1FIGH

Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
216
structure length
216
Chain Sequence
DVQLQQSGPELEKPGASVKISCKASGFSLPGHNINWIVQRNGKSLEWIGNIDPYYGGTNFNPKFKGKATLTVDKSSSTLYMHLTSLQSEDSAVYYCARRRDGNYGFTYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA 1F7 FAB (LIGHT CHAIN)
publication title Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 27
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figH02
1RUAL 5LGJB 1J8HE 1FH5L 5ESAB 3UPCA 3ARVA 5CEXB 3RY6C 5E08H 2VQ1A 5ESQA 4QEGA 3FO0H 4DGYH 2CD0A 3E6FB 1R3IL 1D9KA 2F54E 5EWIL 3CCHA 1G6RB 1JNHA 2VAAA 3RX5A 3EDEA 4G6KL 3MGTA 1U3HB 4FXGB 2QADC 3OXSA 3RVXC 3S8WA 4X5LA 5AUMB 3PHSA 4YIQA 4LGSB 5D70L 4X6FB 4QYOA 4AM0A 3LB6D 1QR1A 1OW0C 3LSOA 4K3EL 1XGRB 2ATKB 2I5YH 2IEPA 3T09A 3VGAB 3ZSTA 4KVNH 3BPNB 4OLVH 3ULVD 1I9JH 2KBGA 2V2XB 4P23B 3QQ4A 1LMKA 4PRIB 2Q6WA 32C2B 5E00A 3MLWH 4HKJB 2JE8A 4GW4B 2FL5A 5FOJA 5D2NA 2E7CA 4OZFA 2YA0A 3T4AA 1MWAH 5IG7A 5I1DB 1B3JA 4FTVA 2BVOA 2ADIA 4QOKA 4Z7OF 4KKBC 4N1EA 4JKMA 4XCNA 4XPHH 1QBML 1KLGB 5GRWA 3CX5K 3HR6A 1CFTA 3CFDA 2VXQL 3VFTB 1MLCA 1RZFL 1H5BC 1NKRA 2P8PB 1B0GB 2VITB 1P1ZA 2XQYG 5DS8A 3KYAA 4GS7B 4KC3B 5KVEH 2YMXL 4KPHL 2YN3A 4PJGB 5B3JE 1IAOB 1JWUB 5C86A 5GS3A 1CT8B 1TTGA 1H15B 1W8NA 5FM8A 4NWTL 4JB9L 5D96B 5T1MB 4OIIH 2AV1B 4HGWB 1EUUA 4JM2F 4M9OA 2DQGL 3VXOA 1QLEL 1TVHA 1MFBL 1G7IB 4ZXBD 4P5MB 5IKCB 1RURL 3SQBA 3MRQA 4K3HA 4RFNB 4LPXA 1UCTA 3KPQA 5A2FA 4X7CC 1KEML 2NY0B 1HHGA 4POZC 1U8MA 3QDJB 5E7BA 3HE7C 3PWPE 3BJ91 4XCCH 3RWHA 4PY8I 1N6VA 4NPYB 3MRJA 1DUYB 3IFLL 5JXAH 5IB3B 4JFHE 3BE1L 1CR9H 1WITA 5GISH 2I27N 5I66A 1PZ5B 1G6RL 3L6FB 3MUGB 3RVTC 3I6KA 4OGAD 4PP1D 5GS2D 5B39A 1I1FB 2G5RA 2D0FA 2VXSL 5L8LB 5JHDA 2Q8AH 4XRCB 3V5HB 3DHMA 4WFFD 2CIKA 3G5VB 5H94B 4ZO7A 5HVGB 2NW2B 2AXFB 1MJJA 1OT1A 2D31B 3FT4A 2FHBA 3QFDA 4PJHE 2BVEA 2YUZA 4N5ED 1YC8A 2X4TA 4P4RA 2FH8A 4Z7VA 2PYFA 4LEOA 4XWGL 3OAYH 3ARQA 4MNQA 4WWKA 4ESKA 4UU9B 4WHTA 4E0RA 1U8QA 1RJCA 4MS8D 3TIDB 5T3ZH 2OXGA 1FNGB 5TGBA 1KB9J 2DQJH 5IQ9B 4KRPC 2HH0L 1RMFH 4PRBA 1M71A 3KPRE 1VGEH 5CHNA 5L2KE 2EDFA 2FJFB 4RGMB 1L7TL 2HVJB 2RB8A 3O3EB 2AJ3B 4LSRL 3U7WL 4DOHB 1FVEB 1FYTD 3MOAL 3RKDC 1CFNA 4NRZA 4QRUB 4F37F 2DWDA 4HIXL 5EOCL 5JZ7C 3MO1A 3QI9D 2DL9A 4C56D 3RVVC 4JQIL 3UTZA 3ZT6A 5LAXA 4KI5D 5IT2L 4FZ8H 5F88A 3J8F7 2J4WH 4BK5A 1SEQH 2PR4H 3ZE0E 3JVGA 4ZS7L 1YMMA 2XQBL 2ZPKL 1A64A 4P0DA 1I3RA 3P0YH 3QO0B 4FNLH 2VDNL 4L1DA 2OI9C 2ZJSH 5F9WB 1OF2A 1A0QH 1QSEE 3HRZA 3KXFD 3O45B 1A1NA 3QWRA 3VXRB 3E3QC 1NCAH 1S9VA 3UTSA 1RU9L 3TCXA 4NN7C 2CUIA 1VFAA 1VACA 3G5YB 2GITA 5F7YC 4P3DA 4GRLA 4M1GL 1QRNE 2DL2A 3EDDA 1A7PH 4P9HC 5C1MB 5AD0B 1J05B 1S7TA 4HIEA 4P5TC 4R6UA 3RWDA 15C8H 4PRHB 2VUYA 4TULL 2X44D 2PYEE 1OP3K 2AJZA 3D87B 5EZJA 1I7UB 5DQ9A 3HPJB 1MCBA 1I8LC 5CD5D 2LABA 4KK9C 4RFEB 2F8VA 3KPSB 5CEZH 1CE6B 3M8OH 4PFEA 2ADJA 1QO3B 1G9NL 4HIHA 1HKLH 5E9DB 4MA3B 1JRHL 3JTSA 3SDCA 25C8L 5DHXB 1PG7X 4H8WL 1ZHLB 4L9LB 3RAJL 4U6TA 4NBXB 4JJ5B 2GJJA 5JPMA 4IJ3B 3OGCB 1BQHA 4JFYA 3MLZL 1UVQA 4S1SH 2KZWA 1ZLUK 1UACL 3ARGA 3FQXB 3U0WL 4Q2ZB 2QR0B 2L7JA 2Q3AA 1R0AH 4X6BA 4PJAF 2V5RA 5C08A 3EYUL 5JMRA 3STZA 1YJDH 1JPGB 5GRXG 1L9MA 1RK1B 3QO1A 1XR9B 3QUXA 5D1XC 2DLFL 4KH2A 4L4TA 4W4OC 5GRJL 1FDLH 4XP9L 3EIFA 4P9MH 1SMOA 1S7VB 4JHAL 3NGBB 1VFMA 4KU1A 5JIHA 4OLZH 2VQ1B 5FGCB 3S4SA 4HGMA 4UNVA 1MI5B 1HNGA 3ZYJA 4WW2F 1KYOK 1CXIA 1CGTA 1WVZA 2FX9H 1XGTA 4IM8A 2VAAB 5AEAA 3MA7B 4ZFOA 3MRBB 1MELA 1IMHC 3DVNA 3MGTB 5C0RH 4WUKH 3OXSB 4YXKH 3V0VA 3RU8H 2GCYA 4M03A 2H32H 1QKZL 2DLEA 3HRPA 3IDMA 4RWYH 2CRIA 5E6IB 5JQ6L 4NQDB 1JV5A 2RHEA 5LKNA 4XWOD 3F7YA 1R3LA 3F58L 3QQ4B 1CDIA 1UB6A 4PGBA 3HE6C 5E00B 2B4CL 2KPNA 4NFDA 4PRAB 5C0BD 2XTJE 5C0EA 2ERJC 4U6VH 3TNNB 1H3WM 5MP6H 4OZFB 3IDYB 5E56A 4LSDA 4U1JA 1XGQA 3ZDXF 1BIHA 4FTVB 4X7EC 5KOMC 2ADIB 4PJEF 1CFVL 1DBKL 3NIDF 1Z9MA 1BOYA 4XCNB 1YN7A 4J1UB 4DUXA 1M05A 1MWAA 4AIOA 4DKFL 1UJ3C 2J88H 2Z93A 4MNGB 1MLCB 1CDHA 1KTDB 2EO9A 1P1ZB 4HUKB 2CDEA 3QB7C 4Q6YA 4LVOB 3F6LA 4QRTB 4UV4L 3NABL 3ZKXB 3Q5YA 1FH5H 5J1TC 1FFNA 1T2QL 3MV8E 2P7TA 3QDMA 4GKSA 3GBMH 4YUEL 1YQ2A 4XGZB 5L88H 4ODBD 3VFVB 2UY6A 4Y5VC 4F7MA 1TVHB 2IPTL 1J8HA 1IGIL 4KGLA 4DN4L 3GSRA 3BN3B 4LSUH 5JXEC 5D5MF 3U4BH 3LQZA 3ELAT 5B38A 3CXDL 4WUUA 4URTB 3KAAA 5HGGS 3RWHB 1UYWL 1A5FL 5FKAA 1U93B 4FQJH 3MRJB 1J0IA 2FX8L 1WC7B 3QYCA 5I66B 4RMVA 2AGJL 1A7OL 1G0DA 3DX7A 4E42B 5B39B 1QA9B 5I30H 4HULB 4JFFA 3JTTB 1B90A 2UVEA 2NY2C 3IF1A 5JHDB 2IAND 5F72S 4PJXF 2EIDA 3I6LD 4QGYA 3MR9A 3P2TA 1D5BA 4NKQB 4ZNCD 3VWJC 4MJ4A 2VXQH 3JV6B 1RZFH 4OCXH 3FT4B 1WIOA 3FRPG 3FQRA 3UTPD 2X4TB 2MQ0A 3CH8A 3V2AR 2AQ1A 2PYFB 1ZTXL 4LEOB 4JPVL 4EIZC 2YMXH 4KPHH 5BVPL 4JY5L 4OD1H 2ITCB 4WWKB 1WAAE 4H5SA 1IZJA 2QEJA 1U8QB 3RUGF 4GAGL 4JB9H 1UQSB 2DMKA 4WVRA 1J0HA 5HDBE 2X5PA 2WV3A 3NIGF 5DJ2A 4KROB 1MRFH 2DI9A 4A6YB 3MBXL 1NGYA 4ZOAA 1OGAB 1RURH 4XC1H 4XB7A 4EI5A 5E8EA 1CFNB 4NRZB 4ZUVB 1EFQA 2DDQL 1ODAA 1ZKAA 2DWDB 2JJVA 3E2HB 3MO1B 2OK0L 4GKZA 4U1HA 4NKIH 3BT2L 1MY7A 3F12A 3MLRH 4Y2DC 4PJ5E 3JBG7 5JW5A 5LAXB 