1FIAA

Crystal structure of the factor for inversion stimulation fis at 2.0 angstroms resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
79
Chain Sequence
VLTVQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION (FIS)
publication title Crystal structure of the factor for inversion stimulation FIS at 2.0 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 30
structure length 79
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fiaA00
5C4JJ 2R5ZB 2R93J 2IBDA 1I6HJ 2TRTA 3HEFA 3TW7A 1B8IA 2ELKA 2YUSA 3FK7A 5FKOA 2O9LA 1BA5A 4W97A 4M3FA 5C4XJ 1VI0A 4X6AJ 4AYBN 4BY1J 2XGCA 5BNGA 3JRCA 2E2IJ 3K7AJ 5HODA 3FIWA 4D5CA 3JRGA 1UHSA 2COBA 3LOCA 1MH3A 3HBLA 4M3EA 4MLOA 4AC0A 3LSJA 4M3BA 1ORKA 5M3MJ 1F36A 4B1RA 5F0CA 1T33A 1W0TA 1ETXA 1UG2A 1TWAJ 3JRIA 3W6VA 4A93J 4Y52J 3Q3SA 2NS7A 3FISA 5E3NA 1ZTRA 5M5YJ 4B4CA 3D1NI 1G2HA 1IUFA 4UUTA 2HXOA 2NVYJ 1FTZA 1TWGJ 2EZHA 4D7MA 4M6VA 2DMNA 3S1MJ 3S1NJ 4LOCA 2HDDA 1ENHA 4A3IJ 1ZR4A 4QTRA 3JRDA 5EDNA 2Y31A 3LSPA 3M4OJ 2YS9A 2M0CA 3MN2A 1JT0A 4MIMA 2DA7A 2D5VA 2L7MP 3JREA 2DN0A 2DTZA 2JA8J 4C3JJ 1XG1A 4FTHA 3S1RJ 4MO7A 4XRSA 1RPWA 2M8GX 2DA1A 5EYRA 5EGOB 1I50J 2XB0X 1ETQA 1K61A 4FCYA 3CCYA 3GTLJ 1QVTA 1Y1VJ 2KT0A 3QQAA 1ETKA 3GTJJ 1IC8A 2GM4A 2CJJA 3LNQA 2LY9A 3A02A 1IDZA 2L9RA 2EBIA 3SDGA 5DTDA 2DMPA 2GLOA 3ZQGA 4DZPA 4BBRJ 3BR0A 3RQIA 5JLXA 5FLMJ 1TC3C 1JUSA 1LE8A 3FKIJ 3FK6A 3RZOJ 3WHBA 2NVQJ 2NVXJ 2WB1N 1ITYA 5IPAA 4BKXA 3DCFA 2EH3A 2VI6A 1X58A 3H0GJ 2HOTA 4Y7NJ 2E1OA 2QF7A 3Q0VA 3BR3A 3S16J 4A3GJ 4RDUA 3HGGA 5E3LA 3S1QJ 1IRZA 2TCTA 4IHYA 1WGXA 2XGDA 1H88C 4XICA 4A3JJ 5C3EJ 2VPRA 3G1OA 3GBGA 2R92J 2EZIA 3B6CA 1PUFB 5F1JA 1IG7A 2YU9J 2MGQA 3SFIA 1IJWC 2JA5J 3ZQHA 5JLWA 1VFCA 4W1UA 4X1EA 1JKRC 3OOUA 1PUFA 2JA7J 1ETYA 2XPUA 2R5ZA 1APLC 1JKPC 2AHQA 1QPIA 4A3LJ 1UMQA 2NOGA 1JKQC 2DA3A 1D5YA 1HOMA 1RESA 1CQTA 2OPTA 2R7ZJ 4V2FA 4UUSB 3VPRA 1MBKA 4DZJA 1S7EA 1K83J 2Y9YA 3TW6A 1MBJA 4FISA 4XIDA 1T56A 4J19A 1U8BA 1H89C 2E2HJ 4I6ZA 3SJMA 1MBGA 1X2MA 4DYRA 2IEKA 4IHXA 2HOAA 3BQZA 3QPSA 3BR5A 1O4XA 2DA2A 3S17J 1HDPA 2P81A 2Y9ZA 1NTCA 5M3FJ 4A69C 2VUMJ 2ECBA 3GTPJ 3HOXJ 2QCOA 1ZK8A 3BTIA 3HDDA 4XK4A 2H8RA 1MSEC 2JN6A 2CQXA 2Y30A 2DA5A 1QRYA 4M3DA 2XRLA 2NVTJ 4L5EA 4MFDA 4C2MJ 4JX4A 4JX6A 2KDZA 3I4MJ 5EF6A 2M9HA 5EG0B 5K7HA 2FJ1A 3LSGA 4FE4A 3OSGA 1GT0C 1A6IA 1H8AC 2LVSA 3BT9A 5EG0A 3MKLA 3O8GA 3S2DJ 2DJNA 3E7LA 1FJLA 1GUUA 3B6AA 5EZGA 3HOUJ 1RETA 1SANA 1P7JA 1WH7A 5FKNA 4HNVA 1IGNA 2XPWA 1Z77A 5F08A 4CYCB 1OJLA 2B63J 2CUEA 5FKKA 4GFBA 1JJ8C 5DS9A 1TWFJ 1E3OC 2DMTA 4A3DJ 1AU7A 3ZOBA 4V2GA 2CQQA 5EGOA 2XSDC 2JMWA 1JTXA 3NAUA 4DYQA 2ME6A 3TEDA 1GDTA 5FLVA 1TWHJ 3C2BA 2CRGA 4A3MJ 2DMUA 1FIAA 4NDLA 4C3HJ 3GTKJ 2LKXA 1GV2A 3BR1A 1OCPA 3OIOA 5FKMA 1RKTA 1FIPA 3BTCA 3L1PA 4A3FJ 3DEWA 2EZKA 4C3IJ 1EF4A 1WPKA 3S15J 5J3LA 3JRHA 1FEXA 1OFCX 2JA6J 3RZDJ 1BW5A 1Y1WJ 2HI3A 1VF9A 1X2NA 5GPCA 2HYJA 1VNDA 3I4NJ 1YRNB 3HOYJ 3BQYA 3G1MA 4A3EJ 1I3QJ 2N8GA 4A3BJ 5GPAA 4RBOA 1ZGWA 1ETOA 2DA4A 1YRNA 1QVUA 2HOSA 2MSYA 2FD5A 2XB5A 5IP7J 1MSFC 1B72B 3S2HJ 1WCMJ 2GBYA 2LK2A 3MVPA 2I10A 1LFUP 5K7ZA 1A5JA 5EZHA 2WV1A 1NK2P 1U9OA 4S0HB 3JRFA 4QSHA 4JX5A 4AUXA 1ETWA 5E3OA 5E3MA 1B72A 2MW8A 3BR2A 3ZQLA 1HLVA 1ETVA 2LD5A 3H3VK 3BR6A 3ZQFA 2MG4A 1Z0XA 1DU6A 5F04A 5M5WJ 1MBHA 1HCRA 3PO3J 2CU7A 1RKWA 3BG5A 2OF7A 2EZLA 3HB9A 5EEAA 2HXIA 5FKLA 4MFEA 2WAQN 1MNMC 1Q1VA 1GVDA 2CUFA 4BY7J 4UUSA 2R5YB 1U9NA 1DU0A 1HDDC 3K2AA 5IOZA 5IYCJ 2HQ5A 2O8KA 3ZQCA 1JTYA 5F0FA 1IV6A 1OCTC 2R5YA 2DA6A 3GTMJ 3IH3A 1XS9A 5C44J 1R9TJ 2JK3A 3TP3A 2W48A 3IH2A 3HKZN 2L0KA 4BBSJ 5IYBJ 2ME0A 1SFOJ 2XGEA 3JRBA 4A3KJ 1JUPA 2PMZN 4JP0A 3GTQJ 5F27A 2LFBA 2Y0SN 2G0EA 1LFBA 1MH4A 2LR8A 3CMYA 1JUMA 2K40A 1GV5A 2L7ZA 1IDYA 5IYDJ 5FJ8J 2ID6A 4I76A 1XC5A 2E19A 2LTPA 3GTOJ 2ZB9A 2X6OA 3CDLA 1BJZA 1TWCJ 3GTGJ 3O8HA 3JR9A 2K9SA 1JGGA 5K7FA 1NK3P 1MBEA 3Q0WA 1MBFA 3M3YJ 3BTJA 3ZQIA 1WH5A 3QPLA 2NS8A 4XRSG 2AO9A 3G1LA 2IAIA 2JJ7A 4ABZA 5J1RA 4XRMA 3A01B 4DYCA 5IOYA 1BL0A 4CYCA 1JT6A 4JYKA 1W0UA 3JRAA 1AKHB 3A01A 4BXXJ 1HF0A 3NARA 5M5XJ 3UKGA 3HGYA 3BG3A 2M2EA 1AKHA 2O7OA 2VKVA 2E2JJ 2RAEA 1P7IA 2XPVA 3PO2J 1ZQ3P 4IHVA 3Q0UA 4M3GA 4D5FA 4QIWN 4DW6A 2K9NA 4D7NA 1U78A 2JWTA 4IEJA 1JJ6C 1AHDP 5IP6A 5GP9A 2X48A 3IV5A 5J1YA 3RKQA 3HOZJ 3BG9A 2Y2ZA 1BW6A 2ECCA 1ZKGA 3HM5A 3WHCA 3LSRA 1LE8B 4IHWA 2M34A 1F43A 4B3AA 3A03A 3F0CA 1RR7A 2ID3A 3CQZJ 3TP0A 2FQ4A 2DMQA 5IP9J 5J1UA 3IH4A 1ZR2A 2LP0A 4FE7A 5F0HA 4A3CJ 1WI3A 3HOVJ 3OSFA 1FTTA 2EQRA 3S14J 2X9DA 4EEFG 4G12A 9ANTA 3HOWJ 1JKOC 2FX0A 2H1KA 3BTLA 2L7FP 1B8IB 2LLKA 1POGA 2K9QA 3PM1A 2R0QC 2VKEA
chains in the Genus database with same CATH superfamily
2TRTA 1QPMA 4ZYDA 3F9KA 1JE8A 3PJRA 5FKOA 3E3VA 2WAFA 1BI2A 4X6AJ 3DPTA 4AYBN 4BY1J 1BM9A 4O6JA 3ESWB 5E1WA 1TW2A 3K7AJ 2W7NA 3EETA 1F4KA 5D4RA 3E5XA 3FIWA 2KPMA 2WAQA 4RGRA 2K3PA 3JRGA 1TLHB 2LF7A 3VEPA 3LOCA 4M3EA 2B9SA 3HBLA 5K5QA 4BEHA 4CCOA 1ON1A 2ZMEC 5ICCA 4AC0A 2AXLA 3DEUA 5CVUA 1U2WA 5M3MJ 3U2RA 4B1RA 2OQRA 2HWVA 2V9VA 1UG2A 4HX8A 1TNSA 2E1MC 5IT9K 1VQ4I 4KT5C 3R0AA 4Y52J 5IY5H 3DBRB 4MTEA 4L0ZB 3FISA 3VYSB 5E3NA 2CGPA 2XIGA 1S9HA 1G2HA 1IUFA 2QQ8A 5ED4A 2FOKA 2X6XA 5DCMA 5B5EC 3Q9VA 1F1ZA 3KEOA 4M6VA 2DMNA 3KZZA 2BVMA 1HW2A 5GAGJ 4ITVA 4EVIA 3S1MJ 5HLIA 2X1CA 1MDMA 2UWMA 4LOCA 3W2WA 1SVMA 1ENHA 2HFHA 2ETHA 5TGTA 1IXSB 1UAAA 3EUHC 2Y31A 2IGOA 2XF6A 3R4KA 3M4OJ 2YS9A 3DF8A 4Y13A 3K4JA 4A0XA 3FX3A 3HTUA 3GMEA 1FOYA 2DA7A 2D5VA 4KJZA 4L18B 1XSDA 2DN0A 2DTZA 1B1BA 3FMQA 2JA8J 4S04A 4C3JJ 1R5ID 2WA0A 3C1DA 3FXKA 4E6KG 4LG0B 3QOEA 2W1OA 3S1RJ 3A4CA 2E1NA 5E1ZB 2F5VA 4NQWA 5LEJA 3L9FA 5EYRA 5BMZA 3B02A 2HR3A 3WTSC 4ZZDA 2M4KA 1I5ZA 2XB0X 4LK1F 1V5FA 3SDBA 4G7HF 4M73A 3P7NA 3CCYA 3GTLJ 2IA0A 2PMUA 2HPIA 4LITA 5FO5A 4EMSA 1ZLKA 4MTDA 2DK5A 3GTJJ 1YW8A 3CMAI 1A35A 3K4MA 3HPHA 1I3AA 2V7FA 4IJAA 4XLFA 3SDGA 2O0YA 3IRRA 3G73A 2X0LA 3MKYB 3SZGA 1LE8A 3ZP5A 3KYDB 1HKSA 2H6BA 2E5ZA 3F8FA 2CQNA 3KP6A 3DCFA 4ESFA 1F5TA 2STTA 2HS5A 4I99C 2O5RA 3Q0VA 4KICA 4L9JA 4CO8A 3F22A 1VQOI 1ZRDA 5KAFC 3HGGA 2MFZA 5E3LA 3F21A 5DM6F 1Z6RA 3IHUA 3S1QJ 4PJNA 3BDDA 4K2EA 4B3XA 2RV8A 5FLXZ 1XCBA 3L2CA 4I09A 4XICA 4A3JJ 3K10A 3CCQI 1A31A 2R92J 1U5TB 2EZIA 1PUFB 2DPUA 3QOPA 4CYDA 3ECHA 3G71I 3C2GA 5J4VA 5JLWA 2VJJA 3D5LA 2C6YA 4JBAA 2V4JC 4KIGA 1JXSA 2ZNZA 2AHQA 5J8CA 4Y33A 1UMQA 2Y69H 1ZHFA 4BXFA 1D5YA 1EH8A 3I9V2 2HDWA 3LL7A 4KNYA 1DQUA 3E6MA 3U1KA 4KMUX 4UUSB 3GLLA 2JT1A 1TTYA 3DTEA 3DPLC 4DZJA 3EUKL 3TW6A 1H89C 4BJTA 1O3SA 2V1XA 1S6LA 4DYRA 3V7RA 4F52A 2IEKA 2HOAA 3BQZA 3BR5A 5CQGA 6PAXA 3FZVA 1HDPA 1YTYA 5ILUA 4A69C 2VUMJ 2L9NA 3OWTA 3HOXJ 2Q2EB 4CZCA 2HYFA 2HKOA 3GF2A 2KDOA 3H92A 3K4NA 4M3DA 2ELJA 4MFDA 4C2MJ 5DD4A 2NRAC 1ONVA 1HSJA 2QLZA 4I0BA 3OYKA 2EWNA 2MH9A 3WU2C 1G8XA 3RTRA 3LSGA 4FE4A 5FGMA 2EK5A 3OSGA 1GT0C 3EYIA 3C7JA 1P4XA 2DCEA 3E5UA 5CLSA 2D1HA 2QZ8A 3MKLA 3I56I 1E17A 2DJNA 1X19A 1GUUA 1S8NA 2XAUA 2PJPA 2M30A 4XLHA 3GYHX 2XAFA 3AKZA 3IKVA 2QEXI 4ZTFA 1Y8RB 4OAYA 2E7XA 3BCBA 1BC7C 2EPFA 2BBYA 2CUEA 4PFOA 1JJ8C 4E7SA 5E18F 4NUBA 1E3OC 1TP4A 2DOEA 2ICWG 4EV0A 3ZOBA 3CP8A 4EJWA 4XN3A 2R7RA 4J00A 3HOTA 2UZKA 1GDTA 1BN5A 5FLVA 3MZ8A 3TMOA 1D3YA 3QP6A 4A5NA 5HNFA 3EDPA 3K70C 1J2XA 4UVBA 2LKXA 3BR1A 3D0SA 4YIRX 4KUMA 1OCPA 3OS2A 3SQNA 4CCKA 4MNUA 1FIPA 4RM3A 2KP6A 4UVAA 2EZKA 4C3IJ 1OYIA 3R61A 4G94A 3CJNA 2VQCA 2VXZA 3MWMA 4OIRF 4OAZA 4PSWA 1BR2A 1BW5A 1P2FA 2G7UA 4GRIA 2EFWA 1USSA 2WY8Q 3QYEA 2KRHA 5LGNA 4IO9F 3TDZC 5J8FA 4B8XA 1LEBA 4QLCU 2M7AA 1YRNB 3HOYJ 3ABLH 3G1MA 4A3EJ 4F55A 3M1CA 2KFDA 2N8GA 5E8GA 4PJLA 1MMNA 3F8NA 5GPAA 1YW9A 4CCJA 2DA4A 3KETA 4DBRA 5CKTA 3T1BA 5IP7J 3V7CA 1MSFC 3S2HJ 2LK2A 3RCOA 1I1SA 2DYSH 5EZHA 2AQFA 3LQRA 3LMMA 2G7HA 3AG2H 1DPRA 2NAZA 4S0HB 3JRFA 2DOAA 4QSHA 4U88A 4ZTJA 1PDNC 1R23A 4A5MA 1E2XA 2IS6A 4ZZLA 3BR2A 2ADUA 1O3RA 1P4AA 1HLVA 3HUGB 3BZKA 1ETVA 1KZHA 2LD5A 3H3VK 2W82A 2D2WA 1HC8A 1U5TC 1DGWY 2LKSA 3QP5A 3K70D 2CU7A 2FBHA 5EEAA 1MNMC 1PYVA 1Q1VA 3FXJA 1PP7U 2R5YB 1SD7A 1G3TA 3NEUA 4DGWB 1YIJI 2HQ5A 3GCMA 2XF7A 5F0FA 3HL2A 1V4RA 1YITI 2FNAA 3R60A 2R7SA 2MLGA 2DA6A 3OIQA 4RB0A 1TT0A 1ZYRF 4KISA 3IH3A 5FRNA 4PSXA 5ILSA 2ZXIA 4XLNF 2HNHA 3DQVC 2W48A 3ELKA 3IH2A 3HKZN 3JSOA 1STZA 3QPHA 2F4MB 2CV2A 4AVZA 1H0MA 1SFOJ 3CO6C 4A3KJ 2MD0A 3GTQJ 3OYGA 1Z7UA 2DO7A 2LFBA 4BH9A 2CWEA 2Y0SN 1TBXA 2LR8A 5DCMB 1QNTA 2CQ7A 2K4JA 2WC2A 5D4SA 5D5WB 1JUMA 3ABTA 2K40A 3A2KA 3M8EA 3VDXA 4BL0B 1MJBA 1FMWA 4LB5A 1XC5A 2K3FA 3ZN0A 2VOOA 4J01A 1WJFA 4II2A 3GTGJ 3M8FA 4ZYAA 3MZYA 3ASNH 1MBEA 1A6QA 3Q0WA 2M8EA 4HSTA 3BTJA 3M3YJ 1ACIA 4CXFA 3HZJA 2NS8A 5J47A 4AWXB 1HSTA 1KU9A 3G1LA 5J1RA 4XRMA 2Z3YA 3ZMZA 