1FIGH

Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
216
structure length
216
Chain Sequence
b'DVQLQQSGPELEKPGASVKISCKASGFSLPGHNINWIVQRNGKSLEWIGNIDPYYGGTNFNPKFKGKATLTVDKSSSTLYMHLTSLQSEDSAVYYCARRRDGNYGFTYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA 1F7 FAB (LIGHT CHAIN)
publication title Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 27
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figH02
4ZO8A 5D7JB 4OT1L 1TXKA 2ZUYA 3ZKXB 4QRQB 3QHFL 3FB7A 5HHOE 1Q0XL 2XZAH 1A7PH 2K1MA 3HZYB 4P23C 4QRRD 3GMMA 4WEMB 5L0QC 3QUZA 4LSSL 4OZFH 3MLSL 4F2MA 2O61A 2GUOA 2BMKB 3LKSB 4Q74A 5EZIL 2IF7A 2SEBA 4PJXE 3PGFL 1I8IA 1QACA 1J8HB 3ZKMD 4GW1A 2DQUH 5LQBL 1PY9A 2P46B 4HS8H 5FA4A 1UM5H 4GKSB 1CDBA 4F7PA 2K7QA 4O5LL 4HJ0D 2GJZB 4Z7WE 4JPKL 2CGRH 4JRXB 5FK9B 3ZYIA 1HOCA 1MIML 5FGBA 3AGVA 4DVRL 1DQLL 4ZSOE 3WD5L 1FL3A 4Q9RL 4G5ZL 3IJSA 1VGKB 4ZAKB 3RWDA 4WO4A 1CD1B 2AV7B 5FUCC 1JZ3A 3L3KB 1CBVL 1T83A 4ODBD 1NMAL 4E41A 4EZMA 2A1WL 3K4DA 4H0HB 4MSWA 4TUJB 4P2RD 5C0FB 5BXFB 5DQ9A 4JQXC 5I6XC 4HHAA 4OCNC 4NUGH 2YPVL 3RNKB 1T89A 5AUMB 3P9WB 2DKMA 1TPXB 1TQBB 4WI6A 3UC0H 1QQDA 3F58L 5D2NE 3UJTH 5I66A 3QDME 3WHXB 2FGWL 3O2VL 1DFBH 2W9LA 3HFML 1JTPA 4TVSa 2OSLB 1CIUA 3L3HA 3BDBA 4GRWH 3AXLB 3K46A 2FEDD 4LSVL 1ZOXA 3BIBX 4KRPD 4L4VD 3UTOA 4BH7B 1VCAA 3SGDH 4J12A 3BZEB 4CGTA 1G7QA 4L3AA 1DUZB 5ETUA 4PRIE 4PJAF 5EG6C 4CW1A 3RVVD 1S5IL 4JFDD 1ZA3B 5SWQA 1GGYA 4GW4A 3HAEH 5CEZL 5IB3B 5IESH 1RZKH 2X4TB 1A14H 2X89A 5HHPA 3RL1A 3ARGD 2D4FA 3N9GL 1WT5C 2P42B 4S10A 4WFGE 3T4YA 2JCCF 2DQTL 5DZOA 4C58B 3RWGB 4YH6A 5ICYB 3NZHL 3F7YA 4H1LH 1FN4A 3CXDH 2DYPB 3LN4A 4G8FA 5BZWA 3CX5J 3FO1A 4NFDA 1DL7L 2FWOB 4PRDA 5KSAD 1HHGB 1QNZH 3PJSB 1IGJB 1P5UA 2WMPA 4HIXH 2R0KH 1FV1B 2DM3A 5ISZE 1F2XK 1MFBL 2HFEB 4F9PC 5K59E 3SBWC 3OG4B 5HHMD 2Y7QA 5DJCA 1MCJA 2ZOKB 3NIFF 1QRND 5DXWA 1CXLA 1MHEA 2C7UB 4Z0BL 5B4MD 1GHFH 4XCYA 2JJUA 3F5WB 3RWHB 5D6DA 3LKNB 1JYVA 1MCPH 5EIVA 4ZDHA 4R97B 5LGHL 1G9MC 1NLBH 4ONFL 4H5SB 5F9WB 1ROWA 1DLHB 4QHNB 1U3ZA 2BJMH 3VGDA 2DB8A 2XQBH 3UBXG 4XCNB 3OB0K 3DMMA 4PGBB 4X4YA 4PS4L 4XCCL 2FX8H 2D7NA 1NJ9A 4F7CA 3C8KB 1MCHA 3OKKB 3TCXA 1A6TB 4D9QE 4PRHA 3MV8E 3MRRB 3WNMA 2Q6WA 1FNSL 2XPGA 4LPYA 3ZTJH 1MJUH 5HD8C 4PYHA 2AJXL 2P8MA 5HYJB 2BNUA 4G8GE 2R9HD 2W60B 3HG1B 4Z7QE 4MD5B 1SYSA 4O51A 4RMQA 4Y2DC 4DN4L 3EYQD 1MHPH 3LY6A 2NY3D 4J6RL 2EEDA 1OLZA 5FA3A 1MF2L 2YKLH 5GQBA 3QYCA 1IBGH 1MVUB 3IAPA 4L5FL 2DTSA 5DJDA 1G7PB 3D6GA 4BJLA 4JB9L 1U8OA 1RZJL 1G7LA 1WLHA 2MPAL 5DJZA 3TBSA 2WWMD 3SCMD 1MCWW 3CU1A 1FL6B 1XGQA 4UILH 4PLOB 5L88H 1I7RB 1OT1A 4QHLB 1EFQA 1MSPA 3SKMA 3FRPA 1H15A 1NGZA 1JZ5A 1NGWB 3QUXD 2E27L 3BDYH 4ODVL 5GS3A 3WNOA 1IGML 4XMPH 3ARFB 1FC2D 3W2DH 3FAWA 3C2AL 5HYSB 2D9CA 5FGRA 5HPMA 3VRLE 4H8WC 3B2VL 1WCQA 4UT6H 1BGXL 2BCKB 1BIIB 4LCWD 4EEEA 3HB3C 1K5NB 1XGPB 4Z76A 2BOBB 4GRMB 5MI0B 4Z78A 2J5LB 2AK4A 5IKCA 1WEJL 3C6SB 3W39A 3STBA 4ELMB 1G9EA 1JPGA 1Q0YH 1KJ2H 3NCFB 4WFHE 1BJ8A 3RL2B 1RUPL 1CF8L 2VLJA 1D6EA 1ZEAL 4ZS6D 3HE7B 4E41D 3O11B 3RIAK 5T3ZL 5E03A 2HJFA 2AQ1A 2DOCA 3BYTA 3AB0B 1YYML 3RI5K 4ZUSA 4PP2B 1F3DH 3KPPA 1DN2A 4L1DA 2VXQL 1KTDB 2I9TB 2OTUB 4X9BA 4W6YB 4G6AD 1UH4A 5GRWA 2FSEA 4P2OB 4OBRA 5IHUH 1G9MH 5EDXA 3FT3A 3FKUS 3NGBB 4QCIA 4WU7A 5T1LA 2EKJA 1OAXH 3LS4H 3B5GA 4JZJB 2C3XA 5IB4B 1UWGL 3P9LB 2J88L 1XIWA 4NKDA 2APFA 3RPKA 1FVEA 1QSFE 4YDJA 3UPAA 3ILQD 3UTQB 3HMXH 1DANT 1G9NL 3ALPA 2BNQD 3BP4A 4KK5C 4V2BA 4LEXH 4FRWA 4D3CL 1D6VL 2ZSVB 4HIJA 5DVKA 5JXAL 4LAQH 4NT6A 2AVGA 2PYED 3JTSB 3W9EB 4XZUA 4KK9D 4MNQE 5AZEL 4BQCA 1K4CA 1Z9MA 1MWAA 4G7VL 5DZNA 3LEXB 1XR9B 2VUYA 2ZOLA 1ORQB 3IDJA 1Z0NA 1FO0A 3L5HA 3NOIA 5DHXB 5D7KD 1PG7W 1DQML 5IF0B 4EOWL 5HHOB 1QO3A 3V5DB 4WFEE 4RGND 5IBUB 3KYKH 1OAUH 2C3WA 4YDIH 3AMKA 1MFCL 1MLCA 3T4AA 4KTEL 1CGYA 4NKOA 4W81A 5CEZD 2BC4A 1KN2L 3UROR 3QJHB 3TA3B 5FYJU 4PJXB 1NDGA 5FUZH 1JTTA 5FB8B 5IB1A 4HKJB 4LAJH 1RU9L 1CR9H 2APXA 5H35A 3DO7A 1LD9B 4H8WH 1EO8H 3U6RB 4UTBH 2FX7L 5KSUA 1T2QL 3ULUE 4KUZH 4HUNB 1IAMA 3DVNB 1IM3A 4PP1D 4ZSOB 3G6DL 1KIRB 3KPSE 3MRGB 4JKMA 4O2FB 4ODTH 5C71A 5IWLA 3TBVB 3G5XB 4XRCB 3ZYJA 3UYPA 2VQUA 4I1NB 4GJTB 3GMQB 1XF3B 1G7MB 4K3JH 2HFFB 1EAJA 2IFFH 3FO0H 5TFSL 4UV4H 1E4WH 4IRJC 2FYYB 1T03H 2IH3B 2EDYA 1XT5A 2RFXB 5DJXA 3L3GA 2D7QA 3EAKA 4AEHH 3BGFC 3N85H 4FQQA 3HI6L 4DVBB 4NOFA 4P4KA 1QFWM 3NIGF 4D9RD 1CVSC 2OXHA 5I8KH 2VDMH 1WBXB 4X83A 4ETYA 1WWAX 2YSSA 3RVTD 3CDGB 5FYKU 4W70A 2NMSA 5DMGD 5CD5C 1QLFB 2QSTA 2VH5H 5E4IA 4JHWL 1U93A 5DJ8B 3BRFA 4ZPVA 1C5BL 3HCVA 1DEEB 2QHLA 4GRLD 5GGQH 3SKJL 4YXLL 4NRXB 4GQ9L 5E6ZA 5JW3L 3EJYC 2A0LD 4F15C 5DLML 2HMIC 3FQXA 4ZUWB 5DWUH 1Q9LA 4N8CL 1TIUA 2CKBL 1DCLA 2H6PB 2LAGB 3IXTB 5GGVL 1RUQL 2R23A 3VXNB 4G8EB 1II4E 2QV2A 4IDLA 3QWOA 5F97E 3QFDB 4JFFA 2JK5B 1X6LA 3EJZC 4KVCL 3GMLA 5T1MA 1FL5A 5H37H 5IV2B 2J6EH 2VABA 1ONQA 2X1PA 4IRSC 3UDWA 2R2BB 1P6AB 1KFAL 5E2WH 1HWHB 2X4NB 1IEAB 2X4SB 4JANB 1A4JA 4X0KA 4WW2B 1OW0A 3LS5L 4FFYH 2ZG2A 3IGAB 4NKQB 4JDTH 4NJ9H 2ITCA 3U0WH 2BK8A 3U0PA 4LOUD 1INEL 5ESVA 3BZFB 4RQQB 