A 5HXMA 3K2OA 4DXSA 1JHJA 1ZRIA 4AL9A 3LD8A 4K21A 1S0CA 2QFEA 2ZEXA 4A6OA 1CN1A 3EQEA 4OVEA 2QQLA 2F4LA 2GH8A 2W1WA 1KD7A 4YVSB 1A8DA 3FBYA 1AL0G 1ULOA 2GMEA 1MZ5A 1LEMA 2QKDA 3B94A 3HEIA 2MEV2 4K1YA 1W6MB 2RS51 1NKGA 3NW4A 3WDWA 5LB6A 1O3SA 3AP4A 1NE6A 3K75B 2R6QA 4MUVA 2HYKA 2IUWA 3U1XA 3VBFC 3M7AA 4ET7A 3HQRA 4L0PA 3VD9A 1VBB3 1ACCA 1QH7A 2A6YA 2DCTA 3RZKA 4JQTA 5SV8A 1I3HA 3N35A 3AXDA 4RS5C 4ISRA 3LOBA 5BPXA 5GM0A 2GC0A 3AP7A 2HEYF 1RMU1 1F9KA 2VCAA 2YUEA 4TYSA 2ENRA 4Q5OA 1R091 1V6NA 1W8UA 2ARAA 4R9DA 5FY9A 3LZZA 3RMXA 5HI0A 1NX9A 3I2JA 3OUHA 4YW1A 3RNSA 1C8M2 5F37A 4E2GA 3ATGA 3BVCA 2G1MA 2AH2A 2VH9A 1QJX3 3KT7A 4UXAA 1QKQA 3SNMA 1D4VB 1XNCA 4WM8C 4AWDA 1OLQA 4ZU4A 1RGSA 1BBT3 3AYCA 4CDWB 3TN93 5LY1A 1EAH1 1LOGA 2EXHA 1QJFA 5F5QA 4Y5Z0 3KVAA 4KWKA 2YBSA 4V2WA 3UJOA 3HNYM 2QQOA 3FWEA 1W2UA 3UKVA 5C7GA 2WYSA 1BEV3 1N3PA 2C4XA 2EAAA 4AQTA 5FOJB 1CWPA 4D8MA 2IC1A 1CGPA 2GU9A 2B39A 2VMDA 3I2FA 2R063 4RGAA 1C3HA 4ZPIA 4I3PA 5EJ3A 5AC92 4Y3OA 3SHRA 4NE9A 4DQAA 4XABA 3UNPA 3RPQA 4QU1A 3APBA 4XBNA 4WM8B 4CU8A 1W04A 4QDSA 1FPN3 1IG0A 1ASJ3 1R64A 1YQ5A 1NCRA 1WCQA 4IXLA 1SBDA 4IV3C 3RFRA 1J3PA 2LROA 5FPZA 4JGYA 1UZYA 2QQKA 2WL1A 1VPHA 1B35C 4WVMB 3OOXA 1TME1 1RUH2 5EXOA 2P1BA 2VZPA 4Q4W1 5DZGA 1PGL1 3UL2A 1RUC3 2P37A 3ZXAC 2PN5A 1ODMA 4O61A 1JYVA 3WD5A 2QZ3A 1AYM1 1J3RA 1DCSA 1XE8A 2VVEA 3VN4A 3V0BB 1T6GC 1X33A 4AEKA 2CGOA 5FYIA 4HL0A 1EV11 1FATA 4HVOA 1W39A 1V70A 1FOD2 2BBVA 5C8CA 4D94A 4AAPA 1ZZ8A 1VBA3 3GGLA 1ZBE2 1VBC2 4BQWA 4YSFA 3C2UA 3IDBB 5A80A 3GCWA 1RUE2 2AEZA 3C7EA 3PVOA 2GAUA 2OQ7A 4IV3B 5K0UA 1JZ6A 2GH2A 1OH3A 4I01A 1NY71 1AR72 5FMCA 3BOPA 4NROA 5EZWA 1Y4WA 4M4PA 3T2QA 3DECA 3N7MA 1H8TA 1ZRRA 2EIDA 5A32A 1WA6X 4YM1A 2IVIB 3KV4A 3WDVA 4CEWA 5FZ1A 1VB2A 2PYTA 1S0FA 4A44A 1O59A 1OKQA 2Y8KA 1NXD1 2D6PA 4IW3A 2VL4A 2WZR1 5FZ9A 5F5AA 4ASKA 1WBFA 1LGBA 2HWF2 3ZFGB 3SLIA 2ZX3A 4W65A 5FZ6A 2ZGPA 1U5YA 3PVNA 2OS2A 2VNOA 2WRAA 1IS6A 1GZWB 4ARYA 1V6LA 1BCXA 3BYWA 3POIA 1SDDB 3AKTA 1C8M3 3RRDA 1W0OA 2E53A 4XDQA 1YFXA 1ULDA 3VKMA 4QX2A 3E6CC 4A41A 4XURA 2HYXA 2TBVA 3IDCB 5EV7A 4JGZB 4MOAA 2FZ1A 4JHTA 1D0GA 2RS33 4YM0A 2Z5WA 2RS11 3GZTB 3BOWA 2QQPA 4Q0VA 5JPMB 2Y6FA 3VZMA 5FY4A 2IXKA 2W94A 2O0OA 4LITA 1N1TA 1AL22 4LHSA 1DGRN 5BUVA 2VMIA 3RWNA 4O9EA 3WNLA 1VIWB 5EJ1B 2CTVA 2J1VA 2H6CA 1E5IA 5FYYA 1OSGA 2A6VA 1LENA 3IAPA 4X6RB 2FMDA 5FYCA 2WS91 5LWBA 1UAIA 1YQCA 2QBXA 4META 2JG8B 3INAA 2QQNA 4UFHA 4XF4A 1YJLA 5EFUA 1ZBA2 1W6NB 2Y33A 5FZDA 3I2GA 4HONA 4RGGA 3IWZA 1H1AA 3IPVA 3POEA 2PQQA 2FHRA 1ENQA 2HWB2 2W52A 3ES1A 5FO9B 5HPOA 3K4ZA 1OMIA 1FMD1 3WF1A 1PIV2 5I93A 2B7YA 2VNVA 4C90A 4P00B 5FO8B 2CWSA 3LA7A 4CU6A 5IVBA 1G8WA 2WT0A 4PI0A 2XHKA 4XC9A 5CG9A 2GNDA 3HIFA 2QQMA 2XWBB 4BQ3A 2A7AA 3H8XA 5JOYA 2IFWA 2IXLA 3ZXLA 5LK7B 5DAPA 1DGRA 5FXXA 3HVDA 5FPLA 4XF9A 4N53C 4U2AA 1R1A1 3GZUC 4NJ4A 3SH4A 2CGNA 2R1DA 1TNFA 5FZOB 5LRSA 1RHI2 3A0KA 2XQRA 2R072 4C0HA 1BQPA 3WW3A 4YM3A 3ZYFA 2X29A 3D0JA 4XFFA 2DCYA 3WP6A 2E26A 4G9SB 3WG2A 2JXAA 4OZXA 2HBUA 5JMOA 2A6ZA 2ZXQA 2AYHA 2JICA 3M2MA 4I30A 4QM9A 3S30A 4AK3A 4MGTA 4KBZA 1MPXA 4KG8A 3NNGA 2J1UA 4QKBA 3VHOA 2P3JA 4FP2A 4R52A 3DPRC 3J8F3 3P3PA 1N1VA 4XOGA 3U75A 4X8PA 4YVWA 2HWE3 4ITCA 4BJ0A 1H9WA 4HANA 4W6WA 5FYHA 5JOZA 2A3WA 3KMHA 1E57A 1OHFA 1X8EA 5FK7A 3V64A 3T2OA 1W28A 3HOBA 4JDMA 1W0NA 1ENXA 4S2HA 1WWYA 3WNMA 4BMEA 4PQQA 4LOTA 4FOYA 2HWF3 4CXYA 4I0WB 5FRAA 3WEZA 4OQ8A 5DDJ2 4UWDA 2DVDA 4QHBA 5ABJC 4DEQA 1TZOA 5CFDA 4UAPA 1MACA 5FFOC 5I0TA 1XE0A 3ALQA 5KXCA 1MQTC 3O14A 4W8JA 4JAAA 4C1WA 4C1XA 1W2NA 1QY4A 2OPKA 3SEEA 3VBRC 1D2QA 1GOHA 2JDYA 4H3WA 3KS7A 3RS6A 5CVRA 2UWBA 4KWLA 3W21A 4E4DX 4Q1PA 3OBTA 3B69A 3B00A 3ENRA 3AC0A 5EP9A 4AR2A 5DPNA 4COUA 3IMNA 1QQP2 