3A01B 4CHUA 5CPRB 2KKOA 2ZO4A 2A69F 1LDJA 4CYCA 2ZJRF 4JYKA 1LUJB 5FD5A 1FLIA 3TKYA 3H9QA 3NARA 4IVNA 3UKGA 4HDVA 5D5XB 4E7LA 2JA2A 2DFIA 2PMHA 2O7OA 2VBYA 4ZDLA 4CCNA 3TOAA 4YG2F 3AL0B 1P7IA 2QWWA 3PO2J 3HRUA 3IWZA 5KHDA 2VC1A 5KK1A 4G6DA 4DW6A 5J6XA 5KCMA 4OIQF 1KQ9A 2PBIA 2CS3A 2FRHA 4A6EA 1T38A 1MJ9A 1ON2A 3TO6A 4YRVA 2BW3A 1X1PA 4H4KC 4P5OA 1EJ9A 2Z1DA 1LE8B 2M34A 2XKOA 4CCLA 3J7AY 3IAM2 1QZYA 3KE2A 3QYFA 1YI2I 1YJ9I 2ID3A 2XRNA 5IP9J 4BQAA 4C2TA 2IS4A 3HSEA 5KVRA 4FE7A 2JPCA 5F0HA 4A3CJ 4A0YA 2F5FA 2PQ8A 3ISPA 2JVHA 3VB2A 3KIOA 3S14J 2RGVA 4EEFG 9ANTA 2EA4A 3IUOA 2VLAA 2OTJI 2CYYA 4M6YA 3L2UA 1WFXA 2OD5A 4A0ZA 2FX0A 1SC7A 4E7ZA 4M74A 1N77A 1B8IB 3LAPA 2LLKA 2K7LA 2K9QA 3WU0A 2A68F 3PM1A 4I7HA 1R1UA 2IBDA 3I53A 4ZYHA 3HEFA 3TW7A 2ELKA 2YUSA 3FK7A 3JSPA 1BA5A 5AONA 4W97A 4HV6A 1D1BA 4HX4A 1YW7A 1SFXA 4NC6A 4B48A 4IRIA 2GA2A 3C18A 1B59A 5BNGA 2E2IJ 2MC4A 2ZCWA 2DPDA 3I5UA 5E8IA 1X1CA 1PJRA 3MCZA 3BPXA 4IHSA 4D5CA 3DEEA 1RR8C 2A5WA 1Z67A 3GVAA 1BBYA 4CH7A 4KN4X 3LSJA 1ORKA 2RDPA 2VE8A 1Z91A 3J7YJ 1B9MA 2IGKA 1HKQA 1T33A 2I8DA 1XMAA 4XSZF 1TW3A 3MAJA 3ZR8X 3CC4I 2ZFWA 1LJ9A 2FA5A 1XCVA 1O7FA 2PFBA 3Q3SA 3VSKA 4F3QA 2KL4A 2DYRH 3KYLA 2CW7A 3PNYA 2LY1A 2GOMA 2B0LA 3D1NI 2W84A 2M1BA 3M1EA 2HXOA 2NVYJ 4PK4A 2QSHX 4CGZA 2EZHA 5H20A 1OLTA 3TDUC 3K2ZA 4A12A 1WJDA 2FF4A 1W7PD 4HNTA 5GTHC 1LB2A 1RIOH 2GQQA 4PFPA 4QTRA 3LSPA 2K85A 4BUPA 3S93A 3HRTA 1N25A 2LG4A 1W5TA 1LKXA 2ESHA 1Q1HA 4RAZA 1IRFA 2QQBA 2R7QA 2X51A 3F3XA 4GCVA 4UB8C 1OCOH 4KDPA 2ZXHA 1D8KA 3FXUA 3WTUC 1XG1A 3V4GA 1XGSA 2K86A 1R7JA 4YFKF 2GXAA 4HRIA 2CG4A 3RSNA 2H1LA 2PLYA 2FNPA 3RPQA 2LKPA 5D8KB 1VZ0A 1X1DA 1ETQA 4GYGA 4CSWA 4QPOA 2V9KA 1NG7A 4R8HA 3SYTA 3W6KB 3WGHA 3PNTA 2EIJH 3QQAA 2HGCA 2MD5A 2DDAA 2CJJA 2IA2A 2X6YA 4IPAA 4RLQA 5BPIA 3OYJA 4Y4RA 3AG4H 2GWRA 2L9RA 1K4SA 1UHMA 2LSOA 2EINH 2L5QA 1Z1DA 1OMIA 3RJPA 5DTDA 1E0EA 2BY0A 3DKWA 4FX0A 3ZQGA 3E0JB 1D1CA 4BBRJ 5F6FA 4DZPA 3AL0C 5JLXA 2VPLA 2JPBA 3BJOA 2EFOA 2K27A 5A2QK 1LVAA 3ML6A 1ITYA 2MABA 2HOTA 2E1OA 2QF7A 3BR3A 3SXYA 3PL8A 5TRDA 2QA4I 2TCTA 3V8JA 3L09A 1WHUA 2XGDA 1XGNA 3FXOA 1FNNA 2E60A 1WJEA 1I39A 5C3EJ 3G1OA 3GBGA 3HYIA 2FOWA 3DTKA 3I58A 2YU9J 3SFIA 3OYHA 2JA5J 3ZQHA 1EA3A 4RGUA 1VFCA 3FMRA 1XDSA 4W1UA 4X1EA 1GHCA 1DUXC 2R5ZA 2XPUA 3FXLA 4XN0A 1APLC 2R7XA 2UXXA 3KZYA 1JKPC 1QPIA 4A3LJ 3I4PA 3N97A 2NOGA 2A05A 2DAOA 5DUIA 3K4CA 4E7JA 1HOMA 2R7DA 4AYBA 4P9UA 1VQNI 4X0GA 4E7IA 1X3UA 1CQTA 2R7ZJ 2L2OA 2V79A 1XD7A 4I02A 2Y9YA 4FISA 1FP1D 2IXSA 4I6ZA 4YIIA 3HJEA 1WJ5A 2VKDA 1X2MA 4RB1A 3OYDA 3DKYA 3TL4X 1D0XA 1J09A 2FMYA 2OZUA 3IP4B 3TO9A 2QKLB 3QPSA 3J81K 2DA2A 3MFKA 2A3SA 3PIOF 5LBQA 2BYVE 2H6CA 2VL8A 3CCEI 4UXNA 2IPQX 3GTPJ 1G59A 2XASA 1ZK8A 1JGSA 1FYLA 4XK4A 1MD0A 1ZG5A 2Y30A 1USTA 1YS6A 1SD5A 1T98A 1YIOA 2XRLA 1YJWI 4JX4A 3BZ6A 3OYFA 2KDZA 1NHAA 3I4MJ 2Z2SB 1O7LA 3T8RA 5EG0B 4MEXF 1T8IA 2XROA 1UG0A 1CF7A 2BEOA 3K69A 5FFZA 1SFUA 5IT3A 1J7KA 1H8AC 1VQPI 2LVSA 3TBIA 1XSXA 2LDUA 4XONA 2RKHA 5H6RA 2Q0OA 2HPMA 2CUZA 1P4WA 3SEZA 2K9LA 3E7LA 4BJ6C 4OINF 2R4GA 1N78A 3CCVI 4WXCA 3JCUC 1KA8A 1SANA 1P7JA 2VT3A 4UV8A 3CDHA 2LREA 1WH7A 4KMFA 2COMA 2YPRA 4B47A 1RRJA 2IGMA 1FWZA 5F08A 4CYCB 2E71A 1FX7A 2B63J 2L4AA 3HG9A 2DFFA 4CICA 5DS9A 2QKMB 2DMTA 4A3DJ 3TGNA 4IZZA 4HZFA 3RI4A 4CA0A 3NAUA 2QQ9A 4GO1A 5J40A 1LEAA 3C2BA 3I0TA 2UV1A 5E1XA 3L2QA 4OWRB 3F6VA 2BZTA 4RM2A 2DMUA 4NDLA 4C3HJ 5L3BA 5HNHA 1AWCA 2PI0A 5HLGA 4O3MA 2CW0F 1FSHA 3S3OA 2DT7B 5FKMA 3JTHA 4G6TB 2CMPA 4HG2A 2KQRA 2DT5A 3GW2A 2BW3B 1NH3A 2YR2A 1A36A 3HPGA 4BE1A 1WPKA 3GO5A 3S15J 1FEXA 3RZDJ 2XHKA 3RDIA 1YOVB 1W4MA 5GTIC 4GGGA 4HYEA 4UVCA 2HYJA 1L3LA 1WZ2A 3I4NJ 1VQMI 3E6BA 3CJRB 4DQ2A 3HTSB 3BQYA 3QODA 4A3BJ 2VJ5A 5DV5A 1FBUA 3A0HC 5EEGA 3KP5A 1HQCA 2V6CA 2Z99A 4ESJA 2STWA 3H5NA 1WCMJ 2GBYA 3BZCA 3MVPA 1LFUP 1ZREA 5K7ZA 1NK2P 1QHGA 1U9OA 5L3DA 2GXGA 1Z7LA 2H09A 5E3OA 1B72A 3M8JA 4IKFA 1H9GA 2F5CA 5ICGA 4AU7A 5HDKA 4P9FA 3KFWX 3P5JA 3OY9A 1DP3A 1MMGA 3BR6A 3BY6A 2JRTA 3E6CC 4DNCA 1DU6A 3VOEA 1B6AA 2EFNA 3DP7A 2OF7A 1WJCA 3HB9A 3E6DA 2TDXA 4MFEA 5JHUA 4E70A 1U9NA 1DU0A 1HDDC 3AG1H 4TV7A 4O5VA 1QZZA 3K2AA 3GZNB 5IYCJ 4AIKA 4BGDA 1KU3A 4FX4A 1I1GA 2O8KA 3ZQCA 1JTYA 1OCTC 1GXQA 3BP8A 2EV0A 3GTMJ 3BROA 3D5SC 1O57A 3MKWB 1XS9A 5C44J 3OYCA 2JK3A 2W57A 3K6GA 1AOYA 2LMDA 5B66C 3H3UA 3REOA 5IYBJ 1FYMA 1UJ8A 4HV5A 5HOOA 1YYVA 4HSRA 4HNUA 3MMYB 2W00A 2M87A 1Z3YA 1UELB 5LRSA 1SD4A 4H0EA 1KYZA 1IAWA 1FPQA 3PNVA 1GV5A 2A61A 3KPHA 2VIXA 2JRMA 2W4SA 4IXAA 3IAS2 1W5SA 2LTPA 3GTOJ 2X6OA 1BJZA 1TWCJ 2P0WA 3O8HA 2XKPA 3JR9A 5LHIA 5K7FA 1A04A 2FBIA 3LA2A 3J80K 2YX4A 3M07A 5H6QA 2OA4A 3WTZA 3ZQIA 3HIFA 5ILVA 4LIVA 4YELA 4KIFA 4MGRA 4PJMA 4P1WA 2PJRA 2GZWA 4WCGA 1IRGA 2JTVA 1X1BA 4I0AA 3UR3C 3ZRGA 4KITB 5HDNA 2RC4A 3IKTA 2QM3A 2L9VA 3N4MA 2RNJA 1MNDA 1UZCA 3GXOA 1BL0A 1JT6A 3CCJI 1AKHB 1K78A 2RN7A 2AQEA 4KFCA 3PUFA 4PJJA 2ZNYA 3VWBA 3OMYA 3SZPA 3TQNA 3WE3A 1WI9A 4U7DA 4E7HA 2E2JJ 2LBFB 1LQ1A 1R6RA 2XPVA 4IHVA 3Q0UA 4LGWA 2HVSA 4QIWN 4FQGA 4D7NA 2JWTA 1AHDP 5LLQA 2Z16A 4KN7X 2X48A 1WJAA 2W24A 3CCMI 3M9AA 1IN5A 3EPZA 2K5CA 4WXHA 1MZBA 4FHTA 1SVOA 1IV8A 2VC0A 2WB1A 3HM5A 1U0JA 2EFQA 3PQJA 2XAHA 3WHCA 5K5RA 4B3AA 4IHTA 2R7TA 2HVRA 2W25A 1YE9A 1W7PB 4XR6A 1MNEA 2OCCH 3KEQA 4L9TA 1XTAA 3CJTB 3S2WA 1E3HA 2FQ4A 3RQ4A 2DMQA 3U21A 5JVTA 3KX2A 1O3TA 1SMYF 3VYRB 2LF8A 3KCCA 1XDUA 4XKVA 4XBFA 1UFMA 2WADA 2EQRA 3F8CA 4G12A 5JVGF 4IQ4A 4LLGF 2H1KA 1FOWA 1POGA 5BOXA 2OBPA 2M45A 1TQIA 2EB7A 1EH6A 2GAUA 1V55H 1T2KA 2R0QC 1ZGAA 2HVQA 1MW7A 5C4JJ 2R5ZB 2R93J 1I6HJ 1FOXA 2IS2A 1ZH5A 4M3FA 1GLNA 5D5VB 1VI0A 5DCFA 4HAMA 4XOPA 3TOBA 4UY8I 3SZTA 4BEHB 4OOIA 2XAGA 3JRCA 1PVEA 2ZSIB 5IT9Z 2JUGA 3V8LA 4Z2YA 4U0VA 2VONA 2CUJA 1UHSA 3ZQQA 1S7AA 2ZJ2A 4MLOA 4M3BA 4C30A 1BR1A 3ONQA 4HBLA 1Y8QB 3I3LA 4N4NB 5F0CA 4XL9A 3PIPF 1OKRA 2NOJB 3KLNA 3JRIA 3EUAA 1OISA 1R00A 2WTEA 5LHHA 3S3NA 3HKZA 1R36A 3W6VA 4RGXA 2ZFUA 1XMXA 3GFLA 2NS7A 1FP2A 2AXTC 4CUGA 1ZTRA 4MQVA 4RAFA 5M5YJ 2VASA 2DLLA 4RB2C 2JUCA 1GXPA 3T8TA 1SVLA 1MDMB 4GDFA 1FTZA 4N9IA 3LQQA 4D7MA 1G6NA 4ESBA 5F1RA 4IRGA 1TNTA 2E34A 2GIZA 2AS5F 3FXRA 3RPUD 2QVOA 3LSMA 4ZYGA 1MJAA 2D1VA 4M9SA 4A3IJ 1ZR4A 1FYKA 4BU2A 3JRDA 5EDNA 4XLPF 1MMDA 1JT0A 5KAIC 3JREA 5LEKA 4CCMA 4NQWB 4AD9A 4M9ZA 4E7KA 1D0YA 2JQ7A 3NQOA 1IRXA 4AIHA 4HEA2 1WKMA 3H5AA 3O6BB 4MO7A 2O03A 1RPWA 4U7BA 2K9MA 1LFPA 2IA1A 1LDKB 2QSGX 1WWXA 5TJJA 4NC8A 3DWLE 2FE3A 4R79A 2HQRA 4PGHA 3BC8A 2A5YB 1D8JA 2HU9A 1GVJA 2P6TA 1QVTA 1Y1VJ 2KT0A 5HDGA 4IX7A 1ETKA 1P9QC 3CDIA 2OUMA 2GM4A 4Y3OA 1ZELA 2LY9A 1YFHA 1Z9CA 2KIFA 2O3FA 2OC6A 4LG3A 2EBIA 2F5EA 2DMPA 4II3A 3RQIA 1KU7A 2EV5A 5FLMJ 3LSIA 1MKMA 3FKIJ 2F4OB 2IGNA 3RPUA 4Q47A 5FD6A 2A6HF 3WHBA 2NVQJ 2DFHA 1ODDA 5IPAA 1VQ8I 2JVGA 2EH3A 2LH9A 4EGZA 1X58A 3FHNA 3X2QH 4RB3C 1ZARA 5D5UB 4FETA 2KISA 3S16J 4RDUA 1OYWA 5H2FC 2J5OA 1IRZA 4IHYA 3ZQ7A 2P5VA 2Y75A 3K0LA 1KYWA 2BY2A 4XKBA 2R7WA 3B6CA 5F1JA 1D1AA 2EJRA 2MGQA 2RNGA 2ZSHB 4WF2A 1IJWC 5L3GA 4B43A 4BDZA 1OQYA 3KZIC 1PUFA 2M0MA 2JA7J 4NNJA 3KP7A 1SFEA 2D45A 2NS0A 1QGPA 1RESA 1J0RA 1FC3A 5CVVA 1VQ7I 2DDBA 2L4MA 2KRFA 1ULYA 3QWLA 4L5JA 4BHPA 1MBKA 1TL8A 2L02A 1SFKA 3R6SA 1S7EA 5CVRA 4J19A 1MBJA 4I01A 1B9NA 1T56A 4XIDA 2ZC2A 1U8BA 2X4HA 4V19K 1ERDA 4M6XA 3V42A 3SJMA 1MBGA 4KIBA 4YIFA 1OYYA 1R49A 2EIMH 3BG7A 3W3CA 1VQ6I 3E97A 4IHXA 1O4XA 3H5RA 3QU3A 3P9IA 2PMZA 1NTCA 2Y9ZA 1LPQA 2ECBA 2VQGA 1WSUA 2QCOA 2KZGA 1V5EA 2JSPA 1HBXG 2KJBA 2H8RA 1MSEC 3G6EI 2JN6A 2CQXA 2F4IA 4OU0A 2DA5A 2CV0A 1QRYA 1LVKA 2XV4S 5DYMA 2HZTA 1LDDA 3WODF 2NVTJ 4AIJA 4F93B 1ZG3A 3RYRA 2LOOA 5JHFA 2CO5A 3I64A 2OTLI 3H9GA 1A6IA 2RQQA 1JI8A 4HQMA 1XPXA 4PGGA 3T5XA 1Y0UA 4IQJA 1S7OA 3ERMA 4HF1A 2XDVA 3DV8A 2BXYA 1R1TA 1X4OA 1ZAOA 2RQPA 2HQAA 3GWZA 2L7KA 2ISYA 2R7OA 5B1BH 3B6AA 5EZGA 3HOUJ 1RETA 1BOBA 3E1SA 3I54A 3BJAA 3V7SA 3CC7I 2PJRB 2H94A 1J5YA 2ESNA 3FKJA 5E20A 5FKNA 4HNVA 2Z33A 2XPWA 3ERED 4EM0B 4LK0F 3HSRA 1OJLA 2FMLA 5FKKA 1L0OC 3QPTA 1M1EB 1K78B 4GFBA 1TWFJ 1T08B 1HKTA 4N0BA 2CQQA 5EGOA 1EV7A 1R58A 5B3SH 2F6CA 4DYQA 2ME6A 4ZYEA 5LFAA 3TEDA 2ZJQF 4EQQA 1K4TA 5EEHA 4L5IA 4XLEA 2CRGA 5EJCA 4A3MJ 3OIPA 3IWFA 1WRJA 1PUEE 1FIAA 3GTKJ 1XGMA 1QBJA 1GV2A 3CCUI 4U87A 3ABUA 4L9VA 3WGGA 3OS0A 1RKTA 3CESA 1FMVA 3BTCA 3L1PA 4I2OA 2GXBA 1YQAA 3CTAA 1G3WA 2EIKH 2CH0A 2M7BA 1REPC 3FWEA 1OR7A 3DFGA 4NB5A 2KJCA 2RVCA 4L9NA 1QO0D 1TQMA 4F91B 2V6EA 5J3LA 5KNLA 3JRHA 1OFCX 2VT2A 2JA6J 3K1PA 1VQ9I 1RI7A 1Y1WJ 2HI3A 3SHFA 2DOFA 1VF9A 1XSVA 1EKEA 2O8XA 5BS6A 4A6DA 1X3WB 2G9WA 3ZCOA 3IC7A 4P96A 1X1AA 2XSJC 3FM3A 3BJ6A 1RC9A 4RBOA 2HZDA 1ETOA 3FM5A 1YRNA 4XKWA 1QVUA 4KYWA 