1FIAA

Crystal structure of the factor for inversion stimulation fis at 2.0 angstroms resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
79
Chain Sequence
VLTVQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the factor for inversion stimulation FIS at 2.0 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords FACTOR FOR INVERSION STIMULATION (FIS)
total genus 30
structure length 79
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fiaA00
1UG2A 4UUTA 3W6VA 3FKIJ 4I6ZA 3S17J 1MBFA 4QTRA 2XB0X 1DU6A 3GTPJ 4DZPA 4FE4A 3WHCA 1K83J 2DA7A 2I10A 4DW6A 2DMNA 3OSGA 2OF7A 2E2HJ 3HBLA 1D5YA 1Q1VA 1B72A 5EGOB 4IHYA 5BNGA 4AYBN 3S2DJ 3NARA 3BR2A 1JGGA 4MFEA 2ELKA 1G2HA 1GV5A 4A3BJ 3VPRA 3MKLA 1PUFA 4JX6A 5J3LA 4X1EA 1JJ8C 1Z77A 2VPRA 5EG0B 3D1NI 2Y0SN 3FK6A 5IPAA 3G1MA 2OPTA 2M9HA 4LOCA 2NVTJ 5C4XJ 4RBOA 4C3JJ 5IP9J 2E2IJ 3JRHA 4D5CA 4M3DA 1IDYA 4BKXA 3JRIA 1IGNA 4JYKA 2DA6A 2ME0A 2P81A 3JRDA 2E1OA 3TP3A 3S1NJ 2R93J 2R5YB 4A3MJ 3BT9A 2WB1N 3HOYJ 1BW6A 4NDLA 5EDNA 1JUMA 2CQXA 2HI3A 3F0CA 3C2BA 5F0FA 2R5YA 3A03A 4MLOA 1SFOJ 2DN0A 5F0CA 1GDTA 2D5VA 2HXOA 2LK2A 3LNQA 3K7AJ 3S14J 2X6OA 1B8IA 3HDDA 1HF0A 2VUMJ 2GLOA 2K9SA 3GTJJ 4UUSA 2AHQA 4M3GA 2GM4A 1ITYA 1QVUA 2CUFA 2VI6A 2M8GX 3S1QJ 2MW8A 2L9RA 3OOUA 3QQAA 1R9TJ 2NVQJ 1LFUP 2EZIA 1ETVA 1GUUA 2TCTA 5J1YA 1FIAA 4EEFG 3IV5A 3JRAA 1JTYA 1ETKA 2K9NA 4FISA 3OSFA 3K2AA 4B1RA 3TP0A 1Y1WJ 2QCOA 5M3MJ 3IH2A 1RETA 1JT6A 1FTZA 2O7OA 3TW7A 2DMQA 2Y31A 4BXXJ 2XGCA 1HDDC 1P7JA 3BR0A 2Y9YA 4HNVA 1JKOC 3JREA 2PMZN 3TEDA 5M3FJ 2QF7A 3ZQGA 2Y30A 3O8HA 4AC0A 1QRYA 3BQYA 4CYCA 2JA6J 2TRTA 1ZTRA 3WHBA 3BR5A 4J19A 1AHDP 1T56A 1I50J 1Z0XA 1POGA 1JJ6C 3NAUA 4C2MJ 2EBIA 1BL0A 5FKLA 3B6AA 4M3FA 1H89C 4FE7A 1H8AC 4BY7J 2DA5A 1U8BA 3S15J 3FISA 1WGXA 2DMUA 1X58A 2JA8J 1JTXA 4JX5A 4A3IJ 3HOUJ 5EF6A 1MSEC 4XK4A 3M4OJ 2W48A 4Y7NJ 1F36A 3BTJA 2XRLA 1TC3C 2JA7J 1I6HJ 2YU9J 1B8IB 2N8GA 3B6CA 2R5ZA 5DS9A 5JLWA 2ME6A 4B4CA 5IP6A 4A3DJ 1OFCX 2LFBA 1ZKGA 2ID6A 3DEWA 1FIPA 2LP0A 4FCYA 5FLMJ 5FJ8J 5GPAA 2FQ4A 2G0EA 5JLXA 5E3OA 3LOCA 5EG0A 2AO9A 2Y9ZA 1QPIA 2JA5J 3ZQIA 5E3LA 4S0HB 1VF9A 2M0CA 1X2MA 3GBGA 1O4XA 2EQRA 2CQQA 4W97A 3UKGA 5C44J 1SANA 4M3EA 2HOSA 3QPLA 2K40A 3L1PA 1I3QJ 1U78A 1RESA 2IAIA 3ZQLA 2JK3A 1W0TA 1MSFC 1ETQA 5C4JJ 5M5YJ 5FLVA 1RPWA 1JT0A 2L0KA 3Q3SA 5IYBJ 3LSPA 3DCFA 3JR9A 3HOVJ 3H0GJ 4JX4A 1RKTA 2M34A 1HCRA 4JP0A 2R5ZB 1LE8B 5FKNA 3Q0VA 1TWGJ 1JUPA 1TWCJ 2KT0A 2IEKA 3BTIA 1IC8A 3I4NJ 2X9DA 5IOZA 3M3YJ 3ZQHA 4B3AA 3S1MJ 2VKEA 4DZJA 5F0HA 2NVYJ 2X48A 3PO3J 4G12A 3S16J 3LSJA 3JRFA 1E3OC 1YRNB 3OIOA 1U9OA 1OCTC 2LVSA 1WPKA 2LD5A 3BQZA 4QIWN 1AKHB 2R7ZJ 5K7HA 5EYRA 1IG7A 2JN6A 1A5JA 2XPUA 1S7EA 1IUFA 3QPSA 1OJLA 1GT0C 1IRZA 4M6VA 1LFBA 4D7MA 3G1OA 1U9NA 1MH4A 4A69C 4DYRA 1ZR4A 3SDGA 4Y52J 2H1KA 3A02A 1DU0A 1ETXA 1XC5A 4XRMA 2O9LA 5IOYA 4A3CJ 2LR8A 3G1LA 2NVXJ 1IJWC 1IV6A 2B63J 1OCPA 5E3MA 3Q0WA 2DA4A 1Y1VJ 4IEJA 5DTDA 5J1UA 3IH3A 1ETWA 4FTHA 1BA5A 2JWTA 1WI3A 5FKKA 4W1UA 2ZB9A 1UMQA 1IDZA 1PUFB 1K61A 2ECBA 2XGEA 4MO7A 1GV2A 1TWFJ 1ZQ3P 1F43A 1ETYA 1FEXA 2VKVA 3ZQFA 3IH4A 1T33A 2XB5A 5IP7J 1WH7A 2CUEA 4A3KJ 1NK3P 3PO2J 2MG4A 4BBRJ 3GTGJ 2DA2A 1AKHA 2DMPA 1EF4A 3PM1A 2H8RA 2YS9A 3BR3A 2FX0A 1YRNA 5E3NA 3S1RJ 1HDPA 4RDUA 1FTTA 2NOGA 5K7ZA 2IBDA 3S2HJ 3CQZJ 2LLKA 1UHSA 1HLVA 3CMYA 1H88C 2O8KA 2M2EA 2JMWA 2HOTA 1W0UA 1RKWA 2XPVA 1MH3A 3I4MJ 4QSHA 1BW5A 3RQIA 2NS7A 4ABZA 4L5EA 1APLC 4MIMA 2EZKA 3H3VK 3Q0UA 4IHWA 2LKXA 2K9QA 4DYQA 3HOZJ 1RR7A 1ZK8A 3CCYA 2R92J 5F04A 5J1RA 5EEAA 1VNDA 3HEFA 1ETOA 4I76A 2RAEA 3MVPA 2E2JJ 1A6IA 2E19A 2HOAA 2WAQN 2HXIA 5F27A 2MSYA 2LY9A 4IHVA 3LSRA 3ZQCA 1ENHA 1LE8A 3HOWJ 1NK2P 1XS9A 1BJZA 2ID3A 3BR6A 1MBKA 1XG1A 3HGYA 4UUSB 4IHXA 2FJ1A 2MGQA 3RZOJ 3GTMJ 1AU7A 4A3FJ 4XRSG 4BY1J 2XGDA 1ZR2A 5F1JA 1CQTA 2DA1A 2CJJA 4X6AJ 3JRGA 4A3EJ 5C3EJ 3HOXJ 1MBEA 2CRGA 3LSGA 3MN2A 4C3HJ 3RZDJ 1MNMC 2XSDC 1MBHA 3HB9A 4M3BA 9ANTA 5FKOA 2CU7A 5M5WJ 5GP9A 1JKPC 2WV1A 1MBGA 2HQ5A 3A01B 5M5XJ 3BG5A 2EZHA 3ZOBA 4XICA 2L7FP 2L7MP 3HKZN 3TW6A 3BTLA 5IYDJ 5EGOA 4A3JJ 3GTOJ 3BR1A 3JRBA 1X2NA 2DJNA 3SJMA 4GFBA 2JJ7A 3SFIA 4D5FA 4XRSA 4CYCB 5EZHA 5IYCJ 1GVDA 1VFCA 4A3GJ 3GTLJ 3JRCA 4AUXA 2KDZA 1ZGWA 2LTPA 5FKMA 1QVTA 2FD5A 3HGGA 1NTCA 5GPCA 3RKQA 2DA3A 4V2GA 3BG9A 1MBJA 3BG3A 1FJLA 3BTCA 3GTKJ 1B72B 4C3IJ 3O8GA 5HODA 1WH5A 1WCMJ 1VI0A 5K7FA 1JKQC 4BBSJ 2GBYA 4V2FA 1JUSA 5EZGA 3E7LA 3FIWA 2XPWA 1P7IA 2DMTA 1JKRC 2YUSA 4XIDA 2R0QC 4A93J 2L7ZA 2HYJA 4MFDA 3A01A 3HM5A 2HDDA 3CDLA 3GTQJ 1ORKA 2ECCA 2COBA 2DTZA 4D7NA 4A3LJ 2EH3A 1TWHJ 2Y2ZA 1HOMA 2EZLA 1TWAJ 2NS8A 4DYCA 3FK7A 5F08A
chains in the Genus database with same CATH superfamily
4LG3A 4UUTA 1F9NA 1YOVB 5H6RA 3OYDA 5CVRA 3WU2C 2QBYB 3S17J 1YO5C 2LMDA 3TL4X 4QTRA 3E6BA 4E7JA 1J59A 1UB9A 4FE4A 1ACIA 1K78A 4C2TA 5FFZA 3K4JA 5AONA 1FX7A 2BHZA 3OSGA 1XSXA 1A36A 4L9NA 1S6LA 3MZYA 3BJAA 3HPGA 2HQNA 3KP2A 2H09A 4M74A 3NARA 1E17A 4AU7A 4MFEA 2ELKA 4XMYA 3VDXA 3SQNA 1W5TA 1XTAA 4HQMA 2BOLA 4A3BJ 3F3XA 1D0ZA 5E79C 3EUHC 4X1EA 1OR7C 1Z77A 4H0EA 2VPRA 3CDHA 4AIDA 2R7RA 4MGRA 3DU6A 1BM9A 2QZ8A 3KP3A 3G1MA 5GAHJ 2RVCA 4JQFA 2QM3A 1UG0A 2NVTJ 5C4XJ 4B09A 2PLYA 3EETA 1ZLJA 3K6GA 4KT6A 4ESBA 1IDYA 1TNSA 4D9JA 4BAYA 1I3AA 2BY1A 4HA8A 4RA2A 3DBRB 2MYSA 2K86A 2WA0A 3E6CC 5A2QZ 1WJCA 3MWMA 1MD0A 4YEJA 2X51A 1WJDA 2R93J 5HNFA 3NWTA 4EGYA 1R23A 2R7TA 3WTWC 1IZ1A 4HYEA 2IJLA 1GHCA 3C2BA 3F0CA 5LLQA 3R61A 4AYBA 4FX4A 4MLOA 4G7HF 3CCLI 4CZZA 2RNGA 2DN0A 4RB3C 2QQ9A 4CXFA 4GYIA 4N0BA 4S05A 4GRIA 2DW4A 4PJMA 3V7CA 1WKMA 3S8PA 4BACA 4HPQA 2BY0A 1J75A 3GTJJ 2BXZA 1O3SA 1T0FC 4BHCA 4Z6YA 4DGWB 1J0RA 2M8GX 2KISA 4XN0A 1H9GA 4E7IA 2KZGA 3MFKA 3TDUC 4Y13A 1FIAA 3HZJA 3IV5A 2R4GA 1W7PA 3KPHA 1T38A 1PP8F 3OSFA 3N05A 3K2AA 3TP0A 2QCOA 2DT7B 3KYDB 5D8LB 5M3MJ 4UHTA 2VASA 3WTZA 4HDVA 2ICWG 3ASNH 3DTIA 2FQ3A 3OMYA 4HV5A 2XGCA 3DLLF 4M9ZA 1Z9CA 2LF7A 4UXNA 3VEPA 2UWMA 1USSA 3I54A 3P5JA 2DOEA 4A6DA 4IF4A 2DQRA 2KRHA 4GGGA 4P1WA 2KKOA 2F5CA 2XGXA 3I56I 1W5SA 1ERDA 4KT5C 1QNTA 4YIFA 1N77A 2VE9A 5TISC 5FKLA 3I71A 5TJJA 4NC6A 3GZ6A 4P5OA 4CYDA 3DPUA 1A6QA 1JTXA 4JX5A 4Y4RA 4ZC3A 5HVQC 4ZJZA 3CC2I 1Y8RB 1MSEC 3HYIA 5BOXA 1NHAA 2R7FA 3GVAA 3FXKA 3ABMH 3LL7A 2V1XA 4O3MA 4EGZA 3BTJA 2XRLA 1I6HJ 1R6RA 2VJIA 1B8IB 4ENJA 3SXYA 3HRMA 3B6CA 5DS9A 3OYGA 3SZTA 3E0JB 5J4VA 5FRNA 2K85A 2LFBA 3ZMSA 2COMA 1ZKGA 3FM5A 2AQEA 2KIUA 3PIPF 1ZRCA 2HOEA 3R6SA 3QPHA 1W1WE 1MJBA 1TQPA 1V4RA 5JLXA 5EG0A 1OCZH 3LOCA 5E3LA 4AIKA 1DP7P 4KIGA 4I01A 3V8KA 2CQQA 3OYBA 1PVEA 4W97A 1QZZA 1KU7A 1SANA 3P7NA 4XORA 3REOA 2L9VA 2HQRA 1I3QJ 3R0JA 4BJ6C 4ZYHA 3H3ZA 4RGUA 4HSTA 2XKOA 3L9FA 5CVVA 1Z1DA 1B1BA 5M5YJ 3LAPA 4GCVA 1VQ7I 3EYYA 4F55A 3LSPA 3CUQC 4UV9A 3T5XA 4HOBA 5DCMA 3DCFA 1YQAA 4XBFA 3HOVJ 1LFPA 3H0GJ 4IHSA 3EYIA 4JP0A 1ZGAA 3GZNB 2FBHA 1REPC 1TWGJ 3E97A 1JUPA 3VFZA 2FMYA 3FM3A 3I4PA 3T8RA 5KK1A 3K4BA 2ETHA 4G6QA 1S5LC 2X9DA 3I4NJ 4A5MA 1X1DA 2VKEA 3S1MJ 1Y0NA 3KCCA 3H35A 4MHGA 3FKJA 1OKRA 1O3QA 2W4SA 2YX7A 3PO3J 4KFCA 2ISYA 3TO6A 1FZPB 1TNTA 2X6YA 2LVSA 2LD5A 3A0HC 3J80Z 4RB0A 2E5NA 1DUXC 2CUZA 2HGCA 2M30A 5EYRA 2A6TA 1XGNA 2EA4A 2Y48A 1IG7A 3ZMZA 3CMEI 1A5JA 1I1SA 4DNCA 2DFIA 3L00A 1OJLA 2DFHA 1GT0C 4HRIA 4M6VA 1IRZA 2VJ5A 2BXYA 4D7MA 4KISA 3A4CA 4OWRB 1ZR4A 3SDGA 2B9SA 4CCMA 2GZWA 2H1KA 3O2PE 4XKBA 3V7SA 3BZKA 1YTYA 3CC7I 5IOYA 2F4IA 2YU3A 4NB5A 3WGHA 2FEZA 2DCEA 1XSDA 2KIQA 2HDWA 2XDVA 3CCRI 1X1PA 2ZXHA 1SFKA 1SEUA 4IO9F 3C2GA 4H4KC 1J09A 2E71A 2NYXA 2P7VB 2ZXWH 1ETWA 4FTHA 1XSVA 5K5QA 3TO7A 2KPMA 3A0BC 4W1UA 1V3FA 1IDZA 1PUFB 1WJ5A 1YE9A 1D1AA 4IOCF 3RI4A 1VQNI 1GV2A 4P96A 2ZJQF 1TWFJ 3OY9A 1ZREA 3CO6C 3CP8A 1XDSA 2XB5A 4I0AA 4PK4A 1SVOA 1KYWA 1K4SA 2MG4A 3GW2A 4BBRJ 1IAWA 1MW7A 1VQ4I 2KRFA 4JK1X 3HHHA 1X1CA 3GTGJ 4UUVA 2DMPA 3Q9SA 1MMSA 3AKZA 2V7FA 2YS9A 3TDZC 2FX0A 4KICA 1FTTA 2NOGA 5K7ZA 2EV5A 3S2HJ 3CCSI 2M4GA 4BU2A 3M07A 3LA7A 2P0WA 3QP6A 2AXLA 2ZBKA 1BI0A 2XAUA 1H88C 4EJUA 4LGWA 2HOTA 3TKYA 2RKHA 4ENMA 1RKWA 5ERIA 5LHGA 2NS7A 4ABZA 1ZYRF 3LSHA 2L01A 4MIMA 2OCEA 2DDBA 2RDPA 3Q0UA 2K9QA 3PSFA 4CCKA 3LA2A 5DCMB 3CCYA 4TV7A 5F04A 5J1RA 4I0BA 2IS2A 1WJBA 1VNDA 3OR1C 4RAZA 2ISZA 3WG7H 4BJ5C 4ITVA 1XCVA 5D4SA 5GAEJ 1A6IA 2HOAA 1R49A 4P55A 2WAQN 5CVUA 2HXIA 3WE2A 5FLXZ 1A35A 2H1LA 5E8IA 3ZQCA 3OL4A 2V9PA 3CUQB 4ESJA 3WGIA 1NK2P 1XS9A 2H27A 3LMMA 4L5IA 2X6XA 1MNEA 4IHXA 1K6YA 5B5EC 3DU5A 2BW3B 2DYRH 4A3FJ 2GWRA 2FSWA 3QWLA 1Z6TA 4AM3A 4I7HA 1CQTA 2LY2A 3IWFA 2BHYA 1E2XA 5HS9A 1CF7B 2LREA 2ZFWA 4A3EJ 3GFLA 4B44A 1XPXA 4C3HJ 3MN2A 3RZDJ 3WGGA 3H0DA 5HLTA 1XCBA 2CU7A 2K4JA 5DYMA 5D5VB 5M5WJ 3BG5A 1RR8C 3PNVA 2L7FP 3BTLA 2HVRA 3DP7A 2LBFB 