2H41A 1I9EA 1IM3A 4OI8A 2R23B 4RGOL 4JLRA 4HPOL 3BE1H 3DV6B 3T0EB 1AP2A 3QEHB 2XXMB 3EYVB 3D0LB 2XWTA 3DARA 1PZUB 5F71A 4MA7L 3WS6C 3B43A 2VXSH 1OF2B 1IAIH 3HRZB 3K8LA 1A1NB 3QDJE 1ZT1A 5ID0A 4WCYL 1PYWA 3RTQA 1VACB 2PO6D 3ARDA 1MIEL 3SDXE 4P3DB 1S7XA 5HYSA 5EIIA 4CL7A 3EJZD 1NANI 4OB5L 3DURA 2BNUB 2VC2L 2XNAA 1S7TB 3C2AH 4MWFA 4XNYL 5GRVL 4XWGH 4UILL 5HHQA 4WI2A 5A16A 5EUKB 5GS0C 4M43H 4P9HL 3ZMRA 1BJMA 1FL3B 5LGKA 4PTTA 4G7VH 2JJTA 4NQXA 2P8LA 1A14H 3NFNA 5EPMA 2J8UA 2GJZB 2HN7A 3WL9B 5D1ZC 3MJ7A 2ADJB 5EZOH 5F1SA 2DQEL 2P45B 2EE9A 2MQ3A 4TUKH 1GHFH 5J3HD 1S7WA 1I7TB 3EBAA 5HJ3B 3ARXA 5EOCH 4X7SH 5E0QA 3GMQA 2X4SB 4JFYB 4PJ9C 4HIJA 2VR9A 1E4XH 3ARGB 5J6GB 2VLME 5FGBA 1R5WB 5BV7C 1HWGB 4LNVA 5J1AA 3MV9D 3NZHL 2JK5A 2RFXB 3OJDA 3VGGA 2ZG3A 3STZB 1T66C 3QIUD 1MH5A 1AD0A 4A6YL 2OJZL 4XXCA 3U2SA 2VDNH 3QUXB 4NCC1 4L4TB 1NGZA 3X11B 1CGVA 5DEFB 4WW1B 1UWGH 4RGNC 5IB4A 2I07A 4JDZB 5D7LA 5E8DL 2BNQE 1YEJL 2R39A 5C09D 3ZHDA 1IGJB 1CDBA 3FKUS 3W9DA 1JF1A 4FQXC 4WU7A 1NAMH 2AP2A 3S4SB 4BUHA 5MEOA 1OWRM 3IRPX 3GNML 4NN5B 1QSEA 3ARPA 2X09A 5GRZA 1N3NA 1XGTB 4U0RC 5D7IF 3VMPA 1AXSA 4NP4L 3DVNB 3QNYA 3OV6A 5D2LF 1OOAA 5GGVY 3BVNB 3HCVA 3VXRE 4PTUA 3TH2T 3HI1A 4Z0BH 1FNEB 3BRFA 2F54D 3F7YB 3KYKL 5C0CD 5C8JA 4CN4A 2N56A 4HPYL 1CDUA 3MRFA 1UB6B 4PGBB 4Y4KB 5I1JH 1M4KA 3QCTL 4KY1L 3CUPA 4HZLA 4Q6IC 1MRCH 1CL7L 1UA6H 1WWBX 3MROA 3HG1E 4I9WE 3ZE1F 1UM5H 4H8WH 4U1JB 2R29L 2G75A 2F74A 4M6ML 4PRHE 4FN0A 3MV7B 5GZOC 1T1XA 2OBGA 2B0SL 4YHML 4FZEL 2GK0B 4HSQA 1YN7B 2CUMA 1M05B 3WO4C 1F8TL 2Q7YA 2P5EA 3C60D 1I9IL 1T1YB 3GSVB 2XWBA 3FZUD 4DKDC 2ZUSA 4LSPL 4OCWL 1MSPA 4JFED 5IB2B 2D7QA 5GRJH 2X41A 4OFYD 5ECJE 4NZUL 3L7FB 4JHAH 4AK1A 5HBBA 3GKWL 3OXRA 4R7DB 2P7TB 3QDMB 5FYLH 4PUBH 3X3FL 4L4VA 4F7MB 5I1KL 2OYPA 2UWEE 4JHWH 2CSPA 4NJAL 3GSRB 4OCLC 3GSUA 3PL6A 2QQLH 3U83A 3W11D 3LQZB 4B7LA 1SY6H 5F7UA 3UTTB 3C9NB 1GC1C 3KLHD 5B38B 2UZXB 1KJVB 3DUSA 2A74A 3FFCA 3F58H 4V2CB 4Y5YA 1EV2E 1MI5E 4KHXL 2DM2A 5IBTL 1JGDA 2JCCF 2C3GA 3MRCA 1OL0A 4S1DC 1TJIL 4C57C 2HT4C 4QF1B 2HLFC 4B7IA 1CD9B 4FOMA 3DOSA 3PWPD 1PGRB 4QWWD 4CADA 4OLUL 4P2OA 3H0TB 4X80H 1JNNL 2NX5B 3BO8A 5FHBH 4F15C 1DBKH 1Q72L 2GK2A 4M1DH 4NWUH 5F6HI 4GLRH 5D4QA 5I73B 4LSTL 3WV0A 1C5BH 4XMKH 3MR9B 4DKFH 4C83A 3K2UL 1EXUB 3FOMB 3PP4H 1OTTC 3VG9B 1P2CA 1XIWB 4HT1L 4PB9H 3PHQA 4PJAB 5CINL 3R8QA 1IM9A 3Q1SH 2WIMA 1TZGL 1FIGL 2YZ1A 4JFXA 4UV4H 1LP9A 3NABH 2FO1A 3H3BC 2OTUA 4I3SH 5D1QD 3VFPA 2E6QA 2IADB 4JN2A 2AQ2A 4YUEH 4XVUD 4S0SD 3G04B 1PSKL 1T6WA 4MNGE 3F7PC 5FOBA 1MFDH 1CXEA 4WTZG 2IG2H 3EFDH 4MNHA 5DZLA 4L8DB 4WW2B 1A6VL 3ISWA 3WFBH 1IGIH 5F1IA 1Q1JL 1CLYL 4HQQL 4YQXL 2BVUA 4RCAA 5DURB 2YD8A 1BJ1H 1A3RL 1OLZA 4I18C 5HGBA 4MA1B 4KGJA 2BMKB 3CXDH 4U1HB 3F12B 5B22A 5L2KD 4PG2A 3MZGB 1FO0L 4W6XB 4U6YA 4ONGL 1IM3B 1IGCL 2D7MA 4Z18A 4JKPH 1AP2B 2VKXA 4R8WL 3O8XD 5IVXE 1EEQA 1S7RA 5AG8A 3RP1A 4EDWL 1R3JB 5FO9A 5JOPD 1MJ8H 3SDDD 1RSFA 5CJBA 1LEKB 1OP3H 3DJ9A 4PJEB 1UCBL 1ZT1B 2CO7B 2MCPH 1NFIA 2PW2A 2MHAA 3SCMC 3SGEI 4PGCA 1FC2D 3GSOB 3T65B 3I75A 3SE4A 1Q9KA 3WXWH 4EEEA 1PFCA 4DUVA 3VXNA 1S7XB 2FEEI 2WBJC 3WLWD 5TF1L 3QIBD 3HI6L 4R4BB 3DO3A 3CK0L 4I8DA 2EEAA 5C0JA 4JY5H 3BN9C 3Q6GH 4ZO6A 4IOIA 3ZHKA 4D8PB 2J12B 3N50A 4IRSD 3VA6A 1RQ5A 4GAGH 4KK8C 3B4NA 2ATPB 2Y5TB 3EZJB 4NQXB 1F3JA 3NFNB 5EPMB 1ZLUH 2J8UB 1ZLVH 2DLTA 4MMZC 2HN7B 3MJ7B 1FHGA 2F8XC 5E4EC 1P53A 1WAAA 3LHPH 5LXGL 2PYED 4L5FL 1S5IL 1QSFE 1V7NL 4XPAH 5D5MB 4PJ8D 4ZUWB 1GAFH 2AJXL 3ARED 4XC3H 2OK0H 4E41B 5I1IH 3FT3A 4BZYA 2PTTA 3GMQB 4PJCA 5INCA 2NLJB 3ZT5A 5TJWK 1ND0A 4IMLA 1JHTB 3NCBB 3Q5OA 5J1AB 5TDNA 2GUOA 5D72L 5AWNL 1FAKT 2JK5B 3PF2A 4X4ZA 3BD5A 1MOEA 3NIFF 5L6YL 4KKCD 1OGAE 2HFFB 1AD0B 2M2DA 2D3VA 4MA7H 4WFGE 5T5FH 3DSNA 1KIPA 3HR5A 4R7NA 1NGZB 2ED8A 1NMBH 1ZT4B 5SWSA 4PJXB 5DF0A 4WCYH 4KAQL 1KFAH 2Q86B 1IEBB 4O02L 4X99A 1ED3A 4GRWE 3T0EE 3WUWA 5IR1A 1FGNH 4YXHH 2QQNH 5ILTH 1N3NB 1AXSB 4OB5H 3MJ8B 3QNYB 1I3VA 1MAML 1NAMA 4RSVA 3HCVB 5JUEH 4Z6AT 4P9HH 3K8KA 3H9HA 5C3TA 3T3PF 2AXGB 3VXUB 3ECBA 1T03H 4Y1AB 3RUGB 5C8JB 2COQA 2IPKB 2C4FT 3G5XA 2OXHA 3MRFB 2EECA 3CFJA 4WI8A 4OZHF 4B0MM 1Q9LA 2F53B 1AE6L 1SJVA 5IVZA 3CUPB 2DQEH 4LRNL 1DQJB 2LU7A 2QBWA 3T04D 1NCDL 5IROA 2G75B 5C0AA 2F74B 5IK3B 2NXZD 2P5WE 4E9LA 3C08H 3DV4A 4YBQC 1RZJL 4JO3H 2XTJD 1AKJB 1DE4A 4ZOCA 2XXCB 4G8FB 4WO4B 3IKCA 5FIEA 1B4RA 3W82A 2P5EB 3O2VL 3OX8B 4JEGB 4YC2B 2JELH 5ISZE 2R9HD 3O6FC 3VRJA 3BZDA 3WD5L 2VDML 3QUYB 4X6EA 1XF1A 2MTPA 4QRPA 2OJZH 4FQ1L 2HKFH 5HHOE 4LHUG 4NO0D 5GGQL 4D3CH 1F2XK 4TUJA 3K1KC 4YHIA 3SKUD 4ORGB 5ALCL 1CVRA 4ZFZA 1NCCH 1TETH 3DGCR 3NA9L 4LMQE 5TQ2L 1G7QA 4GRWH 1QHOA 1GGCH 3VA2C 3REVB 3EZ8A 1ZA6A 1BBDL 2D7NA 3OB8A 3THML 3U1SL 5BW7A 3S9DB 5F6IC 3MV8D 1SBBA 4UOW1 3BGFB 4K8RC 4UTAH 3GSXA 1EERB 3BQUD 4K7PX 5F7KC 3RY6A 2NY4C 5LVEA 1A22B 3SJVB 3UTOA 3KYKH 4Y5YB 2RCSH 4J7RA 5AYUL 1DLHB 3O3AB 4H1LG 3FCTB 4GAFB 1RHHA 1SY6A 4EQ2A 3T3MF 3MRCB 2OZ4L 4KY1H 2W60B 4KMTH 1OW0A 1RY7B 3KHOA 4CADB 3GMPA 3SO5A 5JORA 4P2OB 2HRLA 5IV2A 1A7QH 1YUHA 4I0PD 1W2KT 