5FRMA 2MSYA 1HW5A 2FD5A 3JAMK 3GFIA 1DP7P 2I10A 1A5JA 2WV1A 3CZ6A 5DEQA 2FEZA 4RAGA 4L0YB 4LJZF 1ETWA 2MW8A 4HW0A 3ZQLA 1OPCA 1HW1A 4M71A 3ZXSA 5HLHA 3L2WA 2VODA 4ENJA 3ZQFA 3OYIA 2MG4A 3QAHA 4ZDOA 1NG6A 4LFUA 1Z0XA 4BJ5C 5F04A 3AAFA 5M5WJ 3A0BC 3ULQB 1HCRA 3PO3J 4PCQA 1X3ZB 1RKWA 3HUGA 3KEYA 1IUYA 2WAQN 5DD8A 2CUFA 2QGUA 4BQQA 4EJVA 3FHZA 4Z6YA 3OYAA 5IOZA 4RGSA 4LD5A 1JHFA 2K02A 3ABKH 3G4SI 1U3EM 1IV6A 3OYLA 3GFJA 5JI6A 2R5YA 1Y39A 3GFMA 1AA7A 1W5CC 2RREA 3QU6A 4A2UA 1TT5B 1IO2A 1R9TJ 2MH2A 2VBXA 5LRRA 2GIVA 4OMZA 3JRBA 5J4YA 4JP0A 4GXOA 2NXNB 3I59A 4RMNA 1MH4A 2L54A 3CMYA 3KLOA 1IDYA 2M5WA 1S3JA 5IYDJ 4LLNA 5D6FA 3GZ5A 2ID6A 4BXUA 2VBWA 1V54H 1YO5C 2E19A 1ZRCA 3IL2A 2CFOA 2IJLA 5DUKA 5HS8A 3RKWA 1X4PA 3S3MA 2ZB9A 1BOAA 4JK1X 1W36C 2K9SA 3FF5A 2H27A 2FXAA 1MBFA 3ZMUA 2OAZA 1WH5A 3BWGA 4C9YA 4BE0A 3DU5A 3P9KA 1FZPB 4XRSG 2AO9A 5FROA 3G2BA 2BV6A 2JJ7A 4ABZA 2QQAA 5CYVA 1IXRC 2IRFG 3HOSA 1J59A 2QBYA 4OIOF 4WWCA 1SEUA 1R22A 1Y56A 5TISC 3JRAA 3OYEA 1YX5A 3H35A 3A01A 2XC7A 3GZ6A 3CMEI 4BXXJ 4EJUA 1FOKA 3HGYA 4IOCF 1VQ5I 4HF2A 1UB9A 2LRDA 2XF5A 2RAEA 1XGOA 1DGRM 3HXLA 1U6GA 3LSHA 1ZQ3P 2FQ3A 2EFPA 1T0FA 1ZN2A 2KIUA 2OJED 4M3GA 4G7OF 2K9NA 1YJNI 5HLTA 4IEJA 2K4BA 1PP8F 3OL3A 3CUQA 2DFEA 5IP6A 3IRQA 3LFUA 5J1YA 2M3AA 4OMYA 3L2VA 2VE9A 3WU1B 1IF1A 2ECCA 2KHMA 1HXDA 2KLOA 4HOBA 3CJQB 3LSRA 4IHWA 4NHJA 1F43A 2ACJA 2QYOA 2QUFA 1K7AA 3A03A 3EYYA 3F0CA 3GLXA 5F64A 3F8BA 2VOPA 1W36D 5HVQC 4ENMA 4BS9A 1B4AA 3IH4A 1ZR2A 2LP0A 4EM1A 4YEJA 2DU9A 3WG9A 5HS9A 4XRFA 3CCSI 1WI3A 3HOVJ 2MC3A 2BE5F 2IW5A 3WTVC 2X9DA 3OS1A 2R3SA 2Q1ZB 2UUZA 3HOWJ 3TO7A 1JKOC 3K4LA 2CV1A 4U0YA 4ZDPA 2V1DA 3BTLA 2L7FP 2DJIA 1KGSA 2BHYA 1FBSA 2YSRA 3H1CA 3DBLB 3DKXA 2VKEA 3J7ZI 2ISZA 1MIJA 1KQ0A 2FU4A 5DDGA 3HC7A 2ZMEA 3SFZA 1B8IA 2DBBA 2O9LA 5C4XJ 2ZBKA 3R0JA 3ZMTA 2HEOA 3OYMA 1K79A 2MBFA 2XGCA 5HODA 3KP3A 1YG2A 2V1NA 2Z9OA 2FSWA 1EH7A 4C2UA 1R71A 3ZPLA 2COBA 5FFXA 1MH3A 3B73A 5BPDA 4XLCA 3QRFF 2DXIA 1RUNA 3CLQA 4MEYF 1F36A 4KT6A 1W0TA 1ETXA 4M9XA 1T39A 1TWAJ 3A1YA 2IS1A 4HQEA 4WK8F 1W1WE 4D1QA 4A93J 2OZ6A 3CUOA 4HPQA 2MA3A 3QYBA 4B4CA 3HHHA 3EUHA 5L3EA 3CO7C 3K1MA 4UUTA 1RZ4A 4HLYA 3H3ZA 1N75A 1IN8A 1TWGJ 3L00A 4IL6C 2R7UA 2BVLA 2Q8KA 3S1NJ 4RS8A 4R1HA 3ZN1A 2HDDA 3LA3A 1Y0NA 2OV7A 1R5HA 2QSFX 3PFYA 2ZKZA 1XX5A 3O3KA 4D9JA 2DQLA 2M0CA 1FBQA 3MN2A 4MIMA 2E1CA 3LWFA 2L7MP 5HS7A 5D6EA 2X85A 3OR2C 3VYTB 2A6EF 4HF0A 4BACA 4FTHA 1XB4A 2P5KA 2JSCA 3PSFA 5D8LB 4XRSA 2M8GX 2DA1A 1G3SA 4XKCA 5EGOB 1I50J 3ZGKA 3FBNB 1QHHD 2ZJPF 2BHZA 5LGUA 1K61A 4P55A 1G4DA 2GA1A 1KONA 4FT8A 1BI0A 4HLXA 4FCYA 4XOTA 2MYSA 3BPVA 1R4NB 4B09A 3AG3H 1C0WA 1IW7F 4JOMA 2A07F 1IN6A 4PZJA 1BIAA 1IC8A 2HTSA 1UCRA 5A2QZ 3H36A 1SD6A 3ZMSA 3VSLA 3NWTA 4EJOA 3LNQA 1MMAA 3A02A 1IDZA 1YS7A 4BHCA 4OIPF 4G8XA 1V5GA 3J7AO 4UV9A 3BLYA 3BOQA 2GLOA 3S8PA 1K6OA 1SMTA 3BR0A 3MZHA 2VB6A 2Z5UA 2O6GE 1TC3C 1JUSA 2CSOA 2HOEA 1IZ1A 3FK6A 3RZOJ 2O61A 1H9TA 1WJBA 2WB1N 3MKZA 2NVXJ 4BKXA 4XNFA 2VI6A 5FB2A 2V9PA 3H0GJ 2LYCA 4F7ZA 4Y7NJ 5DM7F 2W85A 4UHTA 1QU3A 4HX7A 5JFRA 1P6RA 4A3GJ 1Z3XA 4I98B 3VYUB 1JHHA 2A6TA 3JAMZ 1WGXA 3CF5F 1H88C 3OR1C 1KQ8A 1YLFA 3LFKA 3RIRA 2VPRA 1MGTA 1SAXA 1IG7A 5L3CA 4G7ZF 3NWSA 1T6SA 4BE2A 3CMMA 4CDGA 3OL4A 1JKRC 3OOUA 1IN7A 2FBKA 1ETYA 1BC8C 4KA4A 1OCRH 2HDCA 4LIUA 2EV6A 3BCAA 4IF4A 2WWYA 2R7VA 2B7EA 3F23A 2KIQA 1JKQC 5AIQA 2DA3A 5LGTA 2LC2A 3Q5FA 3NRVA 3J81Z 5ICEA 4PDKA 2BGCA 1S72I 3V8KA 2OPTA 4V2FA 3VPRA 1YX3A 3DTIA 3DLLF 1K83J 3K1NA 3K9TA 1XN7A 2E2HJ 2BOLA 2VKHA 3KYCB 3W6JB 3LSKA 3JTGA 1QQIA 2EILH 4ZJZA 1E3PA 3S17J 2P81A 2VXDA 3C3WA 5ICFA 1KU2A 5M3FJ 2VQLA 5E79C 3ZMDA 3S32A 2Y0SA 3WE2A 3BTIA 3HDDA 3UNGC 1MMSA 1ZG1A 1K6YA 4DIQA 4U0WA 2IT0A 3I59B 4L5EA 1CF7B 2E7WA 4MHGA 1Z21A 3OYNA 2L3DA 2HKXA 1OCZH 4JX6A 1D5VA 5EF6A 2M9HA 2CFXA 3HRMA 5K7HA 2FJ1A 4E4HA 3ECOA 4F92B 2P8TA 3BT9A 4MQ9F 1UHWA 5EG0A 3O8GA 2CQKA 4D0PA 3S2DJ 4B44A 4ZH4F 2LNBA 2X1EA 1FJLA 2BY1A 4QPQA 4RAYA 2EA2A 2VN2A 2Y48A 4ASNA 1DPUA 2NYXA 3U1DA 3FMSA 3DU6A 2KIMA 2P6SA 3JW4A 4S05A 1IGNA 4LG0A 1LNWA 1Z77A 1ZLJA 2QBYB 3WTYC 2GOXB 1R1VA 1FSEA 2J5PA 1O3QA 1AU7A 2ELHA 1TZLA 4V2GA 5L3FA 2XSDC 3CCRI 4Y17A 3K4BA 2JMWA 1JTXA 3PSIA 4UNOA 1IXCA 3RKXA 1TWHJ 4WX9A 2Y0MA 3CP2A 3N05A 2M4GA 3CCLI 2E35A 1J9IA 3W2AA 2L01A 4RLFA 4YFNF 4AM3A 3HSFA 1CGPA 3CUQB 4XORA 4Q4ZF 2R7FA 3DPUA 3OIOA 2L9SA 2VJ4A 1S5LC 4XQFA 3COAC 2WY7Q 2XAQA 2DI3A 3Q9SA 1F9NA 4A3FJ 3DEWA 2BXZA 5K5OA 1EF4A 3MQ0A 4IRHA 4EM2A 2OQGA 3LAJA 2F5DA 4XSXF 1XMKA 4GYIA 3PUBA 4BAYA 4ENNA 3C2HA 1QZEA 2PG4A 3WGIA 2HQNA 2F2EA 3F72A 1P92A 3H0DA 1BR4A 3RYPA 4HA8A 1X2NA 1BI1A 2DW4A 3KP4A 5GPCA 1VNDA 3MEXA 2E36A 3CC2I 4IOAF 2VJIA 1OR7C 2V26A 3PFIA 3VFZA 4XLAA 1FY7A 1I3QJ 3L7WA 3L2RA 4JQFA 1ZGWA 4EATA 1V3FA 2HOSA 1RNLA 5LHGA 1Y6IA 1U5TA 2XB5A 5FLXK 1B72B 2P7CB 4NC7A 4EJTA 2NNNA 3U9GA 3HHGA 2HYGD 2XUBA 4JX5A 4AUXA 5E3MA 1R5GA 2DTRA 1FT9A 2ZMEB 4WXDA 3WTXC 4UB6C 1U8RA 3F8MA 4LLLA 2PX9A 1MBHA 1R4MB 3EQLF 3CF2A 2E1MB 3BG5A 5B1AH 2EZLA 3RKYA 2HXIA 1IN4A 5FKLA 4BY7J 1GVDA 4UUSA 2BY3A 3DBHB 1S29A 3E5QA 4Q5SF 2X6WA 3W2VA 2VQHA 5JR3A 4CZZA 4BHBA 2KZVA 3GUDA 2NNYA 1VQKI 3TP3A 5K1YA 1Z05A 4Y15A 2L0KA 4BBSJ 2Q2EA 2ME0A 2XGEA 3WTWC 1JUPA 4DBQA 2PMZN 3I55I 3FDYA 1J75A 5F27A 2V1UA 2HTJA 4ANJA 4NBQA 2G0EA 1LFBA 4RA2A 3J80Z 3LSTA 1ZRFA 2I5UA 1G3YA 2QENA 2L7ZA 4PUSA 3BG6A 4M72A 2YU3A 5CQEA 5FJ8J 3AFHA 4I76A 2P4WA 3GX4X 4AIDA 3ROUA 2ZXJA 5AIPA 2IP2A 3CDLA 3ABMH 1JGGA 4ENKA 1NK3P 4ETSA 2YX7A 4HDUA 2P7VB 2JZYA 2MLKA 3OOPA 2NVUB 4FASD 3PQKA 3QPLA 2PEXA 1QA6A 4XM3A 3DLAA 4DJAA 3T0YA 1BI3A 2KRCA 2IAIA 5BQTA 3I71A 4BQOA 1I27A 1DDNA 1TQPA 4N9HA 2WV0A 4DYCA 4AVPA 2PN6A 5IOYA 5GAEJ 1BIBA 3H9JA 2WBMA 1W0UA 4Q48A 3OYBA 3FBIB 1OCCH 1HF0A 5M5XJ 2XVCA 3FXQA 3WTTC 3BG3A 2M2EA 1AKHA 1BJAA 2VKVA 5CVJA 4BNCA 3D5RC 4BQNA 5ERIA 4LMYA 2OCEA 2WAEA 4D5FA 4ON0A 4N4OB 1U78A 1JJ6C 1RUOA 2LBFA 1T95A 5GP9A 1Z6TA 4EGYA 2H8WA 3LA7A 3OV8A 3IV5A 3RKQA 3HOZJ 3BG9A 3WG7H 1YHQI 5E17F 2Y2ZA 2FUG2 1D0ZA 1BW6A 2LY2A 4YFXF 1WQ2A 1ZKGA 4UUVA 4G9YA 1I6XA 4ZC3A 2CW8A 1T0FC 1SAUA 2DK8A 3F6OA 4QWQA 2DT6A 1RR7A 3CUQC 3P9CA 3KP2A 4LB6B 2F48A 3CQZJ 3DXJF 3TP0A 3HRSA 1VQLI 5CVIA 4G6QA 3GEZA 5J1UA 4PJ0C 1W7PA 3ASOH 3MD2A 4BYYA 2ZXWH 3OSFA 5LD2C 2OU2A 1HA8A 1VTNC 3O2PE 3G3ZA 4XMYA 3CD6I 1FTTA 4DOZA 2XGXA 2DQRA 3FXMA 2XAJA 3K4KA 3VODA 2IVMA 3M7GA 3SEQA 3ZMVA 3CLOA 1ZGJA 2VBZA 5CJ9A 5GADJ 2E5NA 2KMUA 4BDYA 5GAHJ 2P5LC 1WVRA 2DODA 2X1DA 2UXNA
chains in the Genus database with same CATH topology
5C4JJ 2R5ZB 2R93J 2IBDA 1I6HJ 2TRTA 3HEFA 3TW7A 1B8IA 2ELKA 2YUSA 3FK7A 5FKOA 2O9LA 1BA5A 4W97A 4M3FA 5C4XJ 1VI0A 4X6AJ 4AYBN 4BY1J 2XGCA 5BNGA 3JRCA 2E2IJ 3K7AJ 5HODA 3FIWA 4D5CA 3JRGA 1UHSA 2COBA 3LOCA 1MH3A 3HBLA 4M3EA 4MLOA 4AC0A 3LSJA 4M3BA 1ORKA 5M3MJ 1F36A 4B1RA 5F0CA 1T33A 1W0TA 1ETXA 1UG2A 1TWAJ 3JRIA 3W6VA 4A93J 4Y52J 3Q3SA 2NS7A 3FISA 5E3NA 1ZTRA 5M5YJ 4B4CA 3D1NI 1G2HA 1IUFA 4UUTA 2HXOA 2NVYJ 1FTZA 1TWGJ 2EZHA 4D7MA 4M6VA 2DMNA 3S1MJ 3S1NJ 4LOCA 2HDDA 1ENHA 4A3IJ 1ZR4A 4QTRA 3JRDA 5EDNA 2Y31A 3LSPA 3M4OJ 2YS9A 2M0CA 3MN2A 1JT0A 4MIMA 2DA7A 2D5VA 2L7MP 3JREA 2DN0A 2DTZA 2JA8J 4C3JJ 1XG1A 4FTHA 3S1RJ 4MO7A 4XRSA 1RPWA 2M8GX 2DA1A 5EYRA 5EGOB 1I50J 2XB0X 1ETQA 1K61A 4FCYA 3CCYA 3GTLJ 1QVTA 1Y1VJ 2KT0A 3QQAA 1ETKA 3GTJJ 1IC8A 2GM4A 2CJJA 3LNQA 2LY9A 3A02A 1IDZA 2L9RA 2EBIA 3SDGA 5DTDA 2DMPA 2GLOA 3ZQGA 4DZPA 4BBRJ 3BR0A 3RQIA 5JLXA 5FLMJ 1TC3C 1JUSA 1LE8A 3FKIJ 3FK6A 3RZOJ 3WHBA 2NVQJ 2NVXJ 2WB1N 1ITYA 5IPAA 4BKXA 3DCFA 2EH3A 2VI6A 1X58A 3H0GJ 2HOTA 4Y7NJ 2E1OA 2QF7A 3Q0VA 3BR3A 3S16J 4A3GJ 4RDUA 3HGGA 5E3LA 3S1QJ 1IRZA 2TCTA 4IHYA 1WGXA 2XGDA 1H88C 4XICA 4A3JJ 5C3EJ 2VPRA 3G1OA 3GBGA 2R92J 2EZIA 3B6CA 1PUFB 5F1JA 1IG7A 2YU9J 2MGQA 3SFIA 1IJWC 2JA5J 3ZQHA 5JLWA 1VFCA 4W1UA 4X1EA 1JKRC 3OOUA 1PUFA 2JA7J 1ETYA 2XPUA 2R5ZA 1APLC 1JKPC 2AHQA 1QPIA 4A3LJ 1UMQA 2NOGA 1JKQC 2DA3A 1D5YA 1HOMA 1RESA 1CQTA 2OPTA 2R7ZJ 4V2FA 4UUSB 3VPRA 1MBKA 4DZJA 1S7EA 1K83J 2Y9YA 3TW6A 1MBJA 4FISA 4XIDA 1T56A 4J19A 1U8BA 1H89C 2E2HJ 4I6ZA 3SJMA 1MBGA 1X2MA 4DYRA 2IEKA 4IHXA 2HOAA 3BQZA 3QPSA 3BR5A 1O4XA 2DA2A 3S17J 1HDPA 2P81A 2Y9ZA 1NTCA 5M3FJ 4A69C 2VUMJ 2ECBA 3GTPJ 3HOXJ 2QCOA 1ZK8A 3BTIA 3HDDA 4XK4A 2H8RA 1MSEC 2JN6A 2CQXA 2Y30A 2DA5A 1QRYA 4M3DA 2XRLA 2NVTJ 4L5EA 4MFDA 4C2MJ 4JX4A 4JX6A 2KDZA 3I4MJ 5EF6A 2M9HA 5EG0B 5K7HA 2FJ1A 3LSGA 4FE4A 3OSGA 1GT0C 1A6IA 1H8AC 2LVSA 3BT9A 5EG0A 3MKLA 3O8GA 3S2DJ 2DJNA 3E7LA 1FJLA 1GUUA 3B6AA 5EZGA 3HOUJ 1RETA 1SANA 1P7JA 1WH7A 5FKNA 4HNVA 1IGNA 2XPWA 1Z77A 5F08A 4CYCB 1OJLA 2B63J 2CUEA 5FKKA 4GFBA 1JJ8C 5DS9A 1TWFJ 1E3OC 2DMTA 4A3DJ 1AU7A 3ZOBA 4V2GA 2CQQA 5EGOA 2XSDC 