1FIGH

Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
216
structure length
216
Chain Sequence
DVQLQQSGPELEKPGASVKISCKASGFSLPGHNINWIVQRNGKSLEWIGNIDPYYGGTNFNPKFKGKATLTVDKSSSTLYMHLTSLQSEDSAVYYCARRRDGNYGFTYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA 1F7 FAB (LIGHT CHAIN)
total genus 27
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figH02
2NTSP 4P3DA 4KUCF 4Y4HD 1IAMA 4J2XA 1NDGB 4D94A 4V1DB 4V1DA 4I0PB 3W0WA 4BFGA 5EU7E 1T7ZA 5HVGB 5DHXB 2ESVB 3O81A 4UB0L 2GKIA 1YPZE 4KTEH 1FGVL 1TJHL 2CK0L 1Z9SA 1ONQB 2R29L 4U1IA 1JGDB 4P2RD 2PF6A 3UYRL 1GC1L 3IFPB 2APVA 4RRPA 1UEYA 3QO0A 1MFBL 1M7DB 1FFOA 1KENL 4LARL 4CVZA 2C3HA 3MLXH 5E8PB 2JJVA 3AUVA 1MPAL 4R90L 2JB6B 1FFNA 3NZ8A 3VA6A 1DBKL 1N6UA 1ZEAL 2VLJB 4RDQG 5I74B 2IH1A 3A6CL 2YRZA 5J0BA 4UBDD 5MP6L 3CK0L 2G5BA 4BKLA 2ID5A 1P5UA 1DUYA 2UY7A 1Q72L 4MAYA 1D9KC 1CFTB 2BVOB 6FABL 1RUKL 3CLEH 4HGWB 4NQVA 4YDIL 3OGOE 1MCHA 1U6AL 1CL7I 4NKQB 2RCSL 4HEPG 3VD3A 1Q72H 3SJVD 4PJAF 2CIKB 1A64A 3V6OA 1S7QB 4L5FL 5JA9A 1MHEB 3CLFL 1A6WH 2H1PL 5TE6H 4JFXA 1HHGB 4JPWH 4L4TB 5I8KH 5GRWA 5C6TL 1BFOA 2BDNH 2MSPA 5IVXE 1GL4B 3VGDA 3W5NA 2FATL 3VRIB 3D39D 4FFVD 2AI0L 5IIEB 2F74A 2X10A 1XH3B 3WIHA 1WAAF 4NQDD 4Y4KC 2CJUL 5IBLD 5ICZA 5F8RC 1MJ7H 3RBGA 3LPWA 4P2RA 4LSUL 5DA4A 2HN7B 3BSZH 4E41E 2XICA 5F6IC 4XRCB 1A7QH 2AAVA 2MKLC 2DIBA 5HYQB 5HYQA 3IDIA 4NM4L 3RIFK 1BGXH 1QRNE 1UXWB 3PWNB 4NNPH 5D1ZA 2YPLB 4U2ZA 5E95B 4NM8L 1PYWA 3VRLE 1KN4H 4K3JL 4WI9A 12E8H 4X6DB 2F58H 4MDJB 3WN5B 4WEMB 3IXAB 5IJVA 4M6OL 1I3VA 5B21A 4LAJH 4FXKB 4RAVA 5F1IB 1YEDB 3VH8A 3IS1X 3L3DB 3OKNB 4HCRA 5BJTB 3BWAB 1AY1L 1OGAA 3MRQA 2DM2A 3MRQB 2P8PA 1MIEH 1UKTA 2VDLH 3BZEB 4TNWF 4E41B 3MCLL 2ZOLA 5TJWK 4ONGL 2EYRB 1JWSB 1R24B 3DRQA 1NCBH 3CLFH 2X05A 4G7VH 5HGHB 3K7UA 1C5CH 3MROB 3S96B 5J11C 5ITBL 2ATPB 4PJEF 3V79C 5GGUB 1X5HA 5A40E 2BVQB 5C8JB 3HE7C 5FYKH 4LU5L 3GNMH 3F7QA 1NQBA 2QKIB 3C2SA 4K2UL 2KDGA 3CK0H 1BM3H 4EVNB 5HPMB 1TQCC 2JJSA 5E4IA 2ZJSL 4I2XA 4HS8H 5ICXA 1WCBA 1U92B 2JELL 4KQ3H 1LQSR 2XNAA 3LPGA 2DQFA 3SQBA 4QRRE 4BFBD 1JF5A 3MV8E 4J3WA 4EIGB 5KOVC 1AGCA 1AD9A 3BX7C 1HEZB 4EI5C 4NP4H 5FF6B 5JPMB 4L8BB 1NGYB 3MFFB 1G7IB 1OARH 