5DZFA 3KGZA 1UPIA 3J7HA 1MS3A 3O1TA 1CAXB 4IV1B 3K3NA 2VZ3A 4HBNA 3WNNA 3VBOC 1D7PM 2TUNA 2VW2A 5JR7B 3WDTA 3ZYPA 2BQPA 4FPKA 1HB1A 1O3RA 3WLUA 3DEMA 5FXVA 3Q8EA 5DUXA 1MQTB 5D21A 2I74A 3H50A 5GLVA 2BWAA 3USUA 3WNOA 2AREA 2PHTA 4DZGA 1W8NA 1XSRA 3WF3A 4P08A 1U0AA 3PU8A 3KVBA 4BOWA 2CU5A 1K42A 2D6NA 5C9AA 4MV2A 3HWJA 4MGQA 1RUF1 5JZGA 1SPPB 1W90A 4RHV3 2WYFA 4TXWA 1WD3A 3PU3A 5JLVA 5E88A 3VDAA 2H6BA 5IJRA 1VB4A 3LQCA 5A6XA 2W46A 3TB0A 2VMFA 2Y60A 3LDBA 5EHDA 3USSA 1XC6A 4EN0A 1VP6A 5A1FA 1OUXA 1R081 1IPKA 3CDZB 3KF5A 3LGRA 3VBUA 1RUG1 1IQDC 2VOVA 3WG1A 1A6CA 1GBGA 4IDZA 4HG6B 3Q8FA 2BNOA 5T5OA 2PHDA 4XXPA 3JB4C 1RHI3 4P9XA 2MPFA 4UFMA 4LKDA 4JZRA 3A4UA 2XKPA 3AZXA 1PGSA 5GLUA 1AR92 4NHMA 2ILMA 4BYYA 1PZ8A 5GZDA 2CDOA 1EY2A 4FPEA 3WQBA 1CX1A 2WDBA 1G6NA 3FLTA 3C7HA 4QQHA 3OD4A 3JBG2 2R042 3IN9A 1FV2A 2AUYA 1RL3A 2YC2A 3JCIA 3DYMA 3AXEA 1YI9A 4TN7A 1X36A 4MXWB 1CZVA 5FO7B 4PIXA 1OA2A 2A73B 4KWUA 4URTA 5FCCA 3ST7A 1ZZ7A 3HQXA 1Q8PA 4DO0A 5LRRA 1QNWA 5GZEA 4U36A 5FWJA 1QF3A 5DDJ3 1DYOA 4RFT0 1JXNA 4NWWA 2ZGTA 4FBFA 2QQIA 5H9PA 2ZOEB 3N3HA 3GJAA 2PLV2 1ZZCA 2WWSA 4KGGA 4MGIE 4OHVA 3K4DA 4LLOA 3THDA 2Z79A 2QDRA 2AC1A 2BYVE 2ARXA 1NLQA 1KRIA 2MHFA 4OUMA 1LOEA 5FMDA 5FZ8A 2C5DA 3D4KA 5BNNA 4WVVA 4BK4A 4IE4A 4ES8A 1UYXA 1YWKA 3I54A 4YW7A 4ATEA 1NG0A 2JWPA 1JYWA 2IZWA 1DYPA 2DUOA 3RI8A 3CJXA 4DB5A 1CD3G 3PUSA 5LCWL 2XJUA 3WP3A 3U4XA 4QGMA 2ETEA 4O9GA 5L7OA 2BUKA 3E6DA 1W6PA 2X5IA 4D6RA 5C5TA 3KCYA 1BLZA 2DCKA 4UT5A 4IE7A 3AZVA 1O8SA 1PO11 4QKFA 1X9PA 3B93A 5KXDA 2FZ2A 2JG9B 2OQ6A 4EWAA 4CEWC 2BU9A 1VAVA 2QQUA 2WNOA 4X6QB 2ZCWA 4LO5B 3EB7A 5F8PA 3VD3A 1D4M3 3MUY1 3VDBA 3OD0A 2QDNA 2YYOA 3WR0A 5I0DA 1VBE3 3RZZA 2O8OA 4ZS3A 1DQ6A 2DFBA 4NIDA 3GNEA 2YFUA 2YDEA 4QM8A 2XKOA 3JQXA 2JD4A 4IEZA 5HBAA 5L9BA 4LNVA 3ETQA 4CDWA 1R1ZA 1QOOA 1RMU2 4RN5A 2QUOA 3N9QA 2KXLA 2RM23 1LU2A 3OGSA 1LOFA 3RVHA 1R092 3KV9A 5BNPA 2WC2A 4XCAA 2H0BA 4YW2A 2GN7A 3EJKA 2ORZA 1CAWB 2WFF1 3BPZA 3OBZA 5IUQA 1RUI1 2XBO1 1ULCA 1HKDA 4P14A 5CIRA 3M3QA 1HJGA 1AR93 1HB3A 1L7LA 4GH4A 1UKRA 1GNHA 3QH7A 4LQRA 1UZVA 5D2AA 5T50A 1ZRDA 2XVKA 2IXIA 4LBLA 2L9LA 2RMU1 2WZ8A 3BU0A 2WA4A 2WWJA 4WV8A 1B09A 1DF0A 1QOTA 2Q1ZB 2VTXA 2YBKA 3H7JA 3AP6A 5C71A 4EE2A 4M3CB 4PBOA 3HT2A 4XF0A 1BXHA 1F4AA 1BVVA 1HQNA 2J22A 3VD5A 3WT3A 5A3MA 4QB6A 4QX7A 5IATA 2XWJB 1EAH2 5KR7A 3ZPOA 1UU5A 4B3NA 5C3QA 2EIBA 4ZONA 1YLLA 4TZDA 3WUCA 1REEA 2P3KA 4EN8B 5IVJA 3GM8A 4NWVA 4XJ8A 1EYBA 1HB4A 4WVMA 5FUPA 4BXFA 1NCQB 1V6JA 4LIVA 1F31A 1AVBA 1C5HA 1DU3D 2BNMA 3I2DA 4LORA 1AR83 2OVUA 4YGEA 2PLV3 3KV5A 1W03A 4PF1A 3MIEA 3W58A 3MIBA 4F83A 4NMIA 2ZMNA 3Q8BA 4BWOA 2VXJA 4JTOA 4XXAA 1UYPA 1Z7S1 2WNUB 4LULA 4AF9A 4CDUB 2DUQA 2GNMA 2VOXA 4XDPA 2WZPP 2EXJA 4EQVA 3FLPA 4ZHNA 4XAEA 3WP4A 3E97A 2XLFA 1PK6B 2OUJA 2Y26A 3S0MA 1J1LA 1YRZA 1TME2 2JE8A 3PURA 1WGPA 4Q4W2 4QX3A 3OY8B 1PGL2 1SZBA 3RZHA 4BDVB 3MEPA 3VB9A 1AYM2 4A7ZA 3NV4A 4N9IA 3UK9A 1E5HA 2WLQA 3DYPA 1ENRA 3M3CA 2P4EA 1EV12 4AW7A 3ACGA 3WW2A 4YZ4A 2ID4A 5F2WA 2ZZJA 1UX7A 3OPZA 1UZWA 3WVJA 1HQWA 2W1QA 2GC3A 3ZFGA 2XPJA 1U12A 1MZEA 5KBFA 3FL7A 4MH0E 1X7NA 5I91A 3H3UA 1F35A 5J1XA 4YNIA 1K45A 5IW0A 3H42B 3NV3A 2ZGSA 3M3EA 1S0JA 1PZ7A 1KQRA 3GXUA 1JOBA 3IKWA 5GLZA 3O7OA 1NY72 4XMIA 4BQXA 1QIQA 4CCLA 1FX5A 1DQ0A 2XLGA 3ZM8A 1CIWA 2K46A 2VMCA 3RZGA 1YJKA 3J7NA 1UOFA 1FXZA 1DLCA 4CUAA 4GWNA 1TMF1 4EZ4A 5C3PA 5IVEA 5C8WA 2P6CA 2I2SA 1XYOA 2AGSA 3MPPG 3BPSA 3ZKUA 3CL1A 1H2NA 5F39A 4DRRA 3NJZA 4QU2A 2HEWF 4XFIA 4L11A 2ADEA 2RG4A 1ND2B 3U10A 5CADA 1Q8QA 1FYUA 1U5IA 1PO21 1ALYA 4FFHA 1KS4A 4A45A 1QXJA 1UOGA 2ZGUA 3N9NA 2PA7A 1NLSA 2YXSA 3MGUA 1SLCA 2F4PA 3O0XA 4J6GA 5LY2A 2OYZA 5F5CA 2Q8OA 3BODA 3WG4A 3ZLIA 2TNFA 3G6JB 1URXA 2HWD1 3VDDC 