2JMWA 1JTXA 3NAUA 4DYQA 2ME6A 3TEDA 1GDTA 5FLVA 1TWHJ 3C2BA 2CRGA 4A3MJ 2DMUA 1FIAA 4NDLA 4C3HJ 3GTKJ 2LKXA 1GV2A 3BR1A 1OCPA 3OIOA 5FKMA 1RKTA 1FIPA 3BTCA 3L1PA 4A3FJ 3DEWA 2EZKA 4C3IJ 1EF4A 1WPKA 3S15J 5J3LA 3JRHA 1FEXA 1OFCX 2JA6J 3RZDJ 1BW5A 1Y1WJ 2HI3A 1VF9A 1X2NA 5GPCA 2HYJA 1VNDA 3I4NJ 1YRNB 3HOYJ 3BQYA 3G1MA 4A3EJ 1I3QJ 2N8GA 4A3BJ 5GPAA 4RBOA 1ZGWA 1ETOA 2DA4A 1YRNA 1QVUA 2HOSA 2MSYA 2FD5A 2XB5A 5IP7J 1MSFC 1B72B 3S2HJ 1WCMJ 2GBYA 2LK2A 3MVPA 2I10A 1LFUP 5K7ZA 1A5JA 5EZHA 2WV1A 1NK2P 1U9OA 4S0HB 3JRFA 4QSHA 4JX5A 4AUXA 1ETWA 5E3OA 5E3MA 1B72A 2MW8A 3BR2A 3ZQLA 1HLVA 1ETVA 2LD5A 3H3VK 3BR6A 3ZQFA 2MG4A 1Z0XA 1DU6A 5F04A 5M5WJ 1MBHA 1HCRA 3PO3J 2CU7A 1RKWA 3BG5A 2OF7A 2EZLA 3HB9A 5EEAA 2HXIA 5FKLA 4MFEA 2WAQN 1MNMC 1Q1VA 1GVDA 2CUFA 4BY7J 4UUSA 2R5YB 1U9NA 1DU0A 1HDDC 3K2AA 5IOZA 5IYCJ 2HQ5A 2O8KA 3ZQCA 1JTYA 5F0FA 1IV6A 1OCTC 2R5YA 2DA6A 3GTMJ 3IH3A 1XS9A 5C44J 1R9TJ 2JK3A 3TP3A 2W48A 3IH2A 3HKZN 2L0KA 4BBSJ 5IYBJ 2ME0A 1SFOJ 2XGEA 3JRBA 4A3KJ 1JUPA 2PMZN 4JP0A 3GTQJ 5F27A 2LFBA 2Y0SN 2G0EA 1LFBA 1MH4A 2LR8A 3CMYA 1JUMA 2K40A 1GV5A 2L7ZA 1IDYA 5IYDJ 5FJ8J 2ID6A 4I76A 1XC5A 2E19A 2LTPA 3GTOJ 2ZB9A 2X6OA 3CDLA 1BJZA 1TWCJ 3GTGJ 3O8HA 3JR9A 2K9SA 1JGGA 5K7FA 1NK3P 1MBEA 3Q0WA 1MBFA 3M3YJ 3BTJA 3ZQIA 1WH5A 3QPLA 2NS8A 4XRSG 2AO9A 3G1LA 2IAIA 2JJ7A 4ABZA 5J1RA 4XRMA 3A01B 4DYCA 5IOYA 1BL0A 4CYCA 1JT6A 4JYKA 1W0UA 3JRAA 1AKHB 3A01A 4BXXJ 1HF0A 3NARA 5M5XJ 3UKGA 3HGYA 3BG3A 2M2EA 1AKHA 2O7OA 2VKVA 2E2JJ 2RAEA 1P7IA 2XPVA 3PO2J 1ZQ3P 4IHVA 3Q0UA 4M3GA 4D5FA 4QIWN 4DW6A 2K9NA 4D7NA 1U78A 2JWTA 4IEJA 1JJ6C 1AHDP 5IP6A 5GP9A 2X48A 3IV5A 5J1YA 3RKQA 3HOZJ 3BG9A 2Y2ZA 1BW6A 2ECCA 1ZKGA 3HM5A 3WHCA 3LSRA 1LE8B 4IHWA 2M34A 1F43A 4B3AA 3A03A 3F0CA 1RR7A 2ID3A 3CQZJ 3TP0A 2FQ4A 2DMQA 5IP9J 5J1UA 3IH4A 1ZR2A 2LP0A 4FE7A 5F0HA 4A3CJ 1WI3A 3HOVJ 3OSFA 1FTTA 2EQRA 3S14J 2X9DA 4EEFG 4G12A 9ANTA 3HOWJ 1JKOC 2FX0A 2H1KA 3BTLA 2L7FP 1B8IB 2LLKA 1POGA 2K9QA 3PM1A 2R0QC 2VKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4J J;  2R5Z B;  2R93 J;  2IBD A;  1I6H J;  2TRT A;  3HEF A;  3TW7 A;  1B8I A;  2ELK A;  2YUS A;  3FK7 A;  5FKO A;  2O9L A;  1BA5 A;  4W97 A;  4M3F A;  5C4X J;  1VI0 A;  4X6A J;  4AYB N;  4BY1 J;  2XGC A;  5BNG A;  3JRC A;  2E2I J;  3K7A J;  5HOD A;  3FIW A;  4D5C A;  3JRG A;  1UHS A;  2COB A;  3LOC A;  1MH3 A;  3HBL A;  4M3E A;  4MLO A;  4AC0 A;  3LSJ A;  4M3B A;  1ORK A;  5M3M J;  1F36 A;  4B1R A;  5F0C A;  1T33 A;  1W0T A;  1ETX A;  1UG2 A;  1TWA J;  3JRI A;  3W6V A;  4A93 J;  4Y52 J;  3Q3S A;  2NS7 A;  3FIS A;  5E3N A;  1ZTR A;  5M5Y J;  4B4C A;  3D1N I;  1G2H A;  1IUF A;  4UUT A;  2HXO A;  2NVY J;  1FTZ A;  1TWG J;  2EZH A;  4D7M A;  4M6V A;  2DMN A;  3S1M J;  3S1N J;  4LOC A;  2HDD A;  1ENH A;  4A3I J;  1ZR4 A;  4QTR A;  3JRD A;  5EDN A;  2Y31 A;  3LSP A;  3M4O J;  2YS9 A;  2M0C A;  3MN2 A;  1JT0 A;  4MIM A;  2DA7 A;  2D5V A;  2L7M P;  3JRE A;  2DN0 A;  2DTZ A;  2JA8 J;  4C3J J;  1XG1 A;  4FTH A;  3S1R J;  4MO7 A;  4XRS A;  1RPW A;  2M8G X;  2DA1 A;  5EYR A;  5EGO B;  1I50 J;  2XB0 X;  1ETQ A;  1K61 A;  4FCY A;  3CCY A;  3GTL J;  1QVT A;  1Y1V J;  2KT0 A;  3QQA A;  1ETK A;  3GTJ J;  1IC8 A;  2GM4 A;  2CJJ A;  3LNQ A;  2LY9 A;  3A02 A;  1IDZ A;  2L9R A;  2EBI A;  3SDG A;  5DTD A;  2DMP A;  2GLO A;  3ZQG A;  4DZP A;  4BBR J;  3BR0 A;  3RQI A;  5JLX A;  5FLM J;  1TC3 C;  1JUS A;  1LE8 A;  3FKI J;  3FK6 A;  3RZO J;  3WHB A;  2NVQ J;  2NVX J;  2WB1 N;  1ITY A;  5IPA A;  4BKX A;  3DCF A;  2EH3 A;  2VI6 A;  1X58 A;  3H0G J;  2HOT A;  4Y7N J;  2E1O A;  2QF7 A;  3Q0V A;  3BR3 A;  3S16 J;  4A3G J;  4RDU A;  3HGG A;  5E3L A;  3S1Q J;  1IRZ A;  2TCT A;  4IHY A;  1WGX A;  2XGD A;  1H88 C;  4XIC A;  4A3J J;  5C3E J;  2VPR A;  3G1O A;  3GBG A;  2R92 J;  2EZI A;  3B6C A;  1PUF B;  5F1J A;  1IG7 A;  2YU9 J;  2MGQ A;  3SFI A;  1IJW C;  2JA5 J;  3ZQH A;  5JLW A;  1VFC A;  4W1U A;  4X1E A;  1JKR C;  3OOU A;  1PUF A;  2JA7 J;  1ETY A;  2XPU A;  2R5Z A;  1APL C;  1JKP C;  2AHQ A;  1QPI A;  4A3L J;  1UMQ A;  2NOG A;  1JKQ C;  2DA3 A;  1D5Y A;  1HOM A;  1RES A;  1CQT A;  2OPT A;  2R7Z J;  4V2F A;  4UUS B;  3VPR A;  1MBK A;  4DZJ A;  1S7E A;  1K83 J;  2Y9Y A;  3TW6 A;  1MBJ A;  4FIS A;  4XID A;  1T56 A;  4J19 A;  1U8B A;  1H89 C;  2E2H J;  4I6Z A;  3SJM A;  1MBG A;  1X2M A;  4DYR A;  2IEK A;  4IHX A;  2HOA A;  3BQZ A;  3QPS A;  3BR5 A;  1O4X A;  2DA2 A;  3S17 J;  1HDP A;  2P81 A;  2Y9Z A;  1NTC A;  5M3F J;  4A69 C;  2VUM J;  2ECB A;  3GTP J;  3HOX J;  2QCO A;  1ZK8 A;  3BTI A;  3HDD A;  4XK4 A;  2H8R A;  1MSE C;  2JN6 A;  2CQX A;  2Y30 A;  2DA5 A;  1QRY A;  4M3D A;  2XRL A;  2NVT J;  4L5E A;  4MFD A;  4C2M J;  4JX4 A;  4JX6 A;  2KDZ A;  3I4M J;  5EF6 A;  2M9H A;  5EG0 B;  5K7H A;  2FJ1 A;  3LSG A;  4FE4 A;  3OSG A;  1GT0 C;  1A6I A;  1H8A C;  2LVS A;  3BT9 A;  5EG0 A;  3MKL A;  3O8G A;  3S2D J;  2DJN A;  3E7L A;  1FJL A;  1GUU A;  3B6A A;  5EZG A;  3HOU J;  1RET A;  1SAN A;  1P7J A;  1WH7 A;  5FKN A;  4HNV A;  1IGN A;  2XPW A;  1Z77 A;  5F08 A;  4CYC B;  1OJL A;  2B63 J;  2CUE A;  5FKK A;  4GFB A;  1JJ8 C;  5DS9 A;  1TWF J;  1E3O C;  2DMT A;  4A3D J;  1AU7 A;  3ZOB A;  4V2G A;  2CQQ A;  5EGO A;  2XSD C;  2JMW A;  1JTX A;  3NAU A;  4DYQ A;  2ME6 A;  3TED A;  1GDT A;  5FLV A;  1TWH J;  3C2B A;  2CRG A;  4A3M J;  2DMU A;  1FIA A;  4NDL A;  4C3H J;  3GTK J;  2LKX A;  1GV2 A;  3BR1 A;  1OCP A;  3OIO A;  5FKM A;  1RKT A;  1FIP A;  3BTC A;  3L1P A;  4A3F J;  3DEW A;  2EZK A;  4C3I J;  1EF4 A;  1WPK A;  3S15 J;  5J3L A;  3JRH A;  1FEX A;  1OFC X;  2JA6 J;  3RZD J;  1BW5 A;  1Y1W J;  2HI3 A;  1VF9 A;  1X2N A;  5GPC A;  2HYJ A;  1VND A;  3I4N J;  1YRN B;  3HOY J;  3BQY A;  3G1M A;  4A3E J;  1I3Q J;  2N8G A;  4A3B J;  5GPA A;  4RBO A;  1ZGW A;  1ETO A;  2DA4 A;  1YRN A;  1QVU A;  2HOS A;  2MSY A;  2FD5 A;  2XB5 A;  5IP7 J;  1MSF C;  1B72 B;  3S2H J;  1WCM J;  2GBY A;  2LK2 A;  3MVP A;  2I10 A;  1LFU P;  5K7Z A;  1A5J A;  5EZH A;  2WV1 A;  1NK2 P;  1U9O A;  4S0H B;  3JRF A;  4QSH A;  4JX5 A;  4AUX A;  1ETW A;  5E3O A;  5E3M A;  1B72 A;  2MW8 A;  3BR2 A;  3ZQL A;  1HLV A;  1ETV A;  2LD5 A;  3H3V K;  3BR6 A;  3ZQF A;  2MG4 A;  1Z0X A;  1DU6 A;  5F04 A;  5M5W J;  1MBH A;  1HCR A;  3PO3 J;  2CU7 A;  1RKW A;  3BG5 A;  2OF7 A;  2EZL A;  3HB9 A;  5EEA A;  2HXI A;  5FKL A;  4MFE A;  2WAQ N;  1MNM C;  1Q1V A;  1GVD A;  2CUF A;  4BY7 J;  4UUS A;  2R5Y B;  1U9N A;  1DU0 A;  1HDD C;  3K2A A;  5IOZ A;  5IYC J;  2HQ5 A;  2O8K A;  3ZQC A;  1JTY A;  5F0F A;  1IV6 A;  1OCT C;  2R5Y A;  2DA6 A;  3GTM J;  3IH3 A;  1XS9 A;  5C44 J;  1R9T J;  2JK3 A;  3TP3 A;  2W48 A;  3IH2 A;  3HKZ N;  2L0K A;  4BBS J;  5IYB J;  2ME0 A;  1SFO J;  2XGE A;  3JRB A;  4A3K J;  1JUP A;  2PMZ N;  4JP0 A;  3GTQ J;  5F27 A;  2LFB A;  2Y0S N;  2G0E A;  1LFB A;  1MH4 A;  2LR8 A;  3CMY A;  1JUM A;  2K40 A;  1GV5 A;  2L7Z A;  1IDY A;  5IYD J;  5FJ8 J;  2ID6 A;  4I76 A;  1XC5 A;  2E19 A;  2LTP A;  3GTO J;  2ZB9 A;  2X6O A;  3CDL A;  1BJZ A;  1TWC J;  3GTG J;  3O8H A;  3JR9 A;  2K9S A;  1JGG A;  5K7F A;  1NK3 P;  1MBE A;  3Q0W A;  1MBF A;  3M3Y J;  3BTJ A;  3ZQI A;  1WH5 A;  3QPL A;  2NS8 A;  4XRS G;  2AO9 A;  3G1L A;  2IAI A;  2JJ7 A;  4ABZ A;  5J1R A;  4XRM A;  3A01 B;  4DYC A;  5IOY A;  1BL0 A;  4CYC A;  1JT6 A;  4JYK A;  1W0U A;  3JRA A;  1AKH B;  3A01 A;  4BXX J;  1HF0 A;  3NAR A;  5M5X J;  3UKG A;  3HGY A;  3BG3 A;  2M2E A;  1AKH A;  2O7O A;  2VKV A;  2E2J J;  2RAE A;  1P7I A;  2XPV A;  3PO2 J;  1ZQ3 P;  4IHV A;  3Q0U A;  4M3G A;  4D5F A;  4QIW N;  4DW6 A;  2K9N A;  4D7N A;  1U78 A;  2JWT A;  4IEJ A;  1JJ6 C;  1AHD P;  5IP6 A;  5GP9 A;  2X48 A;  3IV5 A;  5J1Y A;  3RKQ A;  3HOZ J;  3BG9 A;  2Y2Z A;  1BW6 A;  2ECC A;  1ZKG A;  3HM5 A;  3WHC A;  3LSR A;  1LE8 B;  4IHW A;  2M34 A;  1F43 A;  4B3A A;  3A03 A;  3F0C A;  1RR7 A;  2ID3 A;  3CQZ J;  3TP0 A;  2FQ4 A;  2DMQ A;  5IP9 J;  5J1U A;  3IH4 A;  1ZR2 A;  2LP0 A;  4FE7 A;  5F0H A;  4A3C J;  1WI3 A;  3HOV J;  3OSF A;  1FTT A;  2EQR A;  3S14 J;  2X9D A;  4EEF G;  4G12 A;  9ANT A;  3HOW J;  1JKO C;  2FX0 A;  2H1K A;  3BTL A;  2L7F P;  1B8I B;  2LLK A;  1POG A;  2K9Q A;  3PM1 A;  2R0Q C;  2VKE A; 
#chains in the Genus database with same CATH topology
