1FIGH

Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
216
structure length
216
Chain Sequence
DVQLQQSGPELEKPGASVKISCKASGFSLPGHNINWIVQRNGKSLEWIGNIDPYYGGTNFNPKFKGKATLTVDKSSSTLYMHLTSLQSEDSAVYYCARRRDGNYGFTYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA 1F7 FAB (LIGHT CHAIN)
publication title Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 27
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figH02
1Q9KB 1RI8A 5DMIL 3UJTL 4ELMF 1KCRH 5F7KC 3IFNH 4QXGL 4KKLD 4QHMA 5JW5A 5IBLC 3HZKB 3MCLH 4PY7B 4ZTOH 1R5WB 4PLKD 1QQDA 3SDAD 2AEWA 3QAZC 5E2UH 4PGBA 4JN1H 1A0QL 4OZFH 2EZ0C 2AK1L 3PWUB 1CGSL 3VFMA 5JPNA 4DKDC 1TZHA 1R5IA 4XNZC 4C55A 1P4LB 4WEUD 4JPIA 3O4LB 3GDBA 1TXKA 4XWOC 2DDQH 3ULUF 2IMNA 4QCIB 2XKSA 4OB5L 4XP5L 3QYCA 3SO3C 3MBED 3MJ9L 3KXFB 2YD3A 4Y1AE 3QR2A 1IM3B 1GH7A 4RAVA 4Q2ZB 1TQBC 1HK6A 4FXLA 1TPXC 3CXDL 1IFHL 1ZHNA 3MV9A 2YPLA 2ZJSL 2XQBL 4XTRD 3VFTB 4N0FB 4PRBB 2YUXA 4D3CL 2VSCA 2BMKA 4OGZA 3RL2B 5K9QG 1BJ1J 3TBVA 2HN7B 3O11B 4BFIB 1KJVB 1L6ZA 4PJBB 1CGXA 2RQ8A 1N0XH 2VDNH 3FB6A 3MBXH 5DRNB 3WD5L 4ZODA 1MHEB 3H42L 5D8JL 4QGTA 1LQSR 3T0EC 3DXAD 5DGRA 1DUYB 4HWZA 3STZB 5E6IB 2HRLA 2OZ4H 2HVJB 1MAJA 2IPTH 2AJYH 3VGDA 3B2UC 4NSKB 3OQ3B 1ZE3C 1WLHA 4JFYA 3DX8B 1H15A 3O3AB 3NACH 3PIQA 4WO4D 3UPRA 3O9WA 2P8PA 5AAWA 4HKXB 4JQIL 1DCLA 1J0JA 1HHGB 1A2YB 1CDGA 1U2CA 1NLDL 3GIZH 4W6WB 2ARJB 4U6VH 3MNWB 5AEAA 5HDLA 1MAKA 4WU5A 1MCPL 5E08H 4NQVB 4LCWD 4EUPH 2O61A 1AD9A 4FQIL 1FZKB 4D0BA 2DBLL 3FQTA 4FQJH 3QHZL 3L7FB 3HE7A 2H45A 2P42B 2W92A 3QHTC 4Z7QE 2NLJB 4KUZH 3NA4A 4F58H 2I5YH 2OR9L 4K3EL 1PSKH 4Y1AB 5CCKL 2P8MB 3MLUL 3PG2A 2N1KA 5IKCA 5DJXA 4J1UA 1PYWA 3DXAE 3IJSB 3O8XD 1RIUH 2XKNB 1UJ3A 4YDKL 5GQBA 2GTZB 2CPCA 1J1PL 3DWTA 3AB0C 1HH9B 5D7IE 3C5JB 1PY9A 2AJXL 1JZ2A 4UV7H 1RZFH 2HT2D 4R97C 1SJEA 3PDDA 5INCA 4XNYH 5I0DA 1AKJA 3HNTL 4AK1A 5DJ6A 2GSIB 1X5IA 2X7LB 3SDAB 3MYJB 4M02A 5GGSY 3TN0D 1S7TB 2YWYA 4NKOA 1G9MH 2YWZA 4LCWE 4JFDA 1FV1A 4WRLA 5EUKB 2C26A 3UTQB 3RY4A 4H1LB 2EDDA 4PJDE 3JWOH 2LVCA 4YEEA 1X4YA 4L9LA 2VDML 3MBEB 4GBXC 3OBAA 1R3JA 1IAIH 5HHNA 2D7QA 2HRPL 1KJ3H 4RGMB 5FF6B 3S8WA 3TO2A 2GK2A 1KYOK 3EJZC 5FA3B 4YNYB 1F6AA 2YMXL 3L5HA 1WZMA 4OZ4A 3OGCA 2NMSA 2VDRL 3S36L 4KDVA 4MD4A 1K8DA 1MOEA 3VFPA 5J13C 3QUXA 4XGZB 5E2WL 5HVHB 2BP3A 3QISA 3ARZA 3HNSH 4X7TA 1ACZA 1T1YB 4M6NL 3OZ9L 3UTZB 1F58H 4UDUB 3DXAB 3MRKA 3RL1B 4HS6A 4X7SH 3BPNC 4QTIH 4PS4H 3F65A 3OKMA 3LQAL 5C1MB 5D7JA 1PLGH 2APWA 2ESVA 5D7IB 2ADGA 4WO4B 5FHAL 5HYSA 3IVKB 4H1LG 5GRZA 5A1AA 1AFVH 4QT5A 1JHLL 4HH8A 5AAMA 2XNAA 5JHDD 2F53D 3OKEA 1BFVL 2BSSA 4PJCE 3QG7L 1T6VN 4UT6L 5T33L 3TLRA 4UNUA 2CLRA 3QT2A 4PP1D 4LRNL 1R3KA 1QUNA 2IQ9L 1X5XA 3O6ML 4LCWB 1K8IA 4MA1C 5IHUH 1QYGH 4O00A 5ICZB 1TFHA 4Y4KA 1CFQB 4D0DA 3LIZL 4X7DC 5I8KL 1MCSA 4PJDB 3L5WA 5SWSD 1KLUA 1A6AB 4MS8D 1E4KC 4DKFL 4QHKI 4Y5VB 1YEEL 4N8CL 2NY7H 1IVLA 2F54A 3PL6C 3V9FA 4HUXB 1HZHL 2E27L 3O8XB 3F5WA 1RJZB 3ETBF 2ICCA 2YS4A 3NCYS 4F15C 5IB4B 3QFJA 2L0DA 3H2WA 5GGVL 1M7XA 1UVQB 5CGMA 4X5XB 2AS5M 1FFNA 2B4CL 3ARPA 4OLEA 2DAVA 1XZ0B 5F7HA 4M7LH 3HMXA 5JHDE 2F53E 4MCYA 5D1XC 5A2KH 3GBNL 2H2SC 3U4BH 3HE6C 4ZSOE 4M62L 4WW2B 3DI3B 1O7SA 2H9GA 3BP7A 2R69H 2D7NA 3TN0B 1GHFL 1AR1D 4U33A 1MJ8H 3G5YA 1EO8H 2R29H 2J8OA 2VLRA 1A3RL 4HS8H 4YO0A 3HI6H 1VFBA 4GW1A 1KG0A 2CIKA 5SWSE 3X17A 4LK4A 4OFPA 1ORSA 1CQKA 2IMMA 5I18H 1A3QA 3DRQB 4GMSH 4NPYA 1RULL 4PJCB 4MXQC 2DOCA 1MNUH 2NXYC 5JNYB 4ZO7A 1UWEL 2F74B 2MFNA 4HJGB 4ZXBA 4R26L 3WKMH 5ILTH 1JK8A 5E99L 1VHPA 1BBJB 4E41D 3LRSA 3SCMA 2R9HC 2E9IA 3S37H 3OR6A 1KLFA 1I9JL 1V7ML 5I1GH 5D2NA 1IT9L 3JV5A 4HQQH 3HTLX 4H8WL 1XF2B 5J6HB 4RMWA 1ZLUK 1RUAL 1ZT7B 4IMKA 4UINL 2FATL 3SDCA 5CGYC 4OM1L 2P45B 3DUUB 1PG7W 3MACL 4JO2H 3H9HA 3KPLB 4OLWL 4PR5B 5GIRA 3BPLB 3UJIL 4DN4H 3ULUD 1S9YA 5BZWA 4OZGE 4XBEH 2DI8A 4EN3A 1JWSB 2ZUVA 3NABH 3OTTA 5CBAB 3ALWA 5K93A 4IDJH 3QO0A 1J9CT 4BH7A 3PWNA 5IGXL 4TPRH 3GK8L 5JHDB 5JW4Q 4G6KH 2F53B 3CFKA 1QLRB 4P9MH 4ELME 5C0AD 4ZSOB 2H3NA 4XP1H 2G75A 4GAJH 1FFOB 3X3FL 1G1YA 3GMMB 1CLYH 5C7XL 3DSFL 3RDTD 2BC4A 2X1XR 1WIUA 4QF1B 1NMBL 3GUTA 3KPQB 4KK9C 1QSZA 3BKCH 5EN2B 4ODXA 1FNFA 5T5FL 4E41E 4GQPH 1JL8A 1NCAH 5SWSB 4XPFL 2BVPB 1RHHB 2WV3A 5CD3B 3IS0X 1TCMA 1EMTL 4KVCH 3GSWA 4ORZC 1ZGLM 3RGHA 3L1OH 3JXAA 5IFAL 3RWFB 2YA0A 4ISVB 3BUYA 1S7WB 1KGCD 2AQ2A 5T1KD 3C8DA 2VDQL 5DJ0A 3ULUE 4PRNB 4P5TA 4YHZH 2CRIA 2MJWA 1OW0A 1SJHB 2IGFL 2J2ZA 3GI9L 2XQYK 5ID1B 5GS1A 4PGDA 4U1HB 2D4DA 3B9DA 1Q1JH 4NNYB 3NCJH 4ZUTA 2ICEB 5C09A 5MHSD 5EIIA 5C0AE 2EH8L 1UM6L 5HPMB 1JYNA 1FLTX 4TYUA 4L3AA 2J6EL 2WZPD 3QCTH 4KK6C 3BP4B 2IG2H 1C12A 4JDVB 1RZJL 4OZGB 4RX4D 2ZUXA 4NO2B 4QXTA 2BFVL 1P4BH 1T5XA 2M1KA 4ORGA 3ARRA 1KYOJ 3G5VB 3TBSB 5CINL 3W2DL 5I1IL 1J05A 1JNNL 5ABDE 1YEJL 2XXMB 4ELMB 2D2OA 4X5WB 5GGVY 3KYOA 4Q9QL 1WBYA 4YBLB 1KGCE 5HD8D 5BXFA 1U3JA 5FB8A 2FL5A 5DI8B 3DBXA 5ADPH 4MNQD 4HGKC 3RWDB 3BKJL 1MHCA 2GQHA 3QZWA 4FFVC 4F33B 5E5UB 4E41B 1RMFH 3T0WA 1C5CH 4OI9A 1ZA3B 3KPOB 5MHSE 2OJZH 4PRAA 1JZ3A 3VU2A 5JUEL 2DYPD 1S8DA 3BZDA 4OCRL 