2A6KB 2EDDA 5IFJA 4MQ7A 2NR6C 3CMGA 1Z9OA 1QLRB 2XG5A 4MQXC 5ISZB 1UA6H 3R06A 1J1XL 5SV4A 5C2UB 1BD2E 2VZUA 2XY1A 2AQ3A 3PNWA 1LP9F 1S3KL 3EYFA 5MEOB 2XXCB 5E00B 4JY4A 4U1IB 3V0VA 5T1DL 5BV7B 2OP4L 4OSUH 4OIBA 4FZ8H 3H7BB 3G9VA 2OZ4L 1RIVL 2BRRH 4OGXH 3ULSA 4G9FD 4JLRA 3U7WL 3U30B 2BFVL 2Z91B 2VQTA 2WBJA 3FT2A 5DR5H 4DZ8B 1X9QA 4ZYKA 3IFNH 5TE4H 5T3ZD 2AABH 4KU1A 1GC1C 5D2LE 1FHGA 4LF3B 5IB5A 2R29H 4XC3H 5L7XH 4A2MA 3UO1H 4M7ZB 1U6AL 2C3VA 1T1YA 1TZHA 4JY6A 4NC1C 1P7KA 3G6AB 5D7JD 3MV8B 2R4SH 2A9ML 4CVWA 1MREL 3VG9C 3ABZA 1T3FA 4R90L 5DUMH 1W2KT 5I30L 1U8NA 4PJEF 4ODXB 1I85A 3QUML 1B3JA 4L1HA 1S7SA 4KQ3H 4Z7UF 5I73B 3MV7D 3VRJA 5EUKB 5F9OH 2FLRT 1A6PA 1GGTA 1J8HD 3TH2T 2BSSA 1EXUB 4OJFH 3HI1B 1F13A 3BUTA 5FCSH 4YBQD 3B5HA 2DLTA 5ESQB 5FM5M 3IU3A 4WEBL 3NVQA 2AEIT 5DTFA 3UTSB 1F6FB 5DDHB 3LEYL 3ZDZE 3MRFA 2UVFA 3NCJH 5GGRY 4J1UB 3RHWK 1JUFA 3O4LB 3WIHH 4QTIL 2AJ3B 3QPQC 4AZ8A 4ZAKD 4ZTPL 4X9HA 1IGFL 4RBPH 3SDAA 4S1SH 4TSAH 3Q6FA 4X6CA 4DZBA 1ZVSB 4R2GB 4JG0L 4TYUA 1CK0H 3VFNB 1P53A 3IDMB 4HUXB 3QIWC 1I75A 3DOSA 4UNTA 4FXKB 1N4XL 4G8IA 4HDIA 3L5XH 3P77A 3QO0A 5TDPA 3ZL4H 4PJ8C 3L3DA 5J6HB 3F6IA 5D1ZC 1CS6A 4AYFA 1QFUH 9CGTA 4FFZH 3RZCD 1V05A 4R7DB 1CN4A 5DYOA 3SE9L 3WCYA 1YPZF 5I2IA 2FD6L 3R8QA 2FIKB 3MRIB 4WGWB 1S5HB 3ALXA 1ORSA 3T0EB 4GKNB 5GSRB 5GSVA 4NRYB 2DLIA 4OKVA 3UBXB 2EECA 1A3LH 2ARWA 2E6JA 1HDMA 1YQVH 3PF2A 1K4DB 5MERA 4YBLB 1UYWL 3HLAA 4NQEA 2X4OB 4PUBL 5F6IB 2R4RL 1R3IL 2ESVA 3LD8B 2ERJC 1NC2B 4IMKA 4LLDA 3G5YA 1GC1H 4B7IA 1QSFB 5SV3A 5JDJA 4WHTA 2WBKA 2ZWLT 3BKJH 5TE7L 5FKPA 3VD9A 5I1GL 5C0GA 4WV1C 1BIHA 1MAMH 3WO3B 5T5FH 1JYXA 3BWUC 3C9NA 2XNAA 2JKXA 4WUUB 1OQOA 4RFEB 3KYNA 4RDQF 3RBSA 5FV2A 4UDUA 5CP7A 3BRDA 3BPOC 3QCUH 3EFDH 3GM0A 3ZKMC 5MHSD 3DV6A 4LSTL 2FX9H 1H3UA 4MXQD 5EOQH 2ZKHH 4RIRA 5EC1B 2VLLA 1AE6H 3QG7L 3MO1B 2NY7H 2IAND 2YXMA 1MH5B 3AC0A 4MA1C 3GDBA 4X99B 1JE6A 2VTFA 3X3GL 2BZDA 3IFLL 1DTUA 3CC5A 5KZCB 1BZ7B 4QT5A 1JGDB 1S7VA 5A3ID 4NM4H 5L6YL 3LHPL 4GOSA 2QKIA 2MJWA 1ZLWK 5H2BA 3MV01 3I2CH 2JTDA 1LDPL 3GJFK 5C3LD 3FB6B 5D7IA 2AGJH 1NCAL 1YEKH 2H1PL 3KGRA 4Y5YB 1VACB 5T1KB 4RGMB 5CGMA 5L8KB 5GIRB 1ZTXH 1QFWI 3DBXA 1G6RH 3GMNA 2VE6A 3WFEL 3DVGB 2NX5E 3FB5B 3V0WH 1RZFH 3JVGC 4LHUG 4JPVH 5DD0L 2PXYB 2O5XL 1JWMB 4JRYA 5CZVL 3SOBH 4XH2B 3IFOA 1HSAB 4XP4L 1I1YA 2GTZA 4OD2B 5GGRB 5GGSY 3SDCB 4K94C 2FEDC 3B2UD 1HEZB 4PGCB 4KRPC 3IYLW 1VFOA 1QSEB 5C0AA 4NN7C 2WBJD 3SDDB 2KQNA 3VH8B 3CDFA 3QIUB 1EGJH 4FQLH 4HQQL 1T21B 1PSKH 1NGXA 4ZS7H 3PWUB 2R1YB 1G7IA 1HXMB 1R6VA 1HSBB 2ZUQB 3RVVC 1KN4L 4XP5L 35C8L 2XN9A 3EYSH 4PRIA 3T8XB 2L0DA 2V5MA 2BSTA 3RIFF 3NPSB 1P7QB 4Y16D 3I84A 1B6UA 1EV2E 1LEIA 1TJGH 1YEIH 4P2QB 2MHAA 4U7SA 4ZFGL 5BS0E 3MRPA 3M17B 2DQCH 3ZT5A 4X98A 3FB7B 4JREC 4YFEA 5EOCH 3QUZB 1T20B 3ARFD 3QEHA 5LCVL 5KSAC 4QRUA 1T2XA 1HH6B 3V6OE 2SEBB 3MZGB 4KDTA 1I8IB 5H94A 4NZRH 5JDSA 4S1QL 4LCUA 4XPGL 3RTQB 3DV4B 4P5MA 1A6AB 4PRNB 3IDIA 5HJ3B 4OCSH 2HKHH 3O2WL 1NBQA 5D96B 5DMIH 5IGXH 4ZFZB 5B4MC 1JPSH 3ETBF 2E7MA 1BVLA 4KV5E 3FQTA 3KYOB 3VFVB 2E9WA 3IJSB 3NFSH 2Q20A 1FZOA 1G0XA 5JR1L 1T22B 1S9YA 4PD4K 2UZIL 2VXTH 3PP3H 3DRTA 3OG6B 1T7XA 4FQIL 4MSWB 5EZOH 4JFED 3MJ9H 3OAYH 4OFPA 3VW3L 2GYSA 4YFDB 3UAJD 2OYPA 2Q86B 1DBJH 2Y07H 4K3DL 4OFYA 2DD8L 5C0BA 3HPLA 3FQNA 2PW2A 4KKNA 4YHKH 1F3RB 5JHDE 2P45B 3CMOH 1SYVA 4YEEA 3ALWA 3QR2A 4K94H 4NBZB 2VLRD 4UB0L 3TIEB 1WV7T 2CUIA 1OP5H 2R9HC 4OFIA 4W4NA 1QBLL 3O41B 3OKLA 4YX2H 3EYQC 2M8XA 5IQ9A 5D2LB 2NY3C 5F7NC 4X5WB 4U6YA 4ENED 4KPHL 5CP3A 1WSST 4QOKA 1WIUA 4M8QB 2NLJB 1G7QB 1AHWB 3NCYP 5ETUB 2XG4A 3MV11 1JZ6A 4JPWL 5SWSA 4PTUB 4N0YL 5M94B 1O5DT 2QHRH 4JJ5A 3DWTA 1L7IH 5KAQF 2PTTA 5HYEA 2WWMC 3C09B 5HHOD 3SCMC 1PD6A 5SWQB 4XPHL 3LPFA 1DBMH 2PO6A 3VFPA 4M62L 2RBLA 4IM8A 4HAFA 5GGSB 2DDQH 5JIPA 3RL1B 1CVRA 3QPXH 3O3AA 3QUXC 3VDAA 2DWDA 2BY0A 3T4YB 4KMTH 1J8KA 1YNLL 3TA3D 3WS3A 1NFDA 4V1DE 2NY6D 1P84J 5AWNL 3EDJA 3BESR 3AY4C 3F7YB 4OUUB 1FN4B 2W92A 1QVOB 3GI8H 4G8FB 3CFIC 5JUEH 5DUBA 2D9QB 1UG9A 3KNBB 2I9LA 1A4KA 4YDLC 1CFBA 3MXWL 3T2OA 2V17H 1GAFL 1CFSA 4ZFFA 1I1AA 2F58H 1MAKA 2FATL 5DJCB 2J8UE 3QT2A 2NXYB 5D8JL 5KSBE 3JUYA 3QDJE 2C9AA 1K8DA 2VZ1A 4KI1A 4KMLB 4RNRB 5ICXA 1MHEB 1XAUA 1RZGB 3SKNA 2ZCLL 1ZAGA 4XNUH 2WBWB 2NZIA 4FXLA 4XCYB 5B8CA 4K23L 4G9DB 2CMRH 3H9SE 4ZDHB 4B50A 4XX1G 4N0CC 5C0ND 1JGEA 4TUOA 1G1CA 4UBDD 4OZHF 3QDMD 2VRAA 4PJDF 4GSDH 1DQQA 3DURA 3ILQC 4DAGL 4M5YH 1FNHA 2NYYD 4R7NB 4U6HB 5HI4C 5KN5A 1H3TA 3DMMB 3OAZH 1JHLH 2B8OT 1QYGL 3TBYB 3VFGH 3MOBL 4LU5L 2Q8BL 1NKRA 4YXKL 4F7CB 2W0KA 4YHOH 3MROB 1F4YL 4PRHB 5KJRL 3QQ9D 2XPGB 2OBGA 3BIAX 3N50A 4KK9C 5DFTA 1IGTA 1VENA 2P8MB 4PRID 2BNUB 5I1IL 3MRDA 4O51B 4PJIF 4AMKL 4MAUL 5F88B 1UXWA 4J8RA 3TV3H 4Y5VA 3MRBA 2LU7A 4WFGD 5GJTH 4RGNC 1AGCA 5J11B 1UADC 1T5WB 2GW5A 1KCUH 1U8OB 4JDVB 1G7LB 5DJZB 4OT1H 2W07A 3ULUL 2DQDH 1KLUA 4JKLA 4XBGA 3SKMB 1H15B 4M61B 3PV6A 4LSSH 1X5KA 4A6YH 5ISZD 5HPMB 4JVWA 4X6DA 3VI3E 4DEPC 5EZIH 4PP1C 5J1SC 3PGFH 3GJFA 3X17A 5I8EA 1UFUA 1OAQL 4K71C 4NO5A 1R3JA 4O5LH 1CFQA 3R1GL 