 2TRT A;  1QPM A;  4ZYD A;  3F9K A;  1JE8 A;  3PJR A;  5FKO A;  3E3V A;  2WAF A;  1BI2 A;  4X6A J;  3DPT A;  4AYB N;  4BY1 J;  1BM9 A;  4O6J A;  3ESW B;  5E1W A;  1TW2 A;  3K7A J;  2W7N A;  3EET A;  1F4K A;  5D4R A;  3E5X A;  3FIW A;  2KPM A;  2WAQ A;  4RGR A;  2K3P A;  3JRG A;  1TLH B;  2LF7 A;  3VEP A;  3LOC A;  4M3E A;  2B9S A;  3HBL A;  5K5Q A;  4BEH A;  4CCO A;  1ON1 A;  2ZME C;  5ICC A;  4AC0 A;  2AXL A;  3DEU A;  5CVU A;  1U2W A;  5M3M J;  3U2R A;  4B1R A;  2OQR A;  2HWV A;  2V9V A;  1UG2 A;  4HX8 A;  1TNS A;  2E1M C;  5IT9 K;  1VQ4 I;  4KT5 C;  3R0A A;  4Y52 J;  5IY5 H;  3DBR B;  4MTE A;  4L0Z B;  3FIS A;  3VYS B;  5E3N A;  2CGP A;  2XIG A;  1S9H A;  1G2H A;  1IUF A;  2QQ8 A;  5ED4 A;  2FOK A;  2X6X A;  5DCM A;  5B5E C;  3Q9V A;  1F1Z A;  3KEO A;  4M6V A;  2DMN A;  3KZZ A;  2BVM A;  1HW2 A;  5GAG J;  4ITV A;  4EVI A;  3S1M J;  5HLI A;  2X1C A;  1MDM A;  2UWM A;  4LOC A;  3W2W A;  1SVM A;  1ENH A;  2HFH A;  2ETH A;  5TGT A;  1IXS B;  1UAA A;  3EUH C;  2Y31 A;  2IGO A;  2XF6 A;  3R4K A;  3M4O J;  2YS9 A;  3DF8 A;  4Y13 A;  3K4J A;  4A0X A;  3FX3 A;  3HTU A;  3GME A;  1FOY A;  2DA7 A;  2D5V A;  4KJZ A;  4L18 B;  1XSD A;  2DN0 A;  2DTZ A;  1B1B A;  3FMQ A;  2JA8 J;  4S04 A;  4C3J J;  1R5I D;  2WA0 A;  3C1D A;  3FXK A;  4E6K G;  4LG0 B;  3QOE A;  2W1O A;  3S1R J;  3A4C A;  2E1N A;  5E1Z B;  2F5V A;  4NQW A;  5LEJ A;  3L9F A;  5EYR A;  5BMZ A;  3B02 A;  2HR3 A;  3WTS C;  4ZZD A;  2M4K A;  1I5Z A;  2XB0 X;  4LK1 F;  1V5F A;  3SDB A;  4G7H F;  4M73 A;  3P7N A;  3CCY A;  3GTL J;  2IA0 A;  2PMU A;  2HPI A;  4LIT A;  5FO5 A;  4EMS A;  1ZLK A;  4MTD A;  2DK5 A;  3GTJ J;  1YW8 A;  3CMA I;  1A35 A;  3K4M A;  3HPH A;  1I3A A;  2V7F A;  4IJA A;  4XLF A;  3SDG A;  2O0Y A;  3IRR A;  3G73 A;  2X0L A;  3MKY B;  3SZG A;  1LE8 A;  3ZP5 A;  3KYD B;  1HKS A;  2H6B A;  2E5Z A;  3F8F A;  2CQN A;  3KP6 A;  3DCF A;  4ESF A;  1F5T A;  2STT A;  2HS5 A;  4I99 C;  2O5R A;  3Q0V A;  4KIC A;  4L9J A;  4CO8 A;  3F22 A;  1VQO I;  1ZRD A;  5KAF C;  3HGG A;  2MFZ A;  5E3L A;  3F21 A;  5DM6 F;  1Z6R A;  3IHU A;  3S1Q J;  4PJN A;  3BDD A;  4K2E A;  4B3X A;  2RV8 A;  5FLX Z;  1XCB A;  3L2C A;  4I09 A;  4XIC A;  4A3J J;  3K10 A;  3CCQ I;  1A31 A;  2R92 J;  1U5T B;  2EZI A;  1PUF B;  2DPU A;  3QOP A;  4CYD A;  3ECH A;  3G71 I;  3C2G A;  5J4V A;  5JLW A;  2VJJ A;  3D5L A;  2C6Y A;  4JBA A;  2V4J C;  4KIG A;  1JXS A;  2ZNZ A;  2AHQ A;  5J8C A;  4Y33 A;  1UMQ A;  2Y69 H;  1ZHF A;  4BXF A;  1D5Y A;  1EH8 A;  3I9V 2;  2HDW A;  3LL7 A;  4KNY A;  1DQU A;  3E6M A;  3U1K A;  4KMU X;  4UUS B;  3GLL A;  2JT1 A;  1TTY A;  3DTE A;  3DPL C;  4DZJ A;  3EUK L;  3TW6 A;  1H89 C;  4BJT A;  1O3S A;  2V1X A;  1S6L A;  4DYR A;  3V7R A;  4F52 A;  2IEK A;  2HOA A;  3BQZ A;  3BR5 A;  5CQG A;  6PAX A;  3FZV A;  1HDP A;  1YTY A;  5ILU A;  4A69 C;  2VUM J;  2L9N A;  3OWT A;  3HOX J;  2Q2E B;  4CZC A;  2HYF A;  2HKO A;  3GF2 A;  2KDO A;  3H92 A;  3K4N A;  4M3D A;  2ELJ A;  4MFD A;  4C2M J;  5DD4 A;  2NRA C;  1ONV A;  1HSJ A;  2QLZ A;  4I0B A;  3OYK A;  2EWN A;  2MH9 A;  3WU2 C;  1G8X A;  3RTR A;  3LSG A;  4FE4 A;  5FGM A;  2EK5 A;  3OSG A;  1GT0 C;  3EYI A;  3C7J A;  1P4X A;  2DCE A;  3E5U A;  5CLS A;  2D1H A;  2QZ8 A;  3MKL A;  3I56 I;  1E17 A;  2DJN A;  1X19 A;  1GUU A;  1S8N A;  2XAU A;  2PJP A;  2M30 A;  4XLH A;  3GYH X;  2XAF A;  3AKZ A;  3IKV A;  2QEX I;  4ZTF A;  1Y8R B;  4OAY A;  2E7X A;  3BCB A;  1BC7 C;  2EPF A;  2BBY A;  2CUE A;  4PFO A;  1JJ8 C;  4E7S A;  5E18 F;  4NUB A;  1E3O C;  1TP4 A;  2DOE A;  2ICW G;  4EV0 A;  3ZOB A;  3CP8 A;  4EJW A;  4XN3 A;  2R7R A;  4J00 A;  3HOT A;  2UZK A;  1GDT A;  1BN5 A;  5FLV A;  3MZ8 A;  3TMO A;  1D3Y A;  3QP6 A;  4A5N A;  5HNF A;  3EDP A;  3K70 C;  1J2X A;  4UVB A;  2LKX A;  3BR1 A;  3D0S A;  4YIR X;  4KUM A;  1OCP A;  3OS2 A;  3SQN A;  4CCK A;  4MNU A;  1FIP A;  4RM3 A;  2KP6 A;  4UVA A;  2EZK A;  4C3I J;  1OYI A;  3R61 A;  4G94 A;  3CJN A;  2VQC A;  2VXZ A;  3MWM A;  4OIR F;  4OAZ A;  4PSW A;  1BR2 A;  1BW5 A;  1P2F A;  2G7U A;  4GRI A;  2EFW A;  1USS A;  2WY8 Q;  3QYE A;  2KRH A;  5LGN A;  4IO9 F;  3TDZ C;  5J8F A;  4B8X A;  1LEB A;  4QLC U;  2M7A A;  1YRN B;  3HOY J;  3ABL H;  3G1M A;  4A3E J;  4F55 A;  3M1C A;  2KFD A;  2N8G A;  5E8G A;  4PJL A;  1MMN A;  3F8N A;  5GPA A;  1YW9 A;  4CCJ A;  2DA4 A;  3KET A;  4DBR A;  5CKT A;  3T1B A;  5IP7 J;  3V7C A;  1MSF C;  3S2H J;  2LK2 A;  3RCO A;  1I1S A;  2DYS H;  5EZH A;  2AQF A;  3LQR A;  3LMM A;  2G7H A;  3AG2 H;  1DPR A;  2NAZ A;  4S0H B;  3JRF A;  2DOA A;  4QSH A;  4U88 A;  4ZTJ A;  1PDN C;  1R23 A;  4A5M A;  1E2X A;  2IS6 A;  4ZZL A;  3BR2 A;  2ADU A;  1O3R A;  1P4A A;  1HLV A;  3HUG B;  3BZK A;  1ETV A;  1KZH A;  2LD5 A;  3H3V K;  2W82 A;  2D2W A;  1HC8 A;  1U5T C;  1DGW Y;  2LKS A;  3QP5 A;  3K70 D;  2CU7 A;  2FBH A;  5EEA A;  1MNM C;  1PYV A;  1Q1V A;  3FXJ A;  1PP7 U;  2R5Y B;  1SD7 A;  1G3T A;  3NEU A;  4DGW B;  1YIJ I;  2HQ5 A;  3GCM A;  2XF7 A;  5F0F A;  3HL2 A;  1V4R A;  1YIT I;  2FNA A;  3R60 A;  2R7S A;  2MLG A;  2DA6 A;  3OIQ A;  4RB0 A;  1TT0 A;  1ZYR F;  4KIS A;  3IH3 A;  5FRN A;  4PSX A;  5ILS A;  2ZXI A;  4XLN F;  2HNH A;  3DQV C;  2W48 A;  3ELK A;  3IH2 A;  3HKZ N;  3JSO A;  1STZ A;  3QPH A;  2F4M B;  2CV2 A;  4AVZ A;  1H0M A;  1SFO J;  3CO6 C;  4A3K J;  2MD0 A;  3GTQ J;  3OYG A;  1Z7U A;  2DO7 A;  2LFB A;  4BH9 A;  2CWE A;  2Y0S N;  1TBX A;  2LR8 A;  5DCM B;  1QNT A;  2CQ7 A;  2K4J A;  2WC2 A;  5D4S A;  5D5W B;  1JUM A;  3ABT A;  2K40 A;  3A2K A;  3M8E A;  3VDX A;  4BL0 B;  1MJB A;  1FMW A;  4LB5 A;  1XC5 A;  2K3F A;  3ZN0 A;  2VOO A;  4J01 A;  1WJF A;  4II2 A;  3GTG J;  3M8F A;  4ZYA A;  3MZY A;  3ASN H;  1MBE A;  1A6Q A;  3Q0W A;  2M8E A;  4HST A;  3BTJ A;  3M3Y J;  1ACI A;  4CXF A;  3HZJ A;  2NS8 A;  5J47 A;  4AWX B;  1HST A;  1KU9 A;  3G1L A;  5J1R A;  4XRM A;  2Z3Y A;  3ZMZ A;  3A01 B;  4CHU A;  5CPR B;  2KKO A;  2ZO4 A;  2A69 F;  1LDJ A;  4CYC A;  2ZJR F;  4JYK A;  1LUJ B;  5FD5 A;  1FLI A;  3TKY A;  3H9Q A;  3NAR A;  4IVN A;  3UKG A;  4HDV A;  5D5X B;  4E7L A;  2JA2 A;  2DFI A;  2PMH A;  2O7O A;  2VBY A;  4ZDL A;  4CCN A;  3TOA A;  4YG2 F;  3AL0 B;  1P7I A;  2QWW A;  3PO2 J;  3HRU A;  3IWZ A;  5KHD A;  2VC1 A;  5KK1 A;  4G6D A;  4DW6 A;  5J6X A;  5KCM A;  4OIQ F;  1KQ9 A;  2PBI A;  2CS3 A;  2FRH A;  4A6E A;  1T38 A;  1MJ9 A;  1ON2 A;  3TO6 A;  4YRV A;  2BW3 A;  1X1P A;  4H4K C;  4P5O A;  1EJ9 A;  2Z1D A;  1LE8 B;  2M34 A;  2XKO A;  4CCL A;  3J7A Y;  3IAM 2;  1QZY A;  3KE2 A;  3QYF A;  1YI2 I;  1YJ9 I;  2ID3 A;  2XRN A;  5IP9 J;  4BQA A;  4C2T A;  2IS4 A;  3HSE A;  5KVR A;  4FE7 A;  2JPC A;  5F0H A;  4A3C J;  4A0Y A;  2F5F A;  2PQ8 A;  3ISP A;  2JVH A;  3VB2 A;  3KIO A;  3S14 J;  2RGV A;  4EEF G;  9ANT A;  2EA4 A;  3IUO A;  2VLA A;  2OTJ I;  2CYY A;  4M6Y A;  3L2U A;  1WFX A;  2OD5 A;  4A0Z A;  2FX0 A;  1SC7 A;  4E7Z A;  4M74 A;  1N77 A;  1B8I B;  3LAP A;  2LLK A;  2K7L A;  2K9Q A;  3WU0 A;  2A68 F;  3PM1 A;  4I7H A;  1R1U A;  2IBD A;  3I53 A;  4ZYH A;  3HEF A;  3TW7 A;  2ELK A;  2YUS A;  3FK7 A;  3JSP A;  1BA5 A;  5AON A;  4W97 A;  4HV6 A;  1D1B A;  4HX4 A;  1YW7 A;  1SFX A;  4NC6 A;  4B48 A;  4IRI A;  2GA2 A;  3C18 A;  1B59 A;  5BNG A;  2E2I J;  2MC4 A;  2ZCW A;  2DPD A;  3I5U A;  5E8I A;  1X1C A;  1PJR A;  3MCZ A;  3BPX A;  4IHS A;  4D5C A;  3DEE A;  1RR8 C;  2A5W A;  1Z67 A;  3GVA A;  1BBY A;  4CH7 A;  4KN4 X;  3LSJ A;  1ORK A;  2RDP A;  2VE8 A;  1Z91 A;  3J7Y J;  1B9M A;  2IGK A;  1HKQ A;  1T33 A;  2I8D A;  1XMA A;  4XSZ F;  1TW3 A;  3MAJ A;  3ZR8 X;  3CC4 I;  2ZFW A;  1LJ9 A;  2FA5 A;  1XCV A;  1O7F A;  2PFB A;  3Q3S A;  3VSK A;  4F3Q A;  2KL4 A;  2DYR H;  3KYL A;  2CW7 A;  3PNY A;  2LY1 A;  2GOM A;  2B0L A;  3D1N I;  2W84 A;  2M1B A;  3M1E A;  2HXO A;  2NVY J;  4PK4 A;  2QSH X;  4CGZ A;  2EZH A;  5H20 A;  1OLT A;  3TDU C;  3K2Z A;  4A12 A;  1WJD A;  2FF4 A;  1W7P D;  4HNT A;  5GTH C;  1LB2 A;  1RIO H;  2GQQ A;  4PFP A;  4QTR A;  3LSP A;  2K85 A;  4BUP A;  3S93 A;  3HRT A;  1N25 A;  2LG4 A;  1W5T A;  1LKX A;  2ESH A;  1Q1H A;  4RAZ A;  1IRF A;  2QQB A;  2R7Q A;  2X51 A;  3F3X A;  4GCV A;  4UB8 C;  1OCO H;  4KDP A;  2ZXH A;  1D8K A;  3FXU A;  3WTU C;  1XG1 A;  3V4G A;  1XGS A;  2K86 A;  1R7J A;  4YFK F;  2GXA A;  4HRI A;  2CG4 A;  3RSN A;  2H1L A;  2PLY A;  2FNP A;  3RPQ A;  2LKP A;  5D8K B;  1VZ0 A;  1X1D A;  1ETQ A;  4GYG A;  4CSW A;  4QPO A;  2V9K A;  1NG7 A;  4R8H A;  3SYT A;  3W6K B;  3WGH A;  3PNT A;  2EIJ H;  3QQA A;  2HGC A;  2MD5 A;  2DDA A;  2CJJ A;  2IA2 A;  2X6Y A;  4IPA A;  4RLQ A;  5BPI A;  3OYJ A;  4Y4R A;  3AG4 H;  2GWR A;  2L9R A;  1K4S A;  1UHM A;  2LSO A;  2EIN H;  2L5Q A;  1Z1D A;  1OMI A;  3RJP A;  5DTD A;  1E0E A;  2BY0 A;  3DKW A;  4FX0 A;  3ZQG A;  3E0J B;  1D1C A;  4BBR J;  5F6F A;  4DZP A;  3AL0 C;  5JLX A;  2VPL A;  2JPB A;  3BJO A;  2EFO A;  2K27 