5I15H 4KZEL 3L3JA 4F8TA 2D31B 3S88L 1NMCC 5DLML 2R0WH 3V5HB 3SDYH 4JZJC 5GRXG 4I3SH 1UZ6E 5E8OB 4YQXH 5FDYA 1UCBH 5TH2A 5TFSH 1CTNA 4FTVA 1KPVA 3IDNA 5GGRA 5C0AB 1AE6H 4JN2A 3VG0H 1BQLL 1IQWH 3MLYL 4G6AC 1HILB 5L8KB 2HT3D 4I77H 4LARH 4WENB 4MNQE 3RDTB 4HD9A 3ILPB 3WFDH 1LO3L 3VDBA 3QULA 3WN5A 5E8DH 3ULUL 4NKDA 3TBYA 1INQA 2EC8A 4GUPB 4HFUL 2V7HB 1CS6A 3V6BR 1D6EB 5EULV 2IEPA 3RWHA 2HJKB 5D96C 5JIIA 4S1QH 3QPXL 3V4PL 3EDDA 4GRWE 1JPTL 1LDPL 5T1KB 3BJLA 5CHNB 3CUPB 4POUB 4JG1L 4FMFA 3P4OB 4IIQB 5D4QA 3QO1B 1MEXL 4KKAD 3QP3A 1JYWA 1C16B 1VERA 1NCWL 3TH4T 1NGYB 3MGAA 3DX7A 4GRMB 3EFFB 1QEWA 4YDLC 3T65B 3CFEA 2VB5A 3BEVB 1Q94A 5C86A 1MRFH 3IJHB 3ZL4H 3DUHA 4Y88A 4NQEA 1M71B 3VWJC 3E2HC 2XFXB 3RU8H 3HMXH 1U8HB 2K7PA 5HYEA 4YX2H 1B2WL 4MD0B 4LEOA 1QFWL 3CXHK 5EG6C 2Y6SC 1MCFA 2EIBA 5IMOB 5JO5A 4X9GA 4YHNB 5I1AA 3GSXB 4HT1H 1G7LB 2BSED 4HF5L 4MA7L 4Y2DD 1LDSA 1NSNH 1F45A 1B0RA 1JPGA 4XT1C 4JKMA 4UT9L 3P9MB 4MGXA 4MJID 4MNQB 5ISZA 1Y0LB 4LCCC 1RZ7L 2R8SL 2NR6C 5HI4D 3QUMB 5F7DA 3OF6A 1OB1A 5EOQL 4MDJA 3EHBD 2Z35A 2EDQA 1FDLL 4HZLB 4Z9KB 2DYPB 4GRWB 4GW4A 1U8MA 1M7IA 3CAFA 4KY1H 3UAJD 5IBTH 2EDYA 3TNMB 4NKMB 1ZXQA 2FJFA 3V4UH 5INDB 4XRCB 1MH5B 2ZUQC 4ENED 2EYRA 1NL0H 5GGQH 1OAZL 2BY0A 4NZTL 5E8PA 3ZT7A 5MEPB 1CFSA 2ICWI 3T0DA 3VE0B 4HH9B 1YEFL 3QUML 1EBAA 5K9JH 5DRWB 4Q7DA 4WCYH 5A2IH 1DBAH 1IRAY 5TDOA 4MJIE 3U7YH 2F8OA 1A3LL 2DQTH 5CJ8A 1B4RA 1ERNA 2EE6A 3OKNB 3P9LB 2FIRT 1FSKB 2W9EL 1DR9A 4I8DA 4U1MB 2R56H 4Y19D 4A6YA 2VABB 3NCEB 3LVEA 5F88B 1MELA 3ECBA 2ILLA 2NZ9D 3QDMD 5TQ0H 3TVMA 1NBYA 5B8CA 4OZIE 1KNOB 4G3YH 1LK3H 4J3OC 3FCTB 2BSTB 2SEBB 5FUZH 3EYSL 1SM3H 5J12C 5T5NG 3BGFB 4JREB 5KVEL 1HOCB 5HHMD 3UZVB 2CDFA 2NY2C 5D2LF 2D7OA 3QUYA 3ZLQC 2RCSL 4NBXB 1U3HC 2BVQB 4KRMB 1J1XH 5L2KE 2AGJH 3KJ4B 1N8ZA 4PJAA 4XPTH 3ARVA 4DUXA 1CICA 4KWUA 2Z93B 1UYWL 5DTFA 4HIIA 3TF7C 1CLOL 1I8LA 4P2RD 2IFFH 4PRHD 2HWZH 3MOBL 3SDDD 2DLTA 5IW3A 1GC1L 1RFDH 4G80B 1NUDA 4Z78A 4K7PL 5DSCA 3TEUA 5JOPD 4LSTH 4Y19E 4U6HB 4PY8I 4CKVX 1JNJA 4HJ0C 3U0PB 1JNLH 4ZAKD 2P47B 4Y5YC 2PR4H 3QDME 2Z31D 4Y2DB 3EBAA 2BVOA 3VXQB 2NXZD 2QTEA 4QYOB 2B1HH 4ZOAA 4DKEL 5KS9A 1YQVH 5DC4B 1JYVA 4MJIB 5I66B 1G7PB 1LO2H 4Y8DC 1T1WB 2VTFA 3U6RB 1N59B 4TSAL 4F7CB 3FT4B 1A7RL 5EZOH 3PHSA 1YY8B 5HHME 5F7EL 3V52H 4DGVL 5HHOA 5IW6A 2A73A 4H0GA 1A4JB 1J0HA 1KN2L 3W9DA 1RU9L 5DJZB 1LP9A 4XP6H 3G6DL 2HTLC 4M6OL 1YMMA 4CUCA 4OFYA 3GJEB 4WV1A 3RWJA 3CVHA 4PRHE 5F8RC 3MRMB 3R0NA 2XIDA 3MV7D 4X99A 3K3QA 2WQRA 5MI0C 2PYED 3S4SA 4HLZG 4NM4L 3QQ9D 5JOPE 4QXUL 4L1DA 4CMMA 1OSPL 4RQQB 1E4XI 1ZGLP 3FB7A 4R4ND 5J1AA 2CKNA 1HSBA 1FZMA 4JM4L 1H3PL 4YGVB 1TTFA 1KC5H 4XP9L 5LVEA 5HHQB 4GKSB 4YBQD 1YECL 3L95A 1E4JA 2Q8AL 5EBMB 4OCYL 1A6TA 2NY1C 1FPTL 3ZO0A 2VDPL 3ULVE 3VMPA 5KVFL 1W72A 5FYLE 2HKHH 4JFED 4BSWB 4X8JA 4Y19B 4LLQB 4TNVF 3QDMB 1QSVA 5J0BA 2AEPH 1MLCA 4L4VA 5TDNB 4BQCA 2O5XH 3TBWB 4GKNA 1R24A 5E2JA 5EO9B 2P7TB 2XXCB 3MNVA 4DQOH 5HHMB 2R2EB 3MV7E 2YKLL 1JBJA 5DUBB 4IRJA 1VFOA 4KJWC 2PYEE 1X4XA 1U95B 4WHYH 2X4TA 1D5IL 1IGTA 4O51A 3UROR 4YR6B 1FLRL 4LLDB 4HJJL 4ZD3H 4MNGE 4P3DA 3CXHJ 4N0CD 3NIFF 1B3JA 3DVFA 1F2QA 5JPMB 6FABH 2IANA 4IRZL 2IQAB 4P2RB 4PRHB 3WIIH 3SDDB 1BVLA 2EDOA 2VL4A 3EUUA 5HVWA 2OTPA 1NCDL 1G7HA 1C5DB 4EOWL 1LWRA 4JFEE 1YEHL 2XPGB 4U6XB 4OT1L 4ZAKB 4NQXA 3QI9A 4CVXA 2Z31B 4OGAD 3MXVL 3ARTA 2NXZB 1WAAA 3VXRA 4X83A 4KROC 3QIWC 2DIJA 2VXQL 4X98A 4JO4L 2R23A 2WWMD 5CIPH 4IOIB 4NYLA 4YXLH 1ZVYA 1ND0A 4XCNB 3N1FC 4RMQA 1JN6B 5IHZB 3L6FA 1RZJC 3WO4C 3V6OC 3BFOA 4XAKD 1AY1H 2BSRB 5IB5A 3R06B 5IM7B 1KFAH 4NRZB 3BRGC 3P40A 5JZ7C 4AL8L 4G6FD 5IJKA 2X4RA 3O9WD 4K7PY 4OCSH 3E6HA 1D5XA 2X4SA 2HLAA 1GXEA 2CMRH 1NJ9A 4BZ2L 1P7KB 3RWGA 3FFCE 3AREA 3ALPA 5J11C 3TA3C 5F6IC 2FGWH 4Z7VA 2BCKB 1RVFH 5EH1A 1NH6A 3MV7B 4HCRL 1AXTH 3B43A 4Q58C 1ACYL 2PYEB 1SYVB 2FR4B 2JCCA 1ZLVK 4Q6YA 3ULVL 1XT5A 1FIGH 3PUCA 3ISWA 3D0LA 4MNGB 1HQ4B 1MFNA 5FYLL 1VENA 2DLHA 3RGVC 5HHVH 3WDJA 3NFSL 1KXQE 5DC0A 4MD5B 3VH8B 3EYOA 1CD1A 3FO1B 3QQ3A 4XVSH 3ARBA 4HWBH 5IWLA 1HSAA 3EDJA 3NIDF 3QEUB 2ZUSA 2AABL 4JFEB 1RURL 4XAKE 5FO7A 4APQA 1U0QA 2ED9A 3PHOB 1MIMH 1I8KB 4JJHA 4RWHA 1VSCA 4R96A 1FNEA 1CK0H 2KQNA 5E1AB 3T8XA 5JW5B 3MGOA 1KIUA 3CMGA 2A1WL 2UWEA 2MKWA 3CJJA 3ZTJH 1XIWD 3L9RB 4UMGA 4PREB 1CG9B 1Q9WB 4A6YH 2NZIA 1QQDB 1CDYA 3L5IA 5JW4R 1YEGL 1LO0H 2NYYC 3E6FB 1WBXA 5FV1L 4PGBB 5DD6B 2M26A 5K9KA 3PWPA 4Y16C 3I3EA 3MFFA 1WCQA 3L3GA 1R5IB 4KKBD 4ZPTA 5BRZA 4J4PA 5GGUA 5DEFA 1TJGH 2D03L 1CGUA 1DQJA 2EECA 3LMJL 3CMOH 3J7HA 5DMJB 4IM8A 3EW3B 3NH7L 3VH8G 5KBNC 3H9ZA 1ZVHA 4JR9L 5FK9B 2G9HA 1JGEB 2Y07H 4S0SD 5FYJD 1I1AA 1SEBA 2BDNL 1KELL 5CSBA 2AJSL 2XICA 2YPVH 4JQVC 4O2FB 1F2XK 4JCMA 1CGTA 1RK0B 1EHAA 4Q74A 4U1IA 4NNXA 4KMTL 2BNRA 3CK0L 1PQZA 2HLFD 2APBA 3I6GA 1WF5A 5EIVA 1U92A 4Y0GA 1AGCA 4PBXA 4BH8B 4PV9B 3I3BA 3W39A 4PJ9D 3BWAA 2WANA 4H5SB 2PTTA 4HUMB 4KXZI 3GSVA 2AV1A 4KK8D 3FFDA 1YZZA 1VGEL 5KVDL 1JI2A 3U0TA 2BHUA 4QLRA 5IIEB 4M9PA 4NO5A 1EHLL 4NHCL 4U7KA 3Q6FB 5DJYB 3BN3B 2NW2A 4HUWB 5GSRB 3ZE1F 3S35L 4JFYB 