4YHMH 1CDGA 5F7WC 3D85B 4YDJA 1U3HD 3QZWB 3PWNB 4QRSA 1F8TH 3NPSC 2CKBH 4M62H 4GG8B 2F8OA 3NFSH 3IFPB 4X5XA 2YC1B 3RX7A 1P2CB 4NIKB 2DMCA 4OCWH 3DMMC 4A2LA 4P23D 2H1PL 1MFNA 2AEPH 4PRID 1LP9B 5FK9A 1GGUA 4DKEL 1UH4A 2W07A 3OR6A 3VFPB 3RL2A 3GKWH 3OWEA 1EMTL 1FAIL 2EKJA 4JPWH 4MQXD 2R1XA 4HS6A 4R4FL 1H5BA 1A7BA 4FMKA 5DI8A 2A1WL 5J9PB 1MJUL 2HFEA 1DL7L 4DGIH 4FHBD 5D7IB 2X7LB 5F1IB 2ZUUA 1VSCA 4LCWE 1IEHA 1IC5L 4LVHB 1TFHA 4IHOB 4FRWA 1MFAH 3GMOB 3O2DL 3QH3A 4LLVA 4U6YB 1UT9A 4OLEA 4HHAB 3HI5H 5DRNA 4OZHA 1GVIA 3K4ZA 2Z31C 5MEPA 5C6WH 2GAZB 2BSED 5FO9B 1ZSDB 5CEYA 3RWIA 4PJ5D 4U3XA 4OLUH 1ZHKA 1OY3B 5MEQA 1JNNH 4GBXB 1NGPH 3HE7A 1Q72H 4QRQA 1NFIB 1C08B 3GJEA 4MXVF 5E8PA 2MHAB 4X9IA 5CSZA 1A6TA 3VDCA 1H3GA 5T1KA 4G6AD 3VGFA 2Y36H 3K2UH 3FOLB 4Z7NE 1J1OH 1F42A 1IILE 2NY0D 5A3ID 3EOTH 3OKOA 3PDOB 5CINH 2CIIA 1XF4B 3QDJD 4P3WA 4G80A 1FIGH 5EB9A 2BX5A 1VA9A 2NX5E 5C0JB 2WM0A 4HK3J 4IOIB 1N2RA 3VW3H 2GFBA 4YEEA 5KSVB 3MBEC 3WN5B 3IXAA 1F3JB 4PLJD 5C92A 1PSKH 3QXUA 1NFKA 3INUL 2BJMH 3MJ6A 3SDAB 3ULUC 4EXPX 5AZ2H 4Q7DA 2BVPB 2BHYA 4IOSD 1LO2H 1WCBA 5J12C 1A3RH 3OQ3B 1MCEA 1J18A 1I85C 4O2EA 2D9CA 1L0YA 3FT3B 2CDGA 4KK6D 4PJCB 4Z7WF 1FO0H 4LPYA 1IGCH 4IMLB 1SMAA 4KVCL 5TDNB 2GUOB 2JCCB 4GMSL 4NKMB 4WEUD 1IC4H 3FFDA 5HYJE 3FL7A 4XBPB 3HR5B 1CS6A 4LP5A 4R7NB 3AFLA 5J0BA 2VLMD 1Q38A 3IVKA 5SWSB 3OKLA 2EDEA 5IVXA 5I9QC 4RGNE 5DDHA 5DO2C 3WUWB 4TUOB 1N26A 35C8H 4I4WB 1M6OA 1C16B 4JRWA 3VFWB 2W0FA 2I25N 3CDCA 2EDQA 4BSJA 3NIDE 1QFHA 1I4FA 4JREB 3ECBB 3ZL4L 1J10A 4UQ3A 2CMRL 3F62A 4PP2B 4Q58C 3W0WE 4CVZA 3GSWA 5GS0H 4X6CA 3UCRA 3OG6B 3W2DL 2V17L 3IRZA 1NFDA 2R2EB 4OM0L 5FM5O 3VXRD 5IVZB 1QLRA 3IDUA 4P5TA 4L5FH 2C7UB 5C0AB 3SKOA 4D0DA 3ZYIA 1U95B 2RBLA 1CVSC 3BAEL 3O41B 4JPIA 4LQ1A 4HWZB 1T5WB 1I8LA 1MAKA 4BK4A 2CK2A 4EN3C 3KLDA 3LS4H 3HG1D 4I9WD 1QSFA 4P2YA 3QDGE 3KDMA 3QT2A 3UTQB 4UTBH 4PRHD 3KYOB 3VWKC 5D72H 5AWNH 2R0WL 3TIEA 5TPWL 2DQTH 4UDUA 1J8KA 3TF7C 1KXVC 4MB5A 5F3HB 5DEGA 5K9JL 2DOCA 2GIYA 3I6GB 3O11A 1P4IH 1CYGA 4JR9H 4QRPB 5BV7H 5I1AA 1SEBB 3KPSD 1INEL 3S36L 1AGEA 4OZGA 2LV4A 3PV6A 4OCYH 4E41E 5DQJB 3JWOL 4MD5A 4QY8A 5E9DD 1NL0L 3ARUA 4ZFZB 1D6VH 4G42A 2FATH 4OZIA 4HJJH 1U36A 3P11L 1G7QB 1IZKA 5ITBL 1MHCB 1N8ZA 3BEVA 4QXWA 3QHTC 3WFEL 5D1XA 3IDGB 1ZA6B 5L8KB 3KLAA 4W4OA 4R96A 2GI7A 4W4NA 4NJ9H 5F7DA 4CGTA 4HS8L 3TBTB 1QLFA 2YPKA 1TZIA 4YHPA 5BQ7B 4PJXE 3WNOA 2VDLL 3EYQD 1U8KB 3BKCL 4GMTL 1RHHB 1NCWH 1B6UA 2BFVL 3RGVC 3EYOB 1JJUA 1AE6H 4ODVH 3QG7L 4M00A 4B5EA 1NAKH 3WNLA 2YD7A 4CNIA 3GMPB 2FNBA 5JORB 4LCUB 1A1MB 2X4PA 1MI5D 2QHRH 4YXLL 1D5MB 1JTOA 1S9YA 3U0PB 3VXUE 1CTNA 2FDBP 2KUTA 3ZKQD 3HE6A 1WZ1L 4YDJB 3VRIB 5E6ID 2Y23A 2F53E 3MGAA 4NQDD 4X5XB 5D7JC 1CXFA 4MJIA 2YWZA 2E9IA 3O4LA 5E5RB 1J5OH 1J0ZA 2Z4QB 4KXZI 3QCUH 5FK9B 2CKBA 3ZE2F 5C0FB 1KN4L 2BY0A 2VZOA 1KG0B 2VZ1A 4ZD3L 3LCYA 4EIGB 2X89D 5ISZA 5E5UB 3OR6B 2WBWB 2C1OB 5GSRB 2XWJA 3FQWB 4YE4L 1MIML 3KR3L 3VDAA 2R1XB 4HS6B 5DI8B 4QRRA 3HTLX 4Y16C 3S35L 3WLBA 1DVFB 2HFEB 1RZKC 2V7NA 2VLKE 5C0IA 3QHFL 3CFKA 1XCQA 1CF8H 3U1SH 2R56H 3ZDZF 2VLLB 3TN0A 2YHGA 2NY7L 3C5ZC 4YWGH 3TNMA 3WDIA 3ZO0A 4N0UA 2HTLC 2IMMA 5LBSH 1UKTA 1Q9WA 4WEMB 3ZTJH 4LLVB 4Y5VA 2EEDA 5EIVA 1AO7E 4YBLB 1GC1H 4F3FA 1IFHH 1WIUA 4J3SA 5ACZA 4OZHB 5E2WH 3QAZB 5MEPB 5H8DA 5JXEA 1W8OA 1R3HA 5CEYB 3RWIB 4F9PC 4AEFA 4GG6A 1ZHKB 4ZUUA 5EFIA 4NZJA 5MEQB 3UBXG 4TSBL 4GKNA 4R4NC 5T1LB 3HE7B 3SJVE 3PGCA 3K0WA 3GJEB 4ZDHA 4UBDD 1FSKC 3H3PH 4TPRH 5CSZB 5E8PB 4HKXA 5T1KB 2CK0L 3GB7A 4PRNA 1HHIB 2WMPA 5LWYH 1X5IA 2Z8WC 3EHBD 3NCJL 4BSWB 1DLFH 1YECL 5KVFH 4G80B 3TBWA 5LGHL 2H1PH 3OZ9L 4MYWB 4W81A 4R2GC 3VFOA 1BQUA 4M7ZC 3RWCA 4DKEH 4YX2L 4WRLA 3O0RL 4XB8A 1EEYA 3VWJA 3QIWB 3O6KL 4YBHA 5HGDA 3TGXA 3U4EA 1QZ1A 4YDIH 3AS2A 3BPOB 3T8XB 5JHDD 5C0DA 1MJUH 1A1OA 4LHJB 1YEEL 1IC7L 4KV5E 4OJFL 5IMLB 1FNHA 3QUKA 4J3OC 2Z92B 1MREH 1X9QA 4JFQA 3C6LC 1IC5H 2D4DA 2XN9A 2VLJE 4TOYL 3LV3A 2CDGB 4N1CA 5FYKH 4HWBL 2IPUK 4XH2A 4M9PA 1BFOA 4DW2L 4Q97A 3MLSH 4QHKJ 5SX5K 3REWB 5D7IE 4G6ML 4NC2B 3FB8B 4UAOB 5A43C 1TJHH 3LKPA 3MNWB 2DQHL 1FO0A 4P2QB 2LTQC 3DX8A 5D2LE 1CN4A 2LAAA 1PX4A 3ARFC 4NM4L 3T77A 4G7YL 3MLYH 4LEXL 3HPLB 1OGAD 2P1YA 3RDTB 3VXME 1XGYL 1X5FA 1HH9A 3WS6A 3Q3GB 4LOUC 1M6OB 2OR9L 3ZE1E 2VZUA 4RQQB 3FB7B 5DJ0A 3PQYE 3W39A 3OKEA 3T0ED 4NN7B 4NCC2 1WT5C 1P4LA 1ZT7A 1JNLL 3T0DA 4UQ3B 4LFHD 1WQVT 4CVZB 5JIPA 1FL5A 3GSWB 1U8NB 1A9BB 2YBRA 3TA3C 3CMOL 4J4PC 1IL1A 1NC4A 1QFWH 4XP1L 5KSUA 1EHLL 1QLRB 1A6UH 3X14A 4W6YB 2P47B 4XCEA 5BZWA 3LPWA 3SKOB 4D0DB 1JI2A 4JPIB 4WGVB 3LIZH 4BFIA 2EYSA 2ESVA 3S37X 1OTSD 3B9KB 5D1ZA 3QEQE 4H1LH 5GHWH 4I48B 2Z8RA 4GMSH 5EU6E 4UI2A 5E2UH 5CSBA 3O11B 1YDPB 5J89A 3U30C 5I1AB 4JM2D 5DRZB 2ZNWA 1EFXB 3BZEB 1HZHL 1QBAA 3ZKMC 1QFUL 4PJ9A 4MD5B 4QY8B 4G42B 4OZIB 1CD0A 3WCYA 4ZAKB 5DGQA 4G3YH 4X7TB 4AQ1B 2JCCE 2XICA 3QNXA 4DQOL 2DJSA 1N8ZB 3EW3B 1H9VA 5FYJL 3WIFA 1LDSA 3CD4A 4JAMA 1XAUA 3LB6C 2UYLA 3CSYA 1N64H 1TZIB 4YHPB 4FQ2L 4YHZL 3L9RB 5EUOE 5BVJA 5IBLD 4J2XA 3ULVC 2XA3A 43C9A 5DFTA 2CMRH 1N0XH 3NZ8B 