A;  5A2Q K;  1LVA A;  3ML6 A;  1ITY A;  2MAB A;  2HOT A;  2E1O A;  2QF7 A;  3BR3 A;  3SXY A;  3PL8 A;  5TRD A;  2QA4 I;  2TCT A;  3V8J A;  3L09 A;  1WHU A;  2XGD A;  1XGN A;  3FXO A;  1FNN A;  2E60 A;  1WJE A;  1I39 A;  5C3E J;  3G1O A;  3GBG A;  3HYI A;  2FOW A;  3DTK A;  3I58 A;  2YU9 J;  3SFI A;  3OYH A;  2JA5 J;  3ZQH A;  1EA3 A;  4RGU A;  1VFC A;  3FMR A;  1XDS A;  4W1U A;  4X1E A;  1GHC A;  1DUX C;  2R5Z A;  2XPU A;  3FXL A;  4XN0 A;  1APL C;  2R7X A;  2UXX A;  3KZY A;  1JKP C;  1QPI A;  4A3L J;  3I4P A;  3N97 A;  2NOG A;  2A05 A;  2DAO A;  5DUI A;  3K4C A;  4E7J A;  1HOM A;  2R7D A;  4AYB A;  4P9U A;  1VQN I;  4X0G A;  4E7I A;  1X3U A;  1CQT A;  2R7Z J;  2L2O A;  2V79 A;  1XD7 A;  4I02 A;  2Y9Y A;  4FIS A;  1FP1 D;  2IXS A;  4I6Z A;  4YII A;  3HJE A;  1WJ5 A;  2VKD A;  1X2M A;  4RB1 A;  3OYD A;  3DKY A;  3TL4 X;  1D0X A;  1J09 A;  2FMY A;  2OZU A;  3IP4 B;  3TO9 A;  2QKL B;  3QPS A;  3J81 K;  2DA2 A;  3MFK A;  2A3S A;  3PIO F;  5LBQ A;  2BYV E;  2H6C A;  2VL8 A;  3CCE I;  4UXN A;  2IPQ X;  3GTP J;  1G59 A;  2XAS A;  1ZK8 A;  1JGS A;  1FYL A;  4XK4 A;  1MD0 A;  1ZG5 A;  2Y30 A;  1UST A;  1YS6 A;  1SD5 A;  1T98 A;  1YIO A;  2XRL A;  1YJW I;  4JX4 A;  3BZ6 A;  3OYF A;  2KDZ A;  1NHA A;  3I4M J;  2Z2S B;  1O7L A;  3T8R A;  5EG0 B;  4MEX F;  1T8I A;  2XRO A;  1UG0 A;  1CF7 A;  2BEO A;  3K69 A;  5FFZ A;  1SFU A;  5IT3 A;  1J7K A;  1H8A C;  1VQP I;  2LVS A;  3TBI A;  1XSX A;  2LDU A;  4XON A;  2RKH A;  5H6R A;  2Q0O A;  2HPM A;  2CUZ A;  1P4W A;  3SEZ A;  2K9L A;  3E7L A;  4BJ6 C;  4OIN F;  2R4G A;  1N78 A;  3CCV I;  4WXC A;  3JCU C;  1KA8 A;  1SAN A;  1P7J A;  2VT3 A;  4UV8 A;  3CDH A;  2LRE A;  1WH7 A;  4KMF A;  2COM A;  2YPR A;  4B47 A;  1RRJ A;  2IGM A;  1FWZ A;  5F08 A;  4CYC B;  2E71 A;  1FX7 A;  2B63 J;  2L4A A;  3HG9 A;  2DFF A;  4CIC A;  5DS9 A;  2QKM B;  2DMT A;  4A3D J;  3TGN A;  4IZZ A;  4HZF A;  3RI4 A;  4CA0 A;  3NAU A;  2QQ9 A;  4GO1 A;  5J40 A;  1LEA A;  3C2B A;  3I0T A;  2UV1 A;  5E1X A;  3L2Q A;  4OWR B;  3F6V A;  2BZT A;  4RM2 A;  2DMU A;  4NDL A;  4C3H J;  5L3B A;  5HNH A;  1AWC A;  2PI0 A;  5HLG A;  4O3M A;  2CW0 F;  1FSH A;  3S3O A;  2DT7 B;  5FKM A;  3JTH A;  4G6T B;  2CMP A;  4HG2 A;  2KQR A;  2DT5 A;  3GW2 A;  2BW3 B;  1NH3 A;  2YR2 A;  1A36 A;  3HPG A;  4BE1 A;  1WPK A;  3GO5 A;  3S15 J;  1FEX A;  3RZD J;  2XHK A;  3RDI A;  1YOV B;  1W4M A;  5GTI C;  4GGG A;  4HYE A;  4UVC A;  2HYJ A;  1L3L A;  1WZ2 A;  3I4N J;  1VQM I;  3E6B A;  3CJR B;  4DQ2 A;  3HTS B;  3BQY A;  3QOD A;  4A3B J;  2VJ5 A;  5DV5 A;  1FBU A;  3A0H C;  5EEG A;  3KP5 A;  1HQC A;  2V6C A;  2Z99 A;  4ESJ A;  2STW A;  3H5N A;  1WCM J;  2GBY A;  3BZC A;  3MVP A;  1LFU P;  1ZRE A;  5K7Z A;  1NK2 P;  1QHG A;  1U9O A;  5L3D A;  2GXG A;  1Z7L A;  2H09 A;  5E3O A;  1B72 A;  3M8J A;  4IKF A;  1H9G A;  2F5C A;  5ICG A;  4AU7 A;  5HDK A;  4P9F A;  3KFW X;  3P5J A;  3OY9 A;  1DP3 A;  1MMG A;  3BR6 A;  3BY6 A;  2JRT A;  3E6C C;  4DNC A;  1DU6 A;  3VOE A;  1B6A A;  2EFN A;  3DP7 A;  2OF7 A;  1WJC A;  3HB9 A;  3E6D A;  2TDX A;  4MFE A;  5JHU A;  4E70 A;  1U9N A;  1DU0 A;  1HDD C;  3AG1 H;  4TV7 A;  4O5V A;  1QZZ A;  3K2A A;  3GZN B;  5IYC J;  4AIK A;  4BGD A;  1KU3 A;  4FX4 A;  1I1G A;  2O8K A;  3ZQC A;  1JTY A;  1OCT C;  1GXQ A;  3BP8 A;  2EV0 A;  3GTM J;  3BRO A;  3D5S C;  1O57 A;  3MKW B;  1XS9 A;  5C44 J;  3OYC A;  2JK3 A;  2W57 A;  3K6G A;  1AOY A;  2LMD A;  5B66 C;  3H3U A;  3REO A;  5IYB J;  1FYM A;  1UJ8 A;  4HV5 A;  5HOO A;  1YYV A;  4HSR A;  4HNU A;  3MMY B;  2W00 A;  2M87 A;  1Z3Y A;  1UEL B;  5LRS A;  1SD4 A;  4H0E A;  1KYZ A;  1IAW A;  1FPQ A;  3PNV A;  1GV5 A;  2A61 A;  3KPH A;  2VIX A;  2JRM A;  2W4S A;  4IXA A;  3IAS 2;  1W5S A;  2LTP A;  3GTO J;  2X6O A;  1BJZ A;  1TWC J;  2P0W A;  3O8H A;  2XKP A;  3JR9 A;  5LHI A;  5K7F A;  1A04 A;  2FBI A;  3LA2 A;  3J80 K;  2YX4 A;  3M07 A;  5H6Q A;  2OA4 A;  3WTZ A;  3ZQI A;  3HIF A;  5ILV A;  4LIV A;  4YEL A;  4KIF A;  4MGR A;  4PJM A;  4P1W A;  2PJR A;  2GZW A;  4WCG A;  1IRG A;  2JTV A;  1X1B A;  4I0A A;  3UR3 C;  3ZRG A;  4KIT B;  5HDN A;  2RC4 A;  3IKT A;  2QM3 A;  2L9V A;  3N4M A;  2RNJ A;  1MND A;  1UZC A;  3GXO A;  1BL0 A;  1JT6 A;  3CCJ I;  1AKH B;  1K78 A;  2RN7 A;  2AQE A;  4KFC A;  3PUF A;  4PJJ A;  2ZNY A;  3VWB A;  3OMY A;  3SZP A;  3TQN A;  3WE3 A;  1WI9 A;  4U7D A;  4E7H A;  2E2J J;  2LBF B;  1LQ1 A;  1R6R A;  2XPV A;  4IHV A;  3Q0U A;  4LGW A;  2HVS A;  4QIW N;  4FQG A;  4D7N A;  2JWT A;  1AHD P;  5LLQ A;  2Z16 A;  4KN7 X;  2X48 A;  1WJA A;  2W24 A;  3CCM I;  3M9A A;  1IN5 A;  3EPZ A;  2K5C A;  4WXH A;  1MZB A;  4FHT A;  1SVO A;  1IV8 A;  2VC0 A;  2WB1 A;  3HM5 A;  1U0J A;  2EFQ A;  3PQJ A;  2XAH A;  3WHC A;  5K5R A;  4B3A A;  4IHT A;  2R7T A;  2HVR A;  2W25 A;  1YE9 A;  1W7P B;  4XR6 A;  1MNE A;  2OCC H;  3KEQ A;  4L9T A;  1XTA A;  3CJT B;  3S2W A;  1E3H A;  2FQ4 A;  3RQ4 A;  2DMQ A;  3U21 A;  5JVT A;  3KX2 A;  1O3T A;  1SMY F;  3VYR B;  2LF8 A;  3KCC A;  1XDU A;  4XKV A;  4XBF A;  1UFM A;  2WAD A;  2EQR A;  3F8C A;  4G12 A;  5JVG F;  4IQ4 A;  4LLG F;  2H1K A;  1FOW A;  1POG A;  5BOX A;  2OBP A;  2M45 A;  1TQI A;  2EB7 A;  1EH6 A;  2GAU A;  1V55 H;  1T2K A;  2R0Q C;  1ZGA A;  2HVQ A;  1MW7 A;  5C4J J;  2R5Z B;  2R93 J;  1I6H J;  1FOX A;  2IS2 A;  1ZH5 A;  4M3F A;  1GLN A;  5D5V B;  1VI0 A;  5DCF A;  4HAM A;  4XOP A;  3TOB A;  4UY8 I;  3SZT A;  4BEH B;  4OOI A;  2XAG A;  3JRC A;  1PVE A;  2ZSI B;  5IT9 Z;  2JUG A;  3V8L A;  4Z2Y A;  4U0V A;  2VON A;  2CUJ A;  1UHS A;  3ZQQ A;  1S7A A;  2ZJ2 A;  4MLO A;  4M3B A;  4C30 A;  1BR1 A;  3ONQ A;  4HBL A;  1Y8Q B;  3I3L A;  4N4N B;  5F0C A;  4XL9 A;  3PIP F;  1OKR A;  2NOJ B;  3KLN A;  3JRI A;  3EUA A;  1OIS A;  1R00 A;  2WTE A;  5LHH A;  3S3N A;  3HKZ A;  1R36 A;  3W6V A;  4RGX A;  2ZFU A;  1XMX A;  3GFL A;  2NS7 A;  1FP2 A;  2AXT C;  4CUG A;  1ZTR A;  4MQV A;  4RAF A;  5M5Y J;  2VAS A;  2DLL A;  4RB2 C;  2JUC A;  1GXP A;  3T8T A;  1SVL A;  1MDM B;  4GDF A;  1FTZ A;  4N9I A;  3LQQ A;  4D7M A;  1G6N A;  4ESB A;  5F1R A;  4IRG A;  1TNT A;  2E34 A;  2GIZ A;  2AS5 F;  3FXR A;  3RPU D;  2QVO A;  3LSM A;  4ZYG A;  1MJA A;  2D1V A;  4M9S A;  4A3I J;  1ZR4 A;  1FYK A;  4BU2 A;  3JRD A;  5EDN A;  4XLP F;  1MMD A;  1JT0 A;  5KAI C;  3JRE A;  5LEK A;  4CCM A;  4NQW B;  4AD9 A;  4M9Z A;  4E7K A;  1D0Y A;  2JQ7 A;  3NQO A;  1IRX A;  4AIH A;  4HEA 2;  1WKM A;  3H5A A;  3O6B B;  4MO7 A;  2O03 A;  1RPW A;  4U7B A;  2K9M A;  1LFP A;  2IA1 A;  1LDK B;  2QSG X;  1WWX A;  5TJJ A;  4NC8 A;  3DWL E;  2FE3 A;  4R79 A;  2HQR A;  4PGH A;  3BC8 A;  2A5Y B;  1D8J A;  2HU9 A;  1GVJ A;  2P6T A;  1QVT A;  1Y1V J;  2KT0 A;  5HDG A;  4IX7 A;  1ETK A;  1P9Q C;  3CDI A;  2OUM A;  2GM4 A;  4Y3O A;  1ZEL A;  2LY9 A;  1YFH A;  1Z9C A;  2KIF A;  2O3F A;  2OC6 A;  4LG3 A;  2EBI A;  2F5E A;  2DMP A;  4II3 A;  3RQI A;  1KU7 A;  2EV5 A;  5FLM J;  3LSI A;  1MKM A;  3FKI J;  2F4O B;  2IGN A;  3RPU A;  4Q47 A;  5FD6 A;  2A6H F;  3WHB A;  2NVQ J;  2DFH A;  1ODD A;  5IPA A;  1VQ8 I;  2JVG A;  2EH3 A;  2LH9 A;  4EGZ A;  1X58 A;  3FHN A;  3X2Q H;  4RB3 C;  1ZAR A;  5D5U B;  4FET A;  2KIS A;  3S16 J;  4RDU A;  1OYW A;  5H2F C;  2J5O A;  1IRZ A;  4IHY A;  3ZQ7 A;  2P5V A;  2Y75 A;  3K0L A;  1KYW A;  2BY2 A;  4XKB A;  2R7W A;  3B6C A;  5F1J A;  1D1A A;  2EJR A;  2MGQ A;  2RNG A;  2ZSH B;  4WF2 A;  1IJW C;  5L3G A;  4B43 A;  4BDZ A;  1OQY A;  3KZI C;  1PUF A;  2M0M A;  2JA7 J;  4NNJ A;  3KP7 A;  1SFE A;  2D45 A;  2NS0 A;  1QGP A;  1RES A;  1J0R A;  1FC3 A;  5CVV A;  1VQ7 I;  2DDB A;  2L4M A;  2KRF A;  1ULY A;  3QWL A;  4L5J A;  4BHP A;  1MBK A;  1TL8 A;  2L02 A;  1SFK A;  3R6S A;  1S7E A;  5CVR A;  4J19 A;  1MBJ A;  4I01 A;  1B9N A;  1T56 A;  4XID A;  2ZC2 A;  1U8B A;  2X4H A;  4V19 K;  1ERD A;  4M6X A;  3V42 A;  3SJM A;  1MBG A;  4KIB A;  4YIF A;  1OYY A;  1R49 A;  2EIM H;  3BG7 A;  3W3C A;  1VQ6 I;  3E97 A;  4IHX A;  1O4X A;  3H5R A;  3QU3 A;  3P9I A;  2PMZ A;  1NTC A;  2Y9Z A;  1LPQ A;  2ECB A;  2VQG A;  1WSU A;  2QCO A;  2KZG A;  1V5E A;  2JSP A;  1HBX G;  2KJB A;  2H8R A;  1MSE C;  3G6E I;  2JN6 A;  2CQX A;  2F4I A;  4OU0 A;  2DA5 A;  2CV0 A;  1QRY A;  1LVK A;  2XV4 S;  5DYM A;  2HZT A;  1LDD A;  3WOD F;  2NVT J;  4AIJ A;  4F93 B;  1ZG3 A;  3RYR A;  2LOO A;  5JHF A;  2CO5 A;  3I64 A;  2OTL I;  3H9G A;  1A6I A;  2RQQ A;  1JI8 A;  4HQM A;  1XPX A;  4PGG A;  3T5X A;  1Y0U A;  4IQJ A;  1S7O A;  3ERM A;  4HF1 A;  2XDV A;  3DV8 A;  2BXY A;  1R1T A;  1X4O A;  1ZAO A;  2RQP A;  2HQA A;  3GWZ A;  2L7K