4XN3A 4HX8A 3BR1A 4XOTA 1B59A 2CH0A 2FNAA 3SJMA 4KIBA 3PJRA 3SFIA 3QOPA 1X4PA 4D5FA 2BE5F 4OU0A 1HBXG 1VFCA 2EFQA 3JSPA 2E7WA 3JRCA 1G3YA 3E5QA 3HHGA 4AUXA 2LTPA 2L2OA 1G3WA 4OAZA 2IRFG 3WTVC 1CGPA 3BG9A 4II2A 2DDAA 3BG3A 3F8MA 1YW9A 1U5TB 1WJFA 1N78A 2R7VA 1ZLKA 1IXRC 3GTKJ 2Z33A 1UAAA 1Q1HA 4C3IJ 5F64A 5HODA 2ZXIA 1WH5A 2CS3A 1Z05A 2DPUA 2M45A 2GBYA 4M6YA 1KU3A 4E7HA 4CUGA 1W7PD 2F2EA 5K1YA 4Y17A 3HRUA 5IY5H 2PBIA 1HC8A 3SEZA 1JKRC 4M73A 2R7SA 4XIDA 2L4MA 4ANJA 1JHFA 4ZYGA 2ECCA 3BPVA 2A5WA 2DTZA 4HSRA 4D7NA 1WHUA 2VB6A 2IGNA 2W1OA 2EZLA 3WTTC 4N9HA 1O3RA 3HXLA 1FBUA 2AXTC 2QUFA 3H9QA 2ZMEB 3U1DA 4F52A 1UG2A 3K1PA 3TOBA 2IP2A 4M9SA 2RV8A 3W2WA 3CP2A 1YIOA 2KJCA 2NVUB 3W6VA 4F7ZA 1HSJA 1MBFA 5JHFA 2XB0X 1DU6A 1GLNA 4DZPA 4FT8A 1K83J 2Q8KA 3SZGA 5JFRA 4LFUA 2RC4A 2OF7A 1D5YA 2LOOA 5EGOB 1VQ9I 4BQAA 3EUHA 4U7BA 3M1EA 1LPQA 4L0ZB 3F23A 4AYBN 2TDXA 2M1BA 2A61A 2A6EF 3BR2A 1IN8A 3KP6A 4E7ZA 3TO9A 3RPUD 1PUFA 1YJNI 1TW2A 5J3LA 1JJ8C 5L3FA 5EG0B 3D1NI 1V5FA 2DAOA 1G8XA 3VYSB 2HFHA 2KZVA 2VOPA 2JPCA 2OPTA 2BVMA 4L9JA 1K79A 2V6EA 4LOCA 3J81Z 4Y15A 1LDJA 4KA4A 4RGSA 3JRHA 2E2IJ 1JI8A 3GLLA 1IXSB 1XDUA 1MDMB 2O0YA 4DBQA 3UNGC 3JRIA 4BKXA 1IGNA 1KYZA 3KEYA 4HG2A 2FBKA 4MQ9F 3ECOA 3QPTA 2QGUA 4EV0A 2O5RA 2P81A 4HAMA 2XAQA 3VWBA 1PUEE 2CV2A 3IKVA 2VXDA 4DIQA 4A3MJ 2ZJRF 2BBYA 1FP2A 2WB1N 2X6WA 3FZVA 2CQXA 2HI3A 1N25A 2R5YA 1D0XA 2MBFA 3A03A 1SFOJ 3OWTA 3ZCOA 1IRFA 5K5RA 2G9WA 1LVAA 1BOBA 4YRVA 2DQLA 4HDUA 1T0FA 4MTEA 2QQAA 1KA8A 2HXOA 4XSXF 4LG0A 3IKTA 2CUJA 1LQ1A 3D5LA 2WBMA 3ASOH 3C18A 2VBWA 4Y3OA 5J8CA 1B8IA 3IAS2 2VUMJ 2GLOA 2K9SA 2JUCA 4HV6A 4UUSA 4PZJA 4NC7A 2CUFA 2EV0A 2L9RA 2JRMA 3OOUA 3QQAA 1R9TJ 5LGNA 2EZIA 3QU3A 4XRFA 2TCTA 3RKYA 3H1CA 2JQ7A 5J40A 2KRCA 1T8IA 1U5TC 4LIVA 2RNJA 1YW8A 1HW2A 3GZ5A 3MAJA 5FROA 2K9NA 2LYCA 2M3AA 2J5PA 4FISA 4GXOA 1QGPA 4NNJA 3WTXC 3CC4I 4UY8I 1W7PB 1JT6A 5FFXA 1FTZA 2VN2A 1SFUA 3BC8A 4XLPF 2OU2A 2CV0A 4YFKF 4BXXJ 3VSLA 2M7BA 4LB6B 2Y9YA 3K1NA 3KLOA 1JKOC 3JREA 2Q0OA 2PMZN 2HWVA 5HDNA 1NG6A 3ABTA 3WU0A 3OIQA 3ZQGA 3O8HA 4U0WA 4XL9A 2D2WA 3KYLA 3H9JA 2JA6J 4IRHA 1ZTRA 1RZ4A 5DD8A 2WAFA 3WHBA 3ZMVA 1R71A 5HLHA 1SFXA 3BR5A 4HF2A 3K70D 1RRJA 3BZCA 1I50J 3Q9VA 1POGA 4P9UA 2A69F 5KAIC 5ICCA 3NAUA 2E1CA 2Z3YA 3F6VA 2V1NA 1V5GA 3VYTB 4FE7A 4BY7J 2DA5A 3K4MA 3DXJF 3HIFA 1EH8A 2EIKH 3S15J 2IW5A 1BIBA 1J9IA 3VYUB 4U7DA 2MC4A 4JOMA 3T8TA 4A3IJ 1SAXA 1MMNA 3CO7C 2W7NA 5EF6A 2P4WA 2CFOA 2BY3A 2F5EA 4XK4A 3HG9A 1FC3A 3QODA 2W48A 4BE2A 2PG4A 5A2QK 1LDDA 5JI6A 2CQNA 1IN4A 2YU9J 4HF1A 3HTUA 4OIPF 4V19K 3AG3H 2VODA 5IT9K 5JLWA 4B4CA 5DD4A 5IP6A 1OFCX 4K2EA 4WWCA 4ESFA 1U0JA 2P8TA 4WXDA 2ID6A 3DEWA 4XM3A 2LP0A 2PMHA 1IV8A 5FJ8J 5GPAA 2FQ4A 4CO8A 2G0EA 5GTIC 2ZFUA 5E3OA 3I64A 3IHUA 4UVBA 1VF9A 2M0CA 1HKSA 2WV0A 3AFHA 3R4KA 2HPMA 3GBGA 3F9KA 2EQRA 4LG0B 1UCRA 1HSTA 4DBRA 4U0YA 5CQEA 2HOSA 2DODA 2K40A 3L1PA 1S7AA 2HYGD 2XKPA 5GTHC 5ILVA 2L7KA 1FP1D 1FY7A 3ZQLA 3E6MA 2FNPA 4HZFA 2ZMEC 1BJAA 3K9TA 4XNFA 4OIOF 5FLVA 1RPWA 5IYBJ 3MKZA 2GQQA 2VOOA 4F93B 4CCOA 3JR9A 3GUDA 4JX4A 1D8JA 2M34A 1MZBA 1OCCH 2FRHA 3EDPA 4BGDA 1LE8B 1UHWA 2R7UA 3M9AA 2DLLA 2DFFA 4PFOA 2VC0A 2IEKA 1IC8A 3VB2A 1WWXA 3RPQA 3ZXSA 2NOJB 2ZCWA 3KFWX 1DPRA 4M6XA 2VPLA 4PSXA 3L2QA 1YLFA 4E7KA 2VBZA 4CDGA 2QKMB 2VONA 2XRNA 3P9IA 5J8FA 4Z2YA 1BI1A 4QIWN 4PSWA 4G6DA 5CQGA 1X3ZB 2A68F 5E1ZB 5KHDA 2JRTA 2XPUA 3B73A 3L2WA 4ZYEA 1LFBA 3BCAA 3G1OA 2C6YA 1U9NA 2OV7A 1MH4A 4RS8A 4Y52J 4ZZDA 3WG9A 3L2CA 1ETXA 4XRMA 4YFXF 3TGNA 5FD6A 1IRXA 4A3CJ 5ICFA 2OCCH 2LR8A 3G1LA 1IV6A 2B63J 4D0PA 1HXDA 5E3MA 3CJRB 1ZGJA 1O7FA 1Y1VJ 2HZDA 5J1UA 1HQCA 2IXSA 1T6SA 3S2WA 1Z91A 1BA5A 2EINH 1WI3A 1Z6RA 5FKKA 2KFDA 1DGWY 1UMQA 3SYTA 1IN5A 1HW5A 2ECBA 4FETA 3BY6A 2MABA 3PNYA 4BQOA 2XGEA 2OQGA 4XOPA 1T39A 4IRIA 3W3CA 4Q47A 1Z3YA 4G9YA 2VKVA 3ZQFA 1T33A 3IH4A 1SD5A 2VQCA 3PO2J 5KVRA 2O8XA 2QENA 2GOXB 2F5VA 3PM1A 2W25A 3TQNA 2IPQX 5H20A 5B1AH 2P6TA 5E3NA 3S1RJ 1HDPA 4RDUA 5D5UB 1LUJB 1F4KA 2PEXA 2WAEA 2IBDA 2FOKA 4CCLA 2WC2A 4O6JA 4NQWA 1IN7A 4O5VA 1HLVA 3RDIA 1YW7A 1T2KA 2CSOA 3NWSA 4I09A 1OMIA 2JMWA 1MJ9A 4PJ0C 2V9VA 2MD0A 4L5EA 1E3PA 4EM0B 2EZKA 1MMGA 4C30A 2JVHA 5D8KB 3LSMA 2YSRA 2LKXA 2PX9A 4IHWA 3RKXA 3F8NA 4N4OB 1O57A 3HJEA 2R7QA 3JAMZ 2VLAA 1UZCA 1ETOA 3CDIA 3ECHA 1FOXA 5F1RA 3MVPA 3CTAA 2LY1A 2E2JJ 4LK1F 2W82A 2MSYA 4IHVA 3MKYB 1D0YA 1R5ID 4AWXB 5E17F 1U3EM 3NRVA 2KHMA 1EA3A 4L9TA 1LE8A 2PFBA 3ABUA 1MBKA 3RTRA 2O03A 3RZOJ 1AU7A 4BY1J 2ADUA 4NQWB 3W2AA 5F1JA 2DA1A 2CJJA 4XSZF 4NHJA 4X6AJ 4CSWA 2ELHA 5EEHA 1MBEA 3K1MA 2OA4A 1HA8A 3CCMI 1MBHA 5BPIA 1WQ2A 3LFKA 4BYYA 3HB9A 2V1UA 4RLFA 2F5FA 3F72A 2ZKZA 1Y0UA 1TL8A 2L9NA 1EJ9A 4CHUA 1MBGA 3LFUA 2GXAA 3AL0B 2EZHA 3KX2A 4R79A 1SVMA 2F6CA 3ZOBA 2D1VA 4RM3A 3BZ6A 2CV1A 3TW6A 3ZMDA 5DM6F 4KN4X 3ERED 1EH6A 2P6SA 3ULQB 3OYKA 4XKCA 2Z1DA 1X2NA 1U2WA 2KLOA 1TP4A 5HLIA 3MEXA 1PJRA 3GFMA 5ED4A 4C2UA 4XRSA 2ESNA 5IYCJ 3S32A 1GVDA 4QLCU 4AVZA 3DTKA 3CCQI 1OISA 3LAJA 2QYOA 1G3SA 1YYVA 2KDZA 5FKMA 1YJ9I 1QVTA 2FD5A 2STWA 3RKQA 3ERMA 3FMSA 1TQIA 2V1DA 5HDKA 1IN6A 2MLKA 4BJTA 3OYMA 2JSCA 1DGRM 1FJLA 3BTCA 2OJED 2I8DA 2Z5UA 1B72B 5CVIA 5ICEA 4J01A 1QZEA 3LWFA 2HVSA 4HX4A 1VI0A 1PYVA 3AG2H 2X85A 1R1TA 3JCUC 1JUSA 1YITI 4G6TB 2CWEA 3K4CA 1R22A 4BXFA 1SMTA 5ICGA 1XMXA 3IL2A 4MNUA 3T0YA 1D1CA 2LKPA 2R3SA 4NC8A 1YFHA 1VQ8I 2R7XA 1SMYF 1STZA 2L5QA 3H5RA 2M8EA 2XVCA 2R0QC 3S3OA 4A93J 3ABLH 2HYJA 3HM5A 3RJPA 3GTQJ 2K4BA 4RAYA 4LLGF 1TW3A 4IQJA 1MMAA 3ONQA 4NUBA 2RQPA 3W6JB 1VQKI 4A3LJ 1GVJA 2V79A 4A0ZA 1HOMA 3DWLE 4A2UA 1X4OA 3R60A 2XAFA 4HLXA 3FK7A 5F08A 5BMZA 3RIRA 4OIQF 1H9TA 2HNHA 3FKIJ 3IUOA 3K70C 4I6ZA 2LNBA 3CJNA 4OOIA 3BROA 3GTPJ 2ZSIB 1A04A 3WHCA 4E6KG 1XX5A 2DA7A 2XAHA 4DW6A 4XLAA 2E2HJ 1X3WB 4J00A 3HBLA 4UB6C 1B72A 2QWWA 2ZC2A 4CA0A 5BNGA 4L5JA 3TOAA 2YX4A 5E1WA 4A12A 1JGGA 1ZRDA 4PFPA 2L02A 1WVRA 4XQFA 1FSHA 3FMQA 1G2HA 2CGPA 3L7WA 3MKLA 3C1DA 2HTSA 3VPRA 1S72I 1PP7U 3EUKL 1QU3A 2MH9A 1K4TA 3DBLB 1JGSA 2Y0SN 1FSEA 5IPAA 3IWZA 2M9HA 5K5OA 1BC8C 3FHZA 3ZQQA 3K4KA 2Q2EA 4L9VA 2OZ6A 2KP6A 5D5WB 4XLEA 5D6EA 3I55I 4D5CA 4M3DA 2UUZA 4A5NA 4XR6A 2LF8A 3DQVC 4M72A 5DCFA 4R8HA 5J47A 2DA6A 2X0LA 1RI7A 2I5UA 4LIUA 4QPOA 3MKWB 4YIRX 3JRDA 4FX0A 5DDGA 3E1SA 3TP3A 4XLHA 3PIOF 3BT9A 4U0VA 5E8GA 3GMEA 1MNDA 3IRQA 3DEEA 1BOAA 1BW6A 3AAFA 3HOYJ 3WTYC 1AOYA 1FBSA 1JUMA 3D5SC 5GAGJ 4L0YB 5F0FA 3CLOA 2E5ZA 4A0XA 5KAFC 2GIVA 3OS2A 1P2FA 4WX9A 5F0CA 3E5UA 3OIPA 1GDTA 1FOYA 1I39A 3FBNB 2ESHA 3WE3A 1Y39A 2GOMA 3LNQA 5JHUA 3QOEA 2JVGA 3S14J 2HKXA 2X6OA 2XASA 3ML6A 1FLIA 3QRFF 3ZRGA 2STTA 2AHQA 1WFXA 2GM4A 3LQRA 1QVUA 2MW8A 1IO2A 4I98B 3GWZA 1LFUP 3V7RA 1ETVA 3ZGKA 2HPIA 5J1YA 3KE2A 2DOAA 2EWNA 1FPQA 3F8BA 2M0MA 5IT3A 2BV6A 2LSOA 1ZRFA 2VQLA 3Q5FA 3JSOA 2XIGA 2XF5A 1R4MB 5CLSA 1R36A 3IH2A 1K6OA 1RETA 1CF7A 3I9V2 2IS6A 3WODF 2H6BA 3G73A 1TQMA 2O7OA 3CD6I 1MJAA 3WU1B 2DMQA 2Y31A 1HDDC 1YIJI 2QKLB 3K4LA 3E6DA 4A6EA 5LGUA 4HNVA 2YPRA 2UZKA 4KIFA 5M3FJ 2QF7A 4IHTA 2VQGA 2Y30A 4AC0A 1P92A 1QRYA 4CYCA 1R1VA 3QYBA 1WJAA 3RKWA 1UJ8A 2QQ8A 1FT9A 3OS0A 3KEQA 4RB2C 2R7WA 2A3SA 3HRSA 1L0OC 4UVCA 1YX3A 1Z0XA 1JJ6C 2BZTA 2OUMA 4RMNA 3SFZA 2EBIA 2CYYA 3BOQA 1BL0A 4M3FA 1H8AC 1TTYA 3FXOA 1DDNA 2JA8J 2Z2SB 4LD5A 3HOUJ 2ZJPF 3ZN1A 3CZ6A 3K10A 4S04A 1QA6A 3HOSA 4GO1A 1KQ9A 4Y7NJ 5BS6A 2BVLA 1TC3C 2JA7J 5B3SH 1QBJA 3DPLC 1OYYA 2K27A 2OTLI 2N8GA 2R5ZA 2PI0A 3O3KA 4ZTFA 4A3DJ 3O6BB 3OR2C 3KIOA 4FCYA 5FLMJ 2DPDA 3GO5A 2Y9ZA 2DBBA 2JA5J 1VQMI 3IP4B 5HDGA 1B6AA 1SD6A 5ILSA 1X2MA 2L9SA 1O4XA 4I02A 3JTGA 1V5EA 3UKGA 4M3EA 2EFNA 4XLNF 5BQTA 3QPLA 3I5UA 1MGTA 1ONVA 2KQRA 1U78A 1RESA 3ZPLA 2QBYA 4FQGA 4RLQA 4GYGA 1W0TA 1MSFC 1VTNC 1IF1A 3MMYB 3SDBA 4RGXA 1JT0A 3FDYA 4ASNA 2R7OA 1X19A 1GXPA 3IAM2 5ILUA 1RKTA 4EM2A 5EJCA 5DEQA 1USTA 2R5ZB 3CF2A 3PFIA 5FKNA 3Q0VA 1D8KA 2DXIA 2F4MB 3VOEA 1YX5A 2KT0A 2MC3A 1I6XA 2K9MA 3BTIA 1EV7A 2K9LA 4BS9A 1BN5A 1K7AA 1Z21A 3ZQHA 4B3AA 1R4NB 1P4XA 4YIIA 1X1AA 4KITB 2CW0F 4DZJA 2WY8Q 2NVYJ 4BNCA 2X48A 1S29A 3S16J 3JRFA 4G7ZF 4G8XA 2ZSHB 3OIOA 1OCTC 1OYWA 3H92A 3BQZA 2OTJI 2MFZA 2R7ZJ 4ON0A 5FRMA 1I27A 4KJZA 3V42A 1F1ZA 2JN6A 1S7EA 1IUFA 2X1CA 1ON2A 3QPSA 4E4HA 3G2BA 5TRDA 4A0YA 4N4NB 2PN6A 3GCMA 2HQAA 2EK5A 4BQQA 2LRDA 4I2OA 1UFMA 1KU2A 2CMPA 5EEGA 3L2VA 3A02A 1V54H 2IA1A 4CH7A 1XC5A 3CMAI 4BEHB 2KIFA 4PJJA 2NVXJ 1HW1A 1IJWC 1OCPA 1QQIA 2NXNB 2R7DA 5DV5A 3Q0WA 2DA4A 4IEJA 5DTDA 1ZG5A 1FOKA 4BE1A 4WK8F 2LC2A 2JWTA 2FU4A 4AVPA 2WTEA 5LRRA 3U1KA 4EVIA 3HUGB 4LMYA 4XKWA 5HOOA 1K61A 3OS1A 4E7SA 4ZYDA 3GEZA 2B7EA 3COAC 1ETYA 1OQYA 2E1MB 2O6GE 2HKOA 3BG6A 4FHTA 4KDPA 4XLCA 5FGMA 1WH7A 2CUEA 