2Z31B 1TQCC 3WNKA 2HH0L 4JPKH 4Y1AA 3JWOC 5EO0A 1QR1B 3LOWA 1MIMH 2VLJB 3OKNA 1D6EB 2Y36L 3BZ4A 4DVRH 4P4RB 4HZAA 1KCLA 1DQLH 2HJFB 4XX1E 5GPRA 3WD5H 2VDPH 4H25A 2Z93A 1R5VA 3KPPB 2GITA 5E8PA 5E9DA 2P5EB 2GT9A 2XZCL 4LMQE 1LO3H 5F8QC 1NMAH 1BFTA 3BN9D 2A1WH 5FO9A 3Q5TA 4QCIB 4Z18A 5DMGC 5I76A 4D9QD 1DBAL 4JO2L 2YPVH 3MV8D 5DVMA 4NKDB 3WJJC 4UUJA 4GRLC 2D31B 3KPQA 2A0LC 3F58H 4APQA 3VGAB 1WQVT 2YD6A 1PAMA 2NY2D 5EZLA 3KYAA 1CG9B 4G8GD 5E99L 4OLZH 1DQJB 1F90L 2Y5TA 2FB4L 1IQDA 3O2VH 1WBZA 3TBTA 2FBJL 1AGFA 3HFMH 4HIJB 4NT6B 4BZ2L 1BLNA 1XCQA 4LSVH 4GKOA 4WI9A 4D94A 4M00A 3KLDA 4HSQA 5IVNA 1K4CB 1MWAB 2CIKB 5C6WH 5SX4H 3UTSD 1AKJB 3G6JE 2CRZA 5CEXB 2ZOLB 5TPWL 4HD9A 3IDJB 4NHUB 5BS0B 1MJ7H 1FO0B 3KJ4B 2EE2A 2YK1H 5LXGL 1S5IH 4HPYL 4G42B 4M5ZL 1KUMA 1RZJC 25C8L 4ZOEA 3N0PB 5EU7C 1LNUB 5C0EA 4BZ1L 3T4AB 4LOUC 4Y89A 3QRGL 3T09A 3N9GH 2GKIA 3T77A 5I8CA 2DQTH 1NDGB 3EDFA 5DVLA 2IQAA 3BP6A 5IB1B 2DBLL 2HRPH 4RA3A 3NZHH 4I2XE 1IAKA 5H35B 3DO7B 1B88A 2Y06L 3ME0A 3OJMB 3C87A 4LHJB 3RFZC 4WFHD 1IZJA 3H9HB 5GS1C 1M7DA 2D7TL 4NGHL 4ODSL 3HI5L 5FHAL 3BISA 4Z7VE 1UWXH 1IM3B 1PZ5A 1BF2A 2DJ4A 3OJDA 3KAAA 1OTTD 1MFBH 1J86A 4YAQA 1FNGA 1QRKA 3MGOA 1G6VK 3JWOH 4QYOA 4IOFD 4Y7MA 2XA8L 3C5SB 3FONA 4LHUB 3VXUA 3HTLX 5LWYH 2D0HA 4HUUA 1T4KA 2P5WA 1Z6JT 4GFTB 1H5BA 4MDJB 2ZPKL 1NC2D 1I9EA 1P4IH 2WV3A 5DJXB 2APVA 4HIHA 2EDWA 5GHWL 1QSFD 3KPTA 5LGHH 5D7JC 3LQZA 3DUSA 3ZKXC 1CXHA 2QQLH 4ONFH 4H0GA 4QF1A 2DL2A 1MI5E 4PJCE 3RJDA 2IPUG 3UPRA 1JV5B 1AO7E 3QFJE 5F93C 3O3DA 1U93B 3PHSA 4F58L 4PJFA 4WTZA 2YBRA 4ZPVB 3HCVB 2EYTA 4PS4H 1G9NC 2HVJA 4XCCH 4EXPX 5C08E 4MNQD 2Z8SA 5DA0B 5DK3A 4C55A 5IHLB 1E0OB 2H32H 1Y18B 5B21A 3FQXB 3MREA 2Q3AA 5F1NA 5CSGA 1FNSH 4U2YA 5J1AB 1Q9LB 1NGQL 2YPKB 3OPZL 2G2RB 4YBQC 5IFAH 4ZQKA 3QNYB 3PUCA 4NQDB 2AJXH 1IGIL 2R0LH 3V6ZB 2ZUXA 3A6CH 4OCXL 4OQ1A 2R23B 2UWEE 4LPXA 5AAWA 1TVBA 4DN4H 3O8XA 3QWOB 4WFED 4C56E 4JFFB 1CGWA 1A1MB 4J6RH 1F4WL 1CXEA 3BD4A 5HGAB 4ZAKC 5T1MB 3UMTA 1MF2H 3O3EA 4L8SB 1K85A 4PG9A 1MLBA 4L5FH 5F1OB 2VABB 4XBPA 5TDOB 4JB9H 4V1DB 4BUGA 4Z7NF 3QQ3A 3OQ3B 1MFNA 1RZJH 4YO0A 4LLUB 3VE0A 2MPAH 5F1IA 2AJZB 5T1KD 5H8DA 3QG6A 2ITCB 4FNLL 1X4ZA 4UINL 3ES6A 5ESVB 4XP6L 1QG3A 1TQBC 5DJYA 3ULUD 2E27H 4ODVH 1IGMH 2LVCA 4FQ2H 4LCIL 4DWHA 3KPSD 2PXYD 3RZCC 1BGXH 3PNWB 3VXOB 4G80B 2EEAA 3NCYS 3QDJB 3EYFB 1MY7A 3V7MA 3ESVF 4LRNH 2J8HA 4MJ2A 5C0CB 3V0VB 1WEJH 2YUWA 2ITDA 2RHEA 3LN5A 3SDDD 1EA9C 2VSCA 1MCOL 3QIUD 3S36L 4HAGA 5KS9E 3H9SB 4ZFOB 2ADJA 1CF8H 1ZEAH 4JLRB 5CS7A 1JHKL 1CE6B 4MS8D 4PD4J 4FQPA 1YYMH 2XKNA 3P3YA 2OI9B 4ZYKB 3WO4B 4P5TA 1MFEL 4XVSL 1B6DA 4ELMF 4R96B 1P7QD 3WDIA 4IRZL 2O93L 1I9IL 2QADB 4P3DA 4Q6YA 4NWUL 3QUYD 3OX8B 1IGCL 3KPRE 1UWGH 2J88H 1IAOA 3LSOB 4NM8L 3TT3L 3QEQE 5D9SA 4E42B 4MXQC 1S7RA 4OGAC 4FZEL 4LDOB 1G9NH 5ADPL 4U1GB 2IQ9L 1D6VH 4D3CH 1JPFA 4R3SB 3FQWA 1KOAA 3MRNA 4BFBD 3DUUA 4EI5A 5JXAH 3KPNA 1D5BA 1NAML 5E0QA 3PHQB 3L9RA 3O2DL 3RTQD 5A3IC 5AZEH 5F7MC 4FA8A 3IU3B 5K9KA 3GBLA 3BE1L 5C07E 2VJXA 1Y6KR 1WGOA 1T0MB 1ZE3C 1JUFB 2IBZX 3VI4E 4Z77A 1DQMH 2DS4A 3O2DA 4EOWH 3B9EA 4YR6A 5HTSA 3KPLB 5HPOA 4R97C 2VLKA 4Y8AA 5D5MF 4GAGL 1MFCH 1PG7H 3Q6FB 1D9KB 4X6CB 2NY4D 4DZBB 5DJ2B 3MBXL 1VA9A 1BD2D 1KN2H 4EUPA 1NGYA 4OM0H 3CH1A 4JQVC 2D0FA 5CD3A 2A74A 5DO2D 3MRCA 1SJVA 3F65A 1P4BL 1EZVY 3N1PC 1RU9H 4G8IB 3P77B 3QO0B 4UNUA 3B2UC 4TNWF 3LKQA 2FX7H 1T2QH 3VMPA 4PJGE 4PJXF 3QDHA 4NZTL 5ACZA 5J57B 4GG6E 3MV9B 4UI2A 5F44A 5IROA 1ZGLM 1YEGL 2ARJB 3G6DH 1UB6A 1MCDA 5HY9B 3MRMA 1YMHB 2HVKA 1ORSB 1OTSD 4Z7WF 3P11H 1SY6L 5GSVB 3TPKA 3ZDYF 4YHZL 1A6VH 3PWPE 5HSFA 2BOCA 4DUXA 5TFSH 5C8JA 1OP3K 1DJSA 2AKRB 4Y16C 4TULL 1HILA 3L5IA 4MNGB 1IAIL 2EZ0D 2A6IB 1JGLL 2C1PA 4PV9B 3T0VA 1CGTA 3U1SL 4MD0A 4WHTB 5IVXE 1SY6A 3SGEH 1UXSB 3P4OA 3HI6H 8CGTA 1IFHL 1EX0A 3T0XA 3MBED 3SQOL 1KYOK 1W72L 3WFHA 2XNAB 4RMSA 1YA5A 3ARFC 1C5BH 4P57B 4UDUB 3TYGL 4U7KA 3O6KL 4YXLH 3SKJH 4HLZH 4GQ9H 1JWUA 2H3NA 4HK3J 4PTTA 3ZT6A 3DV6B 5DLMH 1RK0A 2DIAA 4POZD 5JW4Q 4AK1A 1KEGH 1MCEA 1AC0A 2PYFB 3WHE1 2J5LC 4GW5B 4N90E 2VLLB 4N8CH 3HRZA 1OTUC 5FIEA 1JHTA 2CKBH 3VFSA 1JF1A 4NO0A 4U6XB 5DRXB 2R0WL 5GGVH 2Y6SD 1RUQH 3MCLL 5IK3A 4TOYL 1T1WB 4HS6B 2NXYD 3IS0X 4HF5H 3E2HC 2QKIB 3CLFL 3S9DB 4JO1L 4KVCH 5GZOC 1A3QA 5D7IB 1KFAH 4HWZA 3TIDA 5IVOA 3CFBA 1C7TA 4X7DC 1DSFL 4KKLD 3UAJC 2VDQL 5FGCB 4F37K 1VHPA 4NNYB 3T3ME 3IF1A 3RA7L 2XKSA 3QBTB 2I07A 3HR6A 1XZ0A 2EDFA 2XV6B 4JRYB 1J1XH 5JHDA 4WW2F 4PIRF 1I1YB 4TVPE 1JRHH 1S3KH 2BXZA 3CZJA 2ILLA 1JBJA 1Z9LA 3BQUD 4U1KA 3RWIB 2GCYA 1A6WH 1JCKA 5C2BL 1ETZB 5C0AB 4ENEC 2OZ4H 5K9QG 1RIVH 4TSCL 4P5TD 3MJ8A 5E70A 5K59F 1KLGA 1UVQA 2H8PA 1YQ2A 3FOMA 4KJPD 3U7WH 1G7IB 2BFVH 5GS0L 4WTZG 3S3PA 4HGWA 5FYLE 5BJTB 1V3KA 4PJCB 3VXME 2BSTB 1CDIA 4GMSL 3GUTA 3K2UL 3TNNB 1F02I 1EBPA 1G0YR 2V7HB 4U49A 3TZVD 2XYCA 1NEZA 4WHYG 3JTTA 1HE7A 1C08B 3TA3C 2MHAB 5C08B 4WGVB 4JZNB 4G3YL 1MCKA 4X98B 4EI6A 4BUHA 1MREH 2IPKA 3ZYOA 3CFJA 1FRGH 4R90H 4LASL 3TJHD 5F7UA 2E3VA 1A22B 4QRUB 5EBMA 3WXWL 3QUMH 5CIPB 1BQLL 4C56B 2OL3B 1EEZB 