A;  2ISY A;  2R7O A;  5B1B H;  3B6A A;  5EZG A;  3HOU J;  1RET A;  1BOB A;  3E1S A;  3I54 A;  3BJA A;  3V7S A;  3CC7 I;  2PJR B;  2H94 A;  1J5Y A;  2ESN A;  3FKJ A;  5E20 A;  5FKN A;  4HNV A;  2Z33 A;  2XPW A;  3ERE D;  4EM0 B;  4LK0 F;  3HSR A;  1OJL A;  2FML A;  5FKK A;  1L0O C;  3QPT A;  1M1E B;  1K78 B;  4GFB A;  1TWF J;  1T08 B;  1HKT A;  4N0B A;  2CQQ A;  5EGO A;  1EV7 A;  1R58 A;  5B3S H;  2F6C A;  4DYQ A;  2ME6 A;  4ZYE A;  5LFA A;  3TED A;  2ZJQ F;  4EQQ A;  1K4T A;  5EEH A;  4L5I A;  4XLE A;  2CRG A;  5EJC A;  4A3M J;  3OIP A;  3IWF A;  1WRJ A;  1PUE E;  1FIA A;  3GTK J;  1XGM A;  1QBJ A;  1GV2 A;  3CCU I;  4U87 A;  3ABU A;  4L9V A;  3WGG A;  3OS0 A;  1RKT A;  3CES A;  1FMV A;  3BTC A;  3L1P A;  4I2O A;  2GXB A;  1YQA A;  3CTA A;  1G3W A;  2EIK H;  2CH0 A;  2M7B A;  1REP C;  3FWE A;  1OR7 A;  3DFG A;  4NB5 A;  2KJC A;  2RVC A;  4L9N A;  1QO0 D;  1TQM A;  4F91 B;  2V6E A;  5J3L A;  5KNL A;  3JRH A;  1OFC X;  2VT2 A;  2JA6 J;  3K1P A;  1VQ9 I;  1RI7 A;  1Y1W J;  2HI3 A;  3SHF A;  2DOF A;  1VF9 A;  1XSV A;  1EKE A;  2O8X A;  5BS6 A;  4A6D A;  1X3W B;  2G9W A;  3ZCO A;  3IC7 A;  4P96 A;  1X1A A;  2XSJ C;  3FM3 A;  3BJ6 A;  1RC9 A;  4RBO A;  2HZD A;  1ETO A;  3FM5 A;  1YRN A;  4XKW A;  1QVU A;  4KYW A;  5FRM A;  2MSY A;  1HW5 A;  2FD5 A;  3JAM K;  3GFI A;  1DP7 P;  2I10 A;  1A5J A;  2WV1 A;  3CZ6 A;  5DEQ A;  2FEZ A;  4RAG A;  4L0Y B;  4LJZ F;  1ETW A;  2MW8 A;  4HW0 A;  3ZQL A;  1OPC A;  1HW1 A;  4M71 A;  3ZXS A;  5HLH A;  3L2W A;  2VOD A;  4ENJ A;  3ZQF A;  3OYI A;  2MG4 A;  3QAH A;  4ZDO A;  1NG6 A;  4LFU A;  1Z0X A;  4BJ5 C;  5F04 A;  3AAF A;  5M5W J;  3A0B C;  3ULQ B;  1HCR A;  3PO3 J;  4PCQ A;  1X3Z B;  1RKW A;  3HUG A;  3KEY A;  1IUY A;  2WAQ N;  5DD8 A;  2CUF A;  2QGU A;  4BQQ A;  4EJV A;  3FHZ A;  4Z6Y A;  3OYA A;  5IOZ A;  4RGS A;  4LD5 A;  1JHF A;  2K02 A;  3ABK H;  3G4S I;  1U3E M;  1IV6 A;  3OYL A;  3GFJ A;  5JI6 A;  2R5Y A;  1Y39 A;  3GFM A;  1AA7 A;  1W5C C;  2RRE A;  3QU6 A;  4A2U A;  1TT5 B;  1IO2 A;  1R9T J;  2MH2 A;  2VBX A;  5LRR A;  2GIV A;  4OMZ A;  3JRB A;  5J4Y A;  4JP0 A;  4GXO A;  2NXN B;  3I59 A;  4RMN A;  1MH4 A;  2L54 A;  3CMY A;  3KLO A;  1IDY A;  2M5W A;  1S3J A;  5IYD J;  4LLN A;  5D6F A;  3GZ5 A;  2ID6 A;  4BXU A;  2VBW A;  1V54 H;  1YO5 C;  2E19 A;  1ZRC A;  3IL2 A;  2CFO A;  2IJL A;  5DUK A;  5HS8 A;  3RKW A;  1X4P A;  3S3M A;  2ZB9 A;  1BOA A;  4JK1 X;  1W36 C;  2K9S A;  3FF5 A;  2H27 A;  2FXA A;  1MBF A;  3ZMU A;  2OAZ A;  1WH5 A;  3BWG A;  4C9Y A;  4BE0 A;  3DU5 A;  3P9K A;  1FZP B;  4XRS G;  2AO9 A;  5FRO A;  3G2B A;  2BV6 A;  2JJ7 A;  4ABZ A;  2QQA A;  5CYV A;  1IXR C;  2IRF G;  3HOS A;  1J59 A;  2QBY A;  4OIO F;  4WWC A;  1SEU A;  1R22 A;  1Y56 A;  5TIS C;  3JRA A;  3OYE A;  1YX5 A;  3H35 A;  3A01 A;  2XC7 A;  3GZ6 A;  3CME I;  4BXX J;  4EJU A;  1FOK A;  3HGY A;  4IOC F;  1VQ5 I;  4HF2 A;  1UB9 A;  2LRD A;  2XF5 A;  2RAE A;  1XGO A;  1DGR M;  3HXL A;  1U6G A;  3LSH A;  1ZQ3 P;  2FQ3 A;  2EFP A;  1T0F A;  1ZN2 A;  2KIU A;  2OJE D;  4M3G A;  4G7O F;  2K9N A;  1YJN I;  5HLT A;  4IEJ A;  2K4B A;  1PP8 F;  3OL3 A;  3CUQ A;  2DFE A;  5IP6 A;  3IRQ A;  3LFU A;  5J1Y A;  2M3A A;  4OMY A;  3L2V A;  2VE9 A;  3WU1 B;  1IF1 A;  2ECC A;  2KHM A;  1HXD A;  2KLO A;  4HOB A;  3CJQ B;  3LSR A;  4IHW A;  4NHJ A;  1F43 A;  2ACJ A;  2QYO A;  2QUF A;  1K7A A;  3A03 A;  3EYY A;  3F0C A;  3GLX A;  5F64 A;  3F8B A;  2VOP A;  1W36 D;  5HVQ C;  4ENM A;  4BS9 A;  1B4A A;  3IH4 A;  1ZR2 A;  2LP0 A;  4EM1 A;  4YEJ A;  2DU9 A;  3WG9 A;  5HS9 A;  4XRF A;  3CCS I;  1WI3 A;  3HOV J;  2MC3 A;  2BE5 F;  2IW5 A;  3WTV C;  2X9D A;  3OS1 A;  2R3S A;  2Q1Z B;  2UUZ A;  3HOW J;  3TO7 A;  1JKO C;  3K4L A;  2CV1 A;  4U0Y A;  4ZDP A;  2V1D A;  3BTL A;  2L7F P;  2DJI A;  1KGS A;  2BHY A;  1FBS A;  2YSR A;  3H1C A;  3DBL B;  3DKX A;  2VKE A;  3J7Z I;  2ISZ A;  1MIJ A;  1KQ0 A;  2FU4 A;  5DDG A;  3HC7 A;  2ZME A;  3SFZ A;  1B8I A;  2DBB A;  2O9L A;  5C4X J;  2ZBK A;  3R0J A;  3ZMT A;  2HEO A;  3OYM A;  1K79 A;  2MBF A;  2XGC A;  5HOD A;  3KP3 A;  1YG2 A;  2V1N A;  2Z9O A;  2FSW A;  1EH7 A;  4C2U A;  1R71 A;  3ZPL A;  2COB A;  5FFX A;  1MH3 A;  3B73 A;  5BPD A;  4XLC A;  3QRF F;  2DXI A;  1RUN A;  3CLQ A;  4MEY F;  1F36 A;  4KT6 A;  1W0T A;  1ETX A;  4M9X A;  1T39 A;  1TWA J;  3A1Y A;  2IS1 A;  4HQE A;  4WK8 F;  1W1W E;  4D1Q A;  4A93 J;  2OZ6 A;  3CUO A;  4HPQ A;  2MA3 A;  3QYB A;  4B4C A;  3HHH A;  3EUH A;  5L3E A;  3CO7 C;  3K1M A;  4UUT A;  1RZ4 A;  4HLY A;  3H3Z A;  1N75 A;  1IN8 A;  1TWG J;  3L00 A;  4IL6 C;  2R7U A;  2BVL A;  2Q8K A;  3S1N J;  4RS8 A;  4R1H A;  3ZN1 A;  2HDD A;  3LA3 A;  1Y0N A;  2OV7 A;  1R5H A;  2QSF X;  3PFY A;  2ZKZ A;  1XX5 A;  3O3K A;  4D9J A;  2DQL A;  2M0C A;  1FBQ A;  3MN2 A;  4MIM A;  2E1C A;  3LWF A;  2L7M P;  5HS7 A;  5D6E A;  2X85 A;  3OR2 C;  3VYT B;  2A6E F;  4HF0 A;  4BAC A;  4FTH A;  1XB4 A;  2P5K A;  2JSC A;  3PSF A;  5D8L B;  4XRS A;  2M8G X;  2DA1 A;  1G3S A;  4XKC A;  5EGO B;  1I50 J;  3ZGK A;  3FBN B;  1QHH D;  2ZJP F;  2BHZ A;  5LGU A;  1K61 A;  4P55 A;  1G4D A;  2GA1 A;  1KON A;  4FT8 A;  1BI0 A;  4HLX A;  4FCY A;  4XOT A;  2MYS A;  3BPV A;  1R4N B;  4B09 A;  3AG3 H;  1C0W A;  1IW7 F;  4JOM A;  2A07 F;  1IN6 A;  4PZJ A;  1BIA A;  1IC8 A;  2HTS A;  1UCR A;  5A2Q Z;  3H36 A;  1SD6 A;  3ZMS A;  3VSL A;  3NWT A;  4EJO A;  3LNQ A;  1MMA A;  3A02 A;  1IDZ A;  1YS7 A;  4BHC A;  4OIP F;  4G8X A;  1V5G A;  3J7A O;  4UV9 A;  3BLY A;  3BOQ A;  2GLO A;  3S8P A;  1K6O A;  1SMT A;  3BR0 A;  3MZH A;  2VB6 A;  2Z5U A;  2O6G E;  1TC3 C;  1JUS A;  2CSO A;  2HOE A;  1IZ1 A;  3FK6 A;  3RZO J;  2O61 A;  1H9T A;  1WJB A;  2WB1 N;  3MKZ A;  2NVX J;  4BKX A;  4XNF A;  2VI6 A;  5FB2 A;  2V9P A;  3H0G J;  2LYC A;  4F7Z A;  4Y7N J;  5DM7 F;  2W85 A;  4UHT A;  1QU3 A;  4HX7 A;  5JFR A;  1P6R A;  4A3G J;  1Z3X A;  4I98 B;  3VYU B;  1JHH A;  2A6T A;  3JAM Z;  1WGX A;  3CF5 F;  1H88 C;  3OR1 C;  1KQ8 A;  1YLF A;  3LFK A;  3RIR A;  2VPR A;  1MGT A;  1SAX A;  1IG7 A;  5L3C A;  4G7Z F;  3NWS A;  1T6S A;  4BE2 A;  3CMM A;  4CDG A;  3OL4 A;  1JKR C;  3OOU A;  1IN7 A;  2FBK A;  1ETY A;  1BC8 C;  4KA4 A;  1OCR H;  2HDC A;  4LIU A;  2EV6 A;  3BCA A;  4IF4 A;  2WWY A;  2R7V A;  2B7E A;  3F23 A;  2KIQ A;  1JKQ C;  5AIQ A;  2DA3 A;  5LGT A;  2LC2 A;  3Q5F A;  3NRV A;  3J81 Z;  5ICE A;  4PDK A;  2BGC A;  1S72 I;  3V8K A;  2OPT A;  4V2F A;  3VPR A;  1YX3 A;  3DTI A;  3DLL F;  1K83 J;  3K1N A;  3K9T A;  1XN7 A;  2E2H J;  2BOL A;  2VKH A;  3KYC B;  3W6J B;  3LSK A;  3JTG A;  1QQI A;  2EIL H;  4ZJZ A;  1E3P A;  3S17 J;  2P81 A;  2VXD A;  3C3W A;  5ICF A;  1KU2 A;  5M3F J;  2VQL A;  5E79 C;  3ZMD A;  3S32 A;  2Y0S A;  3WE2 A;  3BTI A;  3HDD A;  3UNG C;  1MMS A;  1ZG1 A;  1K6Y A;  4DIQ A;  4U0W A;  2IT0 A;  3I59 B;  4L5E A;  1CF7 B;  2E7W A;  4MHG A;  1Z21 A;  3OYN A;  2L3D A;  2HKX A;  1OCZ H;  4JX6 A;  1D5V A;  5EF6 A;  2M9H A;  2CFX A;  3HRM A;  5K7H A;  2FJ1 A;  4E4H A;  3ECO A;  4F92 B;  2P8T A;  3BT9 A;  4MQ9 F;  1UHW A;  5EG0 A;  3O8G A;  2CQK A;  4D0P A;  3S2D J;  4B44 A;  4ZH4 F;  2LNB A;  2X1E A;  1FJL A;  2BY1 A;  4QPQ A;  4RAY A;  2EA2 A;  2VN2 A;  2Y48 A;  4ASN A;  1DPU A;  2NYX A;  3U1D A;  3FMS A;  3DU6 A;  2KIM A;  2P6S A;  3JW4 A;  4S05 A;  1IGN A;  4LG0 A;  1LNW A;  1Z77 A;  1ZLJ A;  2QBY B;  3WTY C;  2GOX B;  1R1V A;  1FSE A;  2J5P A;  1O3Q A;  1AU7 A;  2ELH A;  1TZL A;  4V2G A;  5L3F A;  2XSD C;  3CCR I;  4Y17 A;  3K4B A;  2JMW A;  1JTX A;  3PSI A;  4UNO A;  1IXC A;  3RKX A;  1TWH J;  4WX9 A;  2Y0M A;  3CP2 A;  3N05 A;  2M4G A;  3CCL I;  2E35 A;  1J9I A;  3W2A A;  2L01 A;  4RLF A;  4YFN F;  4AM3 A;  3HSF A;  1CGP A;  3CUQ B;  4XOR A;  4Q4Z F;  2R7F A;  3DPU A;  3OIO A;  2L9S A;  2VJ4 A;  1S5L C;  4XQF A;  3COA C;  2WY7 Q;  2XAQ A;  2DI3 A;  3Q9S A;  1F9N A;  4A3F J;  3DEW A;  2BXZ A;  5K5O A;  1EF4 A;  3MQ0 A;  4IRH A;  4EM2 A;  2OQG A;  3LAJ A;  2F5D A;  4XSX F;  1XMK A;  4GYI A;  3PUB A;  4BAY A;  4ENN A;  3C2H A;  1QZE A;  2PG4 A;  3WGI A;  2HQN A;  2F2E A;  3F72 A;  1P92 A;  3H0D A;  1BR4 A;  3RYP A;  4HA8 A;  1X2N A;  1BI1 A;  2DW4 A;  3KP4 A;  5GPC A;  1VND A;  3MEX A;  2E36 A;  3CC2 I;  4IOA F;  2VJI A;  1OR7 C;  2V26 A;  3PFI A;  3VFZ A;  4XLA A;  1FY7 A;  1I3Q J;  3L7W A;  3L2R A;  4JQF A;  1ZGW A;  4EAT A;  1V3F A;  2HOS A;  1RNL A;  5LHG A;  1Y6I A;  1U5T A;  2XB5 A;  5FLX K;  1B72 B;  2P7C B;  4NC7 A;  4EJT A;  2NNN A;  3U9G A;  3HHG A;  2HYG D;  2XUB A;  4JX5 A;  4AUX A;  5E3M A;  1R5G A;  2DTR A;  