1RZ7L 5C6PB 3DYPA 3QUXD 1FLRL 5FCUH 1JPSL 4PGDA 1W0VA 2GEEA 3P77A 2Q7NA 2V17H 3GI9H 4OM0H 3DROA 1ZVYA 1D5IH 1BVLB 3M07A 5EC1A 2NY6D 2EDHA 5KVDL 4PY8J 2DQIH 4LAJH 2X4PB 4JO4H 2JB6A 2AEWA 5DQDL 1PD6A 1T20B 1MVUB 3BPCB 5MI0C 3O6LH 3V7MA 3VD5A 2PTVA 1G1YA 4NKOA 1W72L 4TRPL 5HTSA 3T1WA 2DLHA 4P46D 1WCQA 4CVXA 2BDNH 2ERJB 3LKRB 4Q6IA 5CSGA 5L9DH 1X5JA 4MJIB 2ADGB 3O4LB 2KQNA 1NGQL 1BFVH 2NW3B 4NQCB 2CKBB 1INEH 3S36H 4Y4KD 3QDGA 2NYYD 2FHCA 2VLRB 3HUJE 3FT2A 1E0OB 1CBVH 4YPGA 4NQEA 5CCKL 3W9EA 5DZOA 4MX7A 3QQNA 4QRRB 5F7MC 4HJGA 4G8GA 3MV7D 3WLBB 1CCZA 5HHXH 4R97B 5ITBH 1IBGL 5C0IB 4ZTOH 4ZXBC 1XCQB 3CDFA 1V8HA 3WFEH 1VDGA 3X13B 2PF6A 4RAVA 1SBSH 4JGUA 3TN0B 1WBYB 2FB4L 3CFEA 4U1GB 3WS3A 2UV3A 3TVMB 4NT6A 1I7RB 4LVNC 4N0UB 1UKQA 1VPOH 4NO2B 3X12A 3SGKA 1Q9WB 2FECI 3NCYS 4K8RH 3TO2A 4GMTH 4JM4L 4U6XA 4LCWD 2NXYB 4HX1A 3SY0A 1KELH 5ACZB 5JTWA 4Y8DC 2DIJA 3G9VA 4GXVH 3ABZA 3QWOA 1R3HB 4OGAC 4FXKA 4FP8L 4LLAA 4PP1C 4WV1B 1RUQH 1GYAA 3HAEG 3BSZL 4HLJA 5IFHL 4GG6B 4PRPE 4ZUUB 4R90H 1DQDH 1EGJL 1FPTH 4GKNB 2AK4B 3PGCB 4PGZA 1KC5H 1F2QA 2FBJH 4G9FA 3BEWA 2EDRA 3OAZK 1GZPA 3FO2A 3SO3C 4PRNB 1S3KH 1Q0XH 5EOTA 2FBOJ 3UTTD 4KTDH 5IHBA 1N59B 3PUCA 5EN2B 1C12A 4N5EC 1T0MA 5DK2A 6CGTA 5JHLL 1K4DB 1KCSH 3VFOB 1LQSR 3RWCB 2VZVA 2W91A 3K8MA 3D9AL 1EEYB 4KRMB 4MS8C 3KR3H 3VWJB 1OM3L 5HGDB 2DWEB 1KULA 3U6RB 3A6BH 4XPFH 4POYA 3S35H 2R4SL 5C0DB 2NX5D 2GKIA 1FV1A 1OAZL 4N9GB 2HJFB 3QUKB 1E4JA 3B6SA 4JFQB 1I1AD 5DC4B 2XN9B 1RV6X 2H2SD 3ET9F 3QI9C 1A4KA 3X3GL 5IFAL 2HP4A 1JBJA 1XIWD 3LV3B 2ITDA 1XEDA 3CFBA 4XH2B 1G7JB 2YRLA 1BFOB 3N1MC 2OL3L 5DYOA 3NAAH 1B2WH 1J86A 3F6IA 4POUB 1A6ZA 2MJWA 4I18A 3IYLW 3QFJB 5ENWA 2GYSA 4NNXA 3DVGA 1AO7A 4AQOA 1JVKA 1LWRA 4HXBH 1U92A 5DURD 2CK0H 3RZWA 3V4VL 2KQMA 1HH9B 4G43B 2R2BB 2A2QT 4PPTA 4YR6A 3B9EA 3RWEA 3VFGH 5EU4B 4M3KB 3P0GB 1U8HA 2DQFB 2VAJA 4QT5A 5DJ0B 5E2JA 3W39B 4JKKA 4BH7B 3OKEB 3SCMA 1BF2A 1OSPH 3GI8H 3L3KA 5JW3H 3EOAA 5CD5C 2IGFL 1S7SA 1QHPA 5TDOA 3PNWA 3WMSA 2YBRB 1T0NA 1UZ8A 4NRYB 4PRDA 1IL1B 1NC4B 12E8L 2B1HL 5KSUB 3WXVL 3P9LA 3RPKA 3P4MA 1T89C 4OLXH 4YDLB 4XCEB 5BZWB 1RIHH 3W0WD 4OIBA 3ULUH 5IHZA 2EIEA 2HFGL 1UEYA 4OF7A 2GTZA 5DD0H 4UDTB 2OMBA 4Y7MA 2EYTA 3B2VL 3NH7H 1WICA 4HWBH 4CRPA 1RUPL 5D1ZB 3H9SE 3QPXL 4NSKB 2IH1A 3GM8A 1P4BH 5I19H 3V6OC 4AT6A 3MRMB 2Y7QB 1URLA 2D0HA 4G6MH 3HNVH 4FMFA 3U0TB 1DANT 3DPBA 1FNAA 1OD7A 4H1LA 2N4IA 2GTWB 4NM4H 1KIQB 5KSAD 1LO0L 3KYNB 3MRNA 4HG4K 4NM8L 4XCYA 4XPGH 3FTGA 5DUMH 1RJYB 1QEWA 1ZVHA 2E8YA 1KPRA 4YFDB 3QNXB 4LCYA 1TENA 4E41D 4CU8A 1LNUA 1OAXH 4P2QE 2OR9H 1PBYA 1UM6H 2PKDA 5FYJE 2R4RL 1EAPB 3WIFB 2J5LC 1HH6A 5ID1B 3CFCH 5IB1A 2VJXA 2UYLB 4MMXC 4XWOC 5BVJB 1JNLH 2ARWA 3E8UH 3JWNC 2P44B 2IJ0C 3BHBA 3RL1A 4U0RB 3GO1L 4UNTA 3CMOH 3ULVL 3DROB 1BQLL 3ARBB 1FZOA 1EHLH 2H8PA 1T7VA 5EC1B 1A3LH 1MCIA 4Y89A 5FKPB 3RWGB 5KAQF 2JB6B 5DJAA 2C1PB 2FLBT 3KS0H 5B8CB 1T22A 1U6AL 4JFDB 3VH8A 3U9PH 1ERNA 3UJTL 3PGFH 1LEIA 5J11C 1KB5H 1E6JH 1JK8A 5FA4A 5BS0E 3OAUL 4ZO8A 3VXUD 5T3XD 1GIGL 4G6JH 4Y1AD 5DVKA 1NBYB 3KG5A 2GSIA 1YY9D 3WIHA 1HZHH 2OR7A 2F53D 1P7QD 1RVFL 1JZ8A 2J1KA 1QFUH 3FT2B 1SM3H 5AZEL 3WO4B 5EU6A 1G7LA 3V6FA 2WWMD 3GMMB 2AKRA 3FAXA 3O6FA 4GAYB 4HJGB 4G8GB 2KL6A 4XP6L 4UNUA 4DQOH 4N0FA 1XH3A 4EI6A 5EOQL 2VDPL 1ZWIB 4RAVB 1RUML 1AKJD 3ZDYF 4JDTL 4WO4D 3CFEB 2P5ED 5EZLA 3SOBH 4FQ2H 5HHNB 4FG6D 3FRUA 3AB0B 3NTCH 2VLKD 3QUYD 3GZKA 1CGXA 4PY7A 1BF8A 1VFBA 1WWAX 5D8JL 4DGVL 1RZ7H 3TO2B 3ULUF 3IDNA 4HX1B 1UXWA 1H8SA 4OTXH 1IAII 1AGDA 3FJTA 5EUOA 3ARTA 3MOBL 1PKQE 5DJ8A 5KVDH 2WP3T 4FXKB 1KNOA 1K3ZA 2NY1B 4UB0H 1NUNB 3DIFA 1NDMA 6FABL 5DQDH 5ANMB 5I1LB 2AJUL 3VFSA 1MQ8A 3KNBB 3BEWB 5JIKA 3FO2B 1N4XH 1DBAH 1YQVH 2CJUH 4ORZC 3SJVD 3D5OF 2B8OT 1C12B 4PJDA 5F7FA 1T0MB 5DK2B 2V5TA 2X4UB 3LKQB 4ODXA 3L3DA 5JQHC 4M6NH 4OCMC 1X6NA 3D3VB 4QHLA 5DMIL 3GSNL 4Z7WE 5I75C 4LHUD 2V6HA 2APWA 5SX5H 3DMMA 1F4XL 2HT3D 4WENB 1CXHA 3HUJA 3BP6B 3G6AA 4X7FC 3P4NA 2R2CA 3MXVL 5ADPL 1U8IA 2DJ4A 3B6SB 5C0GA 4EBQH 1HK6A 4NQCE 3D85D 2YXFA 5D93B 1RZKH 3MXWH 3EYFA 4HBCH 5DWUL 1E4XI 2Q3ZA 4HUVA 3UDWC 4PJFF 3CLFH 4JN1L 5CBAB 3MJ9L 4IS6A 2ITDB 3AMKA 1BOGA 5HY9A 3CFBB 5IW6B 4JM4H 1V3LA 1GGBL 5HPMB 5KSBF 3O4OC 5CAYB 1FE8H 5BZDA 4I2XE 4K7FA 4U7MA 4S1RL 3HNTH 2VLJD 1BFTA 3R0NA 1KCUH 4CMHC 1A6ZB 3ILPA 1FLTX 4I18B 3RVWD 43CAA 5ENWB 2VZ3A 4MHHI 5IFHH 1PW3A 5F9JA 2R0LL 4DZ8B 2AXJA 1S7UA 4K9EL 4AG4L 2G5BA 3ARWA 1U92B 3ZLQC 4NHCH 5MENA 2PO6C 5IMOA 1G6VK 3ZYOA 5JLZA 5GIRA 4JZJC 3ARRA 2D7TL 2ZCHL 1IT9H 2Z31A 1PG7L 2ZSVA 4PJBF 5D6CA 5KN5A 5DLML 2VB5A 1HEZA 1WBZA 4YR6B 4EUPB 3EJZC 3RWEB 1QACA 3I50L 2CO6B 5JPNB 1U8HB 2C3VB 4QT5B 2VERN 1MFEH 2AK4E 2FO4A 4LKCA 3EOBA 3D9AH 2CPCA 5I1EH 4GXUN 4X8JB 2GY5A 4JQXC 3TBSA 1U9KA 2R0KH 3EOAB 3IJHB 1S8DB 5TDOB 3VRLF 1KBGH 4GBXD 1T0NB 3PQYD 1NMCB 3QQ3B 4PRDB 4YGVB 5DD6B 4TVSa 3P9LB 4LHQB 1EEZA 1HYRC 5FUZL 2BC4B 5CMAA 5JW4Q 5J3HC 4HEPG 4BJLA 3PDDA 4UT7H 4M5YL 4KKLD 2YK1L 4U05A 3QJFB 1O5DT 5IHZB 4L8SB 2JB5L 3MBEA 2BOBA 3T0VA 5SV4A 5IFAH 3X3GH 1AXTH 4DVRL 4LDEB 4XNUL 4CVUA 1FCCA 