4A3KJ 1ZELA 4JBAA 5CVJA 4N9IA 5DM7F 2VJ4A 2DA2A 2RGVA 3FXQA 1EF4A 5BPDA 2H8RA 5FD5A 2W84A 4IPAA 3ZR8X 2VBXA 2CQKA 2M4KA 5L3GA 1YHQI 3H3UA 1U8RA 4CZCA 5DUKA 2LLKA 4KMUX 2RREA 1UHSA 1R1UA 3CMYA 2O8KA 2GA1A 2M2EA 3BJ6A 1DPUA 3K69A 4G94A 3I4MJ 4QSHA 3RQIA 3LA3A 2QQBA 4BXUA 3FWEA 1APLC 2HEOA 3I59B 3ISPA 3LSIA 3SEQA 4OIRF 2VT2A 1W5CC 5KNLA 2R92J 1ZK8A 2GIZA 3F21A 2WAQA 4ZDOA 3C7JA 1SC7A 3NEUA 2WB1A 4II3A 2K5CA 3KP4A 5CJ9A 4UVAA 5JVTA 2W00A 3G4SI 2E19A 6PAXA 1BR4A 4XKVA 5F27A 2DTRA 2QSHX 1ZARA 3LSRA 4KN7X 2PMUA 4PGGA 3DTEA 1T08B 1X1BA 1ENHA 5L3EA 3BG7A 3S93A 2IGMA 1BJZA 3GXOA 2ID3A 3BR6A 4LLLA 1WRJA 3PL8A 3HGYA 4UUSB 2P7CB 4LLNA 1P4AA 5H2FC 3GTMJ 4KUMA 2XGDA 4HNTA 1ZR2A 3I58A 3C2HA 1S3JA 2W85A 1M1EB 5LRSA 3JW4A 2E1NA 2X1DA 1HKTA 1Y56A 2E7XA 2IGKA 3JRGA 2VT3A 1MKMA 5C3EJ 3HOXJ 3OYFA 2CRGA 1MNMC 1B4AA 1TT0A 2DI3A 2F4OB 3MQ0A 4M3BA 2V9KA 1Z7UA 1J5YA 2Z16A 4RAGA 5FKOA 5HS7A 1JKPC 3VODA 3A01B 1HKQA 3HL2A 1S9HA 3I59A 5D6FA 4BH9A 2W57A 1XN7A 1YS7A 4ENNA 4XICA 3I53A 1K78B 1R5GA 2XV4S 1ZHFA 2VJJA 2CW7A 3KP5A 4D1QA 4A3JJ 2HS5A 1LNWA 3JRBA 2DJNA 2K3PA 3LSKA 3P9KA 4BL0B 2F48A 4ETSA 3DV8A 1ZAOA 1VZ0A 2PMZA 4A3GJ 2KMUA 1XGMA 3GTLJ 3FBIB 1ZGWA 1BIAA 5LD2C 1LDKB 3F22A 4BQNA 4IRGA 1W36D 2XSJC 4V2GA 1FNNA 1X3UA 2EB7A 3HRTA 2ZXJA 1UELB 1D1BA 3KYCB 5B1BH 2PJPA 3QP5A 4MQVA 2E36A 4PDKA 3DKXA 1RC9A 2LKSA 3MD2A 5L3CA 2BYVE 2LG4A 4UV8A 3DEUA 1TLHB 4ZH4F 3FIWA 2XPWA 1P7IA 3OYHA 2ELJA 2YUSA 3OYCA 4MEXF 5TGTA 2ZMEA 2L7ZA 1BR2A 3A01A 2WWYA 4HBLA 1LVKA 1OPCA 1WI9A 3CDLA 1WSUA 2HDDA 3BDDA 4ZZLA 1J7KA 3OYIA 2LDUA 5H6QA 4P9FA 3RYPA 2COBA 2ZO4A 3H36A 3CUOA 3H9GA 2Q2EB 2Y2ZA 1U6GA 2EH3A 2JTVA 2Y0MA 5LBQA 2WY7Q 3HC7A 5B66C 4F91B 2P5VA 4WXHA 4HW0A 2RQQA 1BBYA 1XD7A 4WF2A 2KL4A 2VL8A 2DYSH 1O3TA 1AA7A 4RGRA 3K4NA 1E0EA 2I10A 2DMNA 2P5KA 1R00A 1Q1VA 2X1EA 3TBIA 3F6OA 4IL6C 4CICA 4IHYA 3E5XA 2FMLA 1BC7C 4HF0A 3RYRA 2D45A 2OQRA 2IT0A 2EILH 3S2DJ 1ULYA 1EH7A 1IUYA 1GV5A 1QZYA 3MZHA 2VC1A 2IVMA 4QPQA 1OCOH 3WTUC 4JX6A 1Y6IA 4M9XA 2LH9A 4WXCA 2Q1ZB 3KZYA 4YG2F 3FK6A 3J7AO 4Q4ZF 4XONA 4KNYA 4EJWA 1ZH5A 4RBOA 1TT5B 4C3JJ 5IP9J 1LEBA 3PNTA 3CMMA 3J81K 3U2RA 3S3MA 3QYFA 2OBPA 2P5LC 1OR7A 3DFGA 3HSEA 2K3FA 3OL3A 4YELA 3V8LA 3L2RA 1RUOA 2XROA 4JYKA 2GAUA 2ME0A 3ZMUA 1KU9A 1FMWA 3FHNA 1ZN2A 1I1GA 2E1OA 3MZ8A 2DK5A 1FBQA 1QO0D 1QPMA 4FASD 1RUNA 3S1NJ 2OD5A 1FWZA 2R5YB 1Z67A 2DT6A 2YR2A 4LB5A 2A5YB 4NDLA 5L3BA 4OMZA 5EDNA 2UXNA 1EKEA 4BDZA 2FA5A 4EJOA 4B3XA 3T1BA 2D5VA 3BWGA 2LK2A 4F3QA 1KGSA 3K7AJ 3LQQA 1ZG3A 3HDDA 1HF0A 5F6FA 4IXAA 2EJRA 4MEYF 1VQ5I 4EMSA 1GXQA 4M3GA 2QVOA 2VKDA 1ITYA 2VI6A 1QHHD 3S1QJ 2E60A 3GFIA 2EIMH 3ELKA 1KQ8A 4L18B 2NVQJ 1IRGA 1FOWA 1GUUA 1WJEA 3CUQA 3GX4X 3CJTB 1YJWI 4EEFG 2E34A 3JRAA 1R5HA 1JTYA 1ETKA 1OYIA 4EATA 3ABKH 1P4WA 2FUG2 3ZP5A 2M87A 4B1RA 4PJNA 2G7HA 1Y1WJ 4XLFA 3CCVI 4E7LA 3BP8A 3K0LA 2E35A 2NNYA 5J4YA 1FYKA 4PGHA 5FLXK 3BLYA 3M8EA 3TW7A 2QSGX 3TMOA 1MIJA 4G7OF 3EUAA 2HYFA 1G6NA 3J7ZI 2IS1A 4IX7A 1Z7LA 3AG1H 1P7JA 3BR0A 3KZIC 2EFOA 3OYEA 1SD7A 4M71A 2BGCA 5CPRB 3TEDA 1SD4A 4BE0A 4LJZF 3DKYA 3CLQA 3BQYA 3FF5A 4B48A 3ROUA 2G7UA 4PJLA 2LBFA 3ESWB 2TRTA 4PUSA 2CO5A 4J19A 3FMRA 1B9NA 1T56A 1G3TA 1AHDP 2PJRB 4UB8C 1XGOA 5LHIA 4OMYA 2L4AA 4GDFA 1MMDA 3D5RC 2XF7A 4C2MJ 2OC6A 2ZJ2A 3KETA 3B6AA 3M1CA 1YS6A 1LJ9A 2UXXA 3FXLA 1H89C 1VQPI 1U8BA 2M5WA 4EQQA 2OAZA 3FISA 4BUPA 1Y8QB 1WGXA 2DMUA 1X58A 4NBQA 3W2VA 3PQJA 3DBHB 2H94A 3FXUA 3M4OJ 4BHBA 5HNHA 1F36A 1JHHA 1I5ZA 2XC7A 2DFEA 5D4RA 2BW3A 2IA0A 4LK0F 3FXMA 2GA2A 2ME6A 2JZYA 3SHFA 5LFAA 4AIHA 1FIPA 2EIJH 1PDNC 4KYWA 3FXJA 3DLAA 2XAGA 4RB1A 4EJTA 2QA4I 1QPIA 1VQLI 2AO9A 3ZQIA 2FBIA 3J7YJ 5HS8A 4S0HB 1D5VA 5E1XA 2F5DA 5IT9Z 5JVGF 2O61A 1TZLA 1P9QC 4X0GA 3W6KB 4IZZA 3QAHA 5CYVA 2DJIA 5C44J 1ON1A 5AIQA 3H5AA 4DQ2A 5D5XB 2CQ7A 3RPUA 2K02A 1KZHA 1N75A 2ZNYA 1FYMA 2IAIA 2JK3A 5E18F 1L3LA 3C3WA 5L3DA 1ETQA 5C4JJ 2VIXA 5JR3A 2HR3A 2L0KA 3Q3SA 4Q48A 4KMFA 2DU9A 2JPBA 3GFJA 3HPHA 1BI2A 3RCOA 3G71I 3ZQ7A 1HCRA 3EQLF 1KONA 3CCEI 1LEAA 2A07F 1ZG1A 2NRAC 4QWQA 4ZDLA 2MH2A 2MLGA 3PFYA 1TWCJ 2D1HA 3B02A 3A2KA 3DPTA 2NAZA 2Z9OA 1Z3XA 4AIJA 5IOZA 3M3YJ 4HEA2 4HNUA 2DK8A 2XHKA 3HUGA 3PUBA 5F0HA 3HSFA 4G12A 3LSJA 1E3OC 2VQHA 1YRNB 1B9MA 1U9OA 3ZN0A 5CKTA 1WPKA 3N4MA 2IS4A 1AKHB 5K7HA 2H8WA 3V4GA 1G59A 5LHHA 2QLZA 1NG7A 5J6XA 3L2UA 3HKZA 2PJRA 2FXAA 1TBXA 4E70A 4A69C 4DYRA 4Q5SF 5LGTA 2Z99A 2HTJA 5E20A 3BJOA 1SVLA 5GADJ 1QHGA 1DU0A 2EFPA 2O9LA 4CGZA 1D3YA 1YG2A 5FO5A 3GLXA 3CF5F 1VQOI 4IOAF 3JAMK 3OOPA 1XMKA 1UHMA 2CFXA 3PSIA 3IRRA 3G6EI 3OYAA 3IH3A 1KQ0A 3M8FA 3PUFA 3GF2A 2A6HF 2VBYA 2ZB9A 2V4JC 1S7OA 3ZMTA 4MTDA 1JE8A 2L54A 4BDYA 2NS0A 4MO7A 1DP3A 2VXZA 2CW8A 1T98A 5AIPA 2HDCA 1ZQ3P 4UNOA 1F43A 3CCJI 3HOTA 1FEXA 3OV8A 5IP7J 4IKFA 1NK3P 1RIOH 4BHPA 3KP7A 3JTHA 3OYJA 3GYHX 2DOFA 3RSNA 1MDMA 3KZZA 4B47A 1YI2I 1AKHA 2Y75A 3BR3A 3E3VA 1YRNA 2Y69H 2BY2A 2FOWA 2MD5A 2AQFA 3OYNA 2FF4A 1DQUA 2EV6A 2HVQA 1P6RA 1XGSA 3AL0C 4ZYAA 3CQZJ 1LKXA 4RAFA 3HSRA 1W36C 1VQ6I 4Y33A 2KDOA 3BPXA 4EM1A 3S3NA 3CCUI 1F5TA 3PQKA 1W0UA 3F8CA 2XPVA 1MH3A 3NQOA 3VSKA 2EPFA 2VKHA 3FXRA 2A05A 1BW5A 5FB2A 2FE3A 4LITA 3DF8A 3H3VK 3H5NA 3X2QH 4HX7A 4DYQA 3HOZJ 1U5TA 3SZPA 1BI3A 1RR7A 1RNLA 1WZ2A 2ZNZA 3P9CA 5EEAA 3OYLA 2EFWA 3HEFA 4I76A 1BR1A 2RAEA 1AWCA 1T95A 2BEOA 4IVNA 2W24A 4IJAA 2LY9A 1IW7F 2DT5A 1LB2A 1FYLA 2GXBA 4AD9A 2DO7A 3WTSC 4B43A 1J2XA 1A31A 4IQ4A 3HOWJ 2CG4A 4ZTJA 1C0WA 1XG1A 2FJ1A 2MGQA 1FMVA 3MCZA 4OINF 4XRSG 3I3LA 3QYEA 2OZUA 2GXGA 2V6CA 1OCRH 2X4HA 2UV1A 3RQ4A 2L3DA 4DJAA 2QEXI 1NH3A 2B0LA 1JXSA 1IXCA 4RM2A 3LSGA 1OLTA 2XSDC 5LEJA 9ANTA 2KJBA 5GP9A 2WV1A 2HQ5A 2WADA 4ENKA 5M5XJ 1G4DA 4I99C 5LEKA 4C9YA 2O3FA 4PCQA 2L7MP 3HKZN 3U9GA 5IYDJ 3UR3C 2K7LA 2AS5F 3LSTA 2HZTA 4R1HA 2J5OA 5EGOA 2JSPA 2QSFX 2Y0SA 3GTOJ 3F8FA 3G3ZA 3M7GA 2PQ8A 2RN7A 2H6CA 4GFBA 2JJ7A 3IC7A 3L09A 2ACJA 3CJQB 3K2ZA 4BEHA 1SAUA 4CYCB 5EZHA 2XUBA 5KCMA 2E1MC 3KEOA 4EJVA 3HTSB 3BCBA 3M8JA 4CCJA 3R0AA 4HQEA 1R58A 1V55H 5DUIA 3HGGA 1NTCA 5GPCA 3QU6A 1O7LA 2DA3A 4CCNA 1MBJA 3D0SA 4B8XA 4U87A 3EPZA 3VYRB 3J7AY 3V8JA 3U21A 1ODDA 3O8GA 1H0MA 2KIMA 1WCMJ 2HU9A 1XB4A 2MA3A 5K7FA 4WCGA 1JKQC 4YFNF 1XMAA 1W4MA 2IA2A 4BBSJ 4V2FA 3J80K 5EZGA 2NNNA 1R7JA 2JA2A 4ZDPA 3E7LA 1E3HA 5HLGA 4F92B 2DMTA 1S8NA 2EA2A 2M7AA 2V26A 4DOZA 3FX3A 4MFDA 4OAYA 2XAJA 1ORKA 4HLYA 4U88A 2JUGA 2VE8A 3I0TA 3N97A 3DKWA 1TWHJ 2XF6A 1SFEA 3KLNA 3AG4H 2IGOA 1TWAJ 2JT1A 2NS8A 3CESA 4DYCA 3A1YA
chains in the Genus database with same CATH topology
1UG2A 4UUTA 3W6VA 3FKIJ 4I6ZA 3S17J 1MBFA 4QTRA 2XB0X 1DU6A 3GTPJ 4DZPA 4FE4A 3WHCA 1K83J 2DA7A 2I10A 4DW6A 2DMNA 3OSGA 2OF7A 2E2HJ 3HBLA 1D5YA 1Q1VA 1B72A 5EGOB 4IHYA 5BNGA 4AYBN 3S2DJ 3NARA 3BR2A 1JGGA 4MFEA 2ELKA 1G2HA 1GV5A 4A3BJ 3VPRA 3MKLA 1PUFA 4JX6A 5J3LA 4X1EA 1JJ8C 1Z77A 2VPRA 5EG0B 3D1NI 2Y0SN 3FK6A 5IPAA 3G1MA 2OPTA 2M9HA 4LOCA 2NVTJ 5C4XJ 4RBOA 4C3JJ 5IP9J 2E2IJ 3JRHA 4D5CA 4M3DA 1IDYA 4BKXA 3JRIA 1IGNA 4JYKA 2DA6A 2ME0A 2P81A 3JRDA 2E1OA 3TP3A 3S1NJ 2R93J 2R5YB 4A3MJ 3BT9A 2WB1N 3HOYJ 1BW6A 4NDLA 5EDNA 1JUMA 2CQXA 2HI3A 3F0CA 3C2BA 5F0FA 2R5YA 3A03A 4MLOA 1SFOJ 2DN0A 5F0CA 1GDTA 2D5VA 2HXOA 2LK2A 3LNQA 3K7AJ 3S14J 2X6OA 1B8IA 3HDDA 1HF0A 2VUMJ 2GLOA 2K9SA 3GTJJ 4UUSA 2AHQA 4M3GA 2GM4A 1ITYA 1QVUA 2CUFA 2VI6A 2M8GX 3S1QJ 2MW8A 2L9RA 3OOUA 3QQAA 1R9TJ 2NVQJ 1LFUP 2EZIA 1ETVA 1GUUA 2TCTA 5J1YA 1FIAA 4EEFG 3IV5A 3JRAA 1JTYA 1ETKA 2K9NA 4FISA 3OSFA 3K2AA 4B1RA 3TP0A 1Y1WJ 2QCOA 5M3MJ 3IH2A 1RETA 1JT6A 1FTZA 2O7OA 3TW7A 2DMQA 2Y31A 4BXXJ 2XGCA 1HDDC 1P7JA 3BR0A 2Y9YA 4HNVA 1JKOC 3JREA 2PMZN 3TEDA 5M3FJ 2QF7A 3ZQGA 2Y30A 3O8HA 4AC0A 1QRYA 3BQYA 4CYCA 2JA6J 2TRTA 1ZTRA 3WHBA 3BR5A 4J19A 1AHDP 1T56A 1I50J 1Z0XA 1POGA 1JJ6C 3NAUA 4C2MJ 2EBIA 1BL0A 5FKLA 3B6AA 4M3FA 1H89C 4FE7A 1H8AC 4BY7J 2DA5A 1U8BA 3S15J 3FISA 1WGXA 2DMUA 1X58A 2JA8J 1JTXA 4JX5A 4A3IJ 3HOUJ 5EF6A 1MSEC 4XK4A 3M4OJ 2W48A 4Y7NJ 1F36A 3BTJA 2XRLA 1TC3C 2JA7J 1I6HJ 2YU9J 1B8IB 2N8GA 3B6CA 2R5ZA 5DS9A 5JLWA 2ME6A 4B4CA 5IP6A 4A3DJ 1OFCX 2LFBA 1ZKGA 2ID6A 3DEWA 1FIPA 2LP0A 4FCYA 5FLMJ 5FJ8J 5GPAA 2FQ4A 2G0EA 5JLXA 5E3OA 3LOCA 5EG0A 2AO9A 2Y9ZA 1QPIA 2JA5J 3ZQIA 5E3LA 4S0HB 1VF9A 2M0CA 1X2MA 3GBGA 1O4XA 2EQRA 2CQQA 4W97A 3UKGA 5C44J 1SANA 4M3EA 2HOSA 3QPLA 2K40A 3L1PA 1I3QJ 1U78A 1RESA 2IAIA 3ZQLA 2JK3A 1W0TA 1MSFC 1ETQA 5C4JJ 5M5YJ 5FLVA 1RPWA 1JT0A 2L0KA 3Q3SA 5IYBJ 3LSPA 3DCFA 3JR9A 3HOVJ 3H0GJ 4JX4A 1RKTA 2M34A 1HCRA 4JP0A 2R5ZB 1LE8B 5FKNA 3Q0VA 1TWGJ 1JUPA 1TWCJ 2KT0A 2IEKA 3BTIA 1IC8A 3I4NJ 2X9DA 5IOZA 3M3YJ 3ZQHA 4B3AA 3S1MJ 2VKEA 4DZJA 5F0HA 2NVYJ 2X48A 3PO3J 4G12A 3S16J 3LSJA 3JRFA 1E3OC 1YRNB 3OIOA 1U9OA 1OCTC 