3U36A 5H94B 1RURH 4CADA 2HG5A 4LL9A 4YFLI 4LCUB 3CUPA 2JB6A 4DGIL 4KJYA 4P5MB 2PTUA 4XNMA 3DIFA 4WEBH 4Z7QF 4ZFOL 5FEBA 3MFFB 4O9HH 3H2WA 3LEYH 5I1AA 1T1XA 4HWBL 4NKMA 4MD4B 1JZ8A 2MFNA 3N1FC 1BVLB 2E9IA 2MQ0A 4QTIH 4WRLA 1UH3A 1U95A 4EIGB 1QP1A 4ZTPH 2NX5D 3REVA 5C0NC 1I3GL 1IGFH 3MYJB 4PJ9B 5B38A 3EZJB 1N64L 5D2NC 4G43A 1FZOB 4UBDC 1L9NA 1S9YB 1J5OL 2DIBA 2W59A 1BHGA 2NYYC 5D1XA 3CSGA 4OB5L 5D7LE 3IB4A 2V2XB 2X4RA 2GAZA 1JFQL 1I3RA 1CFVL 3O6LL 3HPLB 1N4XH 3E6FA 3VXRA 4DFHA 2PW2B 3GIZH 3QQ9C 2HJKB 3MNWA 1SYVB 3VRLF 3EW3B 1XF5A 3QEGH 1B2WL 4LCCC 3QIBA 4YDKL 3VMOA 4HH8A 3MGTB 3OKLB 4F8TA 4YQXL 4XXCA 3ULVE 2Y72A 1KPRA 2FD6H 5HHNA 1FAIL 2OK0L 1ZGLA 3K1DA 5EA0L 2NNAA 3MRLB 3D39E 3CJJA 1GZQB 1UYWH 2V2WA 4PUBH 1NUFA 2R4RH 1R3IH 3VWKB 1F4HA 5BS0D 4X6FB 3KPRB 4GAYA 5SWSB 4JJ5B 2APBA 1U2HA 2PTTB 4WW2C 3V2AR 2EDNA 4OCYL 3QEQB 4YPJA 2PO6B 4LKXB 2BXYA 5TE7H 3VFPB 1M7XA 4M48L 4U0QB 2R2CA 3GBML 3H0TA 1DLFL 3QAZC 1S7XA 2UVEA 2A9NL 4Q2ZA 1TCRA 3D85A 1Y0LB 1JJUA 2UYLA 3KLHC 1YY9D 1OSPL 2YD9A 5KVGL 4GBXA 1AD0B 4M3JA 1X5ZA 4EKXA 1OGAE 3WDJA 4WWID 4NUJA 1XH3A 4H20L 4K8RL 3QG7H 3CD4A 1OSZA 2LTQB 1XF4B 2VKWA 2I9LB 4U3XA 4MXVE 3U7YL 2PNDA 2CDEB 4XMLL 3WBDA 3IVKA 3X3GH 1CFSB 5INCA 3IFLH 1I1AB 4LVOB 5EC2B 1I7UB 1U91B 3U30C 2YPLA 1JPST 1K8DB 2QQKL 3LHPH 5L6YH 4NNXB 4JVUA 4HC1L 4LHUD 3VWJD 1XGRA 2F5BH 3U2SA 5DT1L 1LDPH 3OAUL 1ZT7A 3C08H 4NN6B 3M1BB 1NCAH 1LEKB 4M7ZC 3MRJA 4ETQB 4UT7L 1JGEB 4CUCA 5JHDD 5CSZA 1F6LL 2IWGA 3O45A 4U05A 3TT1L 3VFUA 2ADGA 2CD0A 3UTPE 5FECB 4PJBA 3IDUA 4HXAL 4OF8A 3OXRB 5DD0H 2O5XH 2W1NA 3BVNA 4LLYB 5CZVH 1JI1A 4XP1L 4Y4FB 4XP4H 5I73C 4TTDD 3HNTH 1VEPA 3GMPB 4XPAL 5IW1A 3PWPB 4AH2B 3X11B 1R5IA 3SJVE 3IKCB 4RSVA 4NQDD 4X4ME 2I24N 1ZANH 4YNYA 1R0AH 4HQQH 3MRDB 5IW6B 2XZAL 5IVXB 4LMQI 3QNZB 1U8PA 4I0CC 2ZSWA 4M93C 1X5AA 1KN4H 4XP5H 1TFHA 35C8H 3Q0HA 1CQYA 4CVZA 4Y5VB 4Y19A 3S96A 1AGCB 4I8DA 3CVHB 3WE6A 3D25B 4ZO9A 4U2ZA 2DQUL 4V1DD 3LKOA 4HS8L 1QLEL 2B0SL 2DJUA 3TC9A 2WUCH 2OX5A 2P48B 5C09B 4RMUA 4ZFGH 1KELL 4OZFA 2BVQA 4Y4HA 3DRQA 1X5XA 1KLUB 43CAB 2BY1A 3GSQA 4XBGB 4DGVL 5EO9A 1O7SA 5I1HL 3PV6B 4QRSA 3HNVL 1DUYB 4OZGB 5JPNB 2W0PA 4H26A 4CMMB 1VFAA 4LPWA 4CNIB 3BXNA 2V2TA 3SE4A 5GZND 1WZKA 1BREA 1OTTC 5JA8B 5I8EB 3BH9B 3QDJD 4ZG1A 3HUJA 5GRYA 2GIYA 4S1QH 4XPGH 1LMKA 4NO5B 1N6QL 1R3JB 4IOFC 2EDXA 2W9EH 3JUZA 3RVXC 1CFQB 4KY1H 5DEFA 2X1XR 5J6GB 2RAMA 5I1LA 1W0WA 4HJJL 4WWKA 1U41A 3PGDB 3V8CA 3H9SD 3OKNB 4QWWD 3V95A 4MWFA 3FB8A 3BZ4B 5F6IC 3EDEA 2VR9A 2V5TA 4L3CB 3S36X 4LGRB 4H25B 1WAAA 5D1XD 4Q97A 5E9DB 2GT9B 5JR1H 4OLUL 3FQRA 3QDAA 4FQIH 3ZKQD 4MJIA 5I76B 4XNYL 4AG4L 4I0PD 1UQSA 4CU6A 5IIEA 2P24A 1C1EL 5IHZB 2V5YA 3QIBD 4YEFA 2UUDH 4K3DH 3VRIA 2Z9TA 1AD9B 3KPQB 3NABL 1KIQA 4APQB 4MDIA 1IRAY 5EZLB 3NA4A 2CLVA 4K9EC 3MZTA 3VA6A 1P1ZA 5JORB 2Y5TB 5L8JB 1TDQA 5LBSL 1IQDB 2FJFB 4CVXA 3PE9A 4F57L 3TBTB 4UB0H 1A14L 1QBLH 4LNRB 1MFAL 4U3HA 1BLNB 1XCQB 3VXMB 4HMDA 1XGTA 4M7JL 1LE9A 2UWEA 1EHXA 1A0QL 2DM4A 4KPHH 1WFNA 2ORBL 5IB2A 1A47A 1IE5A 4XP9L 2FIRT 3NCCB 2DQHL 3HAEA 3LCYA 3CXDL 1LP9E 1KF9B 4HK0A 3K4AA 2APWA 5HYFA 5D2LF 4XPHH 4Z7OE 4PG2C 2R0KL 3TLRA 4P23A 3D85D 4M62H 4YC2C 4UZGA 3EO0B 5HDQL 5T3XE 1D9KD 4PBXA 5BRZA 4H1LA 5F6HJ 1YNLH 5LG1A 5E5UB 4CVUA 2CRMA 3DHJA 3GRWH 2PXYC 3UYRL 2IQAB 1E4JA 3JV4A 5AWNH 3SGDI 5DQJA 1JNHB 4HUVB 4WI5A 5B38G 1Q9WB 1MFDL 3BWAA 2AJSH 2P8LA 3BUYA 1ZHLA 3SDDC 1NL0L 3QIUC 3OJDB 4K8RD 1OGTA 2ZCHH 4OQTL 1EUUA 4YAQB 1GAFH 1UM4H 1FNGB 3ROLA 4LPTA 3B9AA 2XQBL 4BELD 1FDLH 1B0GA 1V7MH 2FATH 4R4BA 4QYOB 4G6ML 5TDNB 2ZUQC 5D8JH 4EQ2A 3RUGE 3K2MC 3VXUB 3ZDZF 4HUUB 1ED3A 1P9MC 1U8QB 4HBCL 4ESKA 2FX8L 3NPSC 5D7LB 2ZCLH 2DM7A 4PY8J 4OV5A 5GGUA 2VDRH 4JQXA 2C3GA 4MMZC 3JXAA 3ARTA 3QUYC 4DKDC 3GK8L 3D0LA 4XAKE 1K8IA 3HZVA 4DFIA 1MHPL 3GSWB 4DAGH 1C5DA 1U8IB 2XTLA 3QHZL 2X4UB 5I75B 2XI9A 2CRYA 1PEZA 3O3DB 4QRPE 4PJFB 2YBRB 1QYGH 4PYGA 3EGSA 2VL5B 4XMKL 4LU5H 2Q8BH 5FXCH 2H41A 1S9KC 4ZO6A 4K9EH 1CLOL 3LKRB 1F4YH 5KJRH 3MREB 4JEGB 5F1NB 3IKKA 7FABL 3RTQC 5FDWB 2EKSA 3MODL 4MX7A 5IEKA 4HFWB 1A1OA 1KCVL 3IETA 5L88L 2Z8WC 5GS2D 5I1IH 5D96C 2V7NA 4FQXD 4XTRD 4XMPL 1YC7A 5DHYA 4AMKH 1NH6A 2ZJSL 1M05B 4ONGL 4RMTA 3EYVA 4Y4KD 3V5KA 3RKDD 4PG9B 3MCKA 1WT5A 4U1SA 4UT9L 4XBPB 4PJ7A 2OXGA 2C4FT 3BPCA 5JIIA 2NY4C 1P5VA 4YO0B 4DW2L 3VE0B 3AFLA 2VDLH 5J9PA 2CLZA 4FXGA 4B5EA 1KJ2L 3RWJB 5DO2C 3BPLB 3TBWA 3D2UA 5HDOA 3ES6B 2ICES 3PDDA 4JGMA 4RBPK 4U33A 2X2YA 5F7KC 2A6JA 4OF6A 3SDXA 1TZGL 1J87A 3LIZL 1QR4A 1N3NB 5BZDA 3FOLB 3MJ7A 3QHTC 4LLWB 4QLRA 4MQSB 4PJ5E 4F9PA 1S7UA 1KJ2A 4WWKD 3SBWA 1OQXA 4GS7B 3PQYA 3STLB 4MB3A 1EERB 1FFNB 2N56A 5BVJA 3NAAL 4KKBD 2HH0H 3IRPX 3O9WB 4RGOL 5TF0A 4X6EB 3WFDH 2X7LA 1D5XA 2ADJB 4NZJA 1JYWA 2Y36H 1WC7A 1AHWC 4KRLB 3O6FB 3CVHL 3Q2CA 5A40E 4NQCE 4LEXL 1INQA 1MI5D 2RB8A 3C09C 4LSRH 2RJMA 3I6KB 1AO7D 3MBEC 3OKEA 1Y6NR 3QFJD 1PFCA 2EC8A 5A16A 1EIBA 1Z5LA 4P3DB 3DHMA 1NCBH 1NFIA 5C08D 3HMXA 3MMEA 4E0RA 1DBAH 1J0IA 2XKUA 4JAMA 3A6OA 5D9SB 3SJVB 4POZC 5DEZA 1S7RB 1J05B 4RZCA 5E99H 1LE5A 1F90H 3X12B 3KYKL 