1X5KA 2NY6C 3WL9B 3QPQC 4G6FB 1T89C 2GYSA 4E0RB 3O9WB 3KLAA 3CDFA 1F4YH 4X7FC 3HI5L 4QRPD 5FYJE 4OCNC 2VOTA 5IBUG 4CNIB 5BO1H 3TJHD 4MB3A 4AYFA 3AGVA 3QIUD 4UAOB 2O61B 1AQKH 1ES0B 4GSDH 4K8RH 4D0BB 3D69A 3B9KA 3B5GA 5T3XD 4MQ7A 2DJSA 3UDWA 1BFSA 5D2LE 1FG2B 1WFOA 3PV7A 1CIUA 2YZ1A 5I71B 5B4MC 4OSUL 5D6CB 3GJFB 2Q3AA 3DRTA 1F4WH 4KI1A 2F54D 4HHAA 5DJXB 4OF0A 1LVEA 5GRUL 1ROWA 4HIHB 2ZSVA 3SJVD 3FL7A 1J0YA 1UJ3B 2YPKA 3P4NB 4UIMA 4PLNC 1JV5B 1KTLA 4P5KB 1ZWIB 4IS6A 3RI5F 2A83B 4Q9RL 3F7PC 1IEAA 3P4MA 4WFED 1RUQH 1W72H 2VR9A 5I1JL 1XIWB 4JDZA 5INCB 4LQFH 1L7TL 3L5XH 1ZGLB 2GY7B 4QRPE 1YPZF 1DVFC 4N0UA 5ERWA 4IOFD 4DAGH 1U8NA 4W70A 5TDPB 1CE1H 1SBSL 3OKOB 4EDWL 2R1YA 2FX8L 3OKDA 4RA0C 2VZTA 5BVJB 2VLRD 1FL3A 1G0XA 4U1KB 5T3XE 3C9NB 2JJVA 4TNVK 2EDLA 4XMPH 5KSBA 3OB0H 4X80H 5MENA 4GQ9L 1CD0A 4H0IA 3DMMD 4AEHH 4LCIH 1DQLH 2B39A 5I1EH 1KUMA 3LEXA 2YRLA 1KB5A 3A67H 1NEZB 3N85H 1DN0A 5EDXA 1PX3A 3SJVE 3QNZB 1LE5A 5GRJH 5FA4A 3OKLA 1QSEA 1UQSA 4N0YL 5I1CL 4X6EB 1ZS8B 5D2LB 3CLEL 3VRJB 4XNQA 3DETC 4WFEE 5F44A 3V0WL 1ADQA 4LBEA 4L8DB 5JA8B 3TIDB 4PJ9B 4UQ2A 3WS6A 1IC5L 3ARFC 3VD3A 2D3VA 1J10A 4G6MH 4XCYA 1W0WA 3O2DA 3IETB 3MRKB 3PWLA 4WWID 5FYJL 1T0MA 5IHBA 5IFHH 2WQ8A 4D2NA 3DV6A 4LQ1A 1LEGA 3EYUH 2ADGB 3MLVH 1BM3H 1K85A 4G43A 1S5IH 4MWFA 2XRAH 2OQJB 3IXAA 1DBML 1N6QH 4GAGL 4KJQD 1IQDA 4YPGB 4QRPB 2HFGL 2BSSB 1FE8L 3BP6B 3PDOA 4N9GB 3T0BA 1XF5A 2VIRA 2NY4D 4U7SA 2EDJA 3QIUB 3JV4A 1TLKA 4N5EC 1NEZG 1K8IB 5C0ND 4HWNA 3MRPB 4FQ1H 3STBA 5HYIA 4XPAL 2Y36L 1I3GL 4YHMH 4PJAF 1MUJA 4DGIL 4I18C 4PBWD 2PTVA 5KW9L 4KJYB 3S34L 1IAIM 3OHXA 4UUJA 2GIYA 4Q0XL 4ZUWA 5IP4A 3WXVH 2W9DL 3B2VH 2B0SH 4NDMA 5FGCE 2F54B 4MDIA 4NWUH 4PUBH 5F1IA 3OKKA 1K6QL 2AKRA 3SJVB 1EEQA 5CZXD 4XMKH 3MRBA 4GFTB 3L5JA 2VXVL 5HDBF 4TUOA 2VAAA 1ZEAL 1DP0A 2MCPH 4KXZH 1S9WA 1BQUA 5T3XL 4FZEH 5A2LH 4O58L 3I6LD 5D1QA 1DLHB 3VFGL 4TVPD 4HDIB 4CN1A 1RZIA 5TF0A 1Q72L 5DO2D 3VG9C 1MY5A 3M1BA 3UJJH 3U2SB 3KYKH 1OPGH 2VLRB 3A6CL 3IDGB 1MJ7H 4JY4A 1LP9F 5C08D 2DWDA 4GW1B 3MOQA 4DGYL 1MRDL 2NY5L 5E2TL 4WTZA 1WWCA 3VGFA 4P2OC 1HE7A 4BQBA 1JNHA 4GOSA 5D93C 3DMMB 3W5MA 1X5ZA 4NC0B 4JPVH 9CGTA 4HIEB 1HCFX 2XY2A 5HGHB 3T2NH 2WWKO 3WMSA 3KR3H 1KPUA 3LPFA 1T4KB 5KN5A 3O2WL 3ARDC 4P3CL 3ULSA 3U36B 4J12A 4HBQA 1U36A 4UNVA 1PZ5B 3LRSB 4HPYH 2H8PB 1JGDA 4K55A 4AG4L 4FQLH 3EOYG 1PVHA 2Z4QB 3DYOA 3NCMA 3HCVB 5JORA 2A74B 3QIBA 1TQCB 4NQCA 3EGSA 4TVPE 4F3FA 1XGUB 2IALB 4N8VB 2Q7YB 3X3GL 4ZUVB 1KJ2B 1RIVL 4RRPA 1JHKL 2IAMC 5DT1L 1JUFA 2IBGA 4WFGD 2MPAH 3WJLA 3RVUD 3QO0B 3NIDE 1ZVSB 4Q6IC 5C08E 2LVEA 4B50A 4BH7B 3BQUD 4JM2A 4NUGL 4JO1H 2QQQA 5HYJA 4F7EB 1E6OH 1DE4A 2IBBA 1IEBA 3TIEB 4C54A 1WFTA 5KG9B 1QPXA 2H3NB 2YBRB 3SKNA 5I19L 2NY4B 4O4YL 4S1DC 5CZVH 1F97A 1YC8A 4YHOH 1R0AL 4X6CF 4NN7C 2E7LC 3O6FA 1BZQK 2DL9A 2GW5A 1KJ2L 3C6LA 3T4AA 2FYYA 4O5LH 2V5MA 4YUEL 3FQNA 1NGZB 4OLZL 4J7RA 1A14L 1SEQL 3KJ6H 1GOHA 4HXAL 3MMEB 4ZQKA 4PJ7E 5EBLA 1IAOA 3U4EB 3VXSE 2F19H 1RV6X 1PEWA 3P3YA 1U91A 3WNOA 5ECJE 1VPOH 1IL1A 3G9AB 4Q97A 3IF1A 4TTDC 1A7BA 2FHBA 4N8VG 1T7WA 4G7YL 1QNZL 2ATPA 2P49B 1W0VB 4JZNA 4X0KA 4WFGE 2W1NA 2YK1L 2VRAA 4FQCH 2DLIA 5ESAA 1WAAF 3BE1H 3GKZA 1MIEL 3ULVC 2XV6B 5IK3A 2AJZA 4MMXC 4TQEH 1RHFA 1FL6A 5F7LB 5IROC 1N5AB 4FQXD 1I9EA 5EBWA 2Y5TA 1UB6A 5GRVL 4NQED 1WIOA 1GOFA 1W8NA 3CFJB 4WI8A 2QLVB 2BOCB 4UIKH 4QXTB 3QH3A 4XVJL 3TZVC 3FRPG 4PG2A 3SO5A 1AGFB 5C08B 3QFDB 4HIJA 3ZDZE 1TVHA 4WGWB 5L88H 3TESA 1VEPA 2WUBH 4NO3B 3GBML 4S1RH 3LEVL 2ZCLL 1LEKB 1FAIL 2CDGB 3KYOB 3OAYK 5BW7C 2OYPA 2VLMD 1DBKH 1WUNT 2JCCF 1T2QH 4TVPL 2DQIL 1Z9MA 5I9QC 2F5AL 2XKUA 3OAZH 3UBXB 2AXFB 3TO4C 2NY3C 2EKJA 2EYTA 2OI9B 1KB5H 1AXSA 5CJOH 5CBEA 3GMRB 2EH7H 1KLGB 2J7LA 4QRSB 4PJ7B 2WUCH 4PRAB 3VXPA 4P0DA 4NO0D 1S7XA 4TSBH 1FC1A 3BVNA 4XXCC 3L3JB 4OCXH 2GJZB 3PJSA 5AYUH 1OT1A 1ADQH 4PTTB 4YZFE 5ALBH 1UB5B 3LDBC 3KWWB 2GFBA 1P1ZB 3BQUB 1T7XA 3MREA 4FQHA 3DVGA 3O2DH 5FKAA 5DHVH 2DD8H 4G8EA 4P4KC 4BYHA 4DVRH 3G6JA 3FO0L 4NC1E 1I85A 4XCEA 2WIIA 1UA6L 2PETA 4RAHA 1NCCL 4HV8A 2VDLL 3F12A 4P57A 5AD0A 3ZMRA 4KRPD 3QULB 1YPZE 3TBYB 5FDWA 3BGMA 3SY0B 3MJ6A 1LNUA 1E4WH 3BD4A 3BW9A 5T1LD 5CP3A 4M5YL 2NTFA 2AQ3A 3X13B 3DO3A 2LTQC 4PJXA 5IUSA 3U30C 1DSFH 1S78C 3O2VL 4ONGL 1TETL 1F00I 4JRXA 4LSUH 5TE6H 4F9LA 4LSSH 5HVGB 3QUYD 4ZPVB 1BP3B 1NBZB 2ITCB 4U1NA 1G7QB 4JLRA 3MR9A 3MODL 5H8DA 1QFOA 5BV7H 1MHPH 1J7VR 3AVEA 4PYGA 1Z6JT 1JF1B 2MQ3A 4R7DB 2VLKE 3U0WL 4FQXB 1Q94B 1M7DB 1NANH 3MZGB 2JJTA 3PGCB 5F1NB 3HB3D 4NQEB 4PB0H 5EO1A 3E8UL 1IBGH 3RWCB 2IBZY 3CDYA 5F96L 3QEQD 4GRLC 3WE6A 1ZLSH 4NQDA 1CD9B 3LKPB 4JZOA 3QWOA 2QSCL 5AZ2L 2EDEA 5IG7A 1MCRA 2O5ZH 4GMTL 4PJIF 3HR6A 1MVUA 5K33A 4UV4H 5I1LA 5FAAA 4C83B 1MQKL 4EQ2A 3VI3F 2NY0C 4WWKA 1DBJL 3D85A 3MC0A 3ELAT 5IF0B 3PL6A 1CVSC 5HY9A 3O45A 4PJ5A 1U8OA 5CEXA 4X6FB 4YWGL 1ZT1B 2PW1A 1YPZB 1FL5A 1AQDB 3HA0A 1MFEH 3QUZC 4FFZH 2VE6B 4L8SC 3N1GC 1U6AH 5I8OL 1I9RH 2DQFA 2UUDH 4NO0B 5C0CA 5D1XA 2OL3B 3N1PC 4AENA 3MV8A 2PO6A 4WEBL 4L8CB 2YEZB 5CFHA 3QEQE 4M7JL 1Q0XL 1FGVL 2EYRB 3QRFM 1FO0B 