2LVSA 1WPKA 2LD5A 3BQZA 4QIWN 1AKHB 2R7ZJ 5K7HA 5EYRA 1IG7A 2JN6A 1A5JA 2XPUA 1S7EA 1IUFA 3QPSA 1OJLA 1GT0C 1IRZA 4M6VA 1LFBA 4D7MA 3G1OA 1U9NA 1MH4A 4A69C 4DYRA 1ZR4A 3SDGA 4Y52J 2H1KA 3A02A 1DU0A 1ETXA 1XC5A 4XRMA 2O9LA 5IOYA 4A3CJ 2LR8A 3G1LA 2NVXJ 1IJWC 1IV6A 2B63J 1OCPA 5E3MA 3Q0WA 2DA4A 1Y1VJ 4IEJA 5DTDA 5J1UA 3IH3A 1ETWA 4FTHA 1BA5A 2JWTA 1WI3A 5FKKA 4W1UA 2ZB9A 1UMQA 1IDZA 1PUFB 1K61A 2ECBA 2XGEA 4MO7A 1GV2A 1TWFJ 1ZQ3P 1F43A 1ETYA 1FEXA 2VKVA 3ZQFA 3IH4A 1T33A 2XB5A 5IP7J 1WH7A 2CUEA 4A3KJ 1NK3P 3PO2J 2MG4A 4BBRJ 3GTGJ 2DA2A 1AKHA 2DMPA 1EF4A 3PM1A 2H8RA 2YS9A 3BR3A 2FX0A 1YRNA 5E3NA 3S1RJ 1HDPA 4RDUA 1FTTA 2NOGA 5K7ZA 2IBDA 3S2HJ 3CQZJ 2LLKA 1UHSA 1HLVA 3CMYA 1H88C 2O8KA 2M2EA 2JMWA 2HOTA 1W0UA 1RKWA 2XPVA 1MH3A 3I4MJ 4QSHA 1BW5A 3RQIA 2NS7A 4ABZA 4L5EA 1APLC 4MIMA 2EZKA 3H3VK 3Q0UA 4IHWA 2LKXA 2K9QA 4DYQA 3HOZJ 1RR7A 1ZK8A 3CCYA 2R92J 5F04A 5J1RA 5EEAA 1VNDA 3HEFA 1ETOA 4I76A 2RAEA 3MVPA 2E2JJ 1A6IA 2E19A 2HOAA 2WAQN 2HXIA 5F27A 2MSYA 2LY9A 4IHVA 3LSRA 3ZQCA 1ENHA 1LE8A 3HOWJ 1NK2P 1XS9A 1BJZA 2ID3A 3BR6A 1MBKA 1XG1A 3HGYA 4UUSB 4IHXA 2FJ1A 2MGQA 3RZOJ 3GTMJ 1AU7A 4A3FJ 4XRSG 4BY1J 2XGDA 1ZR2A 5F1JA 1CQTA 2DA1A 2CJJA 4X6AJ 3JRGA 4A3EJ 5C3EJ 3HOXJ 1MBEA 2CRGA 3LSGA 3MN2A 4C3HJ 3RZDJ 1MNMC 2XSDC 1MBHA 3HB9A 4M3BA 9ANTA 5FKOA 2CU7A 5M5WJ 5GP9A 1JKPC 2WV1A 1MBGA 2HQ5A 3A01B 5M5XJ 3BG5A 2EZHA 3ZOBA 4XICA 2L7FP 2L7MP 3HKZN 3TW6A 3BTLA 5IYDJ 5EGOA 4A3JJ 3GTOJ 3BR1A 3JRBA 1X2NA 2DJNA 3SJMA 4GFBA 2JJ7A 3SFIA 4D5FA 4XRSA 4CYCB 5EZHA 5IYCJ 1GVDA 1VFCA 4A3GJ 3GTLJ 3JRCA 4AUXA 2KDZA 1ZGWA 2LTPA 5FKMA 1QVTA 2FD5A 3HGGA 1NTCA 5GPCA 3RKQA 2DA3A 4V2GA 3BG9A 1MBJA 3BG3A 1FJLA 3BTCA 3GTKJ 1B72B 4C3IJ 3O8GA 5HODA 1WH5A 1WCMJ 1VI0A 5K7FA 1JKQC 4BBSJ 2GBYA 4V2FA 1JUSA 5EZGA 3E7LA 3FIWA 2XPWA 1P7IA 2DMTA 1JKRC 2YUSA 4XIDA 2R0QC 4A93J 2L7ZA 2HYJA 4MFDA 3A01A 3HM5A 2HDDA 3CDLA 3GTQJ 1ORKA 2ECCA 2COBA 2DTZA 4D7NA 4A3LJ 2EH3A 1TWHJ 2Y2ZA 1HOMA 2EZLA 1TWAJ 2NS8A 4DYCA 3FK7A 5F08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG2 A;  4UUT A;  3W6V A;  3FKI J;  4I6Z A;  3S17 J;  1MBF A;  4QTR A;  2XB0 X;  1DU6 A;  3GTP J;  4DZP A;  4FE4 A;  3WHC A;  1K83 J;  2DA7 A;  2I10 A;  4DW6 A;  2DMN A;  3OSG A;  2OF7 A;  2E2H J;  3HBL A;  1D5Y A;  1Q1V A;  1B72 A;  5EGO B;  4IHY A;  5BNG A;  4AYB N;  3S2D J;  3NAR A;  3BR2 A;  1JGG A;  4MFE A;  2ELK A;  1G2H A;  1GV5 A;  4A3B J;  3VPR A;  3MKL A;  1PUF A;  4JX6 A;  5J3L A;  4X1E A;  1JJ8 C;  1Z77 A;  2VPR A;  5EG0 B;  3D1N I;  2Y0S N;  3FK6 A;  5IPA A;  3G1M A;  2OPT A;  2M9H A;  4LOC A;  2NVT J;  5C4X J;  4RBO A;  4C3J J;  5IP9 J;  2E2I J;  3JRH A;  4D5C A;  4M3D A;  1IDY A;  4BKX A;  3JRI A;  1IGN A;  4JYK A;  2DA6 A;  2ME0 A;  2P81 A;  3JRD A;  2E1O A;  3TP3 A;  3S1N J;  2R93 J;  2R5Y B;  4A3M J;  3BT9 A;  2WB1 N;  3HOY J;  1BW6 A;  4NDL A;  5EDN A;  1JUM A;  2CQX A;  2HI3 A;  3F0C A;  3C2B A;  5F0F A;  2R5Y A;  3A03 A;  4MLO A;  1SFO J;  2DN0 A;  5F0C A;  1GDT A;  2D5V A;  2HXO A;  2LK2 A;  3LNQ A;  3K7A J;  3S14 J;  2X6O A;  1B8I A;  3HDD A;  1HF0 A;  2VUM J;  2GLO A;  2K9S A;  3GTJ J;  4UUS A;  2AHQ A;  4M3G A;  2GM4 A;  1ITY A;  1QVU A;  2CUF A;  2VI6 A;  2M8G X;  3S1Q J;  2MW8 A;  2L9R A;  3OOU A;  3QQA A;  1R9T J;  2NVQ J;  1LFU P;  2EZI A;  1ETV A;  1GUU A;  2TCT A;  5J1Y A;  1FIA A;  4EEF G;  3IV5 A;  3JRA A;  1JTY A;  1ETK A;  2K9N A;  4FIS A;  3OSF A;  3K2A A;  4B1R A;  3TP0 A;  1Y1W J;  2QCO A;  5M3M J;  3IH2 A;  1RET A;  1JT6 A;  1FTZ A;  2O7O A;  3TW7 A;  2DMQ A;  2Y31 A;  4BXX J;  2XGC A;  1HDD C;  1P7J A;  3BR0 A;  2Y9Y A;  4HNV A;  1JKO C;  3JRE A;  2PMZ N;  3TED A;  5M3F J;  2QF7 A;  3ZQG A;  2Y30 A;  3O8H A;  4AC0 A;  1QRY A;  3BQY A;  4CYC A;  2JA6 J;  2TRT A;  1ZTR A;  3WHB A;  3BR5 A;  4J19 A;  1AHD P;  1T56 A;  1I50 J;  1Z0X A;  1POG A;  1JJ6 C;  3NAU A;  4C2M J;  2EBI A;  1BL0 A;  5FKL A;  3B6A A;  4M3F A;  1H89 C;  4FE7 A;  1H8A C;  4BY7 J;  2DA5 A;  1U8B A;  3S15 J;  3FIS A;  1WGX A;  2DMU A;  1X58 A;  2JA8 J;  1JTX A;  4JX5 A;  4A3I J;  3HOU J;  5EF6 A;  1MSE C;  4XK4 A;  3M4O J;  2W48 A;  4Y7N J;  1F36 A;  3BTJ A;  2XRL A;  1TC3 C;  2JA7 J;  1I6H J;  2YU9 J;  1B8I B;  2N8G A;  3B6C A;  2R5Z A;  5DS9 A;  5JLW A;  2ME6 A;  4B4C A;  5IP6 A;  4A3D J;  1OFC X;  2LFB A;  1ZKG A;  2ID6 A;  3DEW A;  1FIP A;  2LP0 A;  4FCY A;  5FLM J;  5FJ8 J;  5GPA A;  2FQ4 A;  2G0E A;  5JLX A;  5E3O A;  3LOC A;  5EG0 A;  2AO9 A;  2Y9Z A;  1QPI A;  2JA5 J;  3ZQI A;  5E3L A;  4S0H B;  1VF9 A;  2M0C A;  1X2M A;  3GBG A;  1O4X A;  2EQR A;  2CQQ A;  4W97 A;  3UKG A;  5C44 J;  1SAN A;  4M3E A;  2HOS A;  3QPL A;  2K40 A;  3L1P A;  1I3Q J;  1U78 A;  1RES A;  2IAI A;  3ZQL A;  2JK3 A;  1W0T A;  1MSF C;  1ETQ A;  5C4J J;  5M5Y J;  5FLV A;  1RPW A;  1JT0 A;  2L0K A;  3Q3S A;  5IYB J;  3LSP A;  3DCF A;  3JR9 A;  3HOV J;  3H0G J;  4JX4 A;  1RKT A;  2M34 A;  1HCR A;  4JP0 A;  2R5Z B;  1LE8 B;  5FKN A;  3Q0V A;  1TWG J;  1JUP A;  1TWC J;  2KT0 A;  2IEK A;  3BTI A;  1IC8 A;  3I4N J;  2X9D A;  5IOZ A;  3M3Y J;  3ZQH A;  4B3A A;  3S1M J;  2VKE A;  4DZJ A;  5F0H A;  2NVY J;  2X48 A;  3PO3 J;  4G12 A;  3S16 J;  3LSJ A;  3JRF A;  1E3O C;  1YRN B;  3OIO A;  1U9O A;  1OCT C;  2LVS A;  1WPK A;  2LD5 A;  3BQZ A;  4QIW N;  1AKH B;  2R7Z J;  5K7H A;  5EYR A;  1IG7 A;  2JN6 A;  1A5J A;  2XPU A;  1S7E A;  1IUF A;  3QPS A;  1OJL A;  1GT0 C;  1IRZ A;  4M6V A;  1LFB A;  4D7M A;  3G1O A;  1U9N A;  1MH4 A;  4A69 C;  4DYR A;  1ZR4 A;  3SDG A;  4Y52 J;  2H1K A;  3A02 A;  1DU0 A;  1ETX A;  1XC5 A;  4XRM A;  2O9L A;  5IOY A;  4A3C J;  2LR8 A;  3G1L A;  2NVX J;  1IJW C;  1IV6 A;  2B63 J;  1OCP A;  5E3M A;  3Q0W A;  2DA4 A;  1Y1V J;  4IEJ A;  5DTD A;  5J1U A;  3IH3 A;  1ETW A;  4FTH A;  1BA5 A;  2JWT A;  1WI3 A;  5FKK A;  4W1U A;  2ZB9 A;  1UMQ A;  1IDZ A;  1PUF B;  1K61 A;  2ECB A;  2XGE A;  4MO7 A;  1GV2 A;  1TWF J;  1ZQ3 P;  1F43 A;  1ETY A;  1FEX A;  2VKV A;  3ZQF A;  3IH4 A;  1T33 A;  2XB5 A;  5IP7 J;  1WH7 A;  2CUE A;  4A3K J;  1NK3 P;  3PO2 J;  2MG4 A;  4BBR J;  3GTG J;  2DA2 A;  1AKH A;  2DMP A;  1EF4 A;  3PM1 A;  2H8R A;  2YS9 A;  3BR3 A;  2FX0 A;  1YRN A;  5E3N A;  3S1R J;  1HDP A;  4RDU A;  1FTT A;  2NOG A;  5K7Z A;  2IBD A;  3S2H J;  3CQZ J;  2LLK A;  1UHS A;  1HLV A;  3CMY A;  1H88 C;  2O8K A;  2M2E A;  2JMW A;  2HOT A;  1W0U A;  1RKW A;  2XPV A;  1MH3 A;  3I4M J;  4QSH A;  1BW5 A;  3RQI A;  2NS7 A;  4ABZ A;  4L5E A;  1APL C;  4MIM A;  2EZK A;  3H3V K;  3Q0U A;  4IHW A;  2LKX A;  2K9Q A;  4DYQ A;  3HOZ J;  1RR7 A;  1ZK8 A;  3CCY A;  2R92 J;  5F04 A;  5J1R A;  5EEA A;  1VND A;  3HEF A;  1ETO A;  4I76 A;  2RAE A;  3MVP A;  2E2J J;  1A6I A;  2E19 A;  2HOA A;  2WAQ N;  2HXI A;  5F27 A;  2MSY A;  2LY9 A;  4IHV A;  3LSR A;  3ZQC A;  1ENH A;  1LE8 A;  3HOW J;  1NK2 P;  1XS9 A;  1BJZ A;  2ID3 A;  3BR6 A;  1MBK A;  1XG1 A;  3HGY A;  4UUS B;  4IHX A;  2FJ1 A;  2MGQ A;  3RZO J;  3GTM J;  1AU7 A;  4A3F J;  4XRS G;  4BY1 J;  2XGD A;  1ZR2 A;  5F1J A;  1CQT A;  2DA1 A;  2CJJ A;  4X6A J;  3JRG A;  4A3E J;  5C3E J;  3HOX J;  1MBE A;  2CRG A;  3LSG A;  3MN2 A;  4C3H J;  3RZD J;  1MNM C;  2XSD C;  1MBH A;  3HB9 A;  4M3B A;  9ANT A;  5FKO A;  2CU7 A;  5M5W J;  5GP9 A;  1JKP C;  2WV1 A;  1MBG A;  2HQ5 A;  3A01 B;  5M5X J;  3BG5 A;  2EZH A;  3ZOB A;  4XIC A;  2L7F P;  2L7M P;  3HKZ N;  3TW6 A;  3BTL A;  5IYD J;  5EGO A;  4A3J J;  3GTO J;  3BR1 A;  3JRB A;  1X2N A;  2DJN A;  3SJM A;  4GFB A;  2JJ7 A;  3SFI A;  4D5F A;  4XRS A;  4CYC B;  5EZH A;  5IYC J;  1GVD A;  1VFC A;  4A3G J;  3GTL J;  3JRC A;  4AUX A;  2KDZ A;  1ZGW A;  2LTP A;  5FKM A;  1QVT A;  2FD5 A;  3HGG A;  1NTC A;  5GPC A;  3RKQ A;  2DA3 A;  4V2G A;  3BG9 A;  1MBJ A;  3BG3 A;  1FJL A;  3BTC A;  3GTK J;  1B72 B;  4C3I J;  3O8G A;  5HOD A;  1WH5 A;  1WCM J;  1VI0 A;  5K7F A;  1JKQ C;  4BBS J;  2GBY A;  4V2F A;  1JUS A;  5EZG A;  3E7L A;  3FIW A;  2XPW A;  1P7I A;  2DMT A;  1JKR C;  2YUS A;  4XID A;  2R0Q C;  4A93 J;  2L7Z A;  2HYJ A;  4MFD A;  3A01 A;  3HM5 A;  2HDD A;  3CDL A;  3GTQ J;  1ORK A;  2ECC A;  2COB A;  2DTZ A;  4D7N A;  4A3L J;  2EH3 A;  1TWH J;  2Y2Z A;  1HOM A;  2EZL A;  1TWA J;  2NS8 A;  4DYC A;  3FK7 A;  5F08 A; 
#chains in the Genus database with same CATH topology