1OAUL 4D0CA 2P7TA 1JPFB 2QBWA 4C56D 1NBZA 3DUUB 4EI5B 4N68A 5JOFA 1D5BB 4Y2DA 4TN9A 4BZ2H 2APTA 2NXYC 2Z92B 2G5RA 4ISVB 5HGDB 1I1FA 5ID0A 2IJ0C 2QJDA 5CFHA 5GGTL 4NQSA 1HI6B 3CFCL 3C8HA 3FAXA 4UTBL 5LXGH 4Z77B 1F8TH 4NBXB 3BKCL 4YR6B 4KKLC 4M5ZH 4YIQA 2VLKB 2BHYA 5KVEL 4MQTB 4BZ1H 4TVPL 3MA7A 3QRGH 5ENWB 3UPCA 4KHXL 3VFOA 1NGYB 1T04B 1NCTA 4F9LC 3FHQA 3ILPA 3W11D 3CH1B 3S5LA 5C0DA 4Y5XC 2A74B 3TN0B 3MRCB 2DBLH 4RRPG 4PJAA 4UV4L 5IMLB 1E4WL 3BQUC 3LKQB 3I3BA 4YHPB 2D7TH 4ODSH 1JGVL 5FYLL 3HI5H 5FHAH 3CXHK 2ICWA 3PIQA 5DEGB 4HG4J 2JCCA 4KJPC 3MRMB 3GKWL 4CL7A 2HVKB 1S7WA 1I9RL 1RZIA 2VH5L 4J3VA 2XA8H 4P59H 4C83A 3UX9B 3FCTA 4WVRA 3SE8H 2X9XA 5B3NA 2BOCB 4BZYA 1F3DJ 4KV5F 5CKGA 1NDMA 3TZVC 3VWKD 2ZPKH 1W0VB 2C1PB 3KPRD 3RDTB 5MENA 4EDXB 5GHWH 3TNMA 4URTB 3QEQD 5HVHC 5ESAA 2YWYA 5EUOB 3DYPA 3HR5A 2VDKL 3OSKA 3WFHB 2AV1A 1R24A 3TJHC 5DURD 1CGXA 5E6YA 3G08A 3HAEG 2AJYL 4ONHA 4F58H 2ICWI 3OXSB 5FDYA 5IG7A 4O2EA 1EMTL 2XZZA 2X44D 1JWUB 5J0BA 3QQNA 1RK0B 5E2WL 3SDYL 3G5ZA 2EYRA 1QSVA 2JE8A 2ARJQ 5C07D 3MLYL 1EVTC 3HRZB 3OPZH 1QEWA 2MNUA 3VFTA 5DMJB 4JFQB 4JDTL 2Z31C 2HA1A 4OLXL 3ZTNH 4HUKB 5L2KA 5EH1A 1BF8A 5JTWA 2J6EA 4KZEH 3W82A 2OR7A 3S6CA 1UA6L 3DNKA 1J7VR 1F4WH 1PX4A 2VNCA 2EO9A 2EC9U 1VKXA 1HHKA 1U8KB 4YLQT 2K7PA 5GRXG 3D2UD 4UV7H 3UTTE 1A5FH 3KXFA 5EIIA 3CFBB 4JG1L 5DD6B 4HMCA 3V0AC 1MCQA 2IH1A 5ERWA 4M6OL 4J2XA 4FNLH 4UINH 3VA2C 1Q9KA 1XGUA 1AC6A 4XP6H 3V8OA 4IBLT 3ULVL 5GRVK 4EXKA 2I07B 5J06A 2FHCA 3O4OC 1XZ0B 3PP3K 4QXWA 1SQ2N 3PXHA 1T5XB 1QA9A 4NQUA 3IFNL 3OAYK 3T0BA 5EU4A 1QZ1A 2ADIA 3D3VA 4Y4FD 1I9JL 2R29L 2XRAL 3V7AE 5K9OA 4X6BA 1T1ZA 5L7XL 2NY5C 5IR1A 3TESA 1QPXA 3PWPD 5C9KA 1EDQA 4ERSL 2XICA 3GSNL 1MCOH 3MJ8B 4FP8L 5HHQB 1KLGB 2H8PB 3EYOB 4IRJA 1HQRA 5DD5L 5EZJA 3FOMB 2J8UF 2ZG1A 1OP5K 4B41A 3D39A 5KSBF 1RJYA 1JHKH 2BNRA 1Q9OB 3KJ4C 5DJAA 4HGWB 1PQZA 2R2EA 4N8VG 5EU3B 2F8XC 2OJEA 5ITFA 4X80L 5F3HB 1MFEH 4XVSH 3GUTB 5T5NG 1A9EB 4XAWL 3HE6D 5DI8B 1GGCL 1FE8H 3EZ8A 4IRZH 1NEZB 1I9IH 4PB9L 3V6OC 2NXZB 5BO1L 3T2NL 3BKML 1OT2A 1XR8A 4WI4A 4NWUH 1YZZA 1TNNA 1IGCH 5K9QI 3RWEA 1YY9C 4N90D 2RCSL 3QXUA 1OWRM 1J0HA 3M45A 2Z4QA 2DQEL 4FZEH 3WFBL 3WIHL 1BM3L 4P5KB 5EBMB 1GXEA 4HZLA 2IQ9H 1T7ZA 2NQCA 1FC1A 2XACC 3U36B 4L4TE 3IFPA 4S1SL 3FJTA 1NAMH 3QCVL 3CUPB 2F54E 2XWTB 4HWUA 2W0LA 3DIFB 5KANI 3MRKB 5HGGS 5TGBA 3WIHA 4IRSA 3VWJC 3DX6A 1HKLH 1RUKL 3BE1H 2EEBA 3GB7B 1HHIB 4NKMB 5FFLA 2DQGL 5I1AB 1KCRH 3BN3B 1AR1D 5FOBA 3VJ6B 3LN9A 4FFZL 3LDBB 5B38B 3L5WA 4G43B 5EOTA 1PGRB 4GAGH 3TGXA 1I7TB 3U0TA 3MBXH 2A73B 2GJ6E 3OV6A 2WWKO 4TVPD 1ZK9A 2X42A 5JQ6L 4LLVA 1HNFA 1A3LL 2G75A 1CDHA 2GAZB 3UJJL 2P8PB 1I3RB 3GEWB 5DRZA 1P4BH 4I4WA 4TTDC 3I9GL 3WUWG 4X8XA 1NMBL 4K3GA 3W0WA 3RGVB 5HVWA 1XF5B 4E9LA 4NN5B 2VIRA 4NZTH 4YHYB 4NZUL 4CU8A 1YEGH 2NY5H 3OAZK 3MLXL 5FYLD 5CJXC 5HHNB 4IMLA 3VXMD 1L6ZA 1KJ3L 2GTWA 2FDBP 4J7RA 5F9JA 3B83A 4L8SC 1U42A 1GZPB 5CZKA 2V2WB 3WIFA 2F8OA 4Z6AT 3IAGC 2FJGB 4UQ3A 5J8OA 5EOQL 4GAYB 1IAIH 1XCTA 2ZKHL 4QGTA 3JBG7 1NMCB 4I18B 3U1SH 4LVHB 3L1OL 1MNUL 1OB1A 4YGVB 2XIDA 1TVHB 1LO5A 1HXYA 3SQOH 1XMWA 1W72H 3H0TB 3WLBB 1Q72L 1MCSA 3B8SA 4NM4L 5MEPA 5JHLH 4AIXA 3TYGH 3O6KH 3I2CL 4QHUA 3VMNA 5GZNC 1C8PA 1U8MA 1JNJA 4YK4B 4JN2A 1AI1L 1AGBA 4NUJB 4JRXE 1XH3B 3RQ3A 5CMAA 5DSCA 1ZTXL 4J3OC 3C5ZB 1TJIL 1IJ9A 4EBQL 2WIIB 1N5AB 2R0WH 3IVKB 2B5IB 1YECL 3MCLH 4QWWC 4TOYH 1RZFL 5IW3A 3NFPA 2XFXA 4I13B 4YHIB 2YPLB 2B2XH 3RIFK 3G6JF 5EO1A 1FCCA 3CLFH 1A1NB 4JO1H 3WO4C 1XGRB 2X10A 5D1QD 3AM8C 1BFOB 2VLME 1G6RA 5D7LD 4ZTOL 1FGNH 5ACMA 4UU9B 2AJVL 3HZMB 3QIWA 4D8PA 4LCYA 1KPUA 3GMRA 4FQLL 1RFDL 4MZ2A 4BSWA 3VFUB 4PJ8A 1K3ZA 2ADGB 5C7XL 3RA7H 1ZHKA 3CSYA 4PGEB 5D1ZA 1IL1A 1P7HL 5DS8A 4PPTA 3MUJA 3EYSL 3BVNB 3ULVD 5CBEB 4U1GC 3DGGA 2YD4A 3QXDB 2Q7YA 3AVEA 3BI9X 3D0VB 1GPOL 1W8NA 3OKDB 1EGJA 2MTPA 4GAFB 5A43C 3D39D 5I17A 4Z7VF 3TVMB 4FFVC 3DROA 2IGFL 3H8NA 2DQCL 1U58A 1YMMA 4TSCH 5CBAB 3MSPA 4LGPB 1FYTA 5JZ7D 2GSGA 1I4FA 1Q94A 1U8PB 5T3XL 5J13B 2ZSWB 5JLZA 5CJQH 2EXYD 1KT2A 3OR7A 4CVZB 1LP9A 3S96B 2R15A 4QHMB 5IBLD 4GMSH 3WE6B 4WV1A 4QRRA 2J1KA 1OD9A 3K2UH 3OTTA 4N5ED 2NY1B 1D9KC 5DD3L 3HC0B 4NFCA 4JQIL 1IM9D 2Y1VA 4MXWL 2J8OA 4Y4HB 3DRQB 1OGAD 5H37G 3PWVB 4OCSL 5BMFL 4CAGA 3O3BA 4PJCF 2FEEL 5EO9B 1JPSL 3ECBA 4HPOL 5HYSG 2B1HH 4QRSB 5FV1L 3CH8A 4WU5A 3SKUD 3EFFA 4H26B 1VFAB 4ZOAA 3WXWH 2V2TB 1KJVB 2JJTC 1BQLH 4MHHI 4TSBH 4K8RC 2CLRA 3K8KA 5ALCL 3MJ9L 2O5ZL 4EN3D 4KK8D 4YXHL 3L3JA 1DBJL 2PCPB 3GMOA 5TH2B 5I1LB 1S9WB 1W0WB 4P46B 4JO4L 3UCRA 4HWBH 3AU1B 4WIQA 1UWXK 3BEVA 5E8NA 4PJEA 5D7SH 2NR6D 1IEHA 4P2RA 1X44A 2F74A 3PV7A 2LQRA 3O6FD 4Z7UA 3MJ9A 3AS0A 1I3GH 5SWZE 3JVGA 1J5OH 2ATPA 2D7PA 2AEWA 4OLVL 3Q3GB 3D69A 4OB5H 2DI9A 2HN7A 1UQSB 3WUZA 2P24B 1I7ZA 1CICB 4I3GA 4UTAL 1CFVH 1MY5A 3O6LH 2FEEI 1KIQB 4MDIB 5HYJE 1BBDL 3SJVD 1KEML 2CLVB 3HG1E 3BYYA 1FIEA 1PKQB 1B2WH 3DXAE 5EBLA 2RGSA 3L3IA 4Z5RA 4YQXH 4FQXC 2ATKA 4LPVA 1XGTB 4QXTA 3EIFA 4XTRC 4JFDA 2Z0BA 1FAIH 2OK0H 4WENB 3TFKC 1TTFA 2PN5A 2F53E 5KS9F 1DVFD 4M1GL 4Y4KC 2F8VA 1GH7A 