1ZEAH 3WIIH 5IEHA 1QFOA 3C8KA 1KTKE 4LKXA 4LU5H 1MCFA 1QNZL 2EYRA 2YPLA 2OL3H 3CXHK 4JO1L 3PJSA 5HSFA 4RIRA 5LJYH 5K9OA 4HWBA 3DX9B 3HKFA 3RY5A 1I85A 1KCVL 3OR7A 3BWUC 3QEQD 3SDAD 3Q6FA 3MRNB 1X5ZA 1QP1A 4DUWA 3GGWA 3OKMB 1NGXA 4XCYB 3RIFK 2QKIA 3VXSE 2WZPD 3GM0A 4K3JL 1L7IL 3WFZA 3WO3B 5BO1H 5TF0A 2FWOA 1DBMH 1KPRB 3MFFB 1KJMB 3QUZD 5HYFA 1LNUB 1C5CL 2HJLA 3QFJE 2O5XL 2OJEA 4NQSA 1QTYT 1JGLL 1T3FB 2IQAB 5IB1B 4JG1H 4XP4L 4NNPL 2PNDA 5IF0A 1TDQA 4YNYB 2P42B 5HDQH 4ODTH 2IGFH 2DB8A 3EJYD 1RUKL 3ULVE 1ZA3B 4OLYL 4LLQB 4Q0XL 1MQKH 4D9QE 5DMJB 1A7RH 1DZBA 2B1HH 1KXTB 5SWSD 2H8PB 5H35B 3WXVH 5EBLB 2WINA 4HMEA 4KKAD 4MDIA 5DJAB 2A6IA 1T22B 4PJFA 5IWLC 1AD9A 3IKKA 2C3XA 4P2RB 1PLGL 2XY1A 3AXLB 3HZMB 2ZCKL 2NCMA 1TJGL 1IE5A 2JIXA 3C60C 3VH8B 1QPPA 5DSCA 1LEIB 2BOCB 3FZUC 1WISA 5F6HJ 5FA4B 2QQKL 3HLAA 2YZ8A 1N7ML 4H26B 5CIPH 3H9SA 2GSIB 4UUJA 1A21A 2ZUXA 1KB5A 1LO0H 5IJVA 1S9XA 4NM8H 3MREA 3MODH 2E3VA 4IBLT 1KJ2A 1NBQA 2D7PA 3VWKA 2NZ9D 2AKRB 3TV3L 1BEYL 3HS0A 4NZTH 1XH3B 3L7EA 3P9WB 4AMKL 3IU4H 2VNCA 1TVBA 4L8CB 3A67H 1NJ9B 3MOQA 3W11C 5SWZB 3KLHC 3U9UA 5D9SA 2HYMA 4PY7B 1K8IA 1VFBB 1TTUA 3T0AA 4CMMA 3GO1H 4ERSL 3ULVH 4KUCF 1RIVH 2X10A 1T5XA 5DJ8B 1KNOB 1DFBL 4QWWC 3GMNA 3DIFB 1FNSH 5DD5H 5IHUL 2OTWB 3IDIA 2QL1A 1OARL 5HGAA 3UJIH 2BSSA 1B4JL 2WUCH 1M7IB 3VFSB 4OZ4B 4NQVB 3RGVA 3T4YA 4IDJL 1FFOA 1NEZB 4OD2A 3H7BA 3UJTH 4MXWH 4QTHA 1BP3B 3OAUH 4OCRH 4TNVK 4V1DA 4PJDB 1WUNT 2EE6A 3DYMA 4JO2L 3L3DB 4D0CA 5KAQG 1G84A 4JRXA 4OM1L 5D1QC 3TCLA 1TQCB 5E2TL 1C1EL 4XVUC 5JW4N 4JFDE 5C07A 2JF1A 2V2TA 3OKDB 3V6ZA 4M6OL 1WEJL 3IJSB 2X2YA 4J6RH 1V05A 1RJZB 3DMMB 5EOQH 3G6AB 2CLZA 4HWEL 1RUMH 1Z6JT 1ZGLP 1BZ7A 1ONQA 3TWCL 1K8DA 3TYGL 1M7DB 4JE4B 5KS9F 1YPZF 3V8OA 3MQIA 5HGHA 5AG9A 5ELIA 4OKDA 3D39A 5TE4L 4WTWA 5FM4A 4Y16A 5HY9B 5D8JH 4C56E 3AU1A 1J1PH 1ITCA 2M1KA 1EK3A 3FB6B 3O8XC 4KI5E 2VXTH 2MFNA 4U1MB 2KZ1B 1EBPA 3C5ZA 3ILPB 4R3SB 2VL4A 1F90L 4U1IA 1MHEB 1HINL 1JZ6A 4M7KL 1YA5A 1DVFD 2IAMB 3SDDC 3IJYB 1HSAA 5GS2H 2Q87A 2G5BB 3T0XA 3KXFE 5MENB 5JA9A 5JLZB 4ZPVA 1T2XA 1CICB 1JL8A 3MRDB 5KN5B 1WBZB 3WLWC 4F9PA 3QIBC 4RAUB 1LK2B 4P4KB 4K94C 4YZFF 2PCPA 4MJ5A 4PJGF 4EVNA 3MLUH 1JZ5A 2F5AH 1ORQA 3DSFH 1A02N 3FN0L 4N8CH 2BSTA 1EHXA 3BKML 3EOBB 5T1DH 4W6WB 5KW9H 5DMIH 4WHDA 4IRSC 3GSNH 5J4MA 3TBSB 5ERWA 1D6EB 5CZVL 1OSZA 1MCOL 3ALXA 3EYSH 1QG3A 4ONOA 1F4XH 5T1LD 3HE7D 4JPKH 3QNZB 1X7QA 4ZUSA 3CLEH 1RIUL 5CMAB 4X4YB 2YA1A 3GKZA 3CSGA 4GRMA 1KEGL 3AREC 4M5ZL 2BOBB 1AXIB 3EO1A 1BZ9A 5JNYA 4NFBA 2DYPD 1V7MH 1MJ7L 1YNLL 3MRHB 3DX6A 5IEHB 5IFJB 3V0AC 4MQ7A 1H0DA 1HKFA 1VEOA 1GGBH 2EXYD 2EYRB 2YPLB 4KZDH 3PJSB 4Y19A 4S1RH 5K9OB 1DBJL 4KKCC 5J12B 3C6LA 5J13C 3QIWD 3MRIB 3DXAE 2DI8A 2AJYH 5GGUA 1AHWC 3OR7B 4C59B 2OL3A 5MHSE 1U8PA 5GS1C 4AG4H 1YNTA 5L7XL 5FF6A 3GGWB 1NGXB 2QKIB 3SGJC 3NCYP 4PV9A 2E7HA 5I6XC 2VABA 3EGSA 3SPVA 4C4KT 2ZG1A 1CQKA 2Z8VC 8CGTA 3F8UB 3OF6A 4NQSB 2HKHL 1NBVH 4RDQG 1YEFL 4LIQL 3K7UA 1OP9A 2YKLL 2A9ML 4PV8A 5I16A 3S96B 2DKSA 2VXUL 5IF0B 2UZIL 5EORL 4P2QD 1DQLL 4X98A 5FYJD 3RZCB 1MFCH 1HXYA 4NKDA 5F96H 1OD9A 4Q9RH 2WINB 4DCQB 5C0BE 1QQDA 3AVEA 3DRQB 2QLVB 2UZYB 5I17B 2NXZC 3FMGL 1WT5A 3RDTD 5FV2A 2A6IB 2JB5H 3QXDA 3RA7L 5I71B 3AROA 4I1NB 1DQTA 4PJFB 4Z7UA 2XTJC 2MCG1 5GSVA 5DD1H 3RJQB 1R5IA 5DMKA 2ADFL 3TA3A 1J87A 3RI5F 4J4PA 1EO7A 5KSBB 1CFQA 2R9HC 1GH7A 1UENA 4KJWD 4KDWA 4NZDA 3S88L 1OPGL 3DBXA 2YR3A 2MSPA 1KCVH 4UUJB 4XNZC 1NPUA 4G8IB 1FJ1A 3MREB 1BIIB 2X1OA 5K59F 5BS0D 5CIPA 3U36A 1KJ2B 4HV8A 4XCFH 2R69H 1X4XA 5C9JA 1ORSA 5E94B 5L2JB 4PJBB 3HS0B 3KWWA 3L7EB 4LGRB 3HC4H 1C5CH 4YAQB 3WUZA 1I3UA 1ZHNB 3B9KD 1UB5A 3FQNA 4U4BA 3BMWA 2B39A 1OWWA 4XP4H 1O7VA 3BQUC 1MF2L 2W9DL 3U9UB 1BM3H 3SKNB 1R24A 3CX2A 2Y06H 1XF5B 4PBWD 3BXNA 2O93L 2GSGB 5T5NF 1K8IB 2VDRH 2PTUA 4NUJA 4K2UL 1EFXD 3CFIC 3BH8B 2LAGB 5DJDA 1JN6B 3BUTA 2A0LD 2A9NL 2Q1EA 3AC0A 1NKOA 1I8MB 2ZOLB 4JVWA 3GMNB 1JFQH 4BSVB 1CGYA 2EZ0D 4ZAKD 1RK0A 5H37G 4OFDA 2DKMA 4I0PC 4ZSOA 3HC0B 3IDIB 1EJOH 1BVKB 4GJTB 5BOPA 2XIDA 2IANE 1U3HC 1TJGH 3T4YB 2BRQA 3I6LE 1IGYB 1BD2B 1FFOB 1RULL 4OD2B 3H7BB 3L1OL 5FYKU 3BZ4A 1SQ2N 1YEKL 4QTHB 3VGAC 5GJSH 3BPNC 2EO1A 1AC0A 3S6CA 1NC2B 4JRXB 1BGXL 4OQ1A 5C70A 3L5WA 3TCLB 4P2RE 3UPRB 4F7CA 5IQ7H 4MQXC 2V2TB 3V6ZB 3LH2L 2BVYA 2GJ6B 3BWAB 4Z8FL 3SDYL 2O61A 4QHMA 3HNSH 1I8KB 2MMXA 1G7MB 4LCIL 5C6TH 3IXTA 1BZ7B 1S5HA 5ICYB 1ONQB 4QTIL 1KTLA 2OMNA 2VWEE 5E8NA 4Y4HB 2EDNA 3MRPA 4TVPL 5HGHB 4P57B 5FA3B 1I9RL 3LN9A 4IMKC 3MCG1 5LQBL 2AXHA 3JXAA 3OGOE 2PUQT 2VO5A 4GS7C 2WK2A 4NQCD 4S2SB 1UWXK 3AU1B 2OP4H 2YRZA 4WHCA 4QCIA 3RHWF 1MCNA 2VLRD 2XRAH 1G7HA 1JPFA 5D96C 1DFBH 5SWZE 4BZ2H 4QRRD 5IESL 5IHUH 1HIML 2VIRA 3WE6A 1OARH 3IFNL 3D25A 4APQA 3D0VA 5J1SC 1FFRA 2BRRH 2A6KA 4G6AC 2DI7A 3TN0D 1GGYA 4RFNC 3LKSA 5F7HA 2NY0C 4JCLA 4MCYA 1T7WA 3TVMD 5JW4R 4RAHA 5A3IC 2NR6D 3IFOA 4IIQB 5CILH 3GUTB 1CK0L 3GHBL 4G8EB 1LO4H 3GFUA 4JFOA 3UP1A 4EVNB 2Z8SA 1ZVSA 2NXYD 2D0GA 3IDXH 4PR5A 4OM1H 4Z5RA 4XMPH 1FGVH 2R1YA 4MJ6B 5D7SH 5ERWB 3I2CL 2XKNA 4PLJC 1JUFA 1OSZB 2OS7A 4M6OH 