 4LG3 A;  4UUT A;  1F9N A;  1YOV B;  5H6R A;  3OYD A;  5CVR A;  3WU2 C;  2QBY B;  3S17 J;  1YO5 C;  2LMD A;  3TL4 X;  4QTR A;  3E6B A;  4E7J A;  1J59 A;  1UB9 A;  4FE4 A;  1ACI A;  1K78 A;  4C2T A;  5FFZ A;  3K4J A;  5AON A;  1FX7 A;  2BHZ A;  3OSG A;  1XSX A;  1A36 A;  4L9N A;  1S6L A;  3MZY A;  3BJA A;  3HPG A;  2HQN A;  3KP2 A;  2H09 A;  4M74 A;  3NAR A;  1E17 A;  4AU7 A;  4MFE A;  2ELK A;  4XMY A;  3VDX A;  3SQN A;  1W5T A;  1XTA A;  4HQM A;  2BOL A;  4A3B J;  3F3X A;  1D0Z A;  5E79 C;  3EUH C;  4X1E A;  1OR7 C;  1Z77 A;  4H0E A;  2VPR A;  3CDH A;  4AID A;  2R7R A;  4MGR A;  3DU6 A;  1BM9 A;  2QZ8 A;  3KP3 A;  3G1M A;  5GAH J;  2RVC A;  4JQF A;  2QM3 A;  1UG0 A;  2NVT J;  5C4X J;  4B09 A;  2PLY A;  3EET A;  1ZLJ A;  3K6G A;  4KT6 A;  4ESB A;  1IDY A;  1TNS A;  4D9J A;  4BAY A;  1I3A A;  2BY1 A;  4HA8 A;  4RA2 A;  3DBR B;  2MYS A;  2K86 A;  2WA0 A;  3E6C C;  5A2Q Z;  1WJC A;  3MWM A;  1MD0 A;  4YEJ A;  2X51 A;  1WJD A;  2R93 J;  5HNF A;  3NWT A;  4EGY A;  1R23 A;  2R7T A;  3WTW C;  1IZ1 A;  4HYE A;  2IJL A;  1GHC A;  3C2B A;  3F0C A;  5LLQ A;  3R61 A;  4AYB A;  4FX4 A;  4MLO A;  4G7H F;  3CCL I;  4CZZ A;  2RNG A;  2DN0 A;  4RB3 C;  2QQ9 A;  4CXF A;  4GYI A;  4N0B A;  4S05 A;  4GRI A;  2DW4 A;  4PJM A;  3V7C A;  1WKM A;  3S8P A;  4BAC A;  4HPQ A;  2BY0 A;  1J75 A;  3GTJ J;  2BXZ A;  1O3S A;  1T0F C;  4BHC A;  4Z6Y A;  4DGW B;  1J0R A;  2M8G X;  2KIS A;  4XN0 A;  1H9G A;  4E7I A;  2KZG A;  3MFK A;  3TDU C;  4Y13 A;  1FIA A;  3HZJ A;  3IV5 A;  2R4G A;  1W7P A;  3KPH A;  1T38 A;  1PP8 F;  3OSF A;  3N05 A;  3K2A A;  3TP0 A;  2QCO A;  2DT7 B;  3KYD B;  5D8L B;  5M3M J;  4UHT A;  2VAS A;  3WTZ A;  4HDV A;  2ICW G;  3ASN H;  3DTI A;  2FQ3 A;  3OMY A;  4HV5 A;  2XGC A;  3DLL F;  4M9Z A;  1Z9C A;  2LF7 A;  4UXN A;  3VEP A;  2UWM A;  1USS A;  3I54 A;  3P5J A;  2DOE A;  4A6D A;  4IF4 A;  2DQR A;  2KRH A;  4GGG A;  4P1W A;  2KKO A;  2F5C A;  2XGX A;  3I56 I;  1W5S A;  1ERD A;  4KT5 C;  1QNT A;  4YIF A;  1N77 A;  2VE9 A;  5TIS C;  5FKL A;  3I71 A;  5TJJ A;  4NC6 A;  3GZ6 A;  4P5O A;  4CYD A;  3DPU A;  1A6Q A;  1JTX A;  4JX5 A;  4Y4R A;  4ZC3 A;  5HVQ C;  4ZJZ A;  3CC2 I;  1Y8R B;  1MSE C;  3HYI A;  5BOX A;  1NHA A;  2R7F A;  3GVA A;  3FXK A;  3ABM H;  3LL7 A;  2V1X A;  4O3M A;  4EGZ A;  3BTJ A;  2XRL A;  1I6H J;  1R6R A;  2VJI A;  1B8I B;  4ENJ A;  3SXY A;  3HRM A;  3B6C A;  5DS9 A;  3OYG A;  3SZT A;  3E0J B;  5J4V A;  5FRN A;  2K85 A;  2LFB A;  3ZMS A;  2COM A;  1ZKG A;  3FM5 A;  2AQE A;  2KIU A;  3PIP F;  1ZRC A;  2HOE A;  3R6S A;  3QPH A;  1W1W E;  1MJB A;  1TQP A;  1V4R A;  5JLX A;  5EG0 A;  1OCZ H;  3LOC A;  5E3L A;  4AIK A;  1DP7 P;  4KIG A;  4I01 A;  3V8K A;  2CQQ A;  3OYB A;  1PVE A;  4W97 A;  1QZZ A;  1KU7 A;  1SAN A;  3P7N A;  4XOR A;  3REO A;  2L9V A;  2HQR A;  1I3Q J;  3R0J A;  4BJ6 C;  4ZYH A;  3H3Z A;  4RGU A;  4HST A;  2XKO A;  3L9F A;  5CVV A;  1Z1D A;  1B1B A;  5M5Y J;  3LAP A;  4GCV A;  1VQ7 I;  3EYY A;  4F55 A;  3LSP A;  3CUQ C;  4UV9 A;  3T5X A;  4HOB A;  5DCM A;  3DCF A;  1YQA A;  4XBF A;  3HOV J;  1LFP A;  3H0G J;  4IHS A;  3EYI A;  4JP0 A;  1ZGA A;  3GZN B;  2FBH A;  1REP C;  1TWG J;  3E97 A;  1JUP A;  3VFZ A;  2FMY A;  3FM3 A;  3I4P A;  3T8R A;  5KK1 A;  3K4B A;  2ETH A;  4G6Q A;  1S5L C;  2X9D A;  3I4N J;  4A5M A;  1X1D A;  2VKE A;  3S1M J;  1Y0N A;  3KCC A;  3H35 A;  4MHG A;  3FKJ A;  1OKR A;  1O3Q A;  2W4S A;  2YX7 A;  3PO3 J;  4KFC A;  2ISY A;  3TO6 A;  1FZP B;  1TNT A;  2X6Y A;  2LVS A;  2LD5 A;  3A0H C;  3J80 Z;  4RB0 A;  2E5N A;  1DUX C;  2CUZ A;  2HGC A;  2M30 A;  5EYR A;  2A6T A;  1XGN A;  2EA4 A;  2Y48 A;  1IG7 A;  3ZMZ A;  3CME I;  1A5J A;  1I1S A;  4DNC A;  2DFI A;  3L00 A;  1OJL A;  2DFH A;  1GT0 C;  4HRI A;  4M6V A;  1IRZ A;  2VJ5 A;  2BXY A;  4D7M A;  4KIS A;  3A4C A;  4OWR B;  1ZR4 A;  3SDG A;  2B9S A;  4CCM A;  2GZW A;  2H1K A;  3O2P E;  4XKB A;  3V7S A;  3BZK A;  1YTY A;  3CC7 I;  5IOY A;  2F4I A;  2YU3 A;  4NB5 A;  3WGH A;  2FEZ A;  2DCE A;  1XSD A;  2KIQ A;  2HDW A;  2XDV A;  3CCR I;  1X1P A;  2ZXH A;  1SFK A;  1SEU A;  4IO9 F;  3C2G A;  4H4K C;  1J09 A;  2E71 A;  2NYX A;  2P7V B;  2ZXW H;  1ETW A;  4FTH A;  1XSV A;  5K5Q A;  3TO7 A;  2KPM A;  3A0B C;  4W1U A;  1V3F A;  1IDZ A;  1PUF B;  1WJ5 A;  1YE9 A;  1D1A A;  4IOC F;  3RI4 A;  1VQN I;  1GV2 A;  4P96 A;  2ZJQ F;  1TWF J;  3OY9 A;  1ZRE A;  3CO6 C;  3CP8 A;  1XDS A;  2XB5 A;  4I0A A;  4PK4 A;  1SVO A;  1KYW A;  1K4S A;  2MG4 A;  3GW2 A;  4BBR J;  1IAW A;  1MW7 A;  1VQ4 I;  2KRF A;  4JK1 X;  3HHH A;  1X1C A;  3GTG J;  4UUV A;  2DMP A;  3Q9S A;  1MMS A;  3AKZ A;  2V7F A;  2YS9 A;  3TDZ C;  2FX0 A;  4KIC A;  1FTT A;  2NOG A;  5K7Z A;  2EV5 A;  3S2H J;  3CCS I;  2M4G A;  4BU2 A;  3M07 A;  3LA7 A;  2P0W A;  3QP6 A;  2AXL A;  2ZBK A;  1BI0 A;  2XAU A;  1H88 C;  4EJU A;  4LGW A;  2HOT A;  3TKY A;  2RKH A;  4ENM A;  1RKW A;  5ERI A;  5LHG A;  2NS7 A;  4ABZ A;  1ZYR F;  3LSH A;  2L01 A;  4MIM A;  2OCE A;  2DDB A;  2RDP A;  3Q0U A;  2K9Q A;  3PSF A;  4CCK A;  3LA2 A;  5DCM B;  3CCY A;  4TV7 A;  5F04 A;  5J1R A;  4I0B A;  2IS2 A;  1WJB A;  1VND A;  3OR1 C;  4RAZ A;  2ISZ A;  3WG7 H;  4BJ5 C;  4ITV A;  1XCV A;  5D4S A;  5GAE J;  1A6I A;  2HOA A;  1R49 A;  4P55 A;  2WAQ N;  5CVU A;  2HXI A;  3WE2 A;  5FLX Z;  1A35 A;  2H1L A;  5E8I A;  3ZQC A;  3OL4 A;  2V9P A;  3CUQ B;  4ESJ A;  3WGI A;  1NK2 P;  1XS9 A;  2H27 A;  3LMM A;  4L5I A;  2X6X A;  1MNE A;  4IHX A;  1K6Y A;  5B5E C;  3DU5 A;  2BW3 B;  2DYR H;  4A3F J;  2GWR A;  2FSW A;  3QWL A;  1Z6T A;  4AM3 A;  4I7H A;  1CQT A;  2LY2 A;  3IWF A;  2BHY A;  1E2X A;  5HS9 A;  1CF7 B;  2LRE A;  2ZFW A;  4A3E J;  3GFL A;  4B44 A;  1XPX A;  4C3H J;  3MN2 A;  3RZD J;  3WGG A;  3H0D A;  5HLT A;  1XCB A;  2CU7 A;  2K4J A;  5DYM A;  5D5V B;  5M5W J;  3BG5 A;  1RR8 C;  3PNV A;  2L7F P;  3BTL A;  2HVR A;  3DP7 A;  2LBF B;  4XN3 A;  4HX8 A;  3BR1 A;  4XOT A;  1B59 A;  2CH0 A;  2FNA A;  3SJM A;  4KIB A;  3PJR A;  3SFI A;  3QOP A;  1X4P A;  4D5F A;  2BE5 F;  4OU0 A;  1HBX G;  1VFC A;  2EFQ A;  3JSP A;  2E7W A;  3JRC A;  1G3Y A;  3E5Q A;  3HHG A;  4AUX A;  2LTP A;  2L2O A;  1G3W A;  4OAZ A;  2IRF G;  3WTV C;  1CGP A;  3BG9 A;  4II2 A;  2DDA A;  3BG3 A;  3F8M A;  1YW9 A;  1U5T B;  1WJF A;  1N78 A;  2R7V A;  1ZLK A;  1IXR C;  3GTK J;  2Z33 A;  1UAA A;  1Q1H A;  4C3I J;  5F64 A;  5HOD A;  2ZXI A;  1WH5 A;  2CS3 A;  1Z05 A;  2DPU A;  2M45 A;  2GBY A;  4M6Y A;  1KU3 A;  4E7H A;  4CUG A;  1W7P D;  2F2E A;  5K1Y A;  4Y17 A;  3HRU A;  5IY5 H;  2PBI A;  1HC8 A;  3SEZ A;  1JKR C;  4M73 A;  2R7S A;  4XID A;  2L4M A;  4ANJ A;  1JHF A;  4ZYG A;  2ECC A;  3BPV A;  2A5W A;  2DTZ A;  4HSR A;  4D7N A;  1WHU A;  2VB6 A;  2IGN A;  2W1O A;  2EZL A;  3WTT C;  4N9H A;  1O3R A;  3HXL A;  1FBU A;  2AXT C;  2QUF A;  3H9Q A;  2ZME B;  3U1D A;  4F52 A;  1UG2 A;  3K1P A;  3TOB A;  2IP2 A;  4M9S A;  2RV8 A;  3W2W A;  3CP2 A;  1YIO A;  2KJC A;  2NVU B;  3W6V A;  4F7Z A;  1HSJ A;  1MBF A;  5JHF A;  2XB0 X;  1DU6 A;  1GLN A;  4DZP A;  4FT8 A;  1K83 J;  2Q8K A;  3SZG A;  5JFR A;  4LFU A;  2RC4 A;  2OF7 A;  1D5Y A;  2LOO A;  5EGO B;  1VQ9 I;  4BQA A;  3EUH A;  4U7B A;  3M1E A;  1LPQ A;  4L0Z B;  3F23 A;  4AYB N;  2TDX A;  2M1B A;  2A61 A;  2A6E F;  3BR2 A;  1IN8 A;  3KP6 A;  4E7Z A;  3TO9 A;  3RPU D;  1PUF A;  1YJN I;  1TW2 A;  5J3L A;  1JJ8 C;  5L3F A;  5EG0 B;  3D1N I;  1V5F A;  2DAO A;  1G8X A;  3VYS B;  2HFH A;  2KZV A;  2VOP A;  2JPC A;  2OPT A;  2BVM A;  4L9J A;  1K79 A;  2V6E A;  4LOC A;  3J81 Z;  4Y15 A;  1LDJ A;  4KA4 A;  4RGS A;  3JRH A;  2E2I J;  1JI8 A;  3GLL A;  1IXS B;  1XDU A;  1MDM B;  2O0Y A;  4DBQ A;  3UNG C;  3JRI A;  4BKX A;  1IGN A;  1KYZ A;  3KEY A;  4HG2 A;  2FBK A;  4MQ9 F;  3ECO A;  3QPT A;  2QGU A;  4EV0 A;  2O5R A;  2P81 A;  4HAM A;  2XAQ A;  3VWB A;  1PUE E;  2CV2 A;  3IKV A;  2VXD A;  4DIQ A;  4A3M J;  2ZJR F;  2BBY A;  1FP2 A;  2WB1 N;  2X6W A;  3FZV A;  2CQX A;  2HI3 A;  1N25 A;  2R5Y A;  1D0X A;  2MBF A;  3A03 A;  1SFO J;  3OWT A;  3ZCO A;  1IRF A;  5K5R A;  2G9W A;  1LVA A;  1BOB A;  4YRV A;  2DQL A;  4HDU A;  1T0F A;  4MTE A;  2QQA A;  1KA8 A;  2HXO A;  4XSX F;  4LG0 A;  3IKT A;  2CUJ A;  1LQ1 A;  3D5L A;  2WBM A;  3ASO H;  3C18 A;  2VBW A;  4Y3O A;  5J8C A;  1B8I A;  3IAS 2;  2VUM J;  2GLO A;  2K9S A;  2JUC A;  4HV6 A;  4UUS A;  4PZJ A;  4NC7 A;  2CUF A;  2EV0 A;  2L9R A;  2JRM A;  3OOU A;  3QQA A;  1R9T J;  5LGN A;  2EZI A;  3QU3 A;  4XRF A;  2TCT A;  3RKY A;  3H1C A;  2JQ7 A;  5J40 A;  2KRC A;  1T8I A;  1U5T C;  4LIV A;  2RNJ A;  1YW8 A;  1HW2 A;  3GZ5 A;  3MAJ A;  5FRO A;  2K9N A;  2LYC A;  2M3A A;  2J5P A;  4FIS A;  4GXO A;  1QGP A;  4NNJ A;  3WTX C;  3CC4 I;  4UY8 I;  1W7P B;  1JT6 A;  5FFX A;  1FTZ A;  2VN2 A;  1SFU A;  3BC8 A;  4XLP F;  2OU2 A;  2CV0 A;  4YFK F;  4BXX J;  3VSL A;  2M7B A;  4LB6 B;  2Y9Y A;  3K1N A;  3KLO A;  1JKO