2DTMH 3RKDC 3K4ZA 3HAEB 3QO1B 2R2HA 3QXAA 4HK0B 3B3IA 5IBUG 1RVFL 3HPJA 4OCYH 1YPZA 1MQ8A 1BZQK 2JB5L 2Q7NA 4PJHE 1FJ1B 1JN6A 3OGCB 2X4PA 3CZFA 1U8LA 4M48H 4ZXBB 5KSVA 4K7PY 1CT8A 5A2JH 1QTYT 2D0GA 5KSAA 1I8MA 4L4TB 3WIIL 5HYQA 2A9NH 2BSED 1F3JB 2F54B 1C16A 1CD8A 3GHBL 3JV4B 3TN0D 1OSPH 1U3HB 3QUKA 1AGDA 4XNXL 2CMRL 2W65A 5DQJB 4H20H 4K8RH 1F11A 1RIHL 4WDIA 4J3UA 3BWAB 1QRNA 2D7OA 4KKBC 4W4OC 3U7YH 3S3SA 1OGTB 4NQVB 2C3HA 4XMLH 4AIZB 4M5YL 1B0GB 1EHAA 4R4BB 5L8LB 2I60L 4M6AA 2QQKH 3VFGL 4HC1H 1ED3B 2GJ6B 4Z8FL 3V5HA 4LKCA 5DT1H 3OAUH 2WLZA 1KTLA 2AQ2A 4PRPE 1S7TA 2QQNL 4OV5B 5C0JA 2Y4SA 3U46A 3KHQA 3RDTD 1YN7A 5ILTL 3P4LA 4UT7H 5E8OA 5AYQA 1BX2B 1LO0L 2LV4A 1FZMA 2Z8VC 1K8IB 4RX4D 3TT1H 3HZVB 1WCBB 4F7MB 1C5DB 5D93C 3VD5A 4HXAH 1AY1L 3HMWL 2AS5M 4HUWA 3SKOA 3MGAA 5GJTL 3ZE0E 4XP1H 4N8VB 1FZJB 2FHBA 4GMTL 2XT1B 1KIPB 3BMWA 2WNGA 1H8OA 2VR5A 3P0YH 4PJGF 4QHKJ 2EKSB 2NY0B 5EFIA 5GS2H 4GG6F 4MX7B 5IEKB 2EH7H 4MNHA 4M03A 4XPBL 4L8CB 2DQDL 3EDDA 5KOMC 2XQYG 4OCLC 1A2YA 2V7NB 1U3YA 3QDGB 1CD0A 4A6YL 1ZS8A 3AS1A 3I6GB 4L9LC 3SCMA 5HBBA 3H3KA 3PWJA 5T3XD 3V5KB 4KJQD 1MCWM 4OLWL 4PJ9C 2PF6A 5C9JA 1CDCA 4LFHG 4U1SB 3QUXA 3U9UA 3BPCB 3IAQA 1QLEH 2B0SH 5EN2B 5IVXF 5DK2A 5J9PB 3I85A 1G7JA 4FXGB 3W11C 1KELH 4LCWA 1HCFX 4ZUTA 4A6YA 3AY4A 2VXVH 3ZDYE 4U3CA 1VADA 4DGVH 4KZDL 1RJZA 5I1HH 3B9KB 2A6JB 3VXQA 2ZNXA 1SJHA 3HNVH 2VDPL 4NP4L 3SDXB 1IGYA 3RWCA 4YHML 1QD0A 5BZDB 1UGNA 3N1MC 2CK2A 4YHLL 3K81A 1LO3L 2ED8A 3GBNL 3B8YA 1S7UB 1VFBA 4ODWA 2IPTL 1F6AB 3PQYB 1N6QH 3DECA 3QH3A 3GSOA 2E7CA 4OZGF 4X5LA 5IJKC 5ANMA 4HJJH 5E94A 5J12B 2HWZL 1YJDC 3F8UB 1U92A 3FFDA 4RA0C 4D0BB 1IC5H 5E7FA 3VWKC 1OLLA 3WUWB 4O2CB 5FF6A 4KRMB 3SGJC 4OLZL 3GSXA 5EPMB 4XAKD 3MLTA 4JGUA 1QKZL 2VXSL 4OLUH 3OKEB 4R4FH 5A16B 4QRPD 1Z5LB 1B0RA 2BNQA 2VITA 5GJSL 3T3MF 4YJZL 4XNYH 4AG4H 4Q9QL 4JHZA 1C1EH 1NBYB 1X5HA 4U1NA 3UYOD 5A1AA 5IOPB 1N2RA 2AXFA 3NABH 4JAMB 4YE4L 2PYEA 4OZIB 1AFVH 1MJ7L 1RMFL 3P9MA 5F71A 1BAFL 2YK1L 4I5BA 4RZCB 5CIPH 3L6FB 2OL3H 1O7VA 2LTQC 5LBSH 4F57H 4LARL 2P7TB 1IC1A 5CHNA 3LRSA 3VD7A 5JW5B 5JOFB 2VISA 4LEOB 1MFAH 2RR3A 2ZUWA 4M7JH 3OF6D 3VXSB 3EO1B 1A0QH 2AJUL 3PWLB 2HRPL 2ORBH 4XP9H 2DQHH 4NQSB 4R9HA 1ZSDA 4YUEL 5K93A 3DUHA 2QR0B 1F5WA 1YEFL 2YC1A 4OF5A 3TO2A 3QZWA 4YIQB 3UTTA 2HYMA 3FTGA 4JCMA 1NC4B 4LLQB 5HDQH 3MA7B 3JWOL 2H9GA 2DL9A 4M7LH 1OAYL 4PJ5D 3ILPB 3S5LB 5C0DB 5LWYL 3UYRH 1V7NL 1UT9A 2UZYB 4PJAB 4HUMB 4Y4FC 5SX4I 2CRIA 4C4KO 2KQMA 1F4XL 1V3JA 4KROD 1P4IL 3RGVD 3PDOA 1BOGA 1MFDH 2PW1A 1NL0H 1C5CH 2QQLL 3ZE1E 5ADOH 3PIQB 4OQTH 5J1TC 3BJLA 2JCCB 2AERT 4NQCD 3FFCE 1ZLVH 1ZA6A 4KQ4L 4RFNB 3BEWA 3QEUB 4G6MH 5SWZB 1YJDH 3BGMB 2AP2A 5E6IB 3CPLA 2V5SA 3FCTB 4KH2A 4JDZB 1WFOA 4HBCH 1FQ9C 3HE6C 4X5XA 4N0UA 3D9AL 2V6HA 3T2QA 3WFCL 4AQOA 1VESA 3K8LA 5JMOC 5MENB 2MQ3A 1FBIL 5IFAL 4FQJL 4JPIA 1I8LC 1BQHA 3TNMB 3WJJA 4GRLA 5TE6L 4FQ1L 2R0LL 4U1LB 3GK8H 2IALA 5AEAA 1AP2B 3A6CL 5T33H 1ITCA 1RJLA 2DLGA 3K1KC 5I71B 3DXAB 3OL2A 2ID5A 3QHZH 2AV1B 3LZFL 2H32A 5KVDL 4DN3L 1FNEB 3R0NA 3G08B 4ONHB 3TO4B 5IG7B 1NSNH 4XMKH 1H9VA 1Z0MA 2EDJA 2F5AL 1ZT1A 2F53B 1CLOH 4HEPG 3UTSE 7FABH 4EDWL 3KG5A 4BH8B 3LPGA 4FQHA 1YEDA 3MODH 3C5ZD 1KCVH 4OZHA 4PJDA 3ULVF 1ZT4A 1R3LA 3O4LE 5D72L 1A7RL 5L2KB 5ICZA 1GCFA 2HT3D 4FQ2L 3SEPA 1AR1C 4PJHB 2ZJSH 4ONGH 3ARDB 3CDYA 5KG9B 1VKXB 2WK2A 1RK1A 4UT9H 1J10A 4MLIA 4Q6IC 5I1JL 4DW2H 3IDYC 3KXFB 1FIGH 4LRNL 4CU7A 5IM7A 2P44B 1FFPA 1R3HA 5IP4A 3CX2A 1W8OA 3DSFL 5ERWB 3GSRB 4PJIA 4WTXA 4P9HL 1XGUB 3DI2B 3P0GB 3ARBD 3PL6B 4OV6F 4FMKA 5GS1A 1I8KB 4NKIL 4FG6C 3P4NA 4UMGA 1TZGH 1QA9B 3QCTL 3LIZH 4S0TD 5INDA 5EU4B 4L29B 2A2QT 1UJ3B 4ZUUB 3T0EE 3L7FB 4G9FA 3OB8A 2D3VA 5J3HD 4AL8L 5BQ7A 2NTSP 3P73A 1E4KC 4R0LB 4X6BB 1T1ZB 5IR1B 4NC0B 3VH8G 1T80A 5DFVD 4MXVF 4NWTL 4N0CD 2PR4H 3TVMD 2EIZB 4AM0A 3NAAH 4KKAD 4PRPB 4RGOH 4N0FA 5EZJB 4IRJB 4UOW0 2YEZA 2BNRB 5M7QA 5DJAB 4NQXB 5HI4D 1PQZB 2R2EB 3CVHH 5D7JA 2OJEB 4KFZC 4QRQA 3BSZL 5ITFB 4UOJA 1AR2A 3HZYA 4WUUE 3SO3C 3SPVB 4N9OB 3V4UL 2NY1D 4L3EE 1U36A 1X5FA 3AS2A 3LQAC 3RPIA 3EOAB 2BMKA 2BP3A 3LKSA 3GSUA 3MV7A 1RUML 5AD0A 1J8HA 5HHXH 4IOSD 4D9LL 1UM6H 4GH7B 4TNWK 4U31A 5IFHL 4XVTH 4H0IA 1LGVA 2Z4QB 1DBKL 3I6LE 4FTVE 5I19H 1VPOH 1A21A 5FK9A 2D2OA 4KHTL 1A3RH 1ZVYA 4NIKB 1TZIA 3IFPB 1PG7L 4X4XB 4OD1H 4BSJA 5FYJE 1MELA 3QWRD 1CGSL 1VGKA 4ZAKA 3S37L 4OM0L 2WQ8A 4NSKA 4LGSB 4IRSB 2V9QA 5D1QC 3UTTD 4P46D 5GGTH 1N7MH 1RQ5A 3CFCH 1F4AA 3JWDL 2VQ1B 3VGHA 4ELKA 5CZXD 1BZ9A 5BXFA 2D7MA 3F7VA 3MOQA 3BKCH 3VGGA 3KDMA 1CLZL 5EOTB 5AUMA 5KVEH 3H42L 2X05A 4TVPH 4YDVA 2J4WL 4KDVA 2KZWA 4KHXH 4QTHA 3P11L 1FYHB 3WN5C 3WHXA 5I75C 1OARH 4LLVB 2IFGA 3RZCA 1A6VL 3ULVC 5DVOA 3EO9L 1QSEE 1RUAL 3AXLA 1QBAA 3VFRA 2ENYA 1IMHC 1JGVH 5FYLH 2EIBA 1LEGB 3OR6B 3BZEA 3FN3A 3EUUA 5JZ7C 3GKWH 1J0KA 5FYKE 4PRAB 3AREB 4RMRA 2GTWB 2EXYC 1I9RH 1BVKB 1N8ZB 1E27B 5IB3A 5IBLC 5F9JB 4P2QE 3GNML 4JM2D 1UZ8B 5IQ7L 1AJ7L 4AT6A 4N5EC 4UQ3B 2R1WB 1KEGL 4RCAA 1P84K 5EU6B 1OB1B 2YXFA 3RWGA 4MJ5B 4M43L 1JF6A 2GY5A 3C6LB 5ICYA 1LO5B 3VG9B 4JKPH 2P43B 