4OFGA 3ZXEA 3ACFA 4BXSV 1UXXX 4XJZA 1BMV1 3CU7A 2X8KA 2IFRA 2FMYA 2WQ4A 4RFRB 2UWAA 3ES4A 5A33B 2WZEA 4A2UA 3O5SA 5JI7A 2F6BA 1VR3A 1YQ6A 2VTXJ 4AGVA 2E7TA 1ZRCA 3B7MA 1SDWA 3OYWB 3P6BA 1QJY3 4HT1T 4HZFA 4XFBA 1LOCA 1OLRA 4JVAA 5GZFA 1QJU3 5JZGC 4FOVA 1GP6A 4KU7A 2WS92 3KT4A 3LFMA 4COVA 1JZ4A 3LAGA 5AVAA 4FPJA 3OF1A 1Q8VA 1W9SA 4DXRA 1HRV1 3EBRA 1W6OB 4M0HA 4Z2AA 5FAXA 2OIIA 1JTZX 3MYXA 5FZOA 4S2FA 3VDDB 3WQ7A 4L2NA 1FMD2 2Y6LA 3KV6A 4Q4V2 4R9CA 4AEDC 4CUCA 3AJZA 4MGSA 1AX0A 3N9MA 1YEWA 2BERA 1CX4A 1UPSA 4QPIC 3VUOA 4LT5A 4Y22B 4LE4A 1NYWA 2R30A 1POV1 2XUMA 3DN7A 4CZSA 1W9FA 5JMCA 4CP1A 2VUDA 1W0PA 1YYNA 1POV0 1R1A2 3AX4A 4I0BA 3BN6A 1VBD1 1JUIA 3NSTA 4J1XA 5K4LA 2FD8A 3KF3A 3RWKX 1V9U3 3IIIA 2ZGNA 4FPGA 4ORFA 5FZAA 3PTYA 1Y43B 3TAYA 1YFYA 4RA0A 5JUVA 4DRVA 2DUPA 1V6MA 4NIGA 5GALA 1H1IA 2UYBA 2D6MA 4LOSA 3IDEA 4W4ZA 2W9XA 5C70A 3AKPA 1DQ2A 4D3WA 1HXS3 1VMHA 1AYN3 4PDWA 3K3OA 4F8AA 2PHXA 2FCUA 4CYDA 2RJLA 1QH6A 3GBFA 1GP5A 5EWSA 2RJ2A 4L99A 4BIOA 2PQSA 5FUNA 4E8CA 1AR62 2XH6A 5G04L 3H1WA 3UYJA 4TWTA 1H4HA 3VBSC 5JVVA 1COV3 4L97A 2Z4FA 4LHNA 4IEVA 3DKWA 2VECA 4IV1A 2N7GA 4UOJA 3PVEA 4JHZA 3ZR6A 2VGDA 2ARBA 4IE0A 3KLSA 3MV11 1VE0A 2SLIA 2RR11 5HXVA 5FZ4A 3LPFA 4I02A 4AFAA 3IDAA 3MLJA 4WM7A 4Y1YA 3RGBA 1GOGA 4A6SA 5JWPA 1JOPA 4KWJA 4CDXA 4E4ZA 2WO7A 4QHOA 3NNLA 4D7YA 2JDMA 1E5SA 4RGKA 3MIFA 3ZFFC 1CAVB 1D2SA 2ZGKA 1VALA 3TEXA 2O8QA 5C6CA 3BTYA 3OPTA 1SPPA 4FPCA 2JDAA 3PJYA 3NNMA 4DPNA 1RUJ1 1PX4A 5FMBA 2JKBA 5FPAA 3CZJA 3OGJA 3P5BA 4ISQA 2C26A 1BYHA 4N9HA 2DBIA 4YW3A 3ABZA 1UN1A 3RYPA 4O65A 4RR3C 4YW6A 5F1RA 2VU9A 4HN0A 4HSLA 4JX0A 1BK1A 1RVF2 1K5MC 3AL6A 3KGLA 3MLLA 1AXYA 2PMWB 1DG6A 1RC6A 2R1BA 5T5PA 4Q4V3 3VBFB 2EALA 3AZWA 5K9YA 4AVCA 4ZXEA 4NR1A 1PVC2 1RUF2 2BZDA 1C1LA 3ZN6A 5BNPC 3J9SA 4K6BA 1RB8G 4BA6A 5CFCC 2VVFA 4TLFA 5DABA 2Y6JA 4RS5B 1T6BX 4Y1VA 3SH3A 2ZHMA 2K2SA 1GICA 1NQDA 1DGWX 1UOBA 1XNBA 5DZEA 2WO2A 4Q4X1 3AZYA 4Y20B 4GH4C 1R082 3LKJA 4RQPA 2OT7A 4IL7A 1REDA 4XE9A 3ZYBA 1RUG2 3O1VA 5FREA 2D6OX 3RSJA 4GB33 1BKZA 3O0VA 3JD71 4DS0A 1K5MB 5CBLA 4MXWA 4ZS2A 1S2BA 1TNRA 4LHKA 2VW1A 3OUIA 3AB0A 1YQ8A 3GBWA 1ENSA 3LA2A 1YO8A 1LCLA 2W47A 3VHRA 2DU0A 1Q3EA 5K8SA 2RV9A 3FFQA 2HWC3 5BXXA 1JZ5A 5LATA 4AVTA 2CAVA 2ARCA 5ACA1 1Y9GA 2JIJA 4FOWA 4MO3M 2BEOA 2YV8A 1AXZA 3SKJE 1YHFA 1S0EA 3ZN4A 4UFLA 5IVCA 4QKDA 4PLMA 4CCOA 3BALA 4LKEA 1D0HA 4XW3A 5A7QA 5FP3A 1GQGA 1ND3A 1UU4A 3M4FA 1RUD3 2ZGMA 4G3YC 4A3XA 5JOXA 4CCJA 3HJRA 3FZ3A 3S5QA 4URAA 1AR63 4OHZA 5EQUA 4LBQB 3T0BA 1OPMA 2YZ4A 3BCWA 2PHWA 2J1AA 4CP9A 2ET1A 1KDKA 2CDPA 2W87A 2ZPXA 5C3OA 5CB7A 3N36A 4WZCA 1SQ4A 4MGZE 4YZ5A 1RJ7A 1KEXA 4YRDA 3J7MA 5JXGA 1HRI1 2VM9A 3JB8A 3KWVA 5F7UA 2ZX4A 4ZU7A 4DNYA 1RUOA 2GNTA 2MEV3 2WNVA 3ZSMA 2X09A 5ANNA 3LIHA 1B35B 1OC1A 1VRH1 2JG9A 3FJSA 4Q4Y2 1O3TA 3AYDA 3QLQA 4JCKA 4Y5SA 2JDPA 5FY7A 1RINA 1UU6A 5KXEA 1GSLA 2EF6A 1F5FA 5IFTA 1SLBA 1V6OA 2VY0A 3W5MA 5IAVA 3CKHA 4XJWA 4GMP3 4EZHA 5BV6A 2B8MA 4N43C 5FJHA 1MEC1 2W39A 4H7LA 3NNFA 1PO12 5FXZA 2JJ6A 2GALA 4Q0PA 1EUUA 3MF6A 5C5UA 1RVF3 2EXIA 3AKRA 2VBDA 4LBQD 3ACIA 3SEPA 1UOJA 1C4RA 5I0UA 5EIYB 4DUWA 1OOPA 3LEKA 4LXLA 1UWWA 3TOJA 1KXGA 1PVC3 1CAWA 3AMMA 4K8RB 2P34A 4NIHA 3LSDA 1CAUB 3S5AA 4C0BA 4H55A 2BOIA 3KHCA 2GC1A 2QVSB 4CPBD 2E7AA 4M4RA 1HLCA 4BQ5A 1KFUL 2W3JA 2ZS6B 4N43B 5D8AA 2XVGA 1XOYA 4JRLA 4DXZA 1JN2P 1MS8A 5J98B 4Q0SA 4QX1A 3MF9A 3WHUA 3UKTA 3OJBA 5AC93 2LTNA 2EIGA 3EXUA 3I2HA 2AENA 3KCCA 4NIIA 4IERA 4CEYC 4EN6B 2GDFA 2C9AA 1VBB1 1WMFA 2W92A 2Q30A 5KHGA 2R0HA 2AEYA 2XBO2 3HAGA 4OI2A 1ZZ9A 4QQLA 3BI3A 4AYUA 1NCQA 2XJSA 2NMOA 4OHWA 5EJZB 2PHUA 2RMU2 3I49A 4MG2A 5FP4A 4YARA 2WN2A 2DU1A 4CDQA 5J48A 1W8OA 2B5HA 2A70A 2DBNA 5FLIA 1RUH3 1WCSA 2XB6C 4AHZA 