5E8PB 4K3JL 3MOAH 1OTSC 3QCUH 4KHXL 2KUTA 25C8H 3BKMH 4MHHI 1T83C 3DX9A 2OLDA 1MAMH 1WT5C 4U6YA 4Y5XC 5EOCL 4B7LA 3MUGB 2CK0L 1BF2A 4JDTH 5TDOB 3D0VA 3GHEL 5B3JE 2OL3L 4M6MH 4TRPH 4KRPB 5DD0L 4DK6A 2ORBL 3SE9L 4BFEA 2QV2A 5KJRL 3ZHLA 3DARA 1NGPH 5KSBF 5I6XB 3MLPA 4G7VH 4WDIA 5F1OB 5ITBH 3LN4A 5CJQL 2XZCH 3ECBB 5BVPL 1GIGL 5DMKA 1FO0L 3T2PA 1NBYB 4LPYA 4NZUL 4ZUSA 3MYZA 5T1LB 4PG9A 2AJUH 2J5LC 4FZ8L 3U7WL 2NCMA 5F9AC 3OB0K 5DFVC 2QBWA 5SX5H 1QR1A 3EOBA 2IPKA 5J57B 3F6LA 4PJEF 4NKIL 2QEJA 5B39B 4H25A 3QUYB 3VFSB 1BEYL 1JCKA 1TVBB 1F02I 2CK2A 4CADA 1SY6L 5ICYB 1DUZA 5KSUA 4PJAB 4U1LB 3DVNA 5ITFB 4OD3H 4PJ8A 1FN4B 1D9KA 1H5BC 3RVVD 3ZKND 4JHZA 3V95A 1A47A 1YJDL 5FKPB 3QEQB 1G9NH 3FKUS 5AWNL 1FJ1A 3RX8A 1BREA 4LLYB 5CD5D 3QHFH 7FABH 2MWCA 3G5ZA 3N9GL 4XNXH 3O6KH 1IC1A 3VFRB 3JVGC 1BVZA 4FABH 1AGEB 2OK0H 1K4CA 4NRXA 1P69B 3VXRD 4PRPA 4ZTPL 1BQHA 4UTAH 4DCQA 2UY7A 5AYQA 3AY4A 5GGTL 3GO1H 4I1NB 4LLWA 2GK0B 2V7NA 3QG6B 3U1SL 5B39G 3IXTA 3Q5OA 1F3RB 3BPOC 5DJ8B 4L3CA 4QOKA 1EJOL 1P4IL 4M48L 3O3BB 4X6CE 3S5LB 4DOHE 1DQMH 2FECI 2PYFB 4FP8L 1INEH 3QDGD 3ZKQD 3VJ6A 2NY5C 2IH1B 3IRZA 2BRRL 3RWJB 4K9EL 5GGSA 1FC2D 1E27B 3CVHB 3FB5A 4H0HB 1JFQH 3ZSSA 1UM4H 4N1HB 1II4E 5IVOA 4ALAL 2DIAA 2QADD 3BZ4B 2DS4A 5KAQG 4RISL 3LV3B 5ACMA 3S4SB 2EXYD 4ZNEE 4LVHB 4OKVA 4R0LC 3KLSA 3MUZ1 3QWRA 4RSVA 5J3HD 2YD9A 4JFPB 3IU3A 3FB7B 2NNAA 5D5MA 3RVXC 2JK5B 1C5BH 1EBPA 4NN5B 1HYSD 2BY1A 3ALXA 4DUWA 3THMH 2J4WH 5ADOL 5J89A 1BZ7A 4C56A 1F11A 2J88H 1GOGA 5HGDA 1W2KT 4M43H 4AIZA 2JJSC 2O26U 1Y18B 2FX7L 3HLAB 3PABB 3T1FB 1AHWA 1N4XH 2Z91A 2DN7A 4GXVL 3T0XA 4DTGL 3S5LG 3VRIA 4FG6C 3I02A 5D7LA 1NDGA 2PW2B 2ZP0T 3QDGE 1L9NA 3QRGH 5CWSA 5D6DC 5GS2H 3JV6B 4UTBH 1YN7A 2VH5H 4X9FA 1DANU 3ARGD 1Q9KA 3PGFH 5E1HB 3MJ9A 2ZKHL 4PV8B 3T3PF 3HZKA 4PY7A 4M7LT 2C4XA 2JCCE 5C0FA 1IKNA 4KI5C 4X6CB 5L7XH 4DOHB 4P3DB 1U8IA 5DC9B 1KOAA 3PWUA 2DBJA 3JWDC 3KHQA 1P4LA 4EI6B 2CDEB 5JXEC 3O4LA 1SBBA 1UM5H 3HKFA 1I1YB 1MCWM 4ODUB 4UOJA 3K2UH 3TT1L 4I0PC 1T04B 4OM0L 4JO3H 2RB8A 2IPUK 4Q2ZA 3VXRB 3CSYA 4LL9A 1JPSH 4ZFOB 3UMTA 3QNYA 2WW8A 5EU4B 2UYLB 2Y06H 3VFTA 4J8RB 4OLVH 4N0FA 5FCUH 4PRBA 1UXWB 4ETQA 3RBGA 4ZO8A 1TZGH 1N0XL 2M8XA 1OAQL 2VDNL 3C09B 2HN7A 3O4OB 1T66C 3MBXL 3O11A 4BFIA 4PJBA 3GRWH 4TOYL 2IPTL 5DRNA 4XI5D 3QDGB 2WBJC 3W11C 4Z7UF 1DUYA 3STZA 5E6IA 3NACL 1MF2H 2HVJA 5F7NC 5IESH 1H8OA 3P77A 4LIQH 4NSKA 1WCBB 3WFBH 5D1ZD 3DX8A 3O3AA 2QADB 4ZFOL 2HT4C 3W81A 2V5RA 1CN4A 4JEGB 4U6VL 5FECA 1HHGA 2JCCB 1A2YA 2YHGA 3AAZB 3KLHD 3B9KD 4X6DF 1VEMA 3D0LB 3MNWA 15C8H 3I6KA 1KV3A 2VQTA 1CD1B 4NQVA 4P46C 4U6TA 1FZKA 3LKNB 4KUZL 1HXYB 1A4KB 1HSAB 4F58L 4F57H 4LU5L 3L7FA 3WLWD 1F4HA 1T3FB 3MA7A 4TUKH 2NLJA 4JQXC 4KPHH 4LCCA 2ADFH 1A02N 1TDQA 1U9KA 3EYQD 4XWGL 4EUPG 3A6OA 5JW4M 4Y1AA 1RIUL 2P8MA 2ED7A 5D72H 4JKPH 3JWNC 3U4AA 3K4DA 1P53A 3LAFA 1MWAH 2XKNA 3BN9C 3ARWA 3ARGB 2OSLB 1Q8MA 2B2XL 2GTZA 2YD6A 4PJIE 1YYMH 1HH9A 5LG1A 3SDXE 4F8QA 5HI5D 3C5JA 3S3SA 1WBXB 4DFIA 3RVWC 2FO4B 1XCTB 3HPJB 4P9HC 5GGUB 4J6RH 2GSIA 3SDAA 3MYJA 5SWQA 1MFAL 3HZYB 1QFUH 1S7TA 4LPTA 1S9VB 3EYVB 1QD0A 1Q0YH 3JWOL 5EUKA 3UTQA 5C0JB 4H1LA 3P30H 3CZJA 3FJTA 4POZC 1IAIL 4MLSA 1JHTB 5JIHA 5T3ZH 1YEIH 1JWUB 4DUVA 4WHCA 5AZEH 4JY5H 5SX4I 4RFNB 4B5EA 3V8CA 2CGRH 5FF6A 1FORH 5FA3A 3RX7A 3LHPH 2LQRA 4YNYA 4PBVC 3C5ZC 2DQCL 3BO8B 5DR5L 2H2PD 4M61B 3NVQA 2ZG3A 2PTTB 4LSVH 2YD8A 3FRUB 4G9DB 5I8EB 5L6YL 3CIQA 4RAUB 4XGZA 3UPCA 3MXWH 4Z0BH 3U46A 1F58L 1F3DJ 3UCRA 4Y4FD 3V4VL 4QTIL 2NX5D 4PS4L 4XHJC 1T1YA 3UTZA 4NIKB 2MTPA 2HJLB 3DXAA 4HK0B 3RL1A 2DL2A 5ACLA 4PJXF 1PLGL 4TULL 5EOTA 1IGJB 5IQ9A 1WISA 3SE4C 4PJIB 2VZUA 5D1ZB 1J11A 3SDXB 4AM0B 3K81A 3OX8B 2ENYA 4WO4A 5D7IA 5DJDB 4UZGA 3RTQC 3FMGH 3PDGA 2QQKH 3D69B 3B9KB 4MVBC 4LVOB 4KJPD 1OTUC 4PJEE 4MQ7B 5L9DL 3RUGF 1BX2B 1BJ1H 5LCVH 5FHBL 5DZLA 2P8LB 4LCWA 4RGOH 5ICZA 2B5IB 1CFQA 1IGCH 2I60L 4LASL 4ZO9A 1CGYA 3SE3C 3UJTH 4PJDA 3DLQR 1A6AA 3C60C 4Y4HC 2GCYB 2CJUH 2X1PA 1IM9D 2E7BA 3LRHA 2XN9D 2NX5E 2FX9H 4HUXA 1ONQB 3O8XA 2VKWA 1RJZA 1HI6A 5IB4A 1TNMA 1A0QH 2AK1H 5FYKU 1OAYL 5D1QD 1UVQA 4M7LL 1CGSH 1BZ9B 4QTHA 4X5XA 1YY9D 3U4BL 1ITCA 2I24N 3MLTB 1XZ0A 2R69L 2Q86A 3KYMB 1ZLWH 1X5YA 4WW2A 4OB5H 3EZ8A 2XTJD 4PGEA 2E5EA 1EO8L 3DV4B 4U2YA 3E3QC 3NGBC 3LH2H 3TN0A 1KSRA 3GI8H 3IAQA 3KPPB 1T1ZB 3HI6L 2X41A 4E42B 2OMNA 4K7PX 3CXDH 5I18L 1IFHH 3QWQB 5A43C 2ZWLT 4GMSL 4RBPK 2WK2A 3TPUB 3DRQA 4LF3B 2BERA 5FA4B 5E8NB 1I7TA 4M1GL 4PJEB 2VQ1B 4PJCA 3VWKC 3WKML 2XN9E 2XWBA 3RRQA 5JNYA 1OTTC 2F74A 4HJGA 5F89B 2ZUWA 5EU7E 4LBEB 1YUHB 3V6FB 4R2GC 3S37L 4UQ2B 3WD5H 5I1GL 2Q8BL 1P84J 5IBLD 1BBJA 3KPSD 2YR3A 4NQCD 2A77H 4L3ED 3KGRA 1XF2A 2EE3A 4FS0A 4GLRH 5J7CC 1MFBL 3CVIL 1ZT7A 1HNFA 1SJXA 1YJDC 1NDMB 4NUJB 3DUUA 4Y4FB 2XTJE 4XBEL 2NX5B 4PR5A 2EICA 3FO9B 1NLDH 3NABL 3TH2T 1RZGA 3H3PH 4FFWC 4IDJL 5HYJD 4MWFB 3IXAB 3NZ8B 4XWOD 4OFDA 1JWSA 1OWWA 5ANME 5CBAA 1MCPH 3NIGE 2CR3A 3PDOB 4FQIH 3AS3A 1JJUA 1NGWA 1QOKA 3EKCA 1XF5B 4P9ML 2DBLH 1R6VA 3QHZH 2PXYC 2C9AA 3KG5A 5JHDA 1T22A 4XP1L 2F53A 1SJVA 1QLRA 