3LQAH 2EDEA 2VDKH 5EU5B 3THML 1GGIL 2IANA 2FWOA 1HZHH 1FFQA 4L4TD 1HHGA 4C57C 4HF5L 3PJSA 1IGJA 1JWSA 2AJYH 4ONOA 2F54D 5JW4N 5ALBL 1EMTH 2CXGA 2HFEA 2CKBA 5EUOF 3L5JA 5DRWA 3SDYH 1AGBB 5CMAB 2LU3A 4GS7C 4HS3A 3VXTB 3L95B 3MLYH 4WUKL 4EN3C 1RD6A 4QEGA 4KK8C 1OPGL 2C7UA 1DBBL 4HXBL 2WINA 1KB5B 3O9WC 3SGEI 4OLXH 4LVNB 2M1KA 3RWHA 3LKNA 3NFPB 3DYOA 3GI9H 1TETH 3O6FC 4RAUB 5EO1B 5IUSA 4CKVX 3S4SA 4AENB 2GJ6D 1JRHL 1DLHA 1G6RB 4QHNA 5FO8B 3KS0J 3QI9D 4XCNA 1KTRL 1A6WL 3GJEA 1EEYA 4JG1H 4JQVA 4Z7OF 3K80A 3QIWB 4PGBA 2IAMB 3E8UL 1KPUB 3FHAA 3GMRB 1J1PL 1SJXA 4M6OH 3C8KA 2JIXD 3OKKA 1BWWA 1A6TA 4PJ8B 3MRRA 5BW7C 5D1ZB 3ULVH 3FO2A 1IL1B 2QLVB 5DS8B 2HLAB 3FFCB 5C0IB 5K33A 4LHQB 4MD5A 4HGKC 3T0DA 1LILA 4U1HA 2OZ4A 1I9JH 2XRAH 4MAYB 3HC4H 3LV3A 1RIUL 2UUDK 1CLYL 3DGCR 4TRPL 4MJ6B 2GY7B 2NY0D 2OJZL 3I02A 4L8BB 3O3UN 1U58B 1DVFC 4U7MA 4ERSH 3GSNH 5GRUL 5B39A 1BWMA 4FP8H 4QNPE 1G7PA 4Y16A 5DD5H 2ERJB 1FYTB 4V2CB 3DX8B 1BEYL 1FRGL 3RUGF 1I4FB 1Q94B 2HRLA 1F97A 1KT2B 4RAVA 4W68A 4JZOB 4OIAA 1FNAA 4X80H 4U1JB 4CN6A 4QHLA 1ZLUH 5E24E 4XAWH 4TTGA 4WV1B 4QRRB 1GGCH 1N59B 1V3LA 1RURL 1NGWA 1JRHI 4JY5L 2G9HA 5E8EB 2C4FU 3ARFA 4XHQA 4PB9H 1IKNC 3BKYL 3T2NH 5BO1H 5FHBL 1YNTA 3BKMH 5FOJA 3FRPG 3CFDB 1CDUA 4O9HL 3SQBA 3TN0C 1XGPA 4JRXD 2RCSH 3QUMA 4OIIL 3B9KD 2DQEH 1P4LA 4OLYL 3WFBH 1BM3H 3M8OL 4ELMA 4OKDA 1GIGL 5IROC 3RL2A 3MRHB 2CLRB 3O11A 4KTYA 1F2QA 3QCVH 1S8DB 4HKZB 2X70B 4PLKD 1EO7A 2VLMD 2CR3A 2I9TA 1KTDA 4QO1A 5DQDL 3L3JB 3GMOB 3MLRL 43C9B 1RUKH 2DQGH 4P0DA 2FHFA 4PJEB 3ARQA 3P30L 4JFEA 3GIZL 1IEBB 3W5NA 1RY7B 2F74B 3KPOB 2J12B 1URLA 3QEGL 4Z7UB 3RDTC 5DFWH 5IB4A 1MHHA 3P9LA 1RAMA 4FFWD 4DKAA 2EIEA 4IIQC 3PG2A 3V6BR 4BKLA 5FO7B 1LQSR 1D5IL 2VN4A 2VZOA 2O5YH 3D69B 1M71B 2HN7B 2VLRA 5JQ6H 1I7ZB 1WIOA 4PRHE 2ZSVA 4NFBA 3UJJH 4BQ9A 5CGTA 3H3PL 5CKAA 3PABA 3I9GH 1QFPA 3C60B 4PR5A 4L4VB 1NMBH 1BBJB 3JTSA 3W9EA 4U0RB 4HKXA 4NN7B 3KR3L 5D5MA 4I3RL 4M9PA 4I0KA 1WWCA 5EBLB 5GRJH 5I1EH 4NZUH 1XR9A 3L3IB 3MLXH 1LO4L 5I1DA 1ORQA 2AEQL 2PUQT 1Z3GL 5F72S 4QXTB 4MA3B 3WFZA 4JFDB 2G60H 5IBTL 5IF0A 1LK3H 5HHOA 1KJ3H 1LDSA 3BJ91 1KULA 4LIQE 3WYRA 3SGKC 3FQUB 4KJQC 5D71L 4L3EB 3ARGB 3FZUC 4U6VL 2CH8A 3O0RL 4WY7L 2R2HB 4OGAD 1YYLH 2DYPD 3TA3A 3EOBA 1EPFA 3QXAB 4GG8A 4M1DH 4PJXA 4HJGB 3L1OH 1MNUH 3PXJA 3NCMA 1YPZB 5JW4M 5L2JB 5CJOH 4FTVB 1NC4D 1JN6B 4MB5A 5DGQA 4Z7WA 5KSVB 1EFXB 2VKXA 4Z9KB 1Q72H 1I8MB 32C2A 1VEMA 3W5MA 4XGZA 3DVNA 4KK6D 4ZSOA 2F5BL 1C16B 1KIRA 1OP9A 3MRGA 2IBBA 4ODUB 3G5XA 4K2UH 3C08L 4XRCA 2DLFH 2W65B 1AI1H 3LPWA 1F11B 4WDIB 1A6ZA 2VLJE 1TJIH 4UQ2B 1XF3A 1QRNB 2IC2A 4EBQH 2HFFA 3FN9A 5C92A 3P4MA 2FL5B 4YGAB 2YA2A 1YECH 4OLEA 5IJVB 4N5UA 2P5EE 2RFXA 2VMFA 5SWZD 4WI2A 1QBMH 5E6ID 1ZWIB 5D2NA 3QDMA 4L4JA 4R26H 3HNTL 1WBXA 4AQ1B 1R3KB 4DTGL 4ZTOH 2GSIB 3CDGA 3G04B 1S7TB 1ZHNA 2VXUH 1U9KA 1AXTL 3NN8B 4JGJA 1KTKE 3MA9H 2AJVH 3V6FB 5I1CL 2OR8A 5DJ8A 1H3VA 1B4JH 4IHOB 5HYJD 1RFDH 1ZANL 1FZMB 1R0AL 3HG1D 3MLVH 4PGJA 3VG0L 3WJLC 5B3JE 3QQ4B 5C7XH 3DXAD 4LCCA 1HWGB 3SKOB 2H6PA 2VSDA 3TO4D 1EHNA 3IXTA 3MACL 3RNQB 5A2KH 1GPOH 3VXNA 1YY8B 4MB4A 5IMKA 3CLEH 2F53D 3QFDA 2NY3B 1DZBA 5EFIB 2WUCL 2JK5A 5DJ0B 4MNHB 3ZZ1A 3U7AA 1LO2H 1XGYL 2IGFH 4K3EH 1A2YB 2EXWD 1A64A 4HULB 2E7BA 3GMMB 5T3XH 1KSRA 4JANA 3RY4A 3SCMB 4WW2A 4F2MB 3PWJB 1HIML 2O61B 2GUOB 3PDGA 1AXSA 3ARDD 3LDBC 4JFYA 3QUXB 4GW1B 3U9UB 5BV7L 4M9OA 3BO8A 3WNLA 1QLRA 5DD3H 3ZT7A 5FA4B 4I9WE 4PB0L 5ISZA 5DK2B 4F7PB 2W9EL 4JQIH 1G7JB 1PZUB 1WBYA 4KY1L 4MXWH 1OTUD 4ZUTB 5BMFH 4P3WA 1VADB 1HOCB 3X14A 4HPOH 3HE7D 3PL6D 5E00A 1H3XA 1SJHB 3S4SG 4KROC 1FL3B 3RGVC 4QXUL 3RWCB 3RWDB 4WO4B 3FRUA 5GZOD 4NN5C 3C5JA 4YHYC 3RY6C 4ODWB 1DDHA 4K55A 4E41B 1X5YA 3S34L 1FORL 3E6HA 3IU4H 4P2OD 5D70L 5ALCH 4OAWA 4DZ8A 2O5ZH 2CIIA 5DQ9B 3BPNB 4YXHH 4HHAB 4J4PD 2WUBL 3VDCA 4PRPD 5E94B 4JO4H 4LF3A 5HGBA 1U92B 1QQDB 4HK3N 4LK4A 4JFPA 2BY2A 5I66B 4XNZC 5FF6B 3GSXB 1NMCC 2DMBA 3MLTB 3G6AA 1BJ1H 4I18C 3MV8A 2DWEA 3L3HB 5ID1A 4G8GA 4NBYB 1FPTL 1U8HA 3CAFA 2XWBA 3P40A 4OLVH 2VITB 2X6MA 4ODXA 5B39G 4U1NB 4UTAH 1N2RB 4DOHB 2PYEB 1X5IA 4NQDE 4CW1B 1BBDH 1CGUA 2GQHA 1KEMH 4I5BB 3TH4T 1YN6A 3S8WA 3C5ZC 3UTSA 1ZHBA 3LKPA 4GW4B 5DDHA 4ZNEE 4JFFE 3LRSB 2AAVA 2VISB 4J1UA 5HHPB 1CZ8L 3O4LA 2HT3C 2EDBA 4WFFE 2AJ3A 3GRWL 1PG7X 4CMHB 5HHVH 3B6SA 3OBAA 4M1GH 1A8JH 3CK0L 4UIKL 1ZSDB 3S37X 3DLQR 3LN4B 5BZWB 3FO1B 1JVKA 2YC1B 3BH8A 3BZDA 1RVFH 4PRDB 3VFNA 2AJSL 2CDFA 3IDMA 4HUXA 4DKEL 3D5OF 3FTGB 3GRWA 2JB5H 2ZCHL 3MXVH 1UM4L 3ELAT 3OKMA 4JM2F 3ARBC 2X9WA 1FDLL 1V7ML 5F7FA 3Q1SH 2Y9RT 2Y7QB 1PLGL 1NKOA 5CGYD 3WIIH 4DEPB 3GFUA 1GOHA 3ZMRA 3RVWD 2QSQA 5C0CE 3GHBH 3SO5A 1GRWA 4F33A 4MA8L 1JNLH 5J3HC 2FIKA 5JXED 1S5HA 2EE3A 4XNXH 2FZ3A 1ODAA 1UZ6E 3MUGA 4GKNA 2I5YL 2VDRL 5GSRA 1TQCB 3PDOB 1RIHH 5DFVC 2YMXL 3UBXA 1N0XL 2PW1B 2WP3T 3TVMC 1Z2KA 4KKAC 2BSRA 1AIFA 3DO3A 3F7RA 1ZA6B 1NC2A 5J13C 2I60H 1QSFA 3P0VH 1MQKL 3CPLB 1GJIA 4C59B 2ZNWA 4X4YB 1EH9A 1NJ9B 4Z8FH 3GGWA 4N0UB 4K9EL 3MRQA 2Q6WB 2NY1C 2QQNH 3UP1A 4B7LA 4WUUA 4RFEA 3X13A 4JPIB 5ILTH 