4Z0XB 2FJHB 4BH8A 3H42L 2AK4D 3GSNA 4XAWH 4ELKA 4R2GB 5HI3D 1X7QB 4ZUSB 4LSVL 3UMTA 4ISVB 5I8CA 1MUJB 4GRMB 3TYGH 4HAGA 1G9NC 2ORBH 3EO1B 1BZ9B 5EO1A 2R1WA 3I02A 4KK6C 3NMEA 3DX6B 2YXMA 4MQ7B 3OB0K 2A38A 1Z3GH 2ZSWA 4MA8L 3QEGL 2X70A 5DHVH 1FYTA 5GRYA 2ZUTA 3IB4A 3UO1L 1BFSA 5GGUB 1F90H 3LKNA 4M7KH 1UEMA 2X4NB 4B41A 3MUY1 8FABB 1U8PB 1YNTB 4GSDH 2UVFA 1TMCB 5EBMA 4ZFFA 5HHPA 4FQIH 2DLGA 2VN4A 1JHLH 2MQCA 2NQCA 3EGSB 5C09E 4XP5H 2OTPA 5HHVL 4FQPA 1P69B 4Z7VF 5SWQA 2P8MB 5LCVH 3A6CH 1BJ8A 4LIQE 3KXFA 1TZHB 3VXSD 1SJHA 4PLKC 4LF3B 2E8ZA 4ODHL 5J6HA 1AY1H 1Q94A 2FH6A 3FN0H 3IU3A 2H26A 4XI5D 5HI5D 3BKMH 3TT1H 2ZCLH 3MUZ1 2R2HA 3P30L 5DC9B 3GIVA 4X98B 3P9MA 3QFJD 4KK5D 4MZ2A 4QXTA 1A2YA 1HXYB 5C0CE 5I76B 1HOCA 3FQTA 1ADQH 4X6DA 4HC1H 1RIUH 4Y2OA 3LRSB 4LDLB 4FFZL 5CP7A 1KEGH 3D1MC 5F7EL 2B4CC 4M7LT 3ES6B 5KS9B 1YPZB 1AJ7L 3PWLA 2A73A 4PS4L 1CE1H 1U91B 1G9ML 1NLDL 4Z7UB 4D9QD 1REIA 1UG9A 1MJ7H 1A3QA 1E4WL 1XF3A 2B1AL 4XVTL 1QUNA 3RPIB 2J8OA 5A2IH 1MNUH 4HUMB 1T89A 2E7LC 3G6JA 3QXWA 2XQYK 3D18A 4P3CH 4K7PL 5I2IA 2ZUQB 2FD6H 3ZDYE 4XHQA 4MLIA 3BPLB 1OTUD 2BHUA 4JFEE 5DR5L 3TZVA 1FN4B 1NC4D 5L7XH 5GZND 5ICZA 2FEEL 3V6OA 3U36B 1FG2A 3O9WB 4WFHD 4QHUA 1JGUH 5IIEB 1EHNA 4L9LC 5SX4H 3SE9L 2E6PA 3BW9B 5FM5M 3KWWB 4N0YL 3U30B 2R0ZH 2XTLA 4HKBA 1KF9B 4HS3A 3CVHH 1UB5B 3VCLA 3FQNB 4AY0A 2HKHH 4LK4A 3LZFL 1YEFH 4LIQH 1A6AB 1UXSA 3KPMA 4HCRA 2YKLH 4QXGL 5DMGD 4ELME 5HHMB 1I8IA 1WWWX 3HC3L 3VJ6A 1NCBL 4PJIE 5E5MA 2XZCH 3BDYH 4PG9A 1BWMA 2VXUH 3OJ2C 1R24B 2I9LA 3EYQC 5EORH 3TBVB 2KKQA 1F4HA 1DQLH 2BCKA 3GJFB 4WI4A 5E6ZA 4NUJB 3MLTA 5GJTH 4PGEA 1FC1A 5SV3A 3VFUA 3LRGA 3BIKB 4RRPA 4O4YH 4ZPTA 3NGBC 3RIFF 4O58L 1YN6A 2W59A 5GGTL 3OKYA 3KJ4B 2BSRA 3ULSB 4HH9A 1IAKA 3FMGH 1OAQH 2IQ9H 4U33A 4CBPA 3QRGL 3R1GL 4M8QB 4HH8A 3T2NL 3HZYA 3L3OA 3TO4A 3VI4E 3VFNB 1NMAL 1RZIB 4G9DA 3PHOA 1CD1B 4WWID 1IRAY 5C0BA 4UMGA 1JTPA 5C2BH 3QUMB 5E6IC 5EA0L 4OGXH 1EBAA 3E1F1 5KANI 1EUTA 3CZFB 3ROLA 1S9KC 4BYHA 2B20A 1IVLA 4TYUA 4LSQH 2VN7A 5CFHA 2VRAA 3CPLA 5MI0B 1SYSA 1K2DB 4KUZH 1VKXA 3ARBD 2ARJA 3L5WB 4JZNA 2FRGP 4L3EE 1ZS8A 2AQ3A 4O51A 3V4PH 3IAGC 1EX0A 1NANH 2BNRE 2HTKC 1MCCA 5IW1A 3JUZA 4AIXA 3UZEA 1O0VA 2O61B 1CDYA 1OCWL 3C5SA 4OD3L 1KTLB 4I3GA 3WHE0 4TVPE 5E8NB 4LLDB 1H3TA 4JFDD 4ALAL 4LARL 5TDPA 1RZ8A 4MAYB 4Z78A 1JWMA 3DI2B 5I1HH 3IDJA 5DFVD 1INQA 2W9DH 4F80A 3RIAF 3WFDL 4N0RA 4LVOC 4M7JH 2EC9T 3BJLA 4PJBE 3ZKXC 1DEEA 1G7HB 1JPFB 1MCPL 1SHMA 3NPZB 5DJYA 3DRTA 4H88H 5E24E 2XPGA 4O2FB 1EO8L 1IGTA 4G8GD 4HD9A 2VIRB 3UZQA 3WE6B 5JOPE 5DVLA 1OLLA 2F15A 5JR1L 4APQB 5IGXL 4XMLL 1G7PA 1SJEA 2A6KB 4I77L 4P49A 1K5NB 4YHLH 3CGTA 3GEWB 5F9DC 3KJ6L 3EO0A 3VRLE 3O3BA 4MCYB 1QVOB 3EHBC 2HWZH 5E2VL 4PJ7E 4ODSL 4QNPF 5FECB 4UQ2B 5CJQL 1AR1D 4R26L 3UJJL 1N5AB 4KJYB 1CLZH 3MPCA 3P4OB 1BGXH 4PR5B 2R1YB 4EOWH 3UYRL 2HLAA 3SO3B 3BKJL 2H9GA 1QFWI 4F58L 1CG9A 2XKNB 2NY1D 5EH1A 5GGRY 1V3JA 4HFWA 3GMLA 3QUML 2I60H 3SE8L 2HJKB 3B5TA 3BP5B 1J0JA 4ELKB 1EVTC 4HWNA 4U1KA 4LCIH 1HILA 5GQBA 2CLRA 4OF6A 5I8CB 3V0WL 2FIKB 3U7AA 1DSFH 2HVKA 1ETZB 3CC5A 4L29A 2M26A 1T21B 1ZANL 5ALBH 5HYQB 3I02B 2A77L 3B9VA 4KJPC 4KQ4L 3VGHA 2VDOH 4JFZL 5I0DA 2VOTA 4NRXA 3GRWL 4P59H 3I9GH 4WI6A 4DN3L 3VDBA 4OQTL 5IVNA 2CKNA 2E9WA 1ZHBA 2X70B 2X4OA 1FYTB 3D3VD 5DVMA 4LLWB 2EE3A 4TTGA 3C6SB 3MRLB 1K4CB 3UDWA 3K1DA 3HMWL 4JRYB 2EH8L 1HIMH 3U7YL 5DHVA 1LK3H 5I1GL 3BIAX 1KT2B 5HHPB 1ZLVK 2EDKA 2YRPA 3DXAD 5EZIL 2X4RA 1WFUA 3E2HC 4YFLI 1LDPL 1HHHB 4OZFG 5MHSD 5SWQB 1INDL 3BKYL 3FB5A 3HMXH 5BRZE 1AGFA 4YGAB 1Y0LA 3UAJD 1Q94B 2WWKO 1F58H 1H8OA 3IU3B 4OFKA 4DZBA 3T0EC 4R9HA 3VI3F 2PO6A 1KCKA 2R2HB 4K94H 2YSSA 3GIZL 3LKOA 3N9GL 5ESQB 4NUGH 1KCRH 4XNQA 3T2PA 4M93C 2E27L 1ZGLA 1D9KB 1A2YB 4QXTB 4W70A 3CCHB 1JNHB 3H42H 3WNKA 1HOCB 1X5AA 2BZDA 1BBJA 1FBIH 2Y72A 2XG5A 4YIQB 3SKJL 1MCJA 4QYOB 4AM0B 1QR1B 4KTEL 3LSOB 5CP7B 4DK3A 2WAHA 1BX2A 5DVOA 4CJ1A 4LCCC 2A73B 2BY2A 1ADQA 4YHKL 4HUXA 5H2BA 2Q6WB 1OTSC 4HC1A 4UIKL 1NLBL 4JY4A 1P6FA 1A6WL 1XF3B 1X6LA 2FL5B 4F33A 4MA8H 5F1OB 5D2NB 4Y5XC 5KTEL 3QEGH 5FO7A 1LGVA 1NCUA 4TQEL 3T4AB 3TP4A 3HB3D 4BFEA 5IG7B 5GRVK 2BVOB 1P7KA 1CLOH 4QOKB 4JM2C 4LLUA 1KPVA 2NY3B 5F3BA 1TNNA 4D9LL 3KGRA 3F5WA 4I3RH 3TZVB 4XVSH 4K71C 5ICZB 3MSPA 2ZP0T 1CFTB 1FG2B 3CFDB 3MV9A 4HUUA 4YDKL 3SQOH 4QHUB 2Z91A 3VGBA 3FQUA 5D7KD 3CMGA 5JDSA 5DS8B 2IBGA 5B39G 4HS3B 2G60H 5IP4A 2AK1L 3TPKA 1S78D 2K3TA 1RUAH 4RA3A 5F89A 2JKXA 1I8IB 1F3DH 3S7GA 2WANA 4PJHF 5E5MB 5C09A 1Q0YL 3P30H 5IBLC 2J8UF 3CVHA 5IHLB 2I9LB 2FYYA 3VXOB 2C4FU 1R3IH 1YYML 2SEBA 5EWIH 2HT2D 3MLTB 4PGEB 2YUXA 3WSQL 2XFXA 3U79A 5I18L 4G6KH 4MZ3A 5C7XL 1NGWA 3MRQB 2NY6C 2A83A 5D70H 3KPQB 2ZUYA 4GQPH 4HH9B 1RFDL 1HHGB 4K3EH 1U8MB 2F54A 2CRZA 5C0CA 1AJ7H 4M1CD 4O9HL 4G6FB 4PS4H 1NLDH 3HZYB 3L3OB 3TO4B 2D9QB 3Q0HA 2XY2A 4UZGA 4GH7B 4XVTH 1OAKL 4P46C 3BGMA 3WNNA 1G1CA 3I6KB 1JGVL 4BQ9A 4QHNA 4C55A 4K7PH 1MPAL 4Y4KC 5KS9E 5IWLA 1YPZE 1SYSB 3KYMA 2NYYC 2CIKB 1QRKA 4PRIE 1VKXB 3DO7A 1QBMH 4ZS6D 3C60A 1ZS8B 1MJJB 5HD8D 4J8RA 2QSTA 1UWXH 4F2MA 3QFDB 