2HH0H 4QWWD 4ZSOA 3T09A 2GI7A 1CGWA 4EI5C 4K3GA 2XT1B 3RNKB 1NBVH 3CPLB 4K3EH 1Q9LB 1IKFH 2EDXA 3GMMA 4GG6E 3T3PE 5JOFB 4QF1A 3OHXB 3KPQA 5DUMH 1S7SB 5EN2A 2B20A 3CZFB 1IC4H 3KPSE 1N3NB 5LGHL 4KVCL 4NDMB 4J23A 4JAMB 2VDOL 5SWSA 4L3EE 3L1OL 3ES6B 1J1PH 1KIPB 5CD3A 2J6EA 3SKOB 1FVEB 3BH8B 1IM9B 3UXFA 3T0ED 1PG7H 3RWFA 4ISVA 3RWEA 1DBBH 3WBDA 1I4FB 1S7WA 2XN9B 5C71A 3MRBB 4U1GC 3B2UD 4OQTH 3FZUC 4NQSB 1U3YA 4G42B 1SJHA 1YEKL 4EDXB 1X6LA 1Q1JL 3GM8A 4JB9L 5D1QB 5SV3A 5ID1A 2X9WA 3VW3H 2JJWA 3GMOB 4XPGH 4DW2L 4NNYA 2ICEA 4WI9A 4Y8AA 5HPMA 2VDMH 4JY4B 2XTJB 2MQCA 3BP4A 1RD6A 2DWDB 3DYMA 4JDVA 1T20A 1TJHH 2HRPH 4OZGA 4W6XB 4WI6A 3VFVB 5MERB 4DJMA 4AIOA 4CN6A 4NO2A 1AO7A 2MHAB 3AM8A 3BDXA 3G5VA 2VDRH 3S36H 4P5MB 3VA6A 3RA7L 3QNXB 3SQOL 4Z7UE 3UTPD 3UPAA 4JFZH 4ELMA 4OTXL 2DQUH 4X5WA 3T0EE 5D5MF 5E2WH 5ADPL 2DLFL 1A7PL 4H1LH 3CFCH 4GG6B 3R8BB 3LCYA 3RZCC 4M6NH 1C5CL 1I3RA 3KPSB 1XEDA 4X6DE 4F33A 4PJFE 4E41A 4U0RC 2OJZL 1ZTXL 4JREC 4L3EB 4NQCB 2FO1A 1L0YA 1ZA3A 1GGBL 3QAZB 1HCVA 2KL6A 1JUFB 3K8LA 3UTSE 2R0WL 1FVCB 1W0YT 3BEWB 3SDYL 1ZSDB 4XNZB 2D31A 4PGZA 4OJFL 4JGJA 4RMTA 3V5HA 4P49A 3QG7H 4NWTH 4UT6H 5T33H 2B1AL 5HYJB 3QQ4A 1IEBB 3D25B 5DK2B 4LRNH 1J0IA 1VADB 2IQ9H 3SO3B 3O6MH 4GBXD 5FUCC 3BD5A 5CSGA 2X2YA 3LIZH 3VG0L 4LLUB 1N2RB 3UTPE 4J3TA 1RK1B 4LLMB 3RY6A 1IQWL 3EJZD 4CGTA 3LKRB 5KSVB 4S2SB 3PWJA 1NLBH 1TQBB 5C0AA 1TPXB 4LARL 4GAYB 3WFDL 5E8DL 3AMLA 5HHXL 1UWGH 3RDTA 2P24B 1JTPA 3ILPA 5EBLB 1HZHH 3M8OL 5F21B 4M6AA 1DL7L 3I50L 3TP4A 3ZHDA 2CUMA 1A6UL 4GUPA 4D9RD 1U8PB 2V7HA 4QRTB 5GGVH 1IL1B 5HDOA 4Z7NE 4Z7UB 1ZAGA 2HJKA 1F8TH 3S98A 2FD6L 2B4CH 4JZNB 3T0EB 1T2XA 2A9NH 1MREL 3P11H 2COQA 5T1KA 3GBNH 1RJLB 4BUHA 3FHQA 4F7TB 3P4OA 4IIQA 2AJZB 3QO1A 1FL6B 4WI2A 4X6DB 1UKTA 4CW1B 1R3IH 1NGYA 3LB6C 1A3RH 4GRMA 1YDPA 3EFFA 3WKNA 1MRFL 4OUUB 4PJBF 3T65A 1J18A 1ZHKB 5DQ9B 3ME0A 3BEVA 4P59H 3LZFH 1KXVC 3IJHA 1GZQB 4HAFA 4YX2L 1M71A 2EXWD 1S7RB 4RX4A 2XFXA 4KFZC 2N56A 3CFDB 1UWEH 1OQOA 2EDBA 5DD5H 5EIQA 3FN3A 4MD0A 2FNBA 3EJYC 4HT1L 4D9RE 1J0ZA 5IMOA 5HDQL 4LGPB 1NAKH 4YHNA 4RIRB 4DEPB 1NSNL 3GSXA 3PL6D 1I9JH 1G7LA 1V7MH 1BJ8A 1NFIB 1EGJH 1IT9H 4PJ5D 4EZMA 2JKXA 3D5OF 5E6ZA 4UINH 4GT7A 1AXSB 5DWUH 3P9MA 1F3JB 3AB0B 3MACH 4MNQA 3UJIH 4MSWA 5F72S 5DHYB 1G9MC 1Y0LA 4MX7A 2WBKA 5C0CD 1QR4A 3QUMA 5D1XD 4R97B 3BVNB 4QKXB 2H2SD 3RUGE 3HE6D 3MV8D 2O93L 3JWOC 3SPVB 5IGXH 1OAKL 3K1KC 3L3KB 5IJVB 4KK5C 3W82A 2EIZB 1NUNB 3TFKC 4LVEA 1FCGA 3V4UL 2W0KA 3TNMA 4LNRB 2Q20A 1NL0L 1OL0A 5KSAC 4G8EB 4NKMA 1IGYB 3X3FH 1K5NB 2JIXD 5INDA 3DSFH 2ZOLB 1MH5A 4GBXB 1NCBL 1NMBH 2X4UB 1GL4B 3FT3B 1CDHA 4ONHA 5CJ5A 5MEPA 4MXQD 1MVFA 2NXYD 4HH9A 4XPFH 1DBAL 5DRWA 3SBWA 2H6PB 3BGMB 1JRHI 5DVKA 5IFAH 2JB5H 4M00A 1TTUA 2R9HD 2CR6A 4P9HH 3WUWB 5J13B 5IVXE 2VDQH 4LOUC 4YFLI 2R56L 3OKNA 3P9LA 4N68A 1MCHA 3ZT6A 2CXKA 5C0CE 7CGTA 5E2VL 5TQ0L 1VA9A 5CGYD 3MLSL 3GNMH 2VABA 5F88A 4G3YL 3BPNB 5F6HJ 1KNOA 4KTDL 5EC1B 2EH8H 2ZOKB 3FCTA 1UM6H 4W4OA 2J6EH 2SEBA 3WUZA 3MR9B 4XNUL 3MNZA 4LAQL 5F93C 2R4RH 1HOCA 3FN0L 4Z7QF 2W9LA 3RUGB 1I9IL 5F7MC 3BOVA 4XPBH 1OSZB 4XPTL 5ELIA 4KC3B 4G6JH 2BVQA 5CINH 5I1IH 1N7MH 1YNLL 2IFFL 1JNNH 4MA1B 1YEJH 4FNLL 1GCFA 2Z93A 4NP4L 4KK9D 3ARQA 4Z95H 2D7MA 2A0LC 2CKBB 4P48A 1WICA 4Q9QH 4WUUD 1BWWA 4I18A 3WUWG 4G80A 1MVUB 2BK8A 3GSRB 4LSTL 5I76A 4YBQC 1J8KA 2MNUA 5I1LB 3BKJH 1JNLL 5DRXB 4ODVL 1YQ2A 4U6HA 3U0PA 3PL6B 2UZYB 3D39D 2B1HL 4PJ5B 4L1HA 1YQVL 5CEXB 3DUSB 4Y2DA 3VXQA 1QA9B 3F7RA 4F15B 4QYOA 1JGLL 1OQXA 5I1DB 5EZOL 4QOKD 4MJIA 3GSQA 5I66A 1G7PA 3V52L 4MXWH 4KZEH 3U6RA 1N59A 4F7CA 3FT4A 1RJYB 2CKBL 5DLMH 1YY8A 2OTWB 5C0CB 5D1XB 3LS4L 3HE6B 5JQ6L 3MV8B 4XP6L 4KK6D 5M94B 3OXSB 3QJHB 3O0RH 3DX6B 4JE4B 5DJZA 3WHXB 4WFFD 4E9LA 4OZIA 4U3HA 3QWRD 2GT9B 2BNQD 4WUUE 3MLYH 3MRMA 4O9HH 2B7DT 2JIXB 1TENA 1I7ZB 1U8QB 3ULUH 4HUNB 1ZLUH 2Z0BA 2NXYB 4RQQA 5K59E 1OHQA 4Z77A 4HFUH 4WW2F 2FBOJ 3D39E 4YPJA 5IT2L 3K4AA 5L2KA 5CEYB 4YGVA 4FQ2H 3V4PH 4GKSA 1JPTH 3LN4B 1G9EA 2WINB 5DMKB 4JG1H 5F3BB 2V5TA 2Y7QA 4ZUSB 1FVDB 1NKRA 4BSWA 4Y19A 1NCWH 1S7UB 4HEME 1IAMA 1FNAA 5DJAB 4NJ9H 3QDMA 2ICWB 1EAPA 2EDWA 4WFFE 2O5XL 3B8YA 4Z7OF 5FCSH 4KTYA 4DQOL 2BNQE 3TBWA 3VA2C 5EO9A 1Q38A 1EV2E 2D0FA 3RNQB 2A9ML 1G0DA 5DK3A 2R2EA 3MRJA 5DUBA 3WS3B 4V2CB 2R0LL 1U95A 4ZD3L 1B2WH 1PEZA 2OP4H 4B41A 2HMIC 1QFWH 1T7ZA 4G6AD 4LLDA 2VZ1A 1GAFH 5CIPB 4LKXB 3JBG7 1JGVH 1TCRB 5HJ3A 5HYQB 4HF5H 4MA7H 4WHYG 3A6BH 2IQAA 3HE7C 4PRHA 4WUUB 4UT9H 3G5ZB 4Z6AT 1INDL 1NGXB 2XPGA 4U6XA 4JCLA 4TNWF 4ZAKA 4BZYA 1JRHH 3D39B 5CUSH 1C08B 5FOJA 3UYOD 1UACL 1MHHA 1FDLH 1EHXA 3JV0A 4HCRA 5CAYB 4QOKB 3LEYL 2FHCA 1NC2D 5M7QA 1AY1L 4NCC1 4QRUA 1OGTB 4XCNA 5IHZA 1JN6A 3LSOB 4PRDA 1KFAL 2D0HA 1WFNA 3NCBB 2E6QA 2BSRA 3R06A 5IM7A 1OAZH 1GPOH 2A6IA 4NRZA 3ZSTA 4F2MB 3O6LH 3VWJD 2W60B 5GRYA 5C9KA 4BZ1L 1BFTA 3QUMH 1MCIA 2FGWL 1KACB 1RVFL 2BNQB 3MRHB 1P7KA 1HHHB 5DA4A 1AXTL 2Y6SD 4CJ1A 1BAFL 4L9LC 2BCKA 2VWEC 3MV7A 1KCKA 3MLZL 1MJJA 4M8QB 1JIBA 2PYEA 2QJDA 1SYVA 2FR4A 3BWUC 2YA2A 2W9EH 4KDTA 1BZ7B 5HHVL 3ZKXC 4WUKL 4MNGA 