4GRLB 3C6LD 1LO0H 1KV3A 4MNQA 2IALB 4LPCA 1SYSB 5DHVH 4M6ML 1QUNA 5DF0A 1FZKA 2VN7A 2LAAA 2VDNL 1CXKA 3UBXI 2H32B 5FYJL 4MCZA 1AY1H 3HMWH 2HP4A 5FA3B 3MLWL 4GMTH 5DJDB 1ZT1B 5EORH 2MMXA 4ODHL 1JGDA 4LFHD 4TPRL 5K9JL 2VDLL 3TBSB 2DQIL 3LB6D 4OZHB 4XPBH 4PJDB 1XGQB 5HI5D 4TNVF 3QA3A 1R3LB 12E8L 3NACH 2AK1L 4P46C 4JO3L 1NGZB 2Y5EA 5ICZB 4KMQA 3JSSA 4S0SD 1J0JA 1VACA 2N7AA 2EE6A 5T1KA 2WLYA 5T5NF 5GIRA 3QRFM 1OF2A 5CZXC 4X6CE 4PG2A 4I48A 1GYAA 3KLHD 4OLWH 3DVGA 2BDNL 1CFTA 1ADQH 4ZD3L 4Z76B 2B1AH 4OM1L 4Z78B 3CGTA 5E2VH 2AK4B 5IKCB 1YDPA 1MCFA 3KPSA 2PXYA 1FFPB 1UACH 3W39B 1JPGB 2IAMD 1CICC 1T66C 2XTJE 4PJIB 1TLKA 3WFDL 4OD2A 5GGRA 4KZDH 4M7LT 2QTEA 1GVIA 1HEZA 3MV9E 5I9QC 1T7VA 5J7CC 1QSEA 4NP4H 5JQHC 4HCRH 4YHMH 4ZUSB 5FYKL 3SDDA 3QIUA 4LPUA 3FFCD 4LSRL 4XWOD 2Q8AH 4YHLH 4GXUN 1T21A 3GBNH 4JFHE 3S35H 1HXMA 2FSEB 1TJHL 1HSBA 2IPTH 3P73B 3FT3B 5A2IH 3QNXA 4WU7B 5T1LB 3PP4L 4O02L 4NQEE 1NCBL 5DC4B 5FKAA 3T8XA 1P9MA 1J0ZA 4AM0B 4F80A 2ESVE 4X7CC 3CDCA 4MNGE 1FG9C 1XIWB 3IDGA 1P7QA 2HWZH 1FVEB 4JM2C 4QRTA 1ACYL 4YDJB 5GGVY 2YEZB 1Z9SA 1DN0A 1HN1A 5F21B 3BP4B 3QUYA 3M17A 3BAEL 1MCRA 1QKZH 2FBOJ 2WAHA 4QY8A 5AZ2H 1YEJH 4XCFL 2VXSH 4OTXH 1ND0A 1T20A 4ZXBC 4XZUB 4NO3A 1JZ2A 2CK0H 5GJSH 3RPIB 4WEUD 1HH6A 4Q9QH 3GSUB 3MV7B 1JNNL 4MGXA 4WCYH 5AD0B 1UCBL 1U3HC 4YE4H 3RTQA 3WKMH 1RMFH 1FSKC 1BAFH 3L3OA 3DV4A 1F8TL 1A6AA 3O4LD 4PRNA 3AUVA 1UH2A 1QO3B 2CUHA 4LLAA 5HJ3A 4XPFL 4LARH 3BMVA 4ZFZA 1TZIB 3V9FA 1MLCB 4NKOB 4NNPL 1VFUA 4CDGC 1BQSA 1CD9B 4IJ3B 2BC4B 2QSCH 4OZIF 4PRBA 2HJLA 3KYOA 3VFVA 1PY4A 1G0DA 2KPNA 4R2GD 5D7IE 4NSKB 4OFVA 2AJUH 1NCNA 1T22A 4LSDA 1BD2A 5FGCE 4YUEH 1CI5A 3QI9C 1YEFH 4ELKB 1BZ9B 2MCPL 3F7VB 5KSUB 2Q86A 4K7FA 3KDMB 4NRZA 1UCTA 1MPAH 1EAPA 1REIA 3UZVB 4JRYE 4YDVB 1E6OL 1OHQA 1NAKL 3J7HA 5JIKA 4TQEL 4QTHB 1JGUH 4P9HC 3T0ED 1OAYH 3RVXD 4PREA 3RZCB 4P59L 3TIEA 3OZ9H 3SE8L 1V7NH 3O41A 3CCHA 5C0AE 3C60D 3VFRB 1D7FA 1F4XH 5D2LA 4JHAH 2OR9L 1CXIA 3L3GB 2NY0C 4P49A 4X5WA 2DKUA 2YUXA 1SM3H 3UXFA 3NIDE 4M8QA 2NLJA 4FQQB 1IAIM 4P4KB 1AHWA 4DGYL 2XN9E 4MA7L 3V4PH 4KQ4H 4PTUA 1N5YL 2YSSB 3LRGA 1X4YA 5E4EB 3WMSA 4WUUD 3HZKA 4X9IA 3U4EA 3MBEA 4L3ED 1L9MA 5GGSA 3KHOA 3D9AH 4AT6B 3WFCH 4AIOA 2JJSC 2FECL 4HW6A 4XNQA 1FBIH 3BGAA 4FQJH 5TE6H 4FQ1H 2Y23A 4OUUA 1EHLL 3ZTNL 3I6LD 4FTVD 1G1YA 1QVOA 2DF3A 2MOVA 4KZEL 1EFXD 5KZCD 2IANB 3B9KC 6FABH 1KIUA 3LZFH 3KNBA 5KVDH 3VFWA 2H2SC 4DN3H 1JWSB 3GMLB 1FL5B 1LWRA 5FYJD 15C8H 1ONQB 2EDLA 2F5AH 2CKBB 4UV7L 5F89A 5DRWB 1MRFL 1A5FL 3VGFA 4EDWH 4HS3B 1A4JB 4X0KB 2D03L 3EJJX 4PLKC 4RNRA 3IXAA 1RZGA 2WINB 5D72H 5J12C 1HNGA 3U0PB 1A7RH 1TPXC 5IFJB 4G9DA 4MQ7B 4KI5E 1KC5L 2ZCKH 1H3PH 3R06B 4I77L 3S4SB 3JWDC 3PGCA 1XF2A 2H45A 4FFWC 3W81A 1WF5A 5F7HA 3SDCD 2DMCA 2X5PA 5I1JH 4R7NA 1IT9L 3MLZL 4JY4B 4U6HA 3GJEB 4X4ZA 1EEYB 4DJMA 4F9LA 5C0BE 4Y5XA 2E7LC 2WWKT 2FECI 1FLRL 1QSED 4PJHF 3TBYA 3DSFH 4GXUM 4ZOCA 2GI7A 4JN1L 3LH2L 4P9HH 1DP0A 1S9XA 3MROA 3ULSB 3BQUA 3E3QE 4BM7A 3FO2B 2MWCA 2MQCA 3ARRA 1UC6A 1T7WA 4S2SA 4NKIH 2HTLD 2WBJB 3FT2B 3BX7C 4DKFL 3QCTH 4LIQL 4JFZL 4LSQH 2PETA 4ZPTA 5F96L 4U1HB 5FYKD 5IB5B 3S98A 1FE8L 4AL8H 3LV3B 4NJAL 4QOKE 5LGKA 3T3PE 5F88A 3I02B 2C3VB 4P2QD 4NWTH 1T1YB 1TZHB 4JY6B 4OBSA 4F7EA 1P7KB 1ZGLP 1OL0A 4JJHA 5SWSE 5B39B 1T5WA 2EICA 5ELIA 4Y16B 2P47B 3IDXL 2HT4C 3TZVA 3ZDXE 4JDVA 4J3XA 1NCWL 3QXTA 3LMJL 1T3FB 3QUZD 1U8NB 4RAVB 4PV8A 3BSZH 4R8WL 1CTNA 1S7SB 3VRJB 1JI2A 1NFDE 1YUHA 4M1CD 4M61A 4G6JL 1CL7L 2BSSB 2BVTA 2G9HB 3V4UH 1BECA 3AMLA 1YNTB 3DX9A 5DTFB 4KK6C 4LDLB 1HKLL 1RUMH 4XBEL 3MRFB 3QUMB 4D9LH 5IFHH 1KCRL 4OF0A 3PHOA 1DBKH 2XWJA 1P4LB 1NAMA 3ZE0F 3L7EA 4S1RL 2AW2A 2Z31A 5F8RC 3KS0H 4WO4D 4P9MH 1QR1A 2EO1A 4KHTH 3SDAB 5F9WC 3DETD 4P4RA 5C6TH 4RFNC 3E2HB 1CGSH 2NX5A 3S37H 3TH3T 5E6IC 2P5EA 1Q38A 4K7PH 1P2CA 4OGYL 4HDIB 4FMFA 4JFEB 2FH6A 5TDPB 1KBGL 3BP5A 3L3DB 3JWDH 2XTJB 2WSKA 3GKZA 3HN3A 1MHHB 1VDGA 5IMOA 4LLMA 1WWBX 3I3DA 4S1DD 1CLZH 2NY5L 5DYOB 1DQTA 2D31A 3H42H 5I2IB 2YN5A 1A7OL 2FLBT 2J4WH 4BKLB 5I71C 1CG9A 1CL7I 1MWAL 4KXZI 1DQJA 3PWNA 2VLRB 5BVPL 4OKVB 3O81A 4GAJL 2DBJA 1HDMB 5I15L 1PJ9A 5MERB 3TO4C 3WL9A 1FO0L 3HLAB 4NQEB 3PABB 3EO9H 1RUAH 4PR5B 2DI8A 2ESVB 4MJ4A 4LLDB 4LRIC 4HKXB 3G5YB 5D5MB 2CIKA 4DQOL 3CVIL 1AKJA 5FKPB 2NTFA 5CEXA 1AQKL 5I1DB 4UAOB 2X89D 4NHUA 2EXWC 5BS0A 5C0GB 5E08L 1IARB 5TJWK 3C9NB 2ED7A 4G42A 5JHLL 3KYNB 2W38A 1Y6MR 3ARDC 1LNUA 1UKQA 3BHBA 4KVNH 5CP7B 1JK8A 5C09E 3GNMH 5IQ7H 1AJ7H 2IBZY 3V6OA 5EBGA 5MI0C 3EOBB 5DUPL 4GG8B 4RIRB 5CJBA 5F3BA 2NY6B 1W72A 4JR9L 1JPTL 1JZ4A 4XWGH 4KJWC 4M43H 2R1XA 2K3TA 4OZGE 5FM8A 3THMH 4Z7WB 3CC5B 4J3SA 4X6DE 1GGIH 1I1CA 3HE7C 3PL6C 4QT5B 1PBYA 3H9HA 1S7VB 2B2XL 32C2B 3AB0C 4XGZB 1E6JH 5H2BB 3MOAL 5ALBH 1UJ3C 4U4BA 5E2UL 3FMGL 4PFEA 1RI8A 4Y1AE 1FGNL 1GOFA 4JKKA 2X1QA 3DJ9A 4P2OC 4M8VA 4R0LC 4LVEA 3T1WA 3NGBC 1IAII 5CINH 1A6ZB 3C5SA 1KB9J 4LHUA 2VYRE 4KAQL 4WUKH 3VWJA 3FT4A 1F00I 3DBXB 1OPGH 3NBNA 4J4PC 1DBBH 4HXBH 3GMNB 4JZJC 3P4MB 2VE6B 3ZO0A 4O58H 4U1MA 3J8F7 1I3UA 4MDJA 2AI0L 1K6QL 5E9DE 3HC3H