1DQ4A 1EP0A 3SCFA 3PUAA 2XDVA 4XILA 1XXNA 1QNYA 1Y9MA 1QJX1 2WNUA 4R9AA 4GD4A 4FOQA 2CV6A 2HLEA 2UURA 5FQ0B 3ZDVA 3ZXDA 4CEYB 4DXTA 2O14A 5TSWA 5F2SA 3NAPA 1PK6A 1FOD3 3NQHA 5J96B 4PBPA 1BBT1 2NM1A 2ZKLA 4BPZA 1ZBE3 1VBC3 2XUEA 1APNA 3OY8A 4UF0A 1O5UA 1Y9QA 3DUIA 5T54A 3TN91 4CP0A 4Z92B 4FTSA 1RUE3 1JODA 2WAAA 5H9RA 3PNAA 3ILNA 5E16A 3VDCA 4D7TA 5A1LA 1H1MA 5FZEA 4NHXA 5AFBA 2Q8EA 3E5UA 3W5NA 4Q4Y3 1AR73 1BEV1 2VZVA 1K12A 2Q1FA 4GWJA 2D3RA 4N53B 4LO6B 4W6XA 3SCHA 1MS9A 1OI6A 2R061 4KQ7A 5FJKA 2WLPA 1MZ6A 1L7QA 5DAWA 3C3VA 1QU0A 1KJLA 5BNOC 2DVAA 1FPN1 4FPLA 1OXCA 1HQLA 3X29B 1OD3A 1ASJ1 1ST8A 1PGW1 3CJIC 4UW5A 3FN9A 3WZ1A 2DFCA 4QPGC 5I0SA 5FY0A 1QJZA 3N9OA 3WX5A 3SMHA 3DPRB 5M0TA 1UYYA 5JIUA 1BJQA 1CZTA 1F5JA 1RUC1 5C4WA 3U78A 4E2SA 2GN3A 2ET7A 2J1TA 5FTTC 3AP9A 1ND2A 5I0RA 1LHWA 1WW7A 3UGFA 3VHPA 1UY0A 1SLTA 1AL23 1W2TA 3PIGA 3OSDA 1QHDA 4AEJA 1ULFA 1I6XA 1VBA1 2V09A 4XEZA 3TBDA 5LBBA 4GJZA 3FE5A 4ASLA 1J1TA 5ABJB 3VZJA 5FP8A 4AVVA 4QPGB 1TMF2 1PMJX 5SV5A 3NKTA 1US3A 1NA1A 4WM7C 1QXPA 4QPYA 5IK4A 4CDXC 5A33A 1ZBA3 5DG2A 4YPJA 4YW5A 1AX1A 5FP7A 2HWB3 5FYTA 3T30A 3VBHC 2YHJA 5A7PA 3VBRB 1SLLA 1IOAA 4M00A 2WUHA 4PIYA 5BNQA 1PO22 1PIV3 4Y33A 4AHXA 1WUVA 1NT0A 3O1SA 4EWEA 4DUVA 3GZAA 4XQ4A 1CVNA 1TG7A 2BRTA 4YFWA 1UIJA 1HDKA 1M4WA 3N7JA 3FFZA 2WO1A 3GBGA 4UFIA 5F6LB 3D8CA 5F32A 2ORXA 3VBOB 4KBBA 2LALA 4BZ4A 5L36A 1BMV2 1I9RA 1IS5A 1I5ZA 4GMP0 2NPIA 1C8M1 3MW2A 1XPWA 3E1F1 3VKFC 3HT1A 4O7XA 2E9QA 4LLFA 4Y22A 1ZA7A 2RS31 1SLIA 4Y1UA 2WA3A 2DVFA 4Q0QA 4R4ZA 2R073 4UW6A 4LE3A 4A7KA 3I4IA 4PLNA 4N7IA 5DG1A 2RDNA 1JZ3A 1DIWA 2ADDA 5FK8A 4K9SA 2XJVA 2FDKA 3ZFEA 1HRV2 2PHRA 2VNRA 1SFYA 2VE1A 1TE1B 3GJBA 1XU1A 3HD8B 1LNSA 2XGXA 1LU1A 5FZLA 1PMHX 2ZGRA 3QCWA 3L2HA 1KITA 2YC4A 3SXWA 4NHYA 1DGWA 2XONA 5F6KA 1LECA 3D5OA 5KC5A 2NMNA 2QQJA 2PTMA 4P9LA 2RVAA 1O3QA 1IKPA 4DOUA 1G9FA 1VAKA 5LK5A 1S2EA 3UESA 3VZLA 3CF6E 4XFCA 4FPHA 4CRQA 3M70A 1HB2A 3H3LA 2PHLA 4XZUG 4BU2A 4M3CF 3PL0A 4COZA 1NCRC 4J1WA 3NJXA 1WD4A 4P5YA 5FP9A 2CNAA 1JU3A 2YROA 4IETA 2ZACA 3R4DB 4JGYC 5FUIA 5FZ3A 3VLBB 5LZ6A 1AHSA 1DLLA 2OUHA 4FO9A 2CGPA 3B3QE 2GNBA 4NVPA 1JS9A 5FYZA 3POWA 1G9BA 2PAEA 4AG4A 4GJYA 4YG6A 1GQPA 3WP5A 4MXVA 3KCXA 3U11A 1O4TA 3EHKA 4YG0A 1H8VA 2YU1A 2QJVA 5C8CC 2VBPA 4YVSA 1QQP3 3MIGA 3FHQA 1NZCA 1A8MA 1W6MA 2J1EA 2W5FA 4QT6A 1UXZA 4XETA 4I09A 5K0UC 2BJSA 4IEXA 5F3CA 1ZA4A 2RDQA 2GZWA 4LKFA 3B5LB 4NAOA 2JX9A 1CZSA 1KDMA 4LO4B 4YLZA 3J8F1 1H8TC 2VZRA 2WO3A 3K46A 4CVUA 3T1MA 2HWE1 3N4MA 3TRSB 5JSPA 4UW3A 3VKLA 2FDHA 4MZUA 5EPAA 4YZ1A 3URFA 4HKLA 4P9GA 1GWKA 4AFDA 2RR12 2QQVA 4OULA 1LODA 1NZIA 5FZMA 2J7MA 2RS52 2HWF1 4MADA 1UCXA 1SCSA 3LOIA 2Y6GA 1JYIA 3UKNA 4Q29A 3ZYHA 2GMPA 5K0UB 2ZGLA 1UO9A 2NQYA 3THPA 3PUIA 3ZPYA 3VBFA 4JTNA 2FCTA 2ZMLA 4HK9A 1W2AX 2G4IA 1F4HA 1MS5A 3CZUA 1OF3A 1LKNA 1H8TB 4IGQA 1OOPC 1RUJ2 4CEWB 2ZTNA 1UIKA 1YCIA 1YFUA 2JB4A 4FI9A 4FQZA 2VOWA 5GJ6A 3WF0A 5JPNB 2B9UA 2DTYA 3RQ0A 5FYVA 4BIFA 4NPMA 1UY1A 4GA9A 1AL21 3CQOA 2VCCA 3V56A 3O12A 4BMBA 5D8AC 3T08A 5JXJA 2VVDA 1LGCA 3H8UA 5JDBA 3A21A 1UKGA 1XBFA 1H0BA 4XF1A 3B01A 2EA7A 4IEWA 3JBG3 1KGYA 1MS0A 2R043 1C5IA 2CL2A 4LUMA 4XHBA 4GKYA 2WN3A 3ZYRA 1FV3A 2WWUA 4WM8A 3POSA 1GOFA 4UFJA 1W06A 3ELNA 1M06G 1V6KA 3ACLA 4Q4X2 1ZZBA 3WUDA 2VR4A 5FY5A 3KQRA 4LTAA 5FZBA 1DDLA 4YWAA 4JKLA 4PI2A 4NOTA 4RHV1 3WDYA 3ZXGA 1XB9A 2JE9A 2VQAA 4CDQC 2BPA2 3PLQA 1BZWA 2WQ8A 3I8TA 1MR5A 1UQXA 3KB5A 5FBZA 3ZXJA 2ZBJA 4A3ZA 4W50A 4R8HA 4CUGA 2Q4SA 1Y7BA 4XAAA 4JQRA 2QCSB 1PNGA 2RDRA 2VAUA 3V0BA 2VC9A 4D6QA 1YUDA 1SCRA 2A5ZA 2ZEWA 4LHLA 1VLNA 3H8RA 4C8DA 1QWRA 3HMYA 4NO4A 4QPWA 1ONAA 3IPVB 1GR3A 3S6PA 3VV1A 2GP3A 2BVBA 3KHBA 5F3GA 3NAPC 1RHI1 5DUUA 3ZSJA 1ULEA 1GZCA 3SQOA 5FLHA 