C;  3JRE A;  2Q0O A;  2PMZ N;  2HWV A;  5HDN A;  1NG6 A;  3ABT A;  3WU0 A;  3OIQ A;  3ZQG A;  3O8H A;  4U0W A;  4XL9 A;  2D2W A;  3KYL A;  3H9J A;  2JA6 J;  4IRH A;  1ZTR A;  1RZ4 A;  5DD8 A;  2WAF A;  3WHB A;  3ZMV A;  1R71 A;  5HLH A;  1SFX A;  3BR5 A;  4HF2 A;  3K70 D;  1RRJ A;  3BZC A;  1I50 J;  3Q9V A;  1POG A;  4P9U A;  2A69 F;  5KAI C;  5ICC A;  3NAU A;  2E1C A;  2Z3Y A;  3F6V A;  2V1N A;  1V5G A;  3VYT B;  4FE7 A;  4BY7 J;  2DA5 A;  3K4M A;  3DXJ F;  3HIF A;  1EH8 A;  2EIK H;  3S15 J;  2IW5 A;  1BIB A;  1J9I A;  3VYU B;  4U7D A;  2MC4 A;  4JOM A;  3T8T A;  4A3I J;  1SAX A;  1MMN A;  3CO7 C;  2W7N A;  5EF6 A;  2P4W A;  2CFO A;  2BY3 A;  2F5E A;  4XK4 A;  3HG9 A;  1FC3 A;  3QOD A;  2W48 A;  4BE2 A;  2PG4 A;  5A2Q K;  1LDD A;  5JI6 A;  2CQN A;  1IN4 A;  2YU9 J;  4HF1 A;  3HTU A;  4OIP F;  4V19 K;  3AG3 H;  2VOD A;  5IT9 K;  5JLW A;  4B4C A;  5DD4 A;  5IP6 A;  1OFC X;  4K2E A;  4WWC A;  4ESF A;  1U0J A;  2P8T A;  4WXD A;  2ID6 A;  3DEW A;  4XM3 A;  2LP0 A;  2PMH A;  1IV8 A;  5FJ8 J;  5GPA A;  2FQ4 A;  4CO8 A;  2G0E A;  5GTI C;  2ZFU A;  5E3O A;  3I64 A;  3IHU A;  4UVB A;  1VF9 A;  2M0C A;  1HKS A;  2WV0 A;  3AFH A;  3R4K A;  2HPM A;  3GBG A;  3F9K A;  2EQR A;  4LG0 B;  1UCR A;  1HST A;  4DBR A;  4U0Y A;  5CQE A;  2HOS A;  2DOD A;  2K40 A;  3L1P A;  1S7A A;  2HYG D;  2XKP A;  5GTH C;  5ILV A;  2L7K A;  1FP1 D;  1FY7 A;  3ZQL A;  3E6M A;  2FNP A;  4HZF A;  2ZME C;  1BJA A;  3K9T A;  4XNF A;  4OIO F;  5FLV A;  1RPW A;  5IYB J;  3MKZ A;  2GQQ A;  2VOO A;  4F93 B;  4CCO A;  3JR9 A;  3GUD A;  4JX4 A;  1D8J A;  2M34 A;  1MZB A;  1OCC H;  2FRH A;  3EDP A;  4BGD A;  1LE8 B;  1UHW A;  2R7U A;  3M9A A;  2DLL A;  2DFF A;  4PFO A;  2VC0 A;  2IEK A;  1IC8 A;  3VB2 A;  1WWX A;  3RPQ A;  3ZXS A;  2NOJ B;  2ZCW A;  3KFW X;  1DPR A;  4M6X A;  2VPL A;  4PSX A;  3L2Q A;  1YLF A;  4E7K A;  2VBZ A;  4CDG A;  2QKM B;  2VON A;  2XRN A;  3P9I A;  5J8F A;  4Z2Y A;  1BI1 A;  4QIW N;  4PSW A;  4G6D A;  5CQG A;  1X3Z B;  2A68 F;  5E1Z B;  5KHD A;  2JRT A;  2XPU A;  3B73 A;  3L2W A;  4ZYE A;  1LFB A;  3BCA A;  3G1O A;  2C6Y A;  1U9N A;  2OV7 A;  1MH4 A;  4RS8 A;  4Y52 J;  4ZZD A;  3WG9 A;  3L2C A;  1ETX A;  4XRM A;  4YFX F;  3TGN A;  5FD6 A;  1IRX A;  4A3C J;  5ICF A;  2OCC H;  2LR8 A;  3G1L A;  1IV6 A;  2B63 J;  4D0P A;  1HXD A;  5E3M A;  3CJR B;  1ZGJ A;  1O7F A;  1Y1V J;  2HZD A;  5J1U A;  1HQC A;  2IXS A;  1T6S A;  3S2W A;  1Z91 A;  1BA5 A;  2EIN H;  1WI3 A;  1Z6R A;  5FKK A;  2KFD A;  1DGW Y;  1UMQ A;  3SYT A;  1IN5 A;  1HW5 A;  2ECB A;  4FET A;  3BY6 A;  2MAB A;  3PNY A;  4BQO A;  2XGE A;  2OQG A;  4XOP A;  1T39 A;  4IRI A;  3W3C A;  4Q47 A;  1Z3Y A;  4G9Y A;  2VKV A;  3ZQF A;  1T33 A;  3IH4 A;  1SD5 A;  2VQC A;  3PO2 J;  5KVR A;  2O8X A;  2QEN A;  2GOX B;  2F5V A;  3PM1 A;  2W25 A;  3TQN A;  2IPQ X;  5H20 A;  5B1A H;  2P6T A;  5E3N A;  3S1R J;  1HDP A;  4RDU A;  5D5U B;  1LUJ B;  1F4K A;  2PEX A;  2WAE A;  2IBD A;  2FOK A;  4CCL A;  2WC2 A;  4O6J A;  4NQW A;  1IN7 A;  4O5V A;  1HLV A;  3RDI A;  1YW7 A;  1T2K A;  2CSO A;  3NWS A;  4I09 A;  1OMI A;  2JMW A;  1MJ9 A;  4PJ0 C;  2V9V A;  2MD0 A;  4L5E A;  1E3P A;  4EM0 B;  2EZK A;  1MMG A;  4C30 A;  2JVH A;  5D8K B;  3LSM A;  2YSR A;  2LKX A;  2PX9 A;  4IHW A;  3RKX A;  3F8N A;  4N4O B;  1O57 A;  3HJE A;  2R7Q A;  3JAM Z;  2VLA A;  1UZC A;  1ETO A;  3CDI A;  3ECH A;  1FOX A;  5F1R A;  3MVP A;  3CTA A;  2LY1 A;  2E2J J;  4LK1 F;  2W82 A;  2MSY A;  4IHV A;  3MKY B;  1D0Y A;  1R5I D;  4AWX B;  5E17 F;  1U3E M;  3NRV A;  2KHM A;  1EA3 A;  4L9T A;  1LE8 A;  2PFB A;  3ABU A;  1MBK A;  3RTR A;  2O03 A;  3RZO J;  1AU7 A;  4BY1 J;  2ADU A;  4NQW B;  3W2A A;  5F1J A;  2DA1 A;  2CJJ A;  4XSZ F;  4NHJ A;  4X6A J;  4CSW A;  2ELH A;  5EEH A;  1MBE A;  3K1M A;  2OA4 A;  1HA8 A;  3CCM I;  1MBH A;  5BPI A;  1WQ2 A;  3LFK A;  4BYY A;  3HB9 A;  2V1U A;  4RLF A;  2F5F A;  3F72 A;  2ZKZ A;  1Y0U A;  1TL8 A;  2L9N A;  1EJ9 A;  4CHU A;  1MBG A;  3LFU A;  2GXA A;  3AL0 B;  2EZH A;  3KX2 A;  4R79 A;  1SVM A;  2F6C A;  3ZOB A;  2D1V A;  4RM3 A;  3BZ6 A;  2CV1 A;  3TW6 A;  3ZMD A;  5DM6 F;  4KN4 X;  3ERE D;  1EH6 A;  2P6S A;  3ULQ B;  3OYK A;  4XKC A;  2Z1D A;  1X2N A;  1U2W A;  2KLO A;  1TP4 A;  5HLI A;  3MEX A;  1PJR A;  3GFM A;  5ED4 A;  4C2U A;  4XRS A;  2ESN A;  5IYC J;  3S32 A;  1GVD A;  4QLC U;  4AVZ A;  3DTK A;  3CCQ I;  1OIS A;  3LAJ A;  2QYO A;  1G3S A;  1YYV A;  2KDZ A;  5FKM A;  1YJ9 I;  1QVT A;  2FD5 A;  2STW A;  3RKQ A;  3ERM A;  3FMS A;  1TQI A;  2V1D A;  5HDK A;  1IN6 A;  2MLK A;  4BJT A;  3OYM A;  2JSC A;  1DGR M;  1FJL A;  3BTC A;  2OJE D;  2I8D A;  2Z5U A;  1B72 B;  5CVI A;  5ICE A;  4J01 A;  1QZE A;  3LWF A;  2HVS A;  4HX4 A;  1VI0 A;  1PYV A;  3AG2 H;  2X85 A;  1R1T A;  3JCU C;  1JUS A;  1YIT I;  4G6T B;  2CWE A;  3K4C A;  1R22 A;  4BXF A;  1SMT A;  5ICG A;  1XMX A;  3IL2 A;  4MNU A;  3T0Y A;  1D1C A;  2LKP A;  2R3S A;  4NC8 A;  1YFH A;  1VQ8 I;  2R7X A;  1SMY F;  1STZ A;  2L5Q A;  3H5R A;  2M8E A;  2XVC A;  2R0Q C;  3S3O A;  4A93 J;  3ABL H;  2HYJ A;  3HM5 A;  3RJP A;  3GTQ J;  2K4B A;  4RAY A;  4LLG F;  1TW3 A;  4IQJ A;  1MMA A;  3ONQ A;  4NUB A;  2RQP A;  3W6J B;  1VQK I;  4A3L J;  1GVJ A;  2V79 A;  4A0Z A;  1HOM A;  3DWL E;  4A2U A;  1X4O A;  3R60 A;  2XAF A;  4HLX A;  3FK7 A;  5F08 A;  5BMZ A;  3RIR A;  4OIQ F;  1H9T A;  2HNH A;  3FKI J;  3IUO A;  3K70 C;  4I6Z A;  2LNB A;  3CJN A;  4OOI A;  3BRO A;  3GTP J;  2ZSI B;  1A04 A;  3WHC A;  4E6K G;  1XX5 A;  2DA7 A;  2XAH A;  4DW6 A;  4XLA A;  2E2H J;  1X3W B;  4J00 A;  3HBL A;  4UB6 C;  1B72 A;  2QWW A;  2ZC2 A;  4CA0 A;  5BNG A;  4L5J A;  3TOA A;  2YX4 A;  5E1W A;  4A12 A;  1JGG A;  1ZRD A;  4PFP A;  2L02 A;  1WVR A;  4XQF A;  1FSH A;  3FMQ A;  1G2H A;  2CGP A;  3L7W A;  3MKL A;  3C1D A;  2HTS A;  3VPR A;  1S72 I;  1PP7 U;  3EUK L;  1QU3 A;  2MH9 A;  1K4T A;  3DBL B;  1JGS A;  2Y0S N;  1FSE A;  5IPA A;  3IWZ A;  2M9H A;  5K5O A;  1BC8 C;  3FHZ A;  3ZQQ A;  3K4K A;  2Q2E A;  4L9V A;  2OZ6 A;  2KP6 A;  5D5W B;  4XLE A;  5D6E A;  3I55 I;  4D5C A;  4M3D A;  2UUZ A;  4A5N A;  4XR6 A;  2LF8 A;  3DQV C;  4M72 A;  5DCF A;  4R8H A;  5J47 A;  2DA6 A;  2X0L A;  1RI7 A;  2I5U A;  4LIU A;  4QPO A;  3MKW B;  4YIR X;  3JRD A;  4FX0 A;  5DDG A;  3E1S A;  3TP3 A;  4XLH A;  3PIO F;  3BT9 A;  4U0V A;  5E8G A;  3GME A;  1MND A;  3IRQ A;  3DEE A;  1BOA A;  1BW6 A;  3AAF A;  3HOY J;  3WTY C;  1AOY A;  1FBS A;  1JUM A;  3D5S C;  5GAG J;  4L0Y B;  5F0F A;  3CLO A;  2E5Z A;  4A0X A;  5KAF C;  2GIV A;  3OS2 A;  1P2F A;  4WX9 A;  5F0C A;  3E5U A;  3OIP A;  1GDT A;  1FOY A;  1I39 A;  3FBN B;  2ESH A;  3WE3 A;  1Y39 A;  2GOM A;  3LNQ A;  5JHU A;  3QOE A;  2JVG A;  3S14 J;  2HKX A;  2X6O A;  2XAS A;  3ML6 A;  1FLI A;  3QRF F;  3ZRG A;  2STT A;  2AHQ A;  1WFX A;  2GM4 A;  3LQR A;  1QVU A;  2MW8 A;  1IO2 A;  4I98 B;  3GWZ A;  1LFU P;  3V7R A;  1ETV A;  3ZGK A;  2HPI A;  5J1Y A;  3KE2 A;  2DOA A;  2EWN A;  1FPQ A;  3F8B A;  2M0M A;  5IT3 A;  2BV6 A;  2LSO A;  1ZRF A;  2VQL A;  3Q5F A;  3JSO A;  2XIG A;  2XF5 A;  1R4M B;  5CLS A;  1R36 A;  3IH2 A;  1K6O A;  1RET A;  1CF7 A;  3I9V 2;  2IS6 A;  3WOD F;  2H6B A;  3G73 A;  1TQM A;  2O7O A;  3CD6 I;  1MJA A;  3WU1 B;  2DMQ A;  2Y31 A;  1HDD C;  1YIJ I;  2QKL B;  3K4L A;  3E6D A;  4A6E A;  5LGU A;  4HNV A;  2YPR A;  2UZK A;  4KIF A;  5M3F J;  2QF7 A;  4IHT A;  2VQG A;  2Y30 A;  4AC0 A;  1P92 A;  1QRY A;  4CYC A;  1R1V A;  3QYB A;  1WJA A;  3RKW A;  1UJ8 A;  2QQ8 A;  1FT9 A;  3OS0 A;  3KEQ A;  4RB2 C;  2R7W A;  2A3S A;  3HRS A;  1L0O C;  4UVC A;  1YX3 A;  1Z0X A;  1JJ6 C;  2BZT A;  2OUM A;  4RMN A;  3SFZ A;  2EBI A;  2CYY A;  3BOQ A;  1BL0 A;  4M3F A;  1H8A C;  1TTY A;  3FXO A;  1DDN A;  2JA8 J;  2Z2S B;  4LD5 A;  3HOU J;  2ZJP F;  3ZN1 A;  3CZ6 A;  3K10 A;  4S04 A;  1QA6 A;  3HOS A;  4GO1 A;  1KQ9 A;  4Y7N J;  5BS6 A;  2BVL A;  1TC3 C;  2JA7 J;  5B3S H;  1QBJ A;  3DPL C;  1OYY A;  2K27 A;  2OTL I;  2N8G A;  2R5Z A;  2PI0 A;  3O3K A;  4ZTF A;  4A3D J;  3O6B B;  3OR2 C;  3KIO A;  4FCY A;  5FLM J;  2DPD A;  3GO5 A;  2Y9Z A;  2DBB A;  2JA5 J;  1VQM I;  3IP4 B;  5HDG A;  1B6A A;  1SD6 A;  5ILS A;  1X2M A;  2L9S A;  1O4X A;  4I02 A;  3JTG A;  1V5E A;  3UKG A;  4M3E A;  2EFN A;  4XLN F;  5BQT A;  3QPL A;  3I5U A;  1MGT A;  1ONV A;  2KQR A;  1U78 A;  1RES A;  3ZPL A;  2QBY A;  4FQG A;  4RLQ A;  4GYG A;  1W0T A;  1MSF C;  1VTN C;  1IF1 A;  3MMY B;  3SDB A;  4RGX A;  1JT0 A;  3FDY A;  4ASN A;  2R7O A;  1X19 A;  1GXP A;  3IAM 2;  5ILU A;  1RKT A;  4EM2 A;  