1HQ4A 1UZ8B 3X11B 4XVSL 4HWBL 2QQNL 2ZCKL 2ICWJ 3CD4A 4TSCH 5EC2B 2AEQL 3VH8A 2PNDA 3FO1A 2C3VA 2NR6D 2IBZX 3QUXC 1AHWB 3EYFA 5DQJB 4JGMA 1J8HD 1MFDL 3TYGL 3FQXB 5I1HL 4QY8B 1MIML 4X4YA 5CWSB 3QEUA 4Z0XB 3AS2A 2G2RB 4JFEA 3BUTA 1OLZA 4KK8C 4MJ4A 1IMHC 3PHOA 1I8KA 2RCSH 2P5ED 2FSEB 1NMCB 3Q1SH 4JVPA 3JSSA 4JZJB 3P73B 5C0GB 3QXUA 3D18B 3QQNA 5E1AA 5D7JC 2DI9A 1LO0L 3Q5YA 1BLNB 3L9RA 5ACZA 3E1F1 4PREA 1CG9A 5C0FB 1Q9WA 1XF4B 1OP3K 1UYWH 3VXME 1Z5LB 1XR9B 3WJJA 4FQQB 2BVYA 4UBDC 4ZS6C 3E6FA 3MOBH 4OV5B 4P4KA 5DD6A 4G8GD 3TYFA 1U8IB 4AH2B 3EFDH 1TJGL 2ZZUT 1MI5D 3WXWL 3FTGB 3ZTJG 4K7PH 1S9XB 2Q3ZA 3CMOL 4M8VA 1T1XB 2YZ8A 1FBIL 4CRPA 2EEBA 3H9SD 3I2CL 4U49A 4Y4KC 4URTB 4NNPH 4OLXL 3VDCA 1K2DB 2YPVL 3FFCA 4R4BB 1E4XL 5FK9A 1J8HE 1JGEA 1P2CB 4XNMB 4XXDB 1XGYH 4DKEH 4E5XB 4J3XA 5GHWH 3BDBA 4ZDHA 1U3ZA 5D96B 4O2FA 4XC3H 1A5FH 1RK0A 3WNNA 3CSYB 1A7RH 1QG3A 4P2QD 5F7EH 3QNYB 2CD0A 3IDXL 2P5EE 4UILL 1LO4H 4ETQB 3HR5B 4R8WL 2GSGB 5FEBA 1FRGL 4BH8A 1RU9H 3PWVA 4PV9A 2F8VA 2NY2D 1NC2B 4H5SA 1U3HD 2H32H 5IIEA 5M95B 4YDLB 2CO6B 4G8GE 3N1QC 3Q6FA 1MI5E 5TPWH 4MCZB 1QBBA 5DJYA 3P77B 3CX5K 4HUWA 5GSRA 2B8OT 1T0NB 4QXUH 3VWJB 3WL9A 3RX5A 3WIHH 3E2HB 4BM7A 3ILQC 1OSPH 5GPRA 4E0RA 3H9SE 1K4DB 4MNHB 4NN6C 5FECB 3NMEA 5J6GB 2AEIT 4XP9H 1FNSL 4CNIA 4HJ0D 1YECH 1AQKL 4F7MA 3I6KB 4OCYH 2VDPH 4P2QE 3BKYL 3UYRH 1ES0A 5KVFH 4ZXBC 3AC0A 4RMSA 4QRQB 4P2YA 2ITDB 3MA7B 1FG2A 1DFBH 4X6BB 5L0QC 4LCCB 3SCMC 4G8FB 1VACB 5D6CA 3GJFA 1UZ6F 5D2NC 1CXFA 1J8HB 4XP4H 1UENA 4GXUM 1LEIB 5GZNC 4IMKC 3ARYA 3SDCC 4CU8A 4HIHA 2DQJL 3WDIA 3P4NA 2HTLD 1JV5A 3LS5H 4P5KA 2P5EB 1JZ4A 1ZWIA 1RUQL 1D5IH 2AJ3B 4HC1L 2A83A 2HG5B 4EN3C 1FLRH 5CMAA 4LQFL 3L5XL 4EVNB 4U3XA 4HJJH 4IJ3C 1XIWA 1U58B 4K94C 4QEGA 1ZGLA 2CIIB 4MAYC 5F9OH 1WC7B 3N06B 4IRZH 5SWQB 1EIBA 3NPZB 2HYMA 2RBLA 4G8GB 4JG0H 5TDPA 3FQUB 3KS0J 3OKOA 1NCDH 1UXSB 1MI5B 2KDGA 2X1OA 3F58H 4I2XE 4S10A 5BVJA 4XMPL 4ODSH 4X80L 2A6DB 4EOWH 4U1KA 1L0XA 3B3IB 4GRWF 4DWHA 1LD9B 3C9NA 3H9SB 3SE8L 1DQLL 4OFIA 5T5NF 2NY1D 1UH3A 3QA3B 3MXVH 2ADIA 3A67L 5IEKB 1CXLA 2XWJA 5D7KD 2AVGA 1NEZA 2DTML 5DGQA 4JO4H 1V05A 3QNZA 5TJWK 5IVNA 4P2QB 4FHBD 3MV01 2EIEA 5JLZB 4P5TC 4LPUA 4JRYD 4X6EA 3GSUB 1ZS8A 3DTXB 2P46B 1OW0C 4U05A 5D2LA 5J12B 4LFHD 3VRJA 5CZXC 2VQUA 4L8DA 4YDVB 3TIDA 4AL8H 4G6ML 1T5WA 4PJ9A 2NY2B 3U46B 5GS1C 4KJWD 3VFWB 1U3HB 2F5BH 4BZ2H 3MGTB 1K3IA 2FEDC 5IFHL 4P4RB 1FFRA 3IETA 3CH8A 3EYUL 3GEWB 4NBZB 5EOTB 5IQ9B 1J5OL 1ACYH 2XRAL 3HAEB 3GZKA 1E6JL 5HYFA 4HKJB 3IJYA 4TNWK 2EEDA 2OQJA 5DRZB 2D0GA 4ONFH 4M9OA 3NFSH 3AMKA 4YPGA 4QRPA 5T1DL 3BP6A 4N9GA 5D7KE 3BIKB 3LQMA 3QIUA 3B8SA 4Y5YB 4Z7OE 4YHML 3CU1A 2YXFA 3V5DB 4HIXH 4I2XB 4OD2B 4HUVA 1NAMB 5C92A 43CAB 3MRPA 4LSRH 12E8H 3QB7C 4HK3N 1RURH 1KJMB 4JRYE 4KROD 3QIWD 1MCKA 2MOVA 5DS8A 6CGTA 1PAMA 4KJYA 1F42A 1ZA6B 2YUVA 3EZJB 4RMUA 1KBGH 5A2JH 4NWUL 4PUBL 3NPSC 1S5HA 4YLQT 1SHMA 2H26B 4BSJA 3MLRH 1I7RB 4XVTL 3SJVA 5JZ7D 1YEGH 1HI6B 2KKQA 4XMKL 5DD3L 3BRDA 4EXKA 4ZFFB 3PP3H 2I27N 2Q76A 5JMOC 3HUJF 4QTHB 3HAEG 2X4OB 1NAML 5F7UA 3TA3D 3H7BB 3MA9L 1QACA 2W0LA 2UY6A 1X7QB 2VUYA 2VDKH 5HI3C 2Q86B 5MI0B 1QZ1A 1CDBA 2R2HB 3BIAX 4KTEL 1DLHA 2JJUA 4PGEB 1A6ZB 4HDIA 1OPGL 4JR9H 1MJ7L 4H26A 3AU1B 1NKOA 3RGVD 1KELH 3U2SA 2AJSH 3IDYC 1AO7D 3IDGA 1AP2B 1AR2A 4OZIF 3L7EB 4WY7H 5ENWA 3CK0H 3EIFA 3WN5C 4JPVL 4HX1B 2NY1B 2FH6A 2QHLA 4LLAA 3KR3L 3DMMA 3K8KA 4J3UA 1N0LA 1KCVL 1I7TB 3V6OE 4HIEA 5HGHA 1WBZB 4D8PB 2XA8H 2XWBB 1CXIA 2KBGA 1T4KA 1E28B 3U36A 4HPYL 1VGEH 3MRCA 4M3JA 5KVDH 4YXKH 2V17H 1D5MB 2OXHA 4N8PA 4NHCH 1PZ5A 2H8PA 4JRYB 4GS7C 4LEXH 5F1KC 3S35H 2Z4QA 2AXGB 4YE4H 1OM3H 4EBQL 3CX5J 1JI1A 3HCVA 3UTTD 2V9QA 4Y16D 2A74A 3REVB 2JTDA 1MFCL 2J1KA 1XGUA 2IALA 1RZGB 2Q7YA 4N8VA 1MQ8A 5DK0B 1OP5K 4ZUVA 1KJ2A 4RDQF 1FH5L 2FRGP 4JO1L 1AO7E 3VMNA 4ELKA 1O5DT 1ZVSA 3FT2A 1NGWB 3F6IA 5T1MA 4AMKH 5IQ7L 4HWUA 4F7EA 4OKDA 1T22B 4FFYL 3TIEA 2XZAH 5CZVL 4X9BA 5KG9A 1A6WL 5LAXA 2YBRA 4OSUH 3WFHB 1U2HA 2YUZA 3SGEI 5BOZG 5I74C 5GRUH 3FRPA 3K1DA 4O5LL 1XR8A 3HS0B 1T21B 3WHE0 4KROB 3QIWB 5GJSH 1WV7T 2DM7A 4JFHD 4LGSB 1NGZA 1I8IA 5C0DB 1H3VA 4LFHG 3C2SA 3MMEA 3U4EA 3WO4B 3RWEB 3UTTE 5CKAA 1MLBB 35C8L 1OCWL 4G5ZH 4XAWH 1ZLVH 2NY6D 1D6VH 3QPQD 4JY6B 4FQCL 1W0VA 3C5SA 1MCOH 1VFUA 1SBSH 3K74B 1CYGA 2FX8H 4NZRL 4TQEL 3T3ME 1RIHH 5J11B 5DVLA 3TA3B 5F6IB 3V5KB 1AH1A 3ZE0F 1JZ8A 2D9CA 3MCKA 1PX4A 4Z8FL 4LPXA 4RFOH 3BP5B 1N5AA 3ULVF 3DNKA 4D9LH 1JPFB 3QJFB 3KVQA 3QUKB 1EFXD 1T20B 3CFJA 3RGVB 4QRRD 3C08L 1AO7B 2BOCA 2BJML 1PW3A 2EE9A 4V1DD 5L88L 5B4MD 1AGFA 2WUBL 3QFDA 5C08A 1DANT 5EU5B 4JFHE 2H1PH 4LLVA 5I1CH 4C59B 4NO3A 4XZUA 1LEKA 1WVZA 5F1SA 2CDGA 5F71A 3DGGB 3U48A 4XCFL 3HFMH 1T2QL 5IHLB 2CLVB 1IC5H 3TVMC 1R3HB 5B8CC 3NFPB 1AIFB 1EO7A 1I3RB 3FQWB 3L3IB 4PLOB 2EH7L 3UBXA 2AXFA 5TQ2L 1CIDA 1F90L 2WUCL 2N7BA 3BD3A 2CRMA 2QQLL 1DVFD 2IWGA 3GMRA 4N5UA 3CH1B 5DXWA 5FFLA 4TSBL 3WSQH 1KLGA 4QRSA 4PJ7A 3VXSA 4OCXL 3O3DA 3TWCH 5FXCH 1U8LB 1DBMH 4Y16B 3UTTB 3DECA 2DQHH 3D9AH 4NZJA 5A16A 5E94B 4KRNA 2GJZA 2HFGH 4S1SH 1FE8H 