4CCDA 4FSJA 4GZ9A 1N3QA 4IV3A 3PIJA 1C28A 5FLJA 4R9BA 2WT2A 4AFMA 4COYA 2XMLA 4QXHA 1GKBA 3NMBA 3WCRA 3ZO0B 1YXWA 1B35A 2J1SA 2TEPA 5HV0A 4RD7A 3E5QA 4QMAA 1XYPA 3OGVA 3EYPA 3S57A 2VMGA 2RDSA 2NN8A 4YVWC 5FZCA 1HV1A 1HW5A 4P9WA 1UZ0A 3WQ0A 3D6EA 3HNBM 3ACHA 2OXBA 1VAMA 1UY2A 4M01A 3AKQA 2VZ1A 2BP6A 2J1RA 5LASA 4AI0A 1LAJA 3POJA 5A7WB 4W6YA 5FYUA 3TWIA 4ASMB 3I2OA 1BVP1 1GZWA 3B02A 5C3RA 5CZKA 2RS53 3KD4A 3SITA 1VRH2 5DDJ1 1XQNA 2Y0IA 1F15A 1JW6A 2A6XA 3TYJA 4AHWA 1ZNPA 4UW4A 1HIXA 1G7YA 1NAEA 1O4YA 4IEYA 3W20A 1NUKA 3HPNA 4JGZA 3S7EA 2RJKA 3ILRA 5IK7A 1XJAA 3I3BA 4X8NA 5KHHA 2WJSA 2D93A 1S55A 4YVWB 3A23A 1YI7A 2WZR2 1H2KA 1BHGA 1RMU3 4XDOA 1IZ3A 3MZHA 1R093 2E7QA 3CIHA 2VZUA 3T4VA 1MEC2 3ZSLA 5E6HA 2P17A 3ZKYA 3KSCA 2ZEZA 5F9TA 4Y24A 4FXKB 4WVZA 3HN1A 2JG8A 2R49A 5CFDB 1W6NA 1GWLA 3AJYA 1I5PA 1C8NA 2W91A 3MICA 1GZ9A 4QX5A 3WDUA 1JMUB 2RS12 3RDIA 4Z1VA 2P3YA 2XLAA 3F95A 4QQPA 1CESA 3VZOA 3MBWA 1XU2A 4A42A 1ZREA 4GKXA 4LO7A 4K1ZA 1EAH3 1JOJA 1LHNA 1LULA 4YGDA 4BHPA 1XNDA 5C3SA 1IPJA 4Q8LA 5A3OA 4XJ9A 5IVFA 2VJXA 5C9AC 4MSVA 1H30A 1JHNA 4B4RA 2C1FA 3NV2A 4PQ9A 3WINE 4Z07A 5LBFA 1D4M1 2ZHLA 1N1SA 3T3YA 1IKQA 2BFUS 1S1AA 1RYYA 2UY9A 3M3OA 4QQ2A 3T0AA 3ZSKA 2FBEA 1VBE1 5EYYA 4CU7A 1W9WA 3SH5A 2FDGA 3U14A 1OLMA 3OB8A 3TEYA 2B42B 4V2VA 3TNPB 3VBUC 1WLDA 2YG0A 2UU8A 4GULA 5DAXA 2QNKA 4FAHA 3MV01 4CUBA 1H2LA 4TLGA 3OUJA 5IAXA 1SHWB 2VCMA 1CJDA 4HLTA 1DFQA 3FHIB 4QX0A 4S2DA 2YC0A 4AI3A 5DQ0A 2A3XA 2D97A 4P9IA 2VBBA 1FAYA 2RM21 1PZ9A 1LEDA 4K40A 2VXRA 5DUVA 3O1PA 1QDCA 1PM7A 1SLAA 2WIIB 3VBHB 4PF5A 5C9AB 3OBAA 2VMHA 5JZGB 2CY6A 4XYXA 1TME3 4B7EA 2WSVA 2BOJA 4Q4W3 3MHZA 4AI2A 3GF6A 4B1MA 5FV3A 1AR91 4IQPA 5J7MA 2DURA 1YC61 5JIAA 2GMMA 4N53A 1AYM3 5L9RA 1QJX2 4N90A 1EV13 1QDOA 4MHRA 2AACA 3QACA 4QD2A 5FYMA 1BBT2 5LBCA 1MZFA 4AEDB 2P2KA 3TN92 4XUTA 1WLTA 4OZOA 2X10A 4YG3A 4QPIB 4Z2WA 3AVSA 1GANA 2Q5TA 3AZZA 4LBOA 3VZNA 4E27A 2A75A 4S2GA 3NRUA 1POQA 1BEV2 3OCPA 3MW3A 3DPRA 2XQXA 2V5YA 3AMNA 5KHJA 3NNJA 3VL8A 1S0BA 2DF7A 3WQ1A 5L73A 1AR81 2R062 3VHNA 1DGLA 2PLV1 1KFXL 2E51A 5A6QA 5BNNC 1AXKA 2F17A 1EPZA 2Y6KA 3ECQA 1J3QA 1N47A 1YIPA 2JB8A 1OVSA 2FDFA 1RXFA 4P9YA 5FYBA 4PCRA 4BLIA 2SBAA 3OGRA 1OA3A 1CAXA 1ASJ2 1ULPA 2XL7A 4MVTA 1NQJA 4A7YA 1PGW2 4DMIA 4BM8A 1DQ5A 2JENA 3FUOA 3JQWA 4BH9A 2CWMA 4LA2A 4SBVA 4UBGA 5L7OC 4ATFA 2Q0AA 1FNZA 1IGOA 2X5IC 4MGYE 1MQTA 5GKAC 5A3PA 1RUC2 2LW8A 2B4KA 2ZX1A 2RS13 2GP5A 2V5DA 2W95A 2WSUA 2D40A 3WCSA 5FPBA 2E33A 1SG3A 1S2KA 2DCZA 1LHVA 2H0VA 4AI8A 1GNYA 3VBSB 5JAXA 1VBA2 3C7FA 3DYOA 4OLLA 3ZOIA 2X53S 4AI9A 1DBNA 2E63A 1W8WA 2WS93 2W1UA 3LCPA 4KMQA 5I8SA 3VBOA 4IEOA 4ONUA 1H9PA 5CYYA 3B9IA 2VG9A 5L7OB 5FYSA 3B9CA 4QWNA 4QX8A 3ZDSA 4HXCA 1C1FA 1W6PB 2X5IB 2DCJA 4PT6A 5E1RA 5ANQA 1VRBA 2OKXA 1DZTA 1FMD3 4KI5M 4XCBA 4KH9A 4Y4YA 4CDWC 4UI9L 2IWGB 3ZFFB 1E5RA 4GQ7A 3THCA 3V65A 1LOFC 1YFWA 2DVBA 4AVAA 1F8VA 2X05A 2WAOA 3UJQA 3RI9A 1W9TA 3I2KA 4B1LA 4FXGB 2ATFA 3GHMA 3ZR5A 2LS6A 1S0DA 1FI2A 2CYFA 4XPVA 4BQ1A 4Y1ZA 1NE4A 5FZ7A 3U4SA 1XSQA 1R1A3 1IG3A 1WKYA 1L7RA 4RR3B 3UETA 5H9SA 2JEMA 2OA2A 1RJ8A 4QDQA 1G9AA 2RS32 2ZAHA 3HR9A 3HN3A 3N7LA 1UNBA 5H9QA 1GP4A 2G19A 3NL1A 2NP0A 4F3JA 3WNPA 1UD1A 4UYBA 3NJVA 4R4XA 4PHZA 1G9DA 4QQOA 3A22A 2WABA 5BNPB 2XR4A 1VJ2A 2XJTA 3P3NA 4XUNA 2AZ5A 2Z42A 5CFCB 2VQUA 2JECA 1QJY1 2OZ6A 2WBKA 1QJU1 3G7DA 4AVSA 5CFDC 5FPUA 4GH4B 5A7SA 4TTGA 3M3IA 5FPVA 5B4NA 4OCTA 1SMVA 1ZX5A 5F5IA 2ZAAA 4Q8KA 4ZKTB 2EXKA 1AZDA 3I3QA 2BGCA 1CIYA 5B4XA 4YGCA 2FCVA 2R16A 4RYDA 5LA2A 1X9TA 3ROUA 4NIAA 1WMEA 3N7KA 4JKMA 2W2IA 4GXLA 1GFF2 1A78A 1JYNA 2UYAA 1XE7A 2BBAA 3POGA 1W8ZA 3FLRA 1OUSA 5FZHA 2ZHKA 5FWEA 3NWKA 3RYRA 4OHXA 4ZZ8A 5IYYA 5KHIA 1LTEA 1X8MA 2ZHNA 3H9AA 1UMZA 