1FT9 A;  2ZME B;  4WXD A;  3WTX C;  4UB6 C;  1U8R A;  3F8M A;  4LLL A;  2PX9 A;  1MBH A;  1R4M B;  3EQL F;  3CF2 A;  2E1M B;  3BG5 A;  5B1A H;  2EZL A;  3RKY A;  2HXI A;  1IN4 A;  5FKL A;  4BY7 J;  1GVD A;  4UUS A;  2BY3 A;  3DBH B;  1S29 A;  3E5Q A;  4Q5S F;  2X6W A;  3W2V A;  2VQH A;  5JR3 A;  4CZZ A;  4BHB A;  2KZV A;  3GUD A;  2NNY A;  1VQK I;  3TP3 A;  5K1Y A;  1Z05 A;  4Y15 A;  2L0K A;  4BBS J;  2Q2E A;  2ME0 A;  2XGE A;  3WTW C;  1JUP A;  4DBQ A;  2PMZ N;  3I55 I;  3FDY A;  1J75 A;  5F27 A;  2V1U A;  2HTJ A;  4ANJ A;  4NBQ A;  2G0E A;  1LFB A;  4RA2 A;  3J80 Z;  3LST A;  1ZRF A;  2I5U A;  1G3Y A;  2QEN A;  2L7Z A;  4PUS A;  3BG6 A;  4M72 A;  2YU3 A;  5CQE A;  5FJ8 J;  3AFH A;  4I76 A;  2P4W A;  3GX4 X;  4AID A;  3ROU A;  2ZXJ A;  5AIP A;  2IP2 A;  3CDL A;  3ABM H;  1JGG A;  4ENK A;  1NK3 P;  4ETS A;  2YX7 A;  4HDU A;  2P7V B;  2JZY A;  2MLK A;  3OOP A;  2NVU B;  4FAS D;  3PQK A;  3QPL A;  2PEX A;  1QA6 A;  4XM3 A;  3DLA A;  4DJA A;  3T0Y A;  1BI3 A;  2KRC A;  2IAI A;  5BQT A;  3I71 A;  4BQO A;  1I27 A;  1DDN A;  1TQP A;  4N9H A;  2WV0 A;  4DYC A;  4AVP A;  2PN6 A;  5IOY A;  5GAE J;  1BIB A;  3H9J A;  2WBM A;  1W0U A;  4Q48 A;  3OYB A;  3FBI B;  1OCC H;  1HF0 A;  5M5X J;  2XVC A;  3FXQ A;  3WTT C;  3BG3 A;  2M2E A;  1AKH A;  1BJA A;  2VKV A;  5CVJ A;  4BNC A;  3D5R C;  4BQN A;  5ERI A;  4LMY A;  2OCE A;  2WAE A;  4D5F A;  4ON0 A;  4N4O B;  1U78 A;  1JJ6 C;  1RUO A;  2LBF A;  1T95 A;  5GP9 A;  1Z6T A;  4EGY A;  2H8W A;  3LA7 A;  3OV8 A;  3IV5 A;  3RKQ A;  3HOZ J;  3BG9 A;  3WG7 H;  1YHQ I;  5E17 F;  2Y2Z A;  2FUG 2;  1D0Z A;  1BW6 A;  2LY2 A;  4YFX F;  1WQ2 A;  1ZKG A;  4UUV A;  4G9Y A;  1I6X A;  4ZC3 A;  2CW8 A;  1T0F C;  1SAU A;  2DK8 A;  3F6O A;  4QWQ A;  2DT6 A;  1RR7 A;  3CUQ C;  3P9C A;  3KP2 A;  4LB6 B;  2F48 A;  3CQZ J;  3DXJ F;  3TP0 A;  3HRS A;  1VQL I;  5CVI A;  4G6Q A;  3GEZ A;  5J1U A;  4PJ0 C;  1W7P A;  3ASO H;  3MD2 A;  4BYY A;  2ZXW H;  3OSF A;  5LD2 C;  2OU2 A;  1HA8 A;  1VTN C;  3O2P E;  3G3Z A;  4XMY A;  3CD6 I;  1FTT A;  4DOZ A;  2XGX A;  2DQR A;  3FXM A;  2XAJ A;  3K4K A;  3VOD A;  2IVM A;  3M7G A;  3SEQ A;  3ZMV A;  3CLO A;  1ZGJ A;  2VBZ A;  5CJ9 A;  5GAD J;  2E5N A;  2KMU A;  4BDY A;  5GAH J;  2P5L C;  1WVR A;  2DOD A;  2X1D A;  2UXN A; 
#chains in the Genus database with same CATH homology
 5C4J J;  2R5Z B;  2R93 J;  2IBD A;  1I6H J;  2TRT A;  3HEF A;  3TW7 A;  1B8I A;  2ELK A;  2YUS A;  3FK7 A;  5FKO A;  2O9L A;  1BA5 A;  4W97 A;  4M3F A;  5C4X J;  1VI0 A;  4X6A J;  4AYB N;  4BY1 J;  2XGC A;  5BNG A;  3JRC A;  2E2I J;  3K7A J;  5HOD A;  3FIW A;  4D5C A;  3JRG A;  1UHS A;  2COB A;  3LOC A;  1MH3 A;  3HBL A;  4M3E A;  4MLO A;  4AC0 A;  3LSJ A;  4M3B A;  1ORK A;  5M3M J;  1F36 A;  4B1R A;  5F0C A;  1T33 A;  1W0T A;  1ETX A;  1UG2 A;  1TWA J;  3JRI A;  3W6V A;  4A93 J;  4Y52 J;  3Q3S A;  2NS7 A;  3FIS A;  5E3N A;  1ZTR A;  5M5Y J;  4B4C A;  3D1N I;  1G2H A;  1IUF A;  4UUT A;  2HXO A;  2NVY J;  1FTZ A;  1TWG J;  2EZH A;  4D7M A;  4M6V A;  2DMN A;  3S1M J;  3S1N J;  4LOC A;  2HDD A;  1ENH A;  4A3I J;  1ZR4 A;  4QTR A;  3JRD A;  5EDN A;  2Y31 A;  3LSP A;  3M4O J;  2YS9 A;  2M0C A;  3MN2 A;  1JT0 A;  4MIM A;  2DA7 A;  2D5V A;  2L7M P;  3JRE A;  2DN0 A;  2DTZ A;  2JA8 J;  4C3J J;  1XG1 A;  4FTH A;  3S1R J;  4MO7 A;  4XRS A;  1RPW A;  2M8G X;  2DA1 A;  5EYR A;  5EGO B;  1I50 J;  2XB0 X;  1ETQ A;  1K61 A;  4FCY A;  3CCY A;  3GTL J;  1QVT A;  1Y1V J;  2KT0 A;  3QQA A;  1ETK A;  3GTJ J;  1IC8 A;  2GM4 A;  2CJJ A;  3LNQ A;  2LY9 A;  3A02 A;  1IDZ A;  2L9R A;  2EBI A;  3SDG A;  5DTD A;  2DMP A;  2GLO A;  3ZQG A;  4DZP A;  4BBR J;  3BR0 A;  3RQI A;  5JLX A;  5FLM J;  1TC3 C;  1JUS A;  1LE8 A;  3FKI J;  3FK6 A;  3RZO J;  3WHB A;  2NVQ J;  2NVX J;  2WB1 N;  1ITY A;  5IPA A;  4BKX A;  3DCF A;  2EH3 A;  2VI6 A;  1X58 A;  3H0G J;  2HOT A;  4Y7N J;  2E1O A;  2QF7 A;  3Q0V A;  3BR3 A;  3S16 J;  4A3G J;  4RDU A;  3HGG A;  5E3L A;  3S1Q J;  1IRZ A;  2TCT A;  4IHY A;  1WGX A;  2XGD A;  1H88 C;  4XIC A;  4A3J J;  5C3E J;  2VPR A;  3G1O A;  3GBG A;  2R92 J;  2EZI A;  3B6C A;  1PUF B;  5F1J A;  1IG7 A;  2YU9 J;  2MGQ A;  3SFI A;  1IJW C;  2JA5 J;  3ZQH A;  5JLW A;  1VFC A;  4W1U A;  4X1E A;  1JKR C;  3OOU A;  1PUF A;  2JA7 J;  1ETY A;  2XPU A;  2R5Z A;  1APL C;  1JKP C;  2AHQ A;  1QPI A;  4A3L J;  1UMQ A;  2NOG A;  1JKQ C;  2DA3 A;  1D5Y A;  1HOM A;  1RES A;  1CQT A;  2OPT A;  2R7Z J;  4V2F A;  4UUS B;  3VPR A;  1MBK A;  4DZJ A;  1S7E A;  1K83 J;  2Y9Y A;  3TW6 A;  1MBJ A;  4FIS A;  4XID A;  1T56 A;  4J19 A;  1U8B A;  1H89 C;  2E2H J;  4I6Z A;  3SJM A;  1MBG A;  1X2M A;  4DYR A;  2IEK A;  4IHX A;  2HOA A;  3BQZ A;  3QPS A;  3BR5 A;  1O4X A;  2DA2 A;  3S17 J;  1HDP A;  2P81 A;  2Y9Z A;  1NTC A;  5M3F J;  4A69 C;  2VUM J;  2ECB A;  3GTP J;  3HOX J;  2QCO A;  1ZK8 A;  3BTI A;  3HDD A;  4XK4 A;  2H8R A;  1MSE C;  2JN6 A;  2CQX A;  2Y30 A;  2DA5 A;  1QRY A;  4M3D A;  2XRL A;  2NVT J;  4L5E A;  4MFD A;  4C2M J;  4JX4 A;  4JX6 A;  2KDZ A;  3I4M J;  5EF6 A;  2M9H A;  5EG0 B;  5K7H A;  2FJ1 A;  3LSG A;  4FE4 A;  3OSG A;  1GT0 C;  1A6I A;  1H8A C;  2LVS A;  3BT9 A;  5EG0 A;  3MKL A;  3O8G A;  3S2D J;  2DJN A;  3E7L A;  1FJL A;  1GUU A;  3B6A A;  5EZG A;  3HOU J;  1RET A;  1SAN A;  1P7J A;  1WH7 A;  5FKN A;  4HNV A;  1IGN A;  2XPW A;  1Z77 A;  5F08 A;  4CYC B;  1OJL A;  2B63 J;  2CUE A;  5FKK A;  4GFB A;  1JJ8 C;  5DS9 A;  1TWF J;  1E3O C;  2DMT A;  4A3D J;  1AU7 A;  3ZOB A;  4V2G A;  2CQQ A;  5EGO A;  2XSD C;  2JMW A;  1JTX A;  3NAU A;  4DYQ A;  2ME6 A;  3TED A;  1GDT A;  5FLV A;  1TWH J;  3C2B A;  2CRG A;  4A3M J;  2DMU A;  1FIA A;  4NDL A;  4C3H J;  3GTK J;  2LKX A;  1GV2 A;  3BR1 A;  1OCP A;  3OIO A;  5FKM A;  1RKT A;  1FIP A;  3BTC A;  3L1P A;  4A3F J;  3DEW A;  2EZK A;  4C3I J;  1EF4 A;  1WPK A;  3S15 J;  5J3L A;  3JRH A;  1FEX A;  1OFC X;  2JA6 J;  3RZD J;  1BW5 A;  1Y1W J;  2HI3 A;  1VF9 A;  1X2N A;  5GPC A;  2HYJ A;  1VND A;  3I4N J;  1YRN B;  3HOY J;  3BQY A;  3G1M A;  4A3E J;  1I3Q J;  2N8G A;  4A3B J;  5GPA A;  4RBO A;  1ZGW A;  1ETO A;  2DA4 A;  1YRN A;  1QVU A;  2HOS A;  2MSY A;  2FD5 A;  2XB5 A;  5IP7 J;  1MSF C;  1B72 B;  3S2H J;  1WCM J;  2GBY A;  2LK2 A;  3MVP A;  2I10 A;  1LFU P;  5K7Z A;  1A5J A;  5EZH A;  2WV1 A;  1NK2 P;  1U9O A;  4S0H B;  3JRF A;  4QSH A;  4JX5 A;  4AUX A;  1ETW A;  5E3O A;  5E3M A;  1B72 A;  2MW8 A;  3BR2 A;  3ZQL A;  1HLV A;  1ETV A;  2LD5 A;  3H3V K;  3BR6 A;  3ZQF A;  2MG4 A;  1Z0X A;  1DU6 A;  5F04 A;  5M5W J;  1MBH A;  1HCR A;  3PO3 J;  2CU7 A;  1RKW A;  3BG5 A;  2OF7 A;  2EZL A;  3HB9 A;  5EEA A;  2HXI A;  5FKL A;  4MFE A;  2WAQ N;  1MNM C;  1Q1V A;  1GVD A;  2CUF A;  4BY7 J;  4UUS A;  2R5Y B;  1U9N A;  1DU0 A;  1HDD C;  3K2A A;  5IOZ A;  5IYC J;  2HQ5 A;  2O8K A;  3ZQC A;  1JTY A;  5F0F A;  1IV6 A;  1OCT C;  2R5Y A;  2DA6 A;  3GTM J;  3IH3 A;  1XS9 A;  5C44 J;  1R9T J;  2JK3 A;  3TP3 A;  2W48 A;  3IH2 A;  3HKZ N;  2L0K A;  4BBS J;  5IYB J;  2ME0 A;  1SFO J;  2XGE A;  3JRB A;  4A3K J;  1JUP A;  2PMZ N;  4JP0 A;  3GTQ J;  5F27 A;  2LFB A;  2Y0S N;  2G0E A;  1LFB A;  1MH4 A;  2LR8 A;  3CMY A;  1JUM A;  2K40 A;  1GV5 A;  2L7Z A;  1IDY A;  5IYD J;  5FJ8 J;  2ID6 A;  4I76 A;  1XC5 A;  2E19 A;  2LTP A;  3GTO J;  2ZB9 A;  2X6O A;  3CDL A;  1BJZ A;  1TWC J;  3GTG J;  3O8H A;  3JR9 A;  2K9S A;  1JGG A;  5K7F A;  1NK3 P;  1MBE A;  3Q0W A;  1MBF A;  3M3Y J;  3BTJ A;  3ZQI A;  1WH5 A;  3QPL A;  2NS8 A;  4XRS G;  2AO9 A;  3G1L A;  2IAI A;  2JJ7 A;  4ABZ A;  5J1R A;  4XRM A;  3A01 B;  4DYC A;  5IOY A;  1BL0 A;  4CYC A;  1JT6 A;  4JYK A;  1W0U A;  3JRA A;  1AKH B;  3A01 A;  4BXX J;  1HF0 A;  3NAR A;  5M5X J;  3UKG A;  3HGY A;  3BG3 A;  2M2E A;  1AKH A;  2O7O A;  2VKV A;  2E2J J;  2RAE A;  1P7I A;  2XPV A;  3PO2 J;  1ZQ3 P;  4IHV A;  3Q0U A;  4M3G A;  4D5F A;  4QIW N;  4DW6 A;  2K9N A;  4D7N A;  1U78 A;  2JWT A;  4IEJ A;  1JJ6 C;  1AHD P;  5IP6 A;  5GP9 A;  2X48 A;  3IV5 A;  5J1Y A;  3RKQ A;  3HOZ J;  3BG9 A;  2Y2Z A;  1BW6 A;  2ECC A;  1ZKG A;  3HM5 A;  3WHC A;  3LSR A;  1LE8 B;  4IHW A;  2M34 A;  1F43 A;  4B3A A;  3A03 A;  3F0C A;  1RR7 A;  2ID3 A;  3CQZ J;  3TP0 A;  2FQ4 A;  2DMQ A;  5IP9 J;  5J1U A;  3IH4 A;  1ZR2 A;  2LP0 A;  4FE7 A;  5F0H A;  4A3C J;  1WI3 A;  3HOV J;  3OSF A;  1FTT A;  2EQR A;  3S14 J;  2X9D A;  4EEF G;  4G12 A;  9ANT A;  3HOW J;  1JKO C;  2FX0 A;  2H1K A;  3BTL A;  2L7F P;  1B8I B;  2LLK A;  1POG A;  2K9Q A;  3PM1 A;  2R0Q C;  2VKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...