3N85L 2C4XA 4P4RB 4LFHG 4JFEA 4Z7VB 2OSLA 4P2RD 4OFYA 1CZ8L 5DUPL 4MNQB 4QXGH 4OF0A 1WTGT 5TDPB 1RZ8B 4WHTB 4E0RB 1K6QL 1MAJA 3HC3H 4NWTH 2V5MA 4WY7L 5CUSL 2D03L 4LAQL 5TGBB 2DQGH 4NGHL 5I74B 3RBGA 1QLEH 4PRBB 1MFBH 1M71B 3MRRA 4ELMA 5CHNB 1X44A 4PJIA 4JHZA 3L5IA 4PJGE 1GZQA 2LVCA 1KEMH 5DJYB 4PD4J 5HHME 2XPGB 4U3HA 5HXMA 3FAWA 1IGTB 2ICCA 3QRGH 4HKZA 3R1GH 2MPAL 1B9ZA 3RNQA 3UTZB 5I8OL 2IC2A 1NMAH 3VGDA 1NEUA 1G7PB 1GPOL 1HSBA 1KIRA 3IFLH 4LL9A 3W5NA 5DD3L 1CXKA 1CWVA 5F88B 4WGWB 1HWHB 3EO0B 5SWZD 1G6RH 1KB9K 1YMMB 2R8SL 3O3BB 4QO1A 4XAKE 2CQVA 1I3RB 3S34L 3PWPA 4AEHL 5DZNA 1YEHL 1IARB 4ODUA 4OF8A 3LEVL 1UKSA 3IETA 4TSCL 1S9VB 3UTSB 5E1HB 1E6OL 2HRPL 1TNMA 1EEUA 1VFAB 4YFEA 3B8YA 2GITB 4HEME 3OB0H 4BQ8A 3LS5L 4GRLB 4O5LL 4MB3A 3K4AA 3GMLB 1MHPL 4TSAL 3G6DL 2Y1VA 1GOHA 4HIEB 1OCWH 4U1KB 3RWDB 2XT1B 2CLRB 1I1AC 5D1QA 4LARH 2AJZB 2HVKB 4L29B 5IJKA 5CLWA 3CIQA 5EZJB 5F7NC 2G2RA 2H2SC 5DQ9B 5I75B 4PJHA 1XIWC 1X5XA 4X5WA 1VENA 3S4SG 3BUYA 2NY5L 2HH0H 5FO8A 1TCRA 4HIHB 3LMJL 2APTA 1L7TH 4LSRH 1IGML 3U7WH 3SDCB 3JTSB 1A6PA 2X4OB 1P7HL 2EDJA 3EO9L 3MOAH 4FFYL 3MX0A 4IDLA 4NBZB 3DYOA 1MCPH 1CTOA 4HIXH 3T2QA 3OJMB 3MACL 3KPRA 5M7QA 5L2KA 5DHVB 1S9WA 5JPMB 4WW2C 1BAFL 1BQHB 4JQIH 4JVUA 2VL5A 3WHXA 1UVQB 3CAFA 5IT2H 4XMLH 2WUBL 3O4OB 2QSVA 1PX3A 4RX4D 2X4RB 2I24N 4X6BB 3LEXA 5DJZA 3UX9B 2J6EL 3KJ6H 3O8XA 5C08B 4DOHE 4ZS7H 2ZPKH 2XQBH 3TM6A 4X83A 1KGCE 1LP9F 3QO1B 5E2VH 2UY7A 1CIDA 5K9QI 5CJQH 1AGFB 4X4XA 3S37L 3SDDA 5D71L 4ZODA 3UJJH 1AI1L 4F7EA 1RU9H 4DZBB 4XNXL 1U8OA 5HI4C 2YSSB 4Z7QF 2JJSC 3HMXA 4OUUA 2FGZA 3LN4A 3N1PC 4M1GH 1ZGLB 4OI9A 2IBZY 4ZFOB 3QIBA 1AIFA 2IAMD 3TYFA 1Q9OA 1VGKA 3QISA 4NZRL 3V0VB 1X5LA 2GCYB 3IDMB 4WJ5A 1JV5B 4DEPC 4H25A 4TULH 1QRNA 4IRSA 1CICD 1R3LB 4HUXB 3U4AA 5H2BB 5K59E 2H32A 1BHGA 3ZYZA 3H2WA 4P4KD 3MCLL 4V2BA 1L9NA 4ENED 1DQQA 1G9NH 5C0EB 4OQTH 2PYEA 1JRHH 1RZJC 25C8H 4U1SA 5FO7B 5DMYA 1XGQB 4WHYG 3RAJH 3AREA 1HQ4A 3CVIL 5C9KA 3HMWH 5B38G 3WKNA 5KSAC 3F5WB 3MLZH 5I1GH 3QJHA 5F1NA 1MWAB 1F45A 3KPSE 1UACH 2Y07L 1HDMA 3U0WH 2Z93B 2DJUA 1MY5A 2BERA 3MV9B 4HUUB 4RNRA 5EZIH 5E9DE 3FQUB 3AMLA 3EYUH 1A4JA 2X9YA 4Z9KB 5AYQA 5JDSB 3X17A 2CDEB 1INDH 2DLFH 1AHWA 3M1BA 1G0XA 4XP9H 2C26A 5GS1A 3J7HA 5F89B 4OSUL 3MCKA 1FFNB 4U1LA 5ESVA 2YPLD 1FZKA 4GKSB 3SGJA 3GIZH 1W0WA 2FYYB 2K7PA 2ARJQ 2ZWLT 2SEBB 1WAAF 2XFXB 2H6PA 3ZTNL 1J8HB 4M61A 2DM4A 4D0BA 1QKZH 5HDBF 1SVZA 1QBBA 5JQ6H 2YS4A 3LOWA 4PJCF 4WUUB 3B2UC 1HXMA 1OQOA 1IQWL 4N8VA 5FGCE 5E99L 5FKAB 3QQ9D 1A6WH 4LQFL 1RZGA 1XF2A 2B4CH 3O6ML 2OX5A 2XKUA 2ICWA 4ZFOL 5KTEH 3DX7B 2H3NA 5E08L 3FO0L 4NN6B 4NQDE 4JFFB 1I1YA 3IF1B 4DGYL 3RZCD 1CFVH 1YY9C 5B3NA 3WEXA 3DO7B 1D5BB 4Y4FC 2WWMC 1H3VA 4J8RB 1MCQA 4F2MB 3S5LA 3L3HA 2I5YL 3JV4A 5CKGA 4OLVL 3FQRB 4M7LL 2GY7B 4FTVE 4NO0A 4L3ED 4QOKE 4WO4C 5A2KH 4MD0A 4H5SB 2BNRD 4YC2C 5ACLA 1T2QH 4FG6C 2AV7A 4XXDA 1Q0YH 5EOCJ 4F7PA 1Z0MA 3QUYC 4L8BA 3HFML 1YYMH 5DJ2B 1NUDA 2IPTH 4TVPD 1NGYB 4XPHL 4DN4H 3MV8A 4FXLA 4EI5B 5FB8A 5E8EB 4NDMA 2PXYA 2CUHA 1RFDH 3RFZC 4GKZB 3K81A 4HKZB 2RAMA 3EOYG 1HCFX 3RNQB 5JW5B 1UYWH 1A5FH 2R15A 1U3YA 4JLRB 4CW1A 5KVEL 4MLSA 2FX8H 3GSQA 1EPFA 3BGFC 2AGJH 5LGJA 1A7OH 2XWTB 2WSKA 5J7CC 1JGVH 3GBNL 4RBPH 5CEXA 4ODUB 4XBGA 3E6FA 4I0PA 3EDJA 5K9KA 1G6RA 5CGYD 4YHYB 2Y5EA 4EQ3A 5ID0B 3MRGA 1PYWB 3TH4T 3RTQB 1U3HA 3ARDB 4FXGA 4MD4A 3WFHA 5AUMA 5FGSA 2GW5A 5LG1A 1XGRA 3CX5J 4CKVX 4EJ1C 5EIIB 5HYSB 2HT3C 3DURB 3N85H 2V2XA 3KPOA 2XNAB 4MWFB 1ZTXH 3R0MA 32C2A 4JPVH 5JHDE 5HHQB 4JGMA 5A16B 5BVPH 4HKJA 1KCLA 5D1QB 2GHWB 1BD2D 1K6QH 1JNJA 4PTTB 1KIUA 2G2RB 4PJHB 2P8LB 5CUSH 1DR9A 3L5JA 4X5WB 2D03H 4LAQH 4XHJD 5I1DA 4NGHH 2DM7A 4YJZL 2Q8AL 1QBLL 5FO8B 1NC2D 1TCRB 5DHYA 1JIBA 1ZLWK 3MBXH 4JRXD 2Q76A 1ACZA 4Z7VE 1S7WB 1Y6KR 2DDQH 4LRIC 3O81A 3RVWC 3TPUA 3EAKA 3VFTA 3QG6A 3KPRB 2P8PA 4IMKA 4RFOL 2VITA 3BT2H 2GJ6D 3ROOA 1S9WB 3SN6N 5I8OH 2VL5B 1OQXA 4HIJB 4N90D 1LILA 4RGOH 4HPOH 5IOPA 3HZVA 4GO6B 5DA0B 3OJDB 1JWUA 3LEXB 4NC0B 4Y4HD 5DJZB 3S97C 1UM4L 2D2OA 4LVHC 3UXFA 4EKXA 2R8SH 1H15A 1MH5B 1JPST 3S34H 1E4KC 4J23A 2Y6SD 5T1MA 4PJ5A 5T3ZL 4AEHH 4HGWA 3U2SB 2DQJL 1CIUA 1RMFL 5D6DC 4X4XB 3SDDB 4IRJA 5IB4B 4CJ0A 2I07B 1VGEL 5D7LB 4F7EB 1E6OH 2W38A 3MLVL 2HRPH 3W9DB 1JF1B 4WU7B 1MIEH 4AL8L 5MEOB 4OUUB 1IKNC 5BRZD 4O5LH 1QSEB 4LSSL 1YMME 2YD1A 2YUWA 3QDJA 4GBXC 2HTLD 3QIBB 3G6DH 5F7LB 3TYFB 1NBZA 1BECA 2VC2H 1VGKB 3ARYA 4XNYH 4UILH 4WJ5B 3SDXA 4PTUB 4FZ8L 3HI1B 3SGDI 4KKLC 4H25B 5FCSH 4Z7OE 1QRNB 2BP3A 1SEQL 1PZ5A 2J4WL 2PR4L 3L6FA 2FECL 3P0YL 1XR8A 3BI9X 3RWJA 2H32B 2ZNXA 2ZJSL 3LN5A 1A0QL 3TJHD 5BXFA 3WFCL 5A2LH 1NCAL 2HAZA 4HZLB 5H94A 1TXKA 3MROB 5A40E 1NCTA 1TPXB 2AXFA 3WN5C 3AREB 1T1XB 3K46A 3MNVA 1A7PL 2HA1A 3SDAC 1BAFH 4S1QL 5F1NB 1II4E 3F7QA 4FS0A 2Q7YB 1JWSA 1HDMB 4ZTPL 2AEQL 3NZHH 1EZVX 2XWBB 2J6EH 5IUSA 1A4JB 1AGBA 4A6YH 4WDIA 3JWOC 3QUZC 1Z0NA 4YPJA 3Q2CA 1FNGA 3F7VA 1FIEA 1AHWB 3M1BB 5CEZL 3M8OL 3FN3A 5CGTA 1AI1H 1HKLL 2XZQL 5E8DH 1BJ1J 3MCKB 2HVJA 3OXRB 3O3EA 4XNXH 2AJ3A 1YEJH 1FVEA 1W0WB 4KUCD 3QZWG 4CVWA 