4EV0A 4L92A 3OEAA 4GIQA 2PXJA 2JDKA 1TQ5A 2AR6A 3R4UA 3QH6A 1QJEA 3I59B 4OYUA 5FZIA 3OGGA 1W3XA 4EJRA 3U0ZA 3RZJA 4YZ2A 3T0DA 4IESA 1V9U1 2VPVA 4IE5A 2DDUA 2W08A 1UF2C 3AM2A 3ZFGC 1JYXA 2VULA 1W2OA 4XACA 2BFUL 1N3OA 1CJPA 4E4SA 2Y0OA 2HJIA 3BTZA 5FZ0A 3AK0A 4L9BA 3LEGA 3DKQA 4UFKA 5FBJA 2EVXA 3LA3A 1EUTA 4HN1A 5LA9A 3TNQA 4XUOA 4XF3A 3HNMA 1UW8A 3SC7X 3WF4A 3CMGA 1HXS1 1AYN1 3J8F2 1DP0A 3KT1A 1JH5A 3KM5A 4XUPA 4JGZC 2HWE2 5IVYA 3T1LA 2YY1A 4JV4A 4QKNA 5I8TA 2R32A 4H14A 3VD4A 1QGLA 1LJ7A 4DUXA 5LEKA 4CP2A 1DYKA 3M1HA 3LWCA 3OBRA 3FC0A 1HJFA 2YGMA 2ZKNA 3AFKA 1RUF3 4AEMA 2OZJA 3GHNA 4BLJA 1COV1 2WFPA 4QB2A 2VZSA 1V0AA 5APAA 2D7FA 3U37A 1UY4A 3V0AB 3H3ZA 4OI0A 5HV4A 1WCUA 1R083 4J25A 2JG8C 1Y3TA 1HX6A 1JU4A 4M3CA 5DMYA 1RUG3 3NJYA 3LDKA 3R6SA 1I1EA 2QE3A 1X50A 3MLKA 1DQ1A 2BGPA 4EWDA 5IWFA 3BKZA 4YFZA 1WW4A 4XBQA 2CAUA 3WG3A 3BIEA 4FFFA 2YU2A 2WFF2 4BE3A 4IEUA 1RUI2 4I0AA 3SKVA 1A34A 1ZZ6A 4AOCA 3RZLA 1CPNA 2Z2SB 2W68A 2DVGA 4XBLA 3GYDA 3ORJA 4LKSA 1J59A 4IGOA 2R0FA 3ME2A 2P6HA 2ZX2A 3N9PA
chains in the Genus database with same CATH topology
4KGQA 3AFGA 1AJKA 1Q8OA 2D3SA 5JOWA 4YW4A 3JU9A 5GLTA 3R05A 4GWMA 4KU8A 4CDUA 4Q4V1 5JI9A 4WBBA 2O1QA 3PVBB 3I7DA 1LHUA 4RHV2 4XMAA 1FT9A 4AVBA 3POYA 2IXHA 4FVVA 1IS3A 1O3RA 4D7SA 3PHMA 1AX2A 3KZ4C 3ILFA 1S0IA 4NN0A 3D82A 5HCBA 1PNFA 1WBLA 3ASIA 4AFBA 2DYCA 3WV6A 1O7FA 1QXRA 1RTVA 4XJUA 2OW4A 1Z7S2 1IHMA 2ZABA 3MDPA 3FBMA 4GB31 1W6QB 4OHXA 5I8YA 4Y26A 1JUHA 2DWRA 4Z82A 4YM2A 1SBEA 3UV9A 2PAKA 5CU1A 3W9AA 4LBMA 3EO6A 3S7IA 4QGNA 2HWC1 4COWA 3O0WA 1CR7A 2IXCA 3NVCA 4HPKB 4PDWC 4B29A 5K7PA 3RYKA 1Q5OA 4I2OA 1SBFA 1PO13 4FAGA 4AQSA 4AXOA 4I3GA 2ES3A 1RUD1 4B7KA 1LRHA 1UZZA 2XL9A 1AR61 1CONA 4Q26A 1WLWA 2GC2A 3VL9A 4IV1C 4C91A 4LR4A 2PFWA 4D69A 5BNOB 2WKKA 2XJRA 2ZGOA 4PDWB 3CJIB 1H2MA 2D5HA 2DTWA 2MEV1 4IEQA 1N1YA 1U5XA 4PLOA 3ZYJB 5CA6A 1TEIA 3NV1A 1CQ9A 3U07A 1OFSA 2WINB 3OYWA 2WFF3 4LUKA 5B2GB 1RUI3 2XBO3 2A3YA 2XG3A 5FMOS 4Z8BA 1V6IA 3FUQA 3HBZA 1Q8SA 5J3UA 3QD6A 4XIOA 2RMU3 4GMP1 2HWD2 1W6OA 4N7UA 3VDDA 2WT1A 1JBCA 4GALA 4WM7B 4RSUA 1RVF1 2NLRA 4CDXB 3IIAA 4MLOA 1OPOA 4V1PA 4JDNA 3LB9A 1U5ZA 1MVEA 2VW0A 3R0RA 5KXBA 1EPWA 3VBHA 1D4M2 1PVC1 3MI8A 5BY5A 1H4GA 1VBE2 2Y38A 1OQ1A 3AMQA 4LEJA 4RQPC 1LB2A 4AQ6A 4YGBA 2C0ZA 4FT8A 4LO8A 2I45A 4XTMA 3CEWA 3H1MA 2VUJA 4AEDA 1Z7S3 4EN9B 5T55A 3ZVXA 3CNAA 5AC91 2RM22 4QPIA 1GYKA 4FCAA 5E89A 1RUNA 3ZN6B 2NZ9A 2BTVC 2V73A 4ZU5A 5DUWA 5CNAA 3IT8A 5D1IA 1LOBA 1VBD2 3AMHA 4LBNA 3ZN5A 5FDBA 1LR5A 3VGIA 4RQPB 5HCFA 3WW1A 4AI1A 5JCTA 4AQ2A 1ND3C 1Q56A 1RUH1 4JC1A 4WVWA 4NPRA 1SFNA 1G9CA 4B8EA 4HK8A 5LEJA 3AP5A 4OUSA 1FOD1 1ZBE1 1VBC1 1NCRB 1Z0HA 4K20A 1OQEA 1AR82 4KG0A 4AFCA 2WNVC 4JGYB 1RUE1 1Q43A 2IXJA 4HKWA 2BWCA 4Q27A 1TMF3 2JG9C 1MS4A 4XJAA 3E6BA 4FPYA 2I07B 4PJYA 1CAVA 4K7JA 4FTBA 1ND3B 5T3NA 4Q4Y1 1AR71 1X82A 1A3KA 2ZZQA 3VBSA 5JSOA 2Z69A 3MFCA 4Q2FA 3MFAA 1GQHA 4E2QA 4PIZA 5CG8A 2D44A 1GV9A 1PO23 4ZXKA 5EYXA 4IEPA 4EROA 5C8CB 3AYAA 3DL3A 1O91A 1FNYA 2HWD3 4XFAA 4Y1XA 1AUYA 3T2TA 3IBMA 2HKXA 3WNXA 2WNVB 3BB6A 3W59A 2D6LX 4KL1A 3ZMNA 1XRUA 2WQZC 4XHXA 3ZFFA 2D3PA 1YNAA 5A32B 4RS5A 4HMZA 4HSJA 4XQDA 4AGGA 3IM0A 4Y20A 4NHLA 1HRV3 1MVQA 1WLCA 3GALA 4FQ4A 1WW6A 4RR3A 2PELA 2DV9A 3A0NA 1K5MA 1QMJA 3K51A 2RE9A 4QXKA 2VNGA 5AVPA 2D43A 5KWRA 5E8AA 2XJPA 1DZQA 1ZBA1 2VQ0A 5C33A 1O4ZA 2BVVA 5FOBB 4AHYA 4NHKA 1OOPB 2HWB1 5CFCA 4FTEA 1POV3 5BYNA 4MGKE 1PIV1 4XFHA 3D0SA 1NCQC 5DXDA 3RMYA 3H7YA 3PJQA 1LOAA 3J26N 2YGLA 4OI4A 1UX6A 2P3IA 1VBD3 3JD72 4UBHA 3RG0A 3BTAA 5D8AB 3ZMOA 5I91A 1PMIA 5L19A 4CTEA 4LBQA 2E6VA 2JE7A 3LSEA 1V00A 4SLIA 5ACA2 2WNUC 4CDUC 1SEFA 3ZIWA 5A3LA 4FP3A 2Q1MA 3VKOA 1QJY2 1PK6C 2B46X 4XQWA 1QJU2 1HV0A 1WMDA 