5EJC A;  5DEQ A;  1UST A;  2R5Z B;  3CF2 A;  3PFI A;  5FKN A;  3Q0V A;  1D8K A;  2DXI A;  2F4M B;  3VOE A;  1YX5 A;  2KT0 A;  2MC3 A;  1I6X A;  2K9M A;  3BTI A;  1EV7 A;  2K9L A;  4BS9 A;  1BN5 A;  1K7A A;  1Z21 A;  3ZQH A;  4B3A A;  1R4N B;  1P4X A;  4YII A;  1X1A A;  4KIT B;  2CW0 F;  4DZJ A;  2WY8 Q;  2NVY J;  4BNC A;  2X48 A;  1S29 A;  3S16 J;  3JRF A;  4G7Z F;  4G8X A;  2ZSH B;  3OIO A;  1OCT C;  1OYW A;  3H92 A;  3BQZ A;  2OTJ I;  2MFZ A;  2R7Z J;  4ON0 A;  5FRM A;  1I27 A;  4KJZ A;  3V42 A;  1F1Z A;  2JN6 A;  1S7E A;  1IUF A;  2X1C A;  1ON2 A;  3QPS A;  4E4H A;  3G2B A;  5TRD A;  4A0Y A;  4N4N B;  2PN6 A;  3GCM A;  2HQA A;  2EK5 A;  4BQQ A;  2LRD A;  4I2O A;  1UFM A;  1KU2 A;  2CMP A;  5EEG A;  3L2V A;  3A02 A;  1V54 H;  2IA1 A;  4CH7 A;  1XC5 A;  3CMA I;  4BEH B;  2KIF A;  4PJJ A;  2NVX J;  1HW1 A;  1IJW C;  1OCP A;  1QQI A;  2NXN B;  2R7D A;  5DV5 A;  3Q0W A;  2DA4 A;  4IEJ A;  5DTD A;  1ZG5 A;  1FOK A;  4BE1 A;  4WK8 F;  2LC2 A;  2JWT A;  2FU4 A;  4AVP A;  2WTE A;  5LRR A;  3U1K A;  4EVI A;  3HUG B;  4LMY A;  4XKW A;  5HOO A;  1K61 A;  3OS1 A;  4E7S A;  4ZYD A;  3GEZ A;  2B7E A;  3COA C;  1ETY A;  1OQY A;  2E1M B;  2O6G E;  2HKO A;  3BG6 A;  4FHT A;  4KDP A;  4XLC A;  5FGM A;  1WH7 A;  2CUE A;  4A3K J;  1ZEL A;  4JBA A;  5CVJ A;  4N9I A;  5DM7 F;  2VJ4 A;  2DA2 A;  2RGV A;  3FXQ A;  1EF4 A;  5BPD A;  2H8R A;  5FD5 A;  2W84 A;  4IPA A;  3ZR8 X;  2VBX A;  2CQK A;  2M4K A;  5L3G A;  1YHQ I;  3H3U A;  1U8R A;  4CZC A;  5DUK A;  2LLK A;  4KMU X;  2RRE A;  1UHS A;  1R1U A;  3CMY A;  2O8K A;  2GA1 A;  2M2E A;  3BJ6 A;  1DPU A;  3K69 A;  4G94 A;  3I4M J;  4QSH A;  3RQI A;  3LA3 A;  2QQB A;  4BXU A;  3FWE A;  1APL C;  2HEO A;  3I59 B;  3ISP A;  3LSI A;  3SEQ A;  4OIR F;  2VT2 A;  1W5C C;  5KNL A;  2R92 J;  1ZK8 A;  2GIZ A;  3F21 A;  2WAQ A;  4ZDO A;  3C7J A;  1SC7 A;  3NEU A;  2WB1 A;  4II3 A;  2K5C A;  3KP4 A;  5CJ9 A;  4UVA A;  5JVT A;  2W00 A;  3G4S I;  2E19 A;  6PAX A;  1BR4 A;  4XKV A;  5F27 A;  2DTR A;  2QSH X;  1ZAR A;  3LSR A;  4KN7 X;  2PMU A;  4PGG A;  3DTE A;  1T08 B;  1X1B A;  1ENH A;  5L3E A;  3BG7 A;  3S93 A;  2IGM A;  1BJZ A;  3GXO A;  2ID3 A;  3BR6 A;  4LLL A;  1WRJ A;  3PL8 A;  3HGY A;  4UUS B;  2P7C B;  4LLN A;  1P4A A;  5H2F C;  3GTM J;  4KUM A;  2XGD A;  4HNT A;  1ZR2 A;  3I58 A;  3C2H A;  1S3J A;  2W85 A;  1M1E B;  5LRS A;  3JW4 A;  2E1N A;  2X1D A;  1HKT A;  1Y56 A;  2E7X A;  2IGK A;  3JRG A;  2VT3 A;  1MKM A;  5C3E J;  3HOX J;  3OYF A;  2CRG A;  1MNM C;  1B4A A;  1TT0 A;  2DI3 A;  2F4O B;  3MQ0 A;  4M3B A;  2V9K A;  1Z7U A;  1J5Y A;  2Z16 A;  4RAG A;  5FKO A;  5HS7 A;  1JKP C;  3VOD A;  3A01 B;  1HKQ A;  3HL2 A;  1S9H A;  3I59 A;  5D6F A;  4BH9 A;  2W57 A;  1XN7 A;  1YS7 A;  4ENN A;  4XIC A;  3I53 A;  1K78 B;  1R5G A;  2XV4 S;  1ZHF A;  2VJJ A;  2CW7 A;  3KP5 A;  4D1Q A;  4A3J J;  2HS5 A;  1LNW A;  3JRB A;  2DJN A;  2K3P A;  3LSK A;  3P9K A;  4BL0 B;  2F48 A;  4ETS A;  3DV8 A;  1ZAO A;  1VZ0 A;  2PMZ A;  4A3G J;  2KMU A;  1XGM A;  3GTL J;  3FBI B;  1ZGW A;  1BIA A;  5LD2 C;  1LDK B;  3F22 A;  4BQN A;  4IRG A;  1W36 D;  2XSJ C;  4V2G A;  1FNN A;  1X3U A;  2EB7 A;  3HRT A;  2ZXJ A;  1UEL B;  1D1B A;  3KYC B;  5B1B H;  2PJP A;  3QP5 A;  4MQV A;  2E36 A;  4PDK A;  3DKX A;  1RC9 A;  2LKS A;  3MD2 A;  5L3C A;  2BYV E;  2LG4 A;  4UV8 A;  3DEU A;  1TLH B;  4ZH4 F;  3FIW A;  2XPW A;  1P7I A;  3OYH A;  2ELJ A;  2YUS A;  3OYC A;  4MEX F;  5TGT A;  2ZME A;  2L7Z A;  1BR2 A;  3A01 A;  2WWY A;  4HBL A;  1LVK A;  1OPC A;  1WI9 A;  3CDL A;  1WSU A;  2HDD A;  3BDD A;  4ZZL A;  1J7K A;  3OYI A;  2LDU A;  5H6Q A;  4P9F A;  3RYP A;  2COB A;  2ZO4 A;  3H36 A;  3CUO A;  3H9G A;  2Q2E B;  2Y2Z A;  1U6G A;  2EH3 A;  2JTV A;  2Y0M A;  5LBQ A;  2WY7 Q;  3HC7 A;  5B66 C;  4F91 B;  2P5V A;  4WXH A;  4HW0 A;  2RQQ A;  1BBY A;  1XD7 A;  4WF2 A;  2KL4 A;  2VL8 A;  2DYS H;  1O3T A;  1AA7 A;  4RGR A;  3K4N A;  1E0E A;  2I10 A;  2DMN A;  2P5K A;  1R00 A;  1Q1V A;  2X1E A;  3TBI A;  3F6O A;  4IL6 C;  4CIC A;  4IHY A;  3E5X A;  2FML A;  1BC7 C;  4HF0 A;  3RYR A;  2D45 A;  2OQR A;  2IT0 A;  2EIL H;  3S2D J;  1ULY A;  1EH7 A;  1IUY A;  1GV5 A;  1QZY A;  3MZH A;  2VC1 A;  2IVM A;  4QPQ A;  1OCO H;  3WTU C;  4JX6 A;  1Y6I A;  4M9X A;  2LH9 A;  4WXC A;  2Q1Z B;  3KZY A;  4YG2 F;  3FK6 A;  3J7A O;  4Q4Z F;  4XON A;  4KNY A;  4EJW A;  1ZH5 A;  4RBO A;  1TT5 B;  4C3J J;  5IP9 J;  1LEB A;  3PNT A;  3CMM A;  3J81 K;  3U2R A;  3S3M A;  3QYF A;  2OBP A;  2P5L C;  1OR7 A;  3DFG A;  3HSE A;  2K3F A;  3OL3 A;  4YEL A;  3V8L A;  3L2R A;  1RUO A;  2XRO A;  4JYK A;  2GAU A;  2ME0 A;  3ZMU A;  1KU9 A;  1FMW A;  3FHN A;  1ZN2 A;  1I1G A;  2E1O A;  3MZ8 A;  2DK5 A;  1FBQ A;  1QO0 D;  1QPM A;  4FAS D;  1RUN A;  3S1N J;  2OD5 A;  1FWZ A;  2R5Y B;  1Z67 A;  2DT6 A;  2YR2 A;  4LB5 A;  2A5Y B;  4NDL A;  5L3B A;  4OMZ A;  5EDN A;  2UXN A;  1EKE A;  4BDZ A;  2FA5 A;  4EJO A;  4B3X A;  3T1B A;  2D5V A;  3BWG A;  2LK2 A;  4F3Q A;  1KGS A;  3K7A J;  3LQQ A;  1ZG3 A;  3HDD A;  1HF0 A;  5F6F A;  4IXA A;  2EJR A;  4MEY F;  1VQ5 I;  4EMS A;  1GXQ A;  4M3G A;  2QVO A;  2VKD A;  1ITY A;  2VI6 A;  1QHH D;  3S1Q J;  2E60 A;  3GFI A;  2EIM H;  3ELK A;  1KQ8 A;  4L18 B;  2NVQ J;  1IRG A;  1FOW A;  1GUU A;  1WJE A;  3CUQ A;  3GX4 X;  3CJT B;  1YJW I;  4EEF G;  2E34 A;  3JRA A;  1R5H A;  1JTY A;  1ETK A;  1OYI A;  4EAT A;  3ABK H;  1P4W A;  2FUG 2;  3ZP5 A;  2M87 A;  4B1R A;  4PJN A;  2G7H A;  1Y1W J;  4XLF A;  3CCV I;  4E7L A;  3BP8 A;  3K0L A;  2E35 A;  2NNY A;  5J4Y A;  1FYK A;  4PGH A;  5FLX K;  3BLY A;  3M8E A;  3TW7 A;  2QSG X;  3TMO A;  1MIJ A;  4G7O F;  3EUA A;  2HYF A;  1G6N A;  3J7Z I;  2IS1 A;  4IX7 A;  1Z7L A;  3AG1 H;  1P7J A;  3BR0 A;  3KZI C;  2EFO A;  3OYE A;  1SD7 A;  4M71 A;  2BGC A;  5CPR B;  3TED A;  1SD4 A;  4BE0 A;  4LJZ F;  3DKY A;  3CLQ A;  3BQY A;  3FF5 A;  4B48 A;  3ROU A;  2G7U A;  4PJL A;  2LBF A;  3ESW B;  2TRT A;  4PUS A;  2CO5 A;  4J19 A;  3FMR A;  1B9N A;  1T56 A;  1G3T A;  1AHD P;  2PJR B;  4UB8 C;  1XGO A;  5LHI A;  4OMY A;  2L4A A;  4GDF A;  1MMD A;  3D5R C;  2XF7 A;  4C2M J;  2OC6 A;  2ZJ2 A;  3KET A;  3B6A A;  3M1C A;  1YS6 A;  1LJ9 A;  2UXX A;  3FXL A;  1H89 C;  1VQP I;  1U8B A;  2M5W A;  4EQQ A;  2OAZ A;  3FIS A;  4BUP A;  1Y8Q B;  1WGX A;  2DMU A;  1X58 A;  4NBQ A;  3W2V A;  3PQJ A;  3DBH B;  2H94 A;  3FXU A;  3M4O J;  4BHB A;  5HNH A;  1F36 A;  1JHH A;  1I5Z A;  2XC7 A;  2DFE A;  5D4R A;  2BW3 A;  2IA0 A;  4LK0 F;  3FXM A;  2GA2 A;  2ME6 A;  2JZY A;  3SHF A;  5LFA A;  4AIH A;  1FIP A;  2EIJ H;  1PDN C;  4KYW A;  3FXJ A;  3DLA A;  2XAG A;  4RB1 A;  4EJT A;  2QA4 I;  1QPI A;  1VQL I;  2AO9 A;  3ZQI A;  2FBI A;  3J7Y J;  5HS8 A;  4S0H B;  1D5V A;  5E1X A;  2F5D A;  5IT9 Z;  5JVG F;  2O61 A;  1TZL A;  1P9Q C;  4X0G A;  3W6K B;  4IZZ A;  3QAH A;  5CYV A;  2DJI A;  5C44 J;  1ON1 A;  5AIQ A;  3H5A A;  4DQ2 A;  5D5X B;  2CQ7 A;  3RPU A;  2K02 A;  1KZH A;  1N75 A;  2ZNY A;  1FYM A;  2IAI A;  2JK3 A;  5E18 F;  1L3L A;  3C3W A;  5L3D A;  1ETQ A;  5C4J J;  2VIX A;  5JR3 A;  2HR3 A;  2L0K A;  3Q3S A;  4Q48 A;  4KMF A;  2DU9 A;  2JPB A;  3GFJ A;  3HPH A;  1BI2 A;  3RCO A;  3G71 I;  3ZQ7 A;  1HCR A;  3EQL F;  1KON A;  3CCE I;  1LEA A;  2A07 F;  1ZG1 A;  2NRA C;  4QWQ A;  4ZDL A;  2MH2 A;  2MLG A;  3PFY A;  1TWC J;  2D1H A;  3B02 A;  3A2K A;  3DPT A;  2NAZ A;  2Z9O A;  1Z3X A;  4AIJ A;  5IOZ A;  3M3Y J;  4HEA 2;  4HNU A;  2DK8 A;  2XHK A;  3HUG A;  3PUB A;  5F0H A;  3HSF A;  4G12 A;  3LSJ A;  1E3O C;  2VQH A;  1YRN B;  1B9M A;  1U9O A;  3ZN0 A;  5CKT A;  1WPK A;  3N4M A;  2IS4 A;  1AKH B;  5K7H A;  2H8W A;  3V4G A;  1G59 A;  5LHH A;  2QLZ A;  1NG7 A;  5J6X A;  3L2U A;  3HKZ A;  2PJR A;  2FXA A;  1TBX A;  4E70 A;  4A69 C;  4DYR A;  4Q5S F;  5LGT A;  2Z99 A;  2HTJ A;  5E20 A;  3BJO A;  1SVL A;  5GAD J;  1QHG A;  1DU0 A;  2EFP A;  2O9L A;  4CGZ A;  1D3Y A;  1YG2 A;  5FO5 A;  3GLX A;  3CF5 F;  1VQO I;  4IOA F;  3JAM K;  3OOP A;  1XMK A;  1UHM A;  2CFX A;  3PSI A;  3IRR A;  3G6E I;  3OYA A;  3IH3 A;  1KQ0 A;  3M8F A;  3PUF A;  3GF2 A;  2A6H F;  2VBY A;  2ZB9 A;  2V4J C;  1S7O A;  3ZMT A;  4MTD A;  1JE8 A;  2L54 A;  4BDY A;  2NS0 A;  4MO7 A;  1DP3 A;  2VXZ A;  2CW8 A;  1T98 A;  5AIP A;  2HDC A;  1ZQ3 P;  4UNO A;  1F43 A;  3CCJ I;  3HOT A;  1FEX A;  3OV8 A;  5IP7 J;  4IKF A;  1NK3 P;  1RIO H;  4BHP A;  3KP7 A;  3JTH A;  3OYJ A;  3GYH X;  2DOF A;  3RSN A;  1MDM A;  3KZZ A;  4B47 A;  1YI2 I;  1AKH A;  2Y75 A;  3BR3 A;  3E3V A;  1YRN A;  2Y69 H;  2BY2 A;  2FOW A;  2MD5 A;  