4PTTA 1CICC 3QXDB 3QQ4B 2ZCHL 1UB5A 3I9GH 4QRRE 4V1DE 1I8LC 3UX9B 3KWWA 2DD8L 3KPNB 1P1ZA 3C8HA 3MRQB 3BQUA 3CLFL 4DVRL 4XPAH 2Y36H 1I3GH 4ODBD 4OLUL 4AZ8A 1A1NB 5KW9H 3PWJB 3DGCR 4R7NB 5CJXA 2Y25A 4Q0XH 1KF9B 2W07A 2W9DH 2XYCA 4OIIH 5C3LD 3DETD 3NA9H 1JP5A 2JB6B 1K6QH 1X5JA 1T03H 4DZBB 2Z92B 1BFOA 1E4WL 1CI5A 3SY0A 3ARFD 5DMYA 5TGBA 4M7ZC 1QP1A 2VXVH 1ZEAH 1DSFL 4LSUL 4H20H 5TE6L 4BFGA 3X13A 4HUUB 3SN6N 2NY6B 3TBTB 3FOMB 2VLJD 5CEZH 3WIFB 4HMEA 4WV1C 1QBAA 4K8RC 4ZPVA 1MHPL 2FBJH 4K71C 1NBZA 2ITCA 3A6CH 4NQUA 4QNPE 2NW3B 1G7QA 1YDPB 5F7WC 4DGYH 1JF1A 4R7DA 1GRWA 3HNVL 4N5ED 5E2TH 1CFTB 5ID0B 5E9DE 4FQXA 1AGDB 4PB0L 3ZKMD 1KTDB 1M7DA 4CDGC 4WNQB 5BOPA 1Z0NA 4F9PA 3PGCA 5F1NA 1EFXB 4KQ3L 4OCMC 2VKXA 2EDTA 1ZLSL 4NN5C 4QRRB 4DKAA 3RWCA 1GVIA 4JRWA 4L4TD 4P3CH 4V1DB 2CLZB 2DKUA 3MX0A 3LKPA 1VEOA 4WEMB 4UV4L 3OR7B 2MKLC 5IEHB 1T6WA 2ERJC 2WP3T 3SGEH 5E4EC 1D5ZB 4C83A 3MRIB 1A7QH 1O0VA 4PP2B 4TUJB 1JPST 5IF0A 1F5WA 1WEJL 2EDNA 2APXA 1MFEL 2DQDL 2VLJE 4MSWB 3RPKA 5MEQB 3MRNA 2IADB 4X6FA 1KIQB 3X3GH 1ZT1A 4MX7B 1YPZA 3VXTB 1AQDA 5HHPB 5EORL 3TJEH 3RKPA 3STLB 1I9RL 2VE6A 1JGUL 4L29B 3ESVF 3CDGA 5EFIB 3LKSB 1DVFB 5CLWA 2ZG1A 3SGJA 4IRJC 4NUGH 2VITA 4NO0A 3GSNB 4WHTA 3SEPA 2GJJA 4I48B 4NC2B 2OL3A 4X4ME 2GJ6D 5EZIL 3MV11 4BJLA 1CFNB 3VGAC 1MY7A 4L8CA 2YEZA 4O4YH 3TC9A 4L4TE 1KEML 4P2OD 1R0AH 1ZHLB 3RVVC 2IH3B 1FO0A 3ZKNC 4IMLA 4ONHB 25C8L 1HH6B 1KJ2H 1X5FA 4NM8L 4WFHD 3ARDD 3ZZ1A 4YUEH 3ARUA 2VLKA 4ZO6A 4XVUD 5E7FA 5L2KD 1RQ5A 3HUJE 3B5HA 1A14H 5CD5C 2VC2H 4JKLA 3QI9C 4N1CA 4K94H 1EXUB 1DQQA 4TRPL 1UFUA 3MUGA 1QRKA 1QSFD 3GSNL 2YUWA 4U1JB 5C6TH 1P9MC 3CC5B 1RUML 2K9UA 4G7YH 4XBPB 4NOFA 1SY6A 3Q6GH 2QL1A 2AP2A 3ARFB 2YK1H 5HPOA 1I3UA 3FONB 2AJUL 5I17B 3NZHH 5EUOE 2N7AA 2IAMD 2Y1VA 2C5DC 5T1LA 4FA8A 1WTGT 2GJ6E 3DO7A 2VLJB 5E95B 1A9BB 3MNZB 2Z8WC 3FO2B 1PFCA 2ADJB 5B39A 3AREC 1HEZA 2MQ0A 3VFSA 1A8JH 1OAXL 1YYLL 2J8UA 5LQBL 1TVBA 3IAGC 3D3VD 3CCHB 4WHDA 4S1DD 4WFHE 5ICYA 5J3HC 3GBMH 4U1LA 5J9PB 2ZCLH 4MAUH 1HHJB 4JFFD 5ITFA 1FAIH 5GGTA 3FN9A 1FN4A 1ETZB 1QSFE 2W0PA 4I18B 3GHBH 3QDHA 5FKPA 4NFDA 4L4TB 3O41A 3QEQA 5I76B 2Q7NA 2DM4A 3ARBC 5IWLC 3C2AL 3QHFL 4XNXL 2DQIH 5IW1A 3LD8C 3D2UD 5FUOL 4JHAH 4OD1L 2F5AH 5A3IC 4IRSA 4LLYA 3H3BC 3VFRA 2GUOB 4TTDD 1AGEA 4APQC 3HUJB 2Y72A 4HKZB 1J0KA 2ED8A 3K7UA 3S37X 3DSNA 1UGNA 3AS1A 3OJVC 3GSQB 1NGQH 4M1DH 3ULVD 1F4XH 4UT7L 2GK0A 2OR8A 3QG6A 1DQML 1X9QA 5FYLD 3OJ2C 5DJ8A 3D3VE 1NCNA 3O3BA 3S5LA 2PYFA 2AERT 2WBWB 3VG9B 3IDJB 5EUOB 5I30L 1ZT4B 3G5XB 4H88H 4OZIB 1UM4L 4YDIH 4J4PC 2IH1A 4JFFE 3W9EB 3WCYA 1KXTB 3VD9A 2WM0A 2GJ6B 3TZVD 1RUPL 1RY7B 1E27A 3EAKA 5K9OA 3B4NA 3BZ4A 1NCCH 2VDLH 4P2OB 3LV3A 5D93B 2OJEB 1I1AC 1HKLH 5EZJB 3JTSB 2YC1B 4OGXH 4Z77B 4G9FD 4JFPA 3THML 2J4WL 3ARDB 2JK5A 3PP3K 5L2KB 1N5YL 2J88L 1M4KA 1FAKT 3L3HA 5IMMA 1HDMA 2X1WL 1FZOB 3ZE0E 4GKZB 8CGTA 1QSFB 3TO4D 2NY3D 3T04D 1GGCH 3IRPX 3BHBA 5TE4H 3V6ZB 3F7VB 3ZDYE 1N4XL 2Y7QB 2Q6WA 2J12B 4MMZC 4PJGF 2C1OA 1Y18A 5J1SC 3HLAA 1FG9C 3PABA 3T1FA 3EOAB 3NAAH 4BELD 1CTOA 5DFTA 1EAPB 5T3ZD 3PGFL 3MODH 2IAMB 2PW2A 4LMQI 3JV6A 3U0WH 5FYKD 1I8MB 1CGVA 4Q6IB 2ATKB 4GH7B 4QHNB 4HBCL 2PF6A 4PGCA 1UWXH 2BXZA 2QR0B 4PV8A 3MRJB 4P4KD 2PKDA 3MSPA 4LSPL 5FGSA 5JR1H 3D3VB 4X6CA 1KEGH 4G9FE 3IB4A 2R1XB 2P44B 2QSCH 5AZ2H 4MQTB 1MJUH 4NN7B 3KLHC 3G9VA 4JFFB 5HJ3B 3LY6A 3UDWC 3FFCD 3BZEA 1UM5L 3WLBB 3IDMA 1MQKH 4EI6A 2CDEA 4O2CB 3K2UL 4FRWA 4I4WA 2A6KB 5KVGL 4ZNEA 1I1YA 4YH6A 4ODUA 3D2UB 2XA3A 4RDQG 1T04A 2X1QA 2DTSA 4MA8H 1RUKH 1JPSL 5JOEA 1QLEH 5H37H 5T3ZE 2DJUA 5EPMA 2Y06L 4OLVL 3MPCA 1MHHB 1MCLA 3PGDB 2I26N 5FYKE 4ZFOA 4OCWH 1L4IA 2UYLA 5EU4A 3X12B 4J8RA 1TZGL 4MHHG 1UXWA 4QRUB 4OF7A 4S0TD 3RPIB 5JDSB 5E7BA 4U7MA 1QPPA 3HMWL 4PRDB 1C8PA 1C7TA 3GRWL 2VYRE 2H41A 3OAYH 2A6IB 4K3JH 1MF2L 2HVKB 1DZBA 5IESL 5C6WH 3QDGA 4AIXA 5JW3L 3WFBL 4GXUN 2DIBA 3BXNB 3TZVB 2JELL 4GRLD 2CH8A 3HZMB 2L7JA 1WCBA 2EDRA 2CK0H 3I85A 3S6CA 1MJJB 2OL3H 3AS0A 5DD0H 3FAXA 2ORBH 5D70L 3SE9H 2OTUB 3AAZA 1JZ6A 3I3DA 5GZOC 2WAHA 4G9FB 5L2JB 4YDJB 2NY0D 1CLZL 1KT2B 3GJFK 1HHKA 2AJVH 4ERSL 5CJQH 4F57L 3VI4F 4YIQA 5KOVC 2C3VB 4LNVA 1SYSA 5I9QB 3QUZD 1G1CA 2NY3B 3EYFB 3TO4B 3LKNA 2UZXB 1G7JA 4KPHL 1HXYA 2YN3A 1A4KA 4FZ8H 1WZ1H 2ADFL 5E00B 3MRDA 1T3FA 4WI7A 3WS6C 4AEIH 4X4YB 4NKIH 1B90A 1MSPA 4JKPL 3PP4L 2FEEI 1PKQE 1BBDL 1MWAL 3R1GL 2X4QB 4XH2A 3LDBB 3TV3L 5ACZB 3ARGA 2OSLA 2E8YA 5FOBB 1SVZA 2QSVA 1RZ8B 1T0PB 1JMXA 1J1OH 4NOBA 2FECL 2HKFL 2EDKA 3VFNB 1UG9A 4P4KB 4XPHL 3ZE2F 1OTSD 3TYFB 2VJXA 4EIGB 5IB1B 4OF6A 4J6RL 3AUVA 2FO4A 4PJ7F 1XCTA 1DLFH 3HPJA 1XGRA 5DD1L 3JUYA 1Q0YL 3HZYA 3BYYA 3T0AA 3GMQB 1S9VA 3EYVA 1U93A 3P30L 4HGWB 5IFJB 3FFCB 3BMVA 5T3ZL 4Z76B 4ZNCD 5C0JA 1LO5A 5IBUB 5IMLA 1HINL 5IVZB 2CGRL 4W4NA 4ZDHB 5FYKL 3V2AR 3D48R 1JHTA 4OLYH 1JWUA 2APVA 3T2QA 4GW5B 3V0VB 4HW6A 4MXVE 1FORL 2EC9U 3U1SH 3UTOA 1CL7I 5D7SL 5DFVD 2LTQB 5BV7C 3U30B 3BISA 5HBBA 5C0IB 1S3KL 3PWVB 3BO8A 4K2UH 4FP8H 4M61A 2VXUL 4X4XB 3MXWL 1BOGB 3FRUA 4G9DA 3ORJA 3ZDZF 5I8EA 2Z8VC 4RAUA 5IMKB 3WDHA 5D1QC 