2R071 3QOPA 5CAZA 3H1YA 4XFGA 2XJQA 4YZ3A 5FPXA 3AMPA 5AFEA 3PMEA 1ZVFA 4CDQB 4XZPA 3I59A 4OI1A 1XNKA 3J4UH 2NYYA 1LGNA 4H7MA 1WA4A 2D6KA 2XVLA 5FMOL 4HVRA 3NO8A 3VKNA 4E9KA 4WZFA 1Z78A 1AF9A 2ZMKA 4QGLA 4K8FA 4K3UA 1HRI2 2RR13 1WW5A 3NAPB 3NKGA 1L3JA 3ZSEA 3AYEA 2KM2A 2JDZA 5T52A 1OQDA 3MIHA 1WCKA 1O5LA 1IQAA 1KS5A 2D98A 1OA4A 1V9U2 2VUAA 1NLRA 4INDA 1LESA 2RHPA 5C4WC 3L2YA 3DV8A 1CAUA 3ZYGA 1RUJ3 2ERFA 1ND2C 1SACA 3CLPA 3V0AA 3PMSA 3ZX7A 2UY8A 1HXS2 4N43A 1AYN2 4AGRA 2MNGA 1QQP1 2FQPA 2ZGQA 2G9FA 4P9JA 3THTA 4MX3A 1AJOA 2A71A 2B45X 1NA1C 2VOKA 4DY5A 1S0GA 1KJRA 1XYNA 2ZA9A 1ZYBA 2UWCA 2QZ2A 5JSRA 1COV2 1DHKB 2BW8A 4DINB 5C4WB 4DFSA 5IK5A 3ZYIB 4TSVA 4Q4X3 1JYCA 1RITA 4BCUA 4HKOA 4AE2A 1C57A 4JRAA 4EN7B 3QBQA 3SISA 3BIWE 1OD5A 3JD73 1ULGA 4G4FA 3DGTA 3FX3A 3RJRA 1QOSA 1VBB2 1NA1B 3JUUA 4M3CE 3WOGA 4CEYA 5FQ0A 3FMGA 4OHYA 3USUB 3ZIXA 5ACA3 2ZX0A 5GZGA 5IK8A 4FPFA 1NOVA 1UL9A 4LBJA 1YIFA 3VZKA 5KC6A 3M8LA 2K0GA 3ZFEC 4KNCA 3JZVA 1PVXA 2G9GA 4M0NA 1F2NA 3WW4A 2ZJCA 1LHOA 3E5XA 4XTPA 2BNNA 1W6QA 1J58A 2KA3A 5J37A 3JBG1 2R041 3VBUB 4ES9A 5IT6A 2D5FA 1ZM1A 2YMZA 4XIKA 4P5HA 4F7ZA 1ZRFA 2PHFA 5T5LA 1GNZA 2GSYA 3WXPA 1HRI3 4HPKA 5J36A 2HEVF 2YPJA 5T5JA 3H0OA 5J09A 4B4QA 3OTFA 3ZFEB 1CPMA 4LA3A 1RIRA 1VRH3 3MIDA 3AKSA 5KHKA 4GB32 5GZCA 3L9JT 2W0XA 1IS4A 2A6WA 3RJ2X 3ZXKA 3DF0A 4HFSA 4HETA 2WNEA 2WZR3 4JDOA 1DZRA 2HWC2 2LM3A 4HVQA 1REFA 1FPN2 4DY3A 3R4SA 4YVSC 1NXMA 1MEC3 5BNOA 4MYEA 3K48A 5HCAA 3CO2A 3ZXFA 4L8QA 4B4PA 5ABJA 3CJIA 3SCGA 4YYOA 2LUWA 2K9ZA 4QPGA 1WCDJ 3BU7A 3MPBA 1G86A 1RUD2 1GLHA 1PHMA 5GLWA 3WHTA 3WY6A 4Q1RA 4FPOB 2PAMA 3VBRA 4Q0UA 3Q9OA 1MS1A 3MW4A 3WDXA 5BNNB 2EAKA 4LBKA 1OFNA 4RL7A 4K21A 1S0CA 2QFEA 1CN1A 3EQEA 4OVEA 2GH8A 1KD7A 4YVSB 1A8DA 3FBYA 1AL0G 2GMEA 1MZ5A 1LEMA 2QKDA 3B94A 2MEV2 4K1YA 1W6MB 2RS51 3NW4A 3WDWA 1O3SA 3AP4A 1NE6A 2R6QA 4MUVA 2HYKA 3VBFC 3M7AA 1VBB3 1QH7A 2A6YA 2DCTA 5SV8A 1I3HA 3N35A 3AXDA 4RS5C 4ISRA 3LOBA 5BPXA 5GM0A 2GC0A 3AP7A 2HEYF 1RMU1 1F9KA 2YUEA 4TYSA 2ENRA 1R091 1V6NA 4R9DA 3LZZA 3RMXA 5HI0A 4YW1A 3RNSA 1C8M2 4E2GA 3ATGA 2AH2A 2VH9A 1QJX3 3KT7A 4UXAA 1QKQA 3SNMA 1D4VB 1XNCA 4WM8C 4AWDA 1OLQA 4ZU4A 1RGSA 1BBT3 3AYCA 4CDWB 3TN93 1EAH1 1LOGA 2EXHA 5F5QA 4Y5Z0 4KWKA 3UJOA 3FWEA 1W2UA 3UKVA 1BEV3 1N3PA 2EAAA 4AQTA 5FOJB 2IC1A 1CGPA 2GU9A 2B39A 4RGAA 5AC92 2R063 5EJ3A 1C3HA 4I3PA 3SHRA 4DQAA 3RPQA 3APBA 4XBNA 4WM8B 1FPN3 1ASJ3 1NCRA 4IXLA 1SBDA 4IV3C 1J3PA 5FPZA 4JGYA 1UZYA 2WL1A 1B35C 4WVMB 1TME1 1RUH2 5EXOA 4Q4W1 5DZGA 1PGL1 3UL2A 1RUC3 2P37A 3ZXAC 2PN5A 3WD5A 2QZ3A 1AYM1 1J3RA 1XE8A 2VVEA 3VN4A 3V0BB 1T6GC 1X33A 4AEKA 2CGOA 4HL0A 1EV11 1FATA 4HVOA 1W39A 1V70A 1FOD2 5C8CA 4D94A 1ZZ8A 1VBA3 1ZBE2 1VBC2 4YSFA 3C2UA 3IDBB 1RUE2 5K0UA 3PVOA 2GAUA 4IV3B 2GH2A 4I01A 1NY71 1AR72 3BOPA 5EZWA 3N7MA 1H8TA 1ZRRA 5A32A 4YM1A 3WDVA 4CEWA 1VB2A 2PYTA 1S0FA 1OKQA 1NXD1 2D6PA 2WZR1 1WBFA 1LGBA 2HWF2 3ZFGB 3SLIA 2ZX3A 4W65A 2ZGPA 1U5YA 3PVNA 2VNOA 1IS6A 1GZWB 1V6LA 1BCXA 3AKTA 1C8M3 3RRDA 1W0OA 2E53A 4XDQA 1YFXA 1ULDA 3VKMA 3E6CC 5EV7A 2TBVA 3IDCB 4JGZB 2FZ1A 1D0GA 2RS33 4YM0A 2Z5WA 2RS11 3GZTB 3BOWA 2QQPA 4Q0VA 5JPMB 3VZMA 2IXKA 2O0OA 1N1TA 1AL22 1DGRN 5BUVA 2VMIA 3RWNA 4O9EA 1VIWB 2CTVA 2H6CA 1OSGA 2A6VA 1LENA 4X6RB 2FMDA 2WS91 1UAIA 4META 2JG8B 3INAA 4XF4A 1YJLA 5EFUA 1ZBA2 1W6NB 4RGGA 3IWZA 1H1AA 3IPVA 2PQQA 2FHRA 1ENQA 2HWB2 2W52A 3ES1A 5FO9B 1OMIA 1FMD1 1PIV2 5I93A 2B7YA 4C90A 5FO8B 2CWSA 3LA7A 1G8WA 2WT0A 2XHKA 2GNDA 3HIFA 2XWBB 2A7AA 5JOYA 2IFWA 2IXLA 3ZXLA 5LK7B 1DGRA 4XF9A 4N53C 4U2AA 1R1A1 3GZUC 3SH4A 2CGNA 2R1DA 1TNFA 5LRSA 1RHI2 3A0KA 2R072 4C0HA 1BQPA 3WW3A 4YM3A 2X29A 3D0JA 4XFFA 2DCYA 3WP6A 4G9SB 3WG2A 2JXAA 4OZXA 2A6ZA 2AYHA 2JICA 3M2MA 4I30A 4QM9A 3S30A 