2AQF A;  3OYN A;  2FF4 A;  1DQU A;  2EV6 A;  2HVQ A;  1P6R A;  1XGS A;  3AL0 C;  4ZYA A;  3CQZ J;  1LKX A;  4RAF A;  3HSR A;  1W36 C;  1VQ6 I;  4Y33 A;  2KDO A;  3BPX A;  4EM1 A;  3S3N A;  3CCU I;  1F5T A;  3PQK A;  1W0U A;  3F8C A;  2XPV A;  1MH3 A;  3NQO A;  3VSK A;  2EPF A;  2VKH A;  3FXR A;  2A05 A;  1BW5 A;  5FB2 A;  2FE3 A;  4LIT A;  3DF8 A;  3H3V K;  3H5N A;  3X2Q H;  4HX7 A;  4DYQ A;  3HOZ J;  1U5T A;  3SZP A;  1BI3 A;  1RR7 A;  1RNL A;  1WZ2 A;  2ZNZ A;  3P9C A;  5EEA A;  3OYL A;  2EFW A;  3HEF A;  4I76 A;  1BR1 A;  2RAE A;  1AWC A;  1T95 A;  2BEO A;  4IVN A;  2W24 A;  4IJA A;  2LY9 A;  1IW7 F;  2DT5 A;  1LB2 A;  1FYL A;  2GXB A;  4AD9 A;  2DO7 A;  3WTS C;  4B43 A;  1J2X A;  1A31 A;  4IQ4 A;  3HOW J;  2CG4 A;  4ZTJ A;  1C0W A;  1XG1 A;  2FJ1 A;  2MGQ A;  1FMV A;  3MCZ A;  4OIN F;  4XRS G;  3I3L A;  3QYE A;  2OZU A;  2GXG A;  2V6C A;  1OCR H;  2X4H A;  2UV1 A;  3RQ4 A;  2L3D A;  4DJA A;  2QEX I;  1NH3 A;  2B0L A;  1JXS A;  1IXC A;  4RM2 A;  3LSG A;  1OLT A;  2XSD C;  5LEJ A;  9ANT A;  2KJB A;  5GP9 A;  2WV1 A;  2HQ5 A;  2WAD A;  4ENK A;  5M5X J;  1G4D A;  4I99 C;  5LEK A;  4C9Y A;  2O3F A;  4PCQ A;  2L7M P;  3HKZ N;  3U9G A;  5IYD J;  3UR3 C;  2K7L A;  2AS5 F;  3LST A;  2HZT A;  4R1H A;  2J5O A;  5EGO A;  2JSP A;  2QSF X;  2Y0S A;  3GTO J;  3F8F A;  3G3Z A;  3M7G A;  2PQ8 A;  2RN7 A;  2H6C A;  4GFB A;  2JJ7 A;  3IC7 A;  3L09 A;  2ACJ A;  3CJQ B;  3K2Z A;  4BEH A;  1SAU A;  4CYC B;  5EZH A;  2XUB A;  5KCM A;  2E1M C;  3KEO A;  4EJV A;  3HTS B;  3BCB A;  3M8J A;  4CCJ A;  3R0A A;  4HQE A;  1R58 A;  1V55 H;  5DUI A;  3HGG A;  1NTC A;  5GPC A;  3QU6 A;  1O7L A;  2DA3 A;  4CCN A;  1MBJ A;  3D0S A;  4B8X A;  4U87 A;  3EPZ A;  3VYR B;  3J7A Y;  3V8J A;  3U21 A;  1ODD A;  3O8G A;  1H0M A;  2KIM A;  1WCM J;  2HU9 A;  1XB4 A;  2MA3 A;  5K7F A;  4WCG A;  1JKQ C;  4YFN F;  1XMA A;  1W4M A;  2IA2 A;  4BBS J;  4V2F A;  3J80 K;  5EZG A;  2NNN A;  1R7J A;  2JA2 A;  4ZDP A;  3E7L A;  1E3H A;  5HLG A;  4F92 B;  2DMT A;  1S8N A;  2EA2 A;  2M7A A;  2V26 A;  4DOZ A;  3FX3 A;  4MFD A;  4OAY A;  2XAJ A;  1ORK A;  4HLY A;  4U88 A;  2JUG A;  2VE8 A;  3I0T A;  3N97 A;  3DKW A;  1TWH J;  2XF6 A;  1SFE A;  3KLN A;  3AG4 H;  2IGO A;  1TWA J;  2JT1 A;  2NS8 A;  3CES A;  4DYC A;  3A1Y A; 
#chains in the Genus database with same CATH homology
 1UG2 A;  4UUT A;  3W6V A;  3FKI J;  4I6Z A;  3S17 J;  1MBF A;  4QTR A;  2XB0 X;  1DU6 A;  3GTP J;  4DZP A;  4FE4 A;  3WHC A;  1K83 J;  2DA7 A;  2I10 A;  4DW6 A;  2DMN A;  3OSG A;  2OF7 A;  2E2H J;  3HBL A;  1D5Y A;  1Q1V A;  1B72 A;  5EGO B;  4IHY A;  5BNG A;  4AYB N;  3S2D J;  3NAR A;  3BR2 A;  1JGG A;  4MFE A;  2ELK A;  1G2H A;  1GV5 A;  4A3B J;  3VPR A;  3MKL A;  1PUF A;  4JX6 A;  5J3L A;  4X1E A;  1JJ8 C;  1Z77 A;  2VPR A;  5EG0 B;  3D1N I;  2Y0S N;  3FK6 A;  5IPA A;  3G1M A;  2OPT A;  2M9H A;  4LOC A;  2NVT J;  5C4X J;  4RBO A;  4C3J J;  5IP9 J;  2E2I J;  3JRH A;  4D5C A;  4M3D A;  1IDY A;  4BKX A;  3JRI A;  1IGN A;  4JYK A;  2DA6 A;  2ME0 A;  2P81 A;  3JRD A;  2E1O A;  3TP3 A;  3S1N J;  2R93 J;  2R5Y B;  4A3M J;  3BT9 A;  2WB1 N;  3HOY J;  1BW6 A;  4NDL A;  5EDN A;  1JUM A;  2CQX A;  2HI3 A;  3F0C A;  3C2B A;  5F0F A;  2R5Y A;  3A03 A;  4MLO A;  1SFO J;  2DN0 A;  5F0C A;  1GDT A;  2D5V A;  2HXO A;  2LK2 A;  3LNQ A;  3K7A J;  3S14 J;  2X6O A;  1B8I A;  3HDD A;  1HF0 A;  2VUM J;  2GLO A;  2K9S A;  3GTJ J;  4UUS A;  2AHQ A;  4M3G A;  2GM4 A;  1ITY A;  1QVU A;  2CUF A;  2VI6 A;  2M8G X;  3S1Q J;  2MW8 A;  2L9R A;  3OOU A;  3QQA A;  1R9T J;  2NVQ J;  1LFU P;  2EZI A;  1ETV A;  1GUU A;  2TCT A;  5J1Y A;  1FIA A;  4EEF G;  3IV5 A;  3JRA A;  1JTY A;  1ETK A;  2K9N A;  4FIS A;  3OSF A;  3K2A A;  4B1R A;  3TP0 A;  1Y1W J;  2QCO A;  5M3M J;  3IH2 A;  1RET A;  1JT6 A;  1FTZ A;  2O7O A;  3TW7 A;  2DMQ A;  2Y31 A;  4BXX J;  2XGC A;  1HDD C;  1P7J A;  3BR0 A;  2Y9Y A;  4HNV A;  1JKO C;  3JRE A;  2PMZ N;  3TED A;  5M3F J;  2QF7 A;  3ZQG A;  2Y30 A;  3O8H A;  4AC0 A;  1QRY A;  3BQY A;  4CYC A;  2JA6 J;  2TRT A;  1ZTR A;  3WHB A;  3BR5 A;  4J19 A;  1AHD P;  1T56 A;  1I50 J;  1Z0X A;  1POG A;  1JJ6 C;  3NAU A;  4C2M J;  2EBI A;  1BL0 A;  5FKL A;  3B6A A;  4M3F A;  1H89 C;  4FE7 A;  1H8A C;  4BY7 J;  2DA5 A;  1U8B A;  3S15 J;  3FIS A;  1WGX A;  2DMU A;  1X58 A;  2JA8 J;  1JTX A;  4JX5 A;  4A3I J;  3HOU J;  5EF6 A;  1MSE C;  4XK4 A;  3M4O J;  2W48 A;  4Y7N J;  1F36 A;  3BTJ A;  2XRL A;  1TC3 C;  2JA7 J;  1I6H J;  2YU9 J;  1B8I B;  2N8G A;  3B6C A;  2R5Z A;  5DS9 A;  5JLW A;  2ME6 A;  4B4C A;  5IP6 A;  4A3D J;  1OFC X;  2LFB A;  1ZKG A;  2ID6 A;  3DEW A;  1FIP A;  2LP0 A;  4FCY A;  5FLM J;  5FJ8 J;  5GPA A;  2FQ4 A;  2G0E A;  5JLX A;  5E3O A;  3LOC A;  5EG0 A;  2AO9 A;  2Y9Z A;  1QPI A;  2JA5 J;  3ZQI A;  5E3L A;  4S0H B;  1VF9 A;  2M0C A;  1X2M A;  3GBG A;  1O4X A;  2EQR A;  2CQQ A;  4W97 A;  3UKG A;  5C44 J;  1SAN A;  4M3E A;  2HOS A;  3QPL A;  2K40 A;  3L1P A;  1I3Q J;  1U78 A;  1RES A;  2IAI A;  3ZQL A;  2JK3 A;  1W0T A;  1MSF C;  1ETQ A;  5C4J J;  5M5Y J;  5FLV A;  1RPW A;  1JT0 A;  2L0K A;  3Q3S A;  5IYB J;  3LSP A;  3DCF A;  3JR9 A;  3HOV J;  3H0G J;  4JX4 A;  1RKT A;  2M34 A;  1HCR A;  4JP0 A;  2R5Z B;  1LE8 B;  5FKN A;  3Q0V A;  1TWG J;  1JUP A;  1TWC J;  2KT0 A;  2IEK A;  3BTI A;  1IC8 A;  3I4N J;  2X9D A;  5IOZ A;  3M3Y J;  3ZQH A;  4B3A A;  3S1M J;  2VKE A;  4DZJ A;  5F0H A;  2NVY J;  2X48 A;  3PO3 J;  4G12 A;  3S16 J;  3LSJ A;  3JRF A;  1E3O C;  1YRN B;  3OIO A;  1U9O A;  1OCT C;  2LVS A;  1WPK A;  2LD5 A;  3BQZ A;  4QIW N;  1AKH B;  2R7Z J;  5K7H A;  5EYR A;  1IG7 A;  2JN6 A;  1A5J A;  2XPU A;  1S7E A;  1IUF A;  3QPS A;  1OJL A;  1GT0 C;  1IRZ A;  4M6V A;  1LFB A;  4D7M A;  3G1O A;  1U9N A;  1MH4 A;  4A69 C;  4DYR A;  1ZR4 A;  3SDG A;  4Y52 J;  2H1K A;  3A02 A;  1DU0 A;  1ETX A;  1XC5 A;  4XRM A;  2O9L A;  5IOY A;  4A3C J;  2LR8 A;  3G1L A;  2NVX J;  1IJW C;  1IV6 A;  2B63 J;  1OCP A;  5E3M A;  3Q0W A;  2DA4 A;  1Y1V J;  4IEJ A;  5DTD A;  5J1U A;  3IH3 A;  1ETW A;  4FTH A;  1BA5 A;  2JWT A;  1WI3 A;  5FKK A;  4W1U A;  2ZB9 A;  1UMQ A;  1IDZ A;  1PUF B;  1K61 A;  2ECB A;  2XGE A;  4MO7 A;  1GV2 A;  1TWF J;  1ZQ3 P;  1F43 A;  1ETY A;  1FEX A;  2VKV A;  3ZQF A;  3IH4 A;  1T33 A;  2XB5 A;  5IP7 J;  1WH7 A;  2CUE A;  4A3K J;  1NK3 P;  3PO2 J;  2MG4 A;  4BBR J;  3GTG J;  2DA2 A;  1AKH A;  2DMP A;  1EF4 A;  3PM1 A;  2H8R A;  2YS9 A;  3BR3 A;  2FX0 A;  1YRN A;  5E3N A;  3S1R J;  1HDP A;  4RDU A;  1FTT A;  2NOG A;  5K7Z A;  2IBD A;  3S2H J;  3CQZ J;  2LLK A;  1UHS A;  1HLV A;  3CMY A;  1H88 C;  2O8K A;  2M2E A;  2JMW A;  2HOT A;  1W0U A;  1RKW A;  2XPV A;  1MH3 A;  3I4M J;  4QSH A;  1BW5 A;  3RQI A;  2NS7 A;  4ABZ A;  4L5E A;  1APL C;  4MIM A;  2EZK A;  3H3V K;  3Q0U A;  4IHW A;  2LKX A;  2K9Q A;  4DYQ A;  3HOZ J;  1RR7 A;  1ZK8 A;  3CCY A;  2R92 J;  5F04 A;  5J1R A;  5EEA A;  1VND A;  3HEF A;  1ETO A;  4I76 A;  2RAE A;  3MVP A;  2E2J J;  1A6I A;  2E19 A;  2HOA A;  2WAQ N;  2HXI A;  5F27 A;  2MSY A;  2LY9 A;  4IHV A;  3LSR A;  3ZQC A;  1ENH A;  1LE8 A;  3HOW J;  1NK2 P;  1XS9 A;  1BJZ A;  2ID3 A;  3BR6 A;  1MBK A;  1XG1 A;  3HGY A;  4UUS B;  4IHX A;  2FJ1 A;  2MGQ A;  3RZO J;  3GTM J;  1AU7 A;  4A3F J;  4XRS G;  4BY1 J;  2XGD A;  1ZR2 A;  5F1J A;  1CQT A;  2DA1 A;  2CJJ A;  4X6A J;  3JRG A;  4A3E J;  5C3E J;  3HOX J;  1MBE A;  2CRG A;  3LSG A;  3MN2 A;  4C3H J;  3RZD J;  1MNM C;  2XSD C;  1MBH A;  3HB9 A;  4M3B A;  9ANT A;  5FKO A;  2CU7 A;  5M5W J;  5GP9 A;  1JKP C;  2WV1 A;  1MBG A;  2HQ5 A;  3A01 B;  5M5X J;  3BG5 A;  2EZH A;  3ZOB A;  4XIC A;  2L7F P;  2L7M P;  3HKZ N;  3TW6 A;  3BTL A;  5IYD J;  5EGO A;  4A3J J;  3GTO J;  3BR1 A;  3JRB A;  1X2N A;  2DJN A;  3SJM A;  4GFB A;  2JJ7 A;  3SFI A;  4D5F A;  4XRS A;  4CYC B;  5EZH A;  5IYC J;  1GVD A;  1VFC A;  4A3G J;  3GTL J;  3JRC A;  4AUX A;  2KDZ A;  1ZGW A;  2LTP A;  5FKM A;  1QVT A;  2FD5 A;  3HGG A;  1NTC A;  5GPC A;  3RKQ A;  2DA3 A;  4V2G A;  3BG9 A;  1MBJ A;  3BG3 A;  1FJL A;  3BTC A;  3GTK J;  1B72 B;  4C3I J;  3O8G A;  5HOD A;  1WH5 A;  1WCM J;  1VI0 A;  5K7F A;  1JKQ C;  4BBS J;  2GBY A;  4V2F A;  1JUS A;  5EZG A;  3E7L A;  3FIW A;  2XPW A;  1P7I A;  2DMT A;  1JKR C;  2YUS A;  4XID A;  2R0Q C;  4A93 J;  2L7Z A;  2HYJ A;  4MFD A;  3A01 A;  3HM5 A;  2HDD A;  3CDL A;  3GTQ J;  1ORK A;  2ECC A;  2COB A;  2DTZ A;  4D7N A;  4A3L J;  2EH3 A;  1TWH J;  2Y2Z A;  1HOM A;  2EZL A;  1TWA J;  2NS8 A;  4DYC A;  3FK7 A;  5F08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...