4L4VB 4QRUA 3GNMH 5HVHC 3EJYC 5C08E 4PYGA 3RKPA 4M61B 3KPPA 4NP4H 2BNQA 3BD4A 3GSUB 4L4TE 4NZRH 5HVWA 3PL6B 3CDGA 4KKAC 2QQQA 4WIQA 4KRNA 4K55A 3DUSB 3TEUA 2A74B 3FFCB 4N8VB 1P9MC 4HPYH 1FFPA 3MCLH 4KWUA 1JGDB 3VXRA 4YDVA 3QCTH 4TTDD 2PW1A 4ZQKA 1JCKA 3G9AB 1CL7H 2APXA 1WFOA 3G5YA 4OLZL 1TTFA 2R29H 2NXZB 4M6MH 2B0SH 3CVIH 3BO8B 4RMUA 2XTJB 5IVXF 4FZEH 4U3CA 5T3XL 3WEXB 5C0RL 4WUKL 3HG1A 5C3LD 4C83B 3RU8L 4HF5L 1I9IH 4MQTB 4PRHA 2NZ9C 2E7LA 3S5LB 4LSPH 3PHQB 3JV4B 1I7UA 3HPJA 1IM9B 4JFXB 4HFUL 4RFEA 3KPSA 3MV7E 2VSDA 4NZUH 2OTUB 4XNZB 4ETQA 4MD0B 1QO3A 4U6VL 1GOGA 4OSUH 5E9DA 1QOKA 4JN2B 4MA3A 5MP6L 2YD6A 3IS1X 4XXDB 4F7PB 2ED9A 3MRKA 3X3FH 4X6CF 4L9LA 5DA4A 5FOBB 5I1KH 3VFRA 4JJ5A 4MNHB 1NFDF 4NJAH 3VG0L 1KYOJ 5FB8B 4M48L 4QNPE 2PXYB 5HGBB 3O9WD 5A1AA 4PIRF 5JIIA 2UWEA 3QDME 1I1RA 5E99H 4NHUA 1GXEA 1XR9A 4CW1B 4KHXH 5IBTH 1S7VA 3O6MH 3DVFA 1S7RB 1TJIH 2IFFL 4U0QB 5HHMD 2G9HA 3GBML 5L88L 4L4JA 4OZGF 1MI5A 3BP7A 4XBGB 3UTTE 5L0QC 4I0PB 5K9KB 4OT1L 1J9CT 4WUUE 3TESA 3MA7A 3MRBA 2PW2B 3ZKND 3MRGB 4LSTH 4XAKD 4PGCB 5FAAA 4MD4B 4LSUL 4OZIF 3AM8C 3WFHB 3DECA 3I75B 5E6IA 1Q9KB 5F1KC 1M7XA 3U4BL 4NO3A 4NQDA 1ZLSL 3VXNB 4WI9A 2YD4A 4HT1H 2DAVA 2EXWD 1KJ3L 3FO1A 3KPOB 1TZGH 2ZOKA 4M7LH 1IAIM 4JFFE 5DK3A 4FQJL 3P40A 1WF5A 4GRWF 2F58L 4PRAA 2X89A 4CUCA 2V7HA 4KQ3L 3TNNA 4OF3A 1Z2KA 4F8TA 5I30L 3HFMH 3BYYA 2BY3A 2QHLA 4XT1C 1CU4L 4HW6A 3WUWG 1A9EA 3NOIA 1X5KA 4PJAE 1A6VH 4Z77A 4OV5A 5DHYB 4MHHG 1Q1JH 2Q76B 1CLYH 4HQQH 1PQZA 4J1UA 4YQXH 2XG4A 3TPUB 4MNGA 4OCXL 3QG6B 5TE7L 3AUVA 3N1QC 1DVFC 1KTDA 4DVBA 3ROOB 2PTTB 3VFMA 3VI3E 5INCB 2DS4A 3H9ZA 4LPTA 4ONGH 3P3YA 4QRTA 1ND0B 5IOPB 3HZVB 2ZKHL 4OD1L 4R8WH 4MAYD 5T3ZE 1U0QA 2X6MA 3CH1A 3GBNH 1CD8A 4EDWH 4XGZA 4BELD 4PJ5B 1KIPB 3V8CA 1F97A 1NUFA 4WHYH 3VFVA 4IRJB 1K85A 4YBLC 1MRFL 1UCBH 4RMRA 5DC0A 1PKOA 4XC1L 3QAZC 1CFSA 1KGCD 4X99B 1ED3B 5IR1B 4YEFA 5TF1H 5K33A 4NKIL 3MLRL 3HI6H 1NBZB 5HPOA 1NAMB 1OAUL 3ZDXE 1U93A 4APQD 2AJSL 2LU3A 3CK0H 2QSQA 3SDXB 2HMID 1WC7A 3H9HB 4PJEE 1L0QA 4E42A 1XR8B 1QA9A 3T1FA 1YY8A 3G5XB 3LN5B 5INDA 3RWJB 1G9EA 3CFJB 1KTRL 3JTTA 1IAIL 1Q9LB 1QBLH 5BXFB 5LXGH 2EXYC 3VXTA 1S5IH 1V7NH 4GG6F 3QIWC 3WYRA 2AJXH 3MNVB 3JV6A 3DV4B 3BPOC 4RFOH 1S7QA 5DGRA 4M3JA 3EFFA 1DE4B 2J8UE 3C2AL 3MYZA 4J3WA 3IKCB 3EUUA 1JWSB 3S3PA 4M43L 3UZVB 2ITCA 1PEZA 1L0XA 1UM4H 3VRJB 5L6YH 1AGBB 4WDIB 4X6EB 4G7VL 5DJXA 1UQSA 1A14L 5CEZE 3F7VB 5D5ME 4U1NA 2AEIT 2J6EA 4TUJB 4YHIB 5EZOL 4A6YA 4ZFGL 3C5JA 3MLVH 4TUKL 4D9RE 1OGAA 4KAQH 1GHFL 4UAOC 4ZUVA 4O02H 4AL8H 3LEYL 4X7SL 2IWGA 4LSSH 4JRYD 3KPPB 3AAZA 2BNQB 1MAMH 1E4XL 2R23A 3CDGB 4YLQT 3PXJA 3DV6A 3GSXB 3T0EA 3QEHA 5D7LE 4FABL 2WWKT 3EYVA 3RDTC 1QYGL 3D0LA 2B7DT 3FRPA 1KSRA 4J3TA 5F44A 4EZMA 1PAMA 2ZZUT 1FFPB 4PBVC 4YDVB 1UWGL 3WFCH 1IKFL 2QADB 2PW1B 4ZQKB 4LRNH 4KJWC 4L3AA 1NCDH 1NAML 2J8HA 2VISA 3HZKA 1DANU 5IV2B 3MA9L 1YUHB 2RR3A 4LCCA 1D9KD 1RZJH 5T3XE 2ZG2A 4Y1AE 3RUGE 2BNUA 4S1QH 3HG1B 4QRSB 2B2XL 3O2VH 3NIGE 2P5WA 4Y5XA 4ZTPH 5EUKA 2H2PD 2AEQH 4Z0BL 3WD5H 1FL3A 2VDMH 3C8HA 4DFHA 2B5IC 4FQ1H 3ZHLA 3B9KC 1MCKA 4JM2A 5GGQH 2GJZA 5I1JL 3WL9A 4Z7NF 2MNUA 5IB5A 4ETQB 4U7SA 4LPUA 1P84K 2XZQH 3RL2B 1KLUA 5ALCH 1A8JH 1MRCL 3DTXA 1UA6L 1UJ3A 1UM5L 1I7TA 2P5EE 3MRKB 1H5BB 3NA9H 5TQ2H 5HHOA 5HJ3A 4FTVD 3VFRB 3QPQD 4G5ZL 4CAGA 4BUGA 4QOKD 2NY3D 2GQHA 4ZOEA 4K23L 2DICA 3THMH 1BBDH 2X4SA 3TZVD 2A0LC 5J6GA 1OAYL 1R5WA 3BH9A 2RFXA 3B5HA 2EZ0C 2UWEB 4ZAKC 3BRDA 3QH3B 1FZJA 7FABL 5AYUH 4OIAA 4L4VE 2OM5A 4NHUB 3X11A 5DEFA 4WW1A 5DRNB 3PDGA 2OZ4H 4JDZA 1XZ0A 4KFZC 1IGJA 2G9HB 5FYLL 4XTRD 4PUBL 3IT8D 1LO3L 4OBRA 1VADA 2W0LA 3BP7B 4N0CD 1DUZA 4QRQB 3FFCE 4JHWL 5BJTA 5T3XH 1A6TB 4HZAA 2XZAL 2LE9A 4NQTA 3BVNA 4P46A 4HF5H 1YYLL 2QQLL 2CXGA 4NO5A 4NO3B 1SY6L 1EVUA 1FNEA 2QJDA 3OKOB 1ZLWH 2CIIB 5ADOL 3FO1B 1FCGA 4G6FD 2ZOKB 4HFUH 3TO4D 2VSCA 3L3JA 4Y4KA 1XGUA 1N2RB 2GFBB 2CRYA 2V7HB 4P5KA 1JI1A 1EMTH 1FAIH 1VFUA 3IXAB 4R4FH 3CDYA 3ZZ1A 4X80L 2A1WH 3MV7A 1A9EB 3A0OA 1DL7H 5FHBL 2EDBA 4UOW0 4M1DL 4NWUL 4Z77B 4OV5B 2GK0A 1EJ6A 3VG0H 1PQZB 1C5BL 4XMKL 1LP9E 1WCBB 4F7TA 4M48H 2WBKA 1T1YA 2X1XR 3GSVA 3PP4L 4O2EB 4JVPA 4PB9L 4ZG1A 4DVBB 3O2DH 3VFMB 4R97C 4KRPB 3RVUD 4Z7QE 3Q1SL 5IB2A 4QGTA 1EH9A 4LCWA 4I3SL 3TN0C 4K3DL 4MNQD 5E03A 3L7FA 4WWKD 2IFFH 3QR2A 4U1GC 5HDLA 2C3HA 4R7DA 1AFVL 3CH1B 3FFDB 3TVMC 2NR6C 4PLNC 2RIKA 1MEXL 2CR6A 1Z5LA 1MFDL 2IG2L 3EFDL 3IVKB 4OT1H 4Y2DA 4KROD 2NXYC 5FEBA 4NQUA 3OKLB 3WFBL 5IVXB 2X9WA 2O26U 4GAJL 3UC0L 2YPVL 1CFSB 5DDHB 2PETA 4WV1C 1ZLSH 1MCDA 3UTTA 3C9NA 5JDJA 1GGIL 1H8NA 1KJVA 1KJ3H 2OI9B 1MCHA 2W0FB 4GW5A 4LBEA 5HI3C 4XZUA 4A2MA 4DKAA 4UIMA 2F58H 4JKPL 4KQ3H 4GQ9L 1I4FB 1YMMD 2E7MA 4QF1A 3T1FB 1YMHA 1YY8B 5INDB 1MJ8L 1JF6A 3H0TA 4X6CB 1CU4H 2NX5A 3INUH 3QWRD 1NFDB 3UTSD 2MCPL 3P0VL 1RD6A 4P5TB 3VXTB 5A2JH 3BP4A 1I1AA 3IS0X 3C2SA 3WXWL 1EXUA 3FOMA 4GRLD 5TE7H 3V5DA 1XIWA 4PJAA 1S7QB 4OGZA 5BCAA 1ROWA 3EFFB 5SX4I 4ONFL 2VQUA 3DETD 1QSFB 1NUGA 3KDMB 4KVCH 1T4KA 2ZKHH 3Q6GL 2X40A 3TIEB 4UDUB 5DEGB 2IADA 5DJXB 3QDAA 3G04A 3OMZA