4AK3A 4KG8A 3VHOA 2P3JA 4FP2A 4R52A 3DPRC 3J8F3 3P3PA 1N1VA 4XOGA 4X8PA 4YVWA 2HWE3 4ITCA 1H9WA 4HANA 4W6WA 5JOZA 2A3WA 3KMHA 1E57A 1OHFA 1X8EA 3V64A 4JDMA 1ENXA 4S2HA 4BMEA 4FOYA 2HWF3 4I0WB 5FRAA 5DDJ2 2DVDA 4QHBA 5ABJC 5CFDA 1MACA 5FFOC 5I0TA 3ALQA 5KXCA 1MQTC 3O14A 4JAAA 4C1WA 4C1XA 1QY4A 2OPKA 3VBRC 1D2QA 4H3WA 3KS7A 3RS6A 5CVRA 2UWBA 4KWLA 4E4DX 4Q1PA 3OBTA 3B69A 3B00A 3ENRA 4COUA 3IMNA 1QQP2 5DZFA 3KGZA 1UPIA 1MS3A 1CAXB 4IV1B 4HBNA 3VBOC 2TUNA 2VW2A 5JR7B 3WDTA 3ZYPA 2BQPA 4FPKA 3WLUA 5DUXA 1MQTB 5GLVA 2I74A 3H50A 3USUA 2BWAA 2AREA 2PHTA 4DZGA 1U0AA 4BOWA 2D6NA 5C9AA 4MV2A 3HWJA 1RUF1 5JZGA 4RHV3 1WD3A 5JLVA 5E88A 2H6BA 1VB4A 3TB0A 4EN0A 3USSA 1VP6A 1R081 1IPKA 3LGRA 3VBUA 1RUG1 3WG1A 2VOVA 1A6CA 1GBGA 2BNOA 2PHDA 4XXPA 3JB4C 1RHI3 4P9XA 2MPFA 3A4UA 2XKPA 3AZXA 1PGSA 5GLUA 1AR92 4NHMA 2ILMA 4BYYA 1PZ8A 5GZDA 1EY2A 4FPEA 3FLTA 1G6NA 4QQHA 3OD4A 3JBG2 2R042 3IN9A 1FV2A 2AUYA 1RL3A 3JCIA 3AXEA 1YI9A 1X36A 4MXWB 5FO7B 4PIXA 1OA2A 2A73B 4URTA 5FCCA 3ST7A 1ZZ7A 3HQXA 1Q8PA 5LRRA 1QNWA 5GZEA 4U36A 1QF3A 5DDJ3 4RFT0 1JXNA 4NWWA 2ZGTA 4FBFA 5H9PA 2ZOEB 3N3HA 2PLV2 1ZZCA 2WWSA 4KGGA 4MGIE 4OHVA 4LLOA 2Z79A 2QDRA 2BYVE 2ARXA 2MHFA 4OUMA 1LOEA 5BNNA 2C5DA 3D4KA 4WVVA 4ES8A 1YWKA 3I54A 4ATEA 1NG0A 2IZWA 1DYPA 2DUOA 3RI8A 3CJXA 4DB5A 1CD3G 2XJUA 3WP3A 3U4XA 4QGMA 2ETEA 4O9GA 5L7OA 2BUKA 3E6DA 1W6PA 2X5IA 3KCYA 2DCKA 3AZVA 1PO11 2FZ2A 3B93A 5KXDA 2JG9B 4EWAA 4CEWC 1VAVA 4X6QB 2ZCWA 4LO5B 1D4M3 3OD0A 2QDNA 2YYOA 3WR0A 1VBE3 3RZZA 2O8OA 1DQ6A 2DFBA 3GNEA 2YDEA 4QM8A 2XKOA 3JQXA 2JD4A 4IEZA 5HBAA 4LNVA 3ETQA 4CDWA 1R1ZA 1QOOA 1RMU2 2QUOA 2RM23 2KXLA 1LU2A 5BNPA 1LOFA 1R092 2WC2A 2H0BA 4YW2A 2GN7A 3EJKA 2WFF1 1CAWB 3BPZA 5IUQA 1RUI1 2XBO1 1ULCA 1HKDA 4P14A 5CIRA 3M3QA 1AR93 4GH4A 1UKRA 1GNHA 3QH7A 5T50A 1ZRDA 2XVKA 2IXIA 4LBLA 2RMU1 2WA4A 4WV8A 5T5OA 1B09A 1DF0A 1QOTA 2Q1ZB 3H7JA 5CG9A 3AP6A 4M3CB 4PBOA 3HT2A 4XF0A 1BXHA 1BVVA 1HQNA 3WT3A 5A3MA 2XWJB 1EAH2 1UU5A 4B3NA 1YLLA 4TZDA 3WUCA 1REEA 2P3KA 4EN8B 4NWVA 4XJ8A 1EYBA 4WVMA 1NCQB 1V6JA 1F31A 1AVBA 1C5HA 1DU3D 2BNMA 3I2DA 4YGEA 1AR83 2OVUA 2PLV3 3MIEA 3W58A 3MIBA 4F83A 2ZMNA 4BWOA 4JTOA 4XXAA 1Z7S1 2WNUB 4LULA 4AF9A 4CDUB 2DUQA 2GNMA 2VOXA 2WZPP 2EXJA 3FLPA 3WP4A 3E97A 2XLFA 1PK6B 2OUJA 2Y26A 3S0MA 1J1LA 1YRZA 1TME2 1WGPA 4Q4W2 3OY8B 1PGL2 3MEPA 1AYM2 4A7ZA 3NV4A 4N9IA 3UK9A 2WLQA 3M3CA 1ENRA 4AW7A 1EV12 3WW2A 4YZ4A 2ZZJA 3OPZA 3WVJA 1HQWA 2GC3A 3ZFGA 2XPJA 1U12A 1MZEA 5KBFA 4MH0E 1X7NA 3H3UA 4YNIA 3NV3A 2ZGSA 3M3EA 1S0JA 1PZ7A 1KQRA 3IKWA 5GLZA 3O7OA 1NY72 4XMIA 1FX5A 1DQ0A 2XLGA 1CIWA 1YJKA 1FXZA 4GWNA 1TMF1 5C8WA 2I2SA 1XYOA 2AGSA 3MPPG 3CL1A 1H2NA 4DRRA 3NJZA 4QU2A 2HEWF 4XFIA 4L11A 1ND2B 3U10A 5CADA 1Q8QA 1FYUA 1U5IA 1PO21 1ALYA 1KS4A 1QXJA 2ZGUA 2PA7A 1NLSA 2YXSA 3MGUA 1SLCA 2F4PA 3O0XA 4J6GA 3WG4A 2OYZA 2Q8OA 1KRIA 3BODA 2TNFA 3G6JB 1URXA 2HWD1 3VDDC 4OFGA 3ZXEA 4XJZA 1BMV1 3CU7A 2X8KA 2IFRA 2FMYA 2WQ4A 2UWAA 3ES4A 5A33B 4A2UA 3O5SA 5JI7A 2F6BA 1VR3A 4AGVA 2E7TA 1ZRCA 3B7MA 1SDWA 3OYWB 3VBHC 1QJY3 4HT1T 4HZFA 4XFBA 1LOCA 1OLRA 4JVAA 5GZFA 1QJU3 5JZGC 4FOVA 4KU7A 2WS92 3KT4A 4COVA 3LAGA 5AVAA 4FPJA 3OF1A 1Q8VA 1HRV1 3EBRA 1W6OB 4M0HA 5FAXA 2OIIA 1JTZX 3MYXA 3VDDB 4S2FA 3WQ7A 4L2NA 1FMD2 4Q4V2 4R9CA 4AEDC 3AJZA 1AX0A 1CX4A 1UPSA 4QPIC 3VUOA 4LT5A 4Y22B 4LE4A 1NYWA 2R30A 1POV1 2XUMA 3DN7A 4CZSA 5JMCA 4CP1A 1W0PA 1YYNA 1POV0 1R1A2 3AX4A 4I0BA 1VBD1 1JUIA 3NSTA 4J1XA 1V9U3 2ZGNA 4FPGA 4ORFA 3PTYA 1Y43B 3TAYA 1YFYA 4RA0A 4DRVA 2DUPA 1V6MA 5GALA 1H1IA 2UYBA 2D6MA 3IDEA 3AKPA 1DQ2A 4D3WA 1HXS3 1AYN3 4PDWA 4F8AA 2PHXA 4CYDA 2RJLA 1QH6A 3GBFA 5EWSA 4L99A 4BIOA 1AR62 2XH6A 3H1WA 4TWTA 1H4HA 3VBSC 5JVVA 1COV3 4L97A 4LHNA 4IEVA 3DKWA 2VECA 4IV1A 2N7GA