4JFXA 4D94A 4RISH 3KXFE 4JFOB 1VFAB 1PKQB 2BVUA 4QHUB 4XMLL 2E7CA 2W59A 2QHRH 4ZOBA 2HJLA 1YNTA 4UDTA 4HK0A 3WEXB 2LU3A 1AGBB 4GRLB 1IGJA 2OCFD 1BQHG 4PJIA 2V2XB 3BSZH 5ADOH 5D1ZA 4AM0A 3SDXA 3FMGL 3OX8A 3RQ3A 5DJDA 4M93C 4YHIA 2QQKL 4F7MB 2HTKC 1B4JH 4LKCB 1I75A 3NOIA 5JQHC 2LU7A 2Y9RT 3CVHH 1XCQB 1BPVA 2FX7H 2NY0B 3WFEH 2V2TB 5ETUA 2NPLX 1BX2A 4MQXC 4GXVH 3T4YB 2A6JB 5E6YA 4Z7WF 2P8LA 5I2IB 5C6PB 4YZFF 5LXGH 1EVTC 1S7VA 3QUZB 1P6AB 1LILA 1WTLA 2CJUL 2EO9A 3OMZA 1KCSL 4L8SB 3SGKA 4LHQB 2Z8RA 2GCYA 3W0WD 5BS0D 3QIBC 2ZKHH 1LHZA 2FX9L 2R0KH 5MP6H 4M1CC 5CMAB 1ONQA 3V7AE 3WJLC 1Z9SA 3O81A 5BJTB 5DMGC 4JM2C 2I07B 4CJ0A 1BZ9A 4JJ5B 3BDYH 3HRZB 3MLTA 3RVXD 3UYPA 1CD8A 1P7QD 5E5RB 2O5YH 3U83A 4HMCA 3KYMA 3LH2L 3RBSA 3GI8L 4OQ1A 4Y5XB 5ICXB 3QXWA 3DV4A 1KCUH 3TT3H 2AXHA 3TT1H 3O6FC 4QWWC 5B38B 3KPPA 1T1ZA 4OM0H 3C6LC 1L9MA 3PQYD 4DZ8B 2ADIB 4E42A 3MRFB 2XWJB 3B5TA 1VKXB 4IOSD 2FH8A 4P2CG 3W0WE 5BS0E 3TPUA 4FG6D 1V3MA 4LF3A 5JHLL 5E8NA 4KQ4L 4PJEA 2J5LB 2VQ1A 1FGNL 1OAQH 3BGAA 5DUPH 3PNWB 1F6LL 5I1KL 5ESQB 2XOTA 4F7PB 5F89A 2DWEB 4ZOCA 4MA3B 1YUHA 3V6FA 4TOYH 1T5WB 2A77L 2BHYA 1OARL 2VERN 3TCXA 1CT8B 3MLXL 1XGPA 1NC4D 1BJMA 2L7UA 2VZSA 4KI5D 2K3TA 3QXAB 2DQGL 1G9NC 5F9WC 3H3PL 1NDMA 2AK4D 2VL5B 3HI1A 4NUJA 2E8ZA 4Y4FA 1OGAD 2PCPB 2NX5A 4YGAB 4JANB 3RVTC 1H5BB 3IJYB 3FO9A 4ZFZB 3JTTB 2ZSWA 4J3WA 4R4FH 5EU6A 4LCUB 4PJGE 4YHLH 5JXED 2J8HA 4PG2C 3NZ8A 4WI5A 5B38G 3PQYE 4IBLT 1KN4L 1HQRB 2HH0L 3NTCL 4I0PD 3CFBB 1A6VL 2J8UF 3VD4A 4LU5H 1NBVL 1QVOB 4HLJA 4HUVB 1IKFL 2GTWB 1HHIB 1PJ9A 3LPWA 4DEPC 3RNKA 5GRVK 3N0PB 1NFDF 3CPLA 3SOBH 2P48B 4XWGH 1Q9LA 5DS8B 5C0RH 5DUML 1H0DB 4YFLF 5I75C 1I1RA 1IC4L 1TTGA 5JOFA 1BMGA 1AC0A 1F3DH 4EEEA 5KAQF 1S7SA 3CZFA 1YMHB 1N3NA 1S5HB 3BPOB 1T66D 2E9BA 1B0GB 2AI0L 2X42A 3PV6B 1DDHB 2B2XH 4JAMA 4KI5E 2FB4H 5E5MB 5I0ZA 3ES6A 1PG7L 4MB5A 1KIPA 5MEOB 1DBBL 3SKOA 4AY0A 1CL7H 5EA0L 3W0WB 1FVEA 4C4KT 5BS0B 3IDIB 3BH8A 3QCVL 1IM9A 2WBJD 4OQTL 3SQBA 3MRRA 3P2TA 3W11D 2Q76B 3HPLA 2AK4E 1GYAA 1I4FA 2XN9A 2HFFA 1OGAE 3RZWA 3ZYOA 5HVFB 5KTEH 4KV5E 4NQSA 3V7AG 1MFAH 3VW3L 5B3JF 3DURB 4G42A 4CMHC 2HT4D 3GSOB 4R0LB 4XPGL 4EDXA 2VO5A 5IV2B 1J12A 3GMOA 4H26B 1I85C 4O02H 1Z0MA 4WJ5B 1J88A 1P7QB 5IR1B 2BHZA 1TJHL 4NT6B 4P46D 1A1OB 2R0ZL 2ZPKH 4PLJC 5DEZA 5ENWB 3MUJA 4PJGB 1R5VA 3VFVA 4LRIA 4LVNC 5MERA 4I3RH 2EE2A 3PQYB 1EPFA 1BVKB 5ANMA 2DQCH 2MHAA 5DR5H 4YC2C 4M7KL 4RGNC 4JFZL 4P5MA 2DQUL 3QNXA 2W0FB 4YK4C 2X44D 3MRCB 4P23C 3CFCL 5L6YH 4MJ5A 3U9PH 4ACPA 3BN9D 1M1SA 4GJTB 3Q0HA 1I1CA 4KZDH 3UZEA 4GG6A 4F9LC 4QO1A 3V4VH 1BIIA 1GGYA 3GGWA 3KYNB 3VXSD 1BECA 3KPSA 2R4SL 3RVWD 3LKOB 4TULH 1G6RB 3WFCH 3LRGA 1NC4B 5FGCB 4L3EA 4AQOA 1FFPA 5J1TC 8FABA 5C0BD 3VI4E 1NMAL 2I9TB 1NANI 2VXTH 2JJTC 2AK4B 5TE7H 1FVCA 3BEWA 1OGAB 1ZSDA 4NWTL 4ELKB 3FT2B 4LDLB 1BD2D 1AD0B 4RWYH 5T1MB 4POZD 4OI7A 5L9DH 3D25A 5DK2A 3O3EB 5FHBH 1VADA 5LAXB 1EDQA 2EXWC 1FNGB 4I0PB 1IGIL 1NLBL 2I60H 4LASH 4LLUA 4OF8A 1N2RA 4LLMA 1RK1A 1G6RL 5KSVA 3LKRA 1CFVH 4S2SA 1XR8B 3C5ZD 5CILL 4WWKC 1UWGL 3OJDA 4WW1B 5DDHB 1TZIB 1UWXK 4GAYA 3ZE2E 2V5YA 5DJCA 1I8IB 1QBLL 2P24A 3JWDL 3F62A 4QXWA 5JTWA 3F8UB 1UKQA 1F8TL 3LQZB 1U8PA 2X4NB 4QRTA 3OAUH 1WWWX 1OAYH 4Z7UA 5C0BE 4XHJD 2A9NL 2FJGB 2CQVA 3P11L 1N64H 5D9SB 5AUMB 2GITB 4N1EA 3C5SB 2WBJB 4L9DA 3H7LA 3T0EA 2C3WA 2DICA 3BT2L 4WIQA 2PO6C 2VR5A 1RJLA 1BD2E 4F7TA 1C1EH 2ARWA 1R3IL 3MCKB 4CL7A 3RTQD 4ETYA 4YHYC 2DMKA 2R39A 4X6DA 3H9YA 4PJFA 3ROOB 4CW1A 5DYOB 5H2BB 3O3UN 5BQ7B 5KVMC 1XAUA 4MVBD 1OTUD 1S7QB 3CSGA 4NZDA 3RHWF 4P59L 3LZFL 1IZKA 4OUUA 1ZANL 1ZHKA 3UTSA 4XB8A 3HZVB 5DQ9A 2WLYA 4P46B 5BZDA 5DD5L 1GZQA 2VISA 4M1GH 3S3PA 3RI5K 4LLVB 3KPMB 3MRGB 1S7RA 4ZFGL 3CFDA 4XZUB 3C60D 1CZ8H 1NAKL 3HG1D 4Y4HD 2VLLB 3BAEL 4XBGB 4RA3A 4IHOB 3MJ7A 1HWGB 4XB7A 4HXBL 2Q8BH 1EGJL 1TJIL 1ZK9A 4RIRA 3HC0B 1EEYB 4PJHE 1NFIA 5DWUL 5GS0C 3ARXA 1QTYT 1FP5A 2OMBA 1MFBH 3CVIH 4OBRA 2P5WD 1F3JA 5I73C 4YFDB 5DHYA 3VXSB 3O3DB 2M2DA 3IFLL 2V5SA 3HC3L 5A16B 1I3VA 3T0VA 4MAYA 1BIHA 5C0BB 4Z7WE 3SPVA 1SQ2N 4F37F 4JVWA 4YHPB 4PJ8C 1D9KC 3L3KA 5IJVA 2E6JA 2EIZA 1BD2B 4P3WA 1J87A 5F3HB 4NGHL 1CBVH 4LNRA 1IGYA 1CR9H 1RZKC 1K5NA 4KHTH 3HG1E 2VLKD 2ZOLA 1NCTA 4GBXA 1WSST 2X4UA 3FT3A 3VWKD 3IU4H 5F6HI 5LGHH 4OZHF 4KAQL 3KNBA 2VDOH 1OTTD 2AV7B 2JB5L 3C5ZB 1AJ7H 4P9HL 2H6PA 4R2GD 5IOPB 5AG8A 3Q48A 3QEGL 1BFOB 2C7UB 1NBQA 5FO9B 3AY4C 2P5WE 1Q9OB 1JWMB 5TGBB 3WUWA 3FQRB 2JE8A 3IKKA 4JPKH 1GJIA 2XZZA 3GMLA 3GNML 2YD7A 3CSPA 4K23H 1YEKH 1L7IH 4MB4A 4JB9H 5DZOA 4PJHB 3E3QE 4Q9BA 4FFWD 5C9JB 4DW2H 3RKDC 5DQDH 1MCEA 1GZPB 3PF2A 5KANI 2E9JA 5EC1A 2ZOKA 1VGKB 2YRZA 2R4RL 3KPRD 4PRID 4HS3B 2G60H 2EKSB 2C4FU 3IFPB 3RTQB 4FOMA 5C07D 1T7VA 2PXYD 2V2WB 4XPBL 5GISL 4G6JL 3RUGA 1QO3B 4EI5D 4ODHH 1HIMH 3BIBX 1OSZA 4Z7WB 1N7ML 2RFXB 4LSDA 3F7YB 5JMRA 4D9QD 4Z95L 43C9B 5D71L 3RA7H 2XI9A 1EZVY 3SQOH 4NBYB 5SWZD 1IGFL 4MJ6B 2D9QB 2XG4A 4OTXH 2CKBA 1JZ5A 2DLFH 3OPZL 1A7PH 1CU4H 3FB8B 4GO6B 4IRSD 2ZUTA 5FO8B 3C60B 4BSVB 3HG1B 4Y4HB 3GSRA 3SDXF 2AXJA 2PUQT 1E4KA 2ZNXA 1AHWC