4I0CC 2HH0H 1XR8A 1ACYH 3DVGA 1D5BA 3BPOB 3HZVA 3IVKA 3RVXD 1ZA6B 2N7AA 5C0CE 2OLDA 1JI2A 3VXQB 2H2PC 4UT6L 2AV7B 3MV7B 4L8DB 4LL9A 4H25B 4J4PA 4HIHA 1W8NA 4DOHE 4DN4L 3S4SA 4HIJA 5FYKE 1OQXA 3VW3L 4QHLB 3ROLA 5SX4H 2R0LH 5D1QC 4LLQB 2EKJA 3TWCH 2YRLA 3GHEL 3S6CA 1OOAA 3D48R 3V4UH 3T1FA 4JO1L 3TBTB 4P99A 4CU7A 4WU5A 4GW4A 4KK6C 5A2IH 2VC2L 4UQ3B 1IC4L 3B9VA 3FO1B 1JGUH 4G9FA 5GJSH 3VI4E 5JHLL 2C7UB 1H8SA 3CVHH 3BDBA 4JHWL 4CADA 3ARBB 1F11B 4LMQE 4EDXA 4S1QH 1DLFH 3BZ4B 3QFJE 4UTBL 1IE5A 4EN3C 4LSPL 1S7VA 3RY6C 5DJDA 1A4KA 3HB3D 5I1JH 4FQHB 3TZVD 1VGEL 4WEUD 2FLRT 5BVJA 1EO5A 2H9GB 4WGWB 1UZ6F 5DUMH 1M71B 1JGVL 3RZCC 5D9SA 2NMSA 2ZCLH 3MREA 3E0GA 2X4NB 5IVNA 2GTZA 3QNYA 4PTUB 2NX5E 3EFFB 5B3JE 4XI5C 4Y1AD 3AU1B 2ARWA 1PFCA 2VWEC 4PRDB 1F58L 2DIAA 3MRRB 1HI6B 2DQIL 1PG7H 3HZMB 5GZND 1DQDH 1JTTA 1NGPH 3WDHA 5EU4A 3Q6GH 2I26N 5DD1H 4WO4B 3ZTJH 4NPYB 1XF4B 2NY7L 2ZUXA 2V9QA 5DUBB 5JW4R 4WY7H 2FWOB 2BP3A 1TPXC 3HUJF 1MCLA 1BZ7A 2NX5A 4ZFOA 3IDMA 4P2OC 2JB5H 3QT2A 4N90E 1KLGA 3KR3H 5E2WH 4YHIA 2HVKA 3UJTL 3C87A 1BBJB 3CGTA 4HF5L 1L4IA 2DD8H 1YEFL 4LSRH 1FDLL 1VEPA 3VD5A 3HZKB 3MXVL 2VZOA 2G9HB 4XHJD 2YPKA 2VLMD 1JHLL 1S3KL 1YEIL 5DA0B 4YBQD 3A0OA 4ZUUB 4GLRH 4OZGA 5JW4Q 1KJ2B 4PRIB 4MQTB 4X9BA 2KH2B 3D0VB 4AZ8A 5IW6B 1U3JA 3ZKMD 3CX5J 1Y18B 1LILA 4ZFOL 1CVSC 4MJ4A 3TJEH 2DN7A 2EDFA 4X9IA 3MROA 3S96A 4Y4KD 1EO7A 2IBZX 3MRCA 5EOQH 1CF8H 4BZ2L 4Q9QH 1QSVA 3SY0B 3NAAH 4KKBD 3JWDC 2VSDA 1U2HA 2VLRE 5DQDH 5JPMA 5CEXB 5IWLA 4P4RB 1LVEA 5IB2B 1QD0A 5TF1L 2A38A 2XWTB 3PWPB 3V0WL 2CQVA 4RX4D 3ECBB 4NT6B 4V2CB 5L7XH 2EZ0C 2XNAB 2Q86B 1CT8B 2VXTH 3LEVH 1CDGA 4ZUWB 2BSRB 3GJFA 2VDPH 2Y4SA 3V0VB 4QKXB 4RMSA 1CU4H 2X7LB 3ULUF 5AAMA 3KJ4B 5BVPH 2BMKA 2JJWA 2EIZB 5A2FA 4CUCA 1DQDL 3MRDA 5JMRA 5F6HJ 4ERSH 5FA4B 2AK4B 4XCEB 3TO2B 1IGFL 3NPSC 1MHPL 5IK3B 2LAAA 5L2KD 4BSJA 3KYOB 3QUMH 3LQAL 4MZ3A 5C92A 4OZ4B 4GKSA 1MFNA 5IESL 1MREH 4OZGF 4QTHA 1X5JA 5JW3L 1EVTC 4TTDD 1FAIL 3LKRB 5T5FL 4AH2B 1DEEA 4FZ8H 4S11A 2IADB 3LN4B 3CCHA 4WY7L 2ORBL 2IF7A 3RZCB 4Z76A 4U6VL 1VGKA 3IFOB 3MQIA 2E9JA 3WSQH 3UMTA 4FFYH 3QIUB 1Q9WA 1FNGA 5KJRH 4NDMB 1LE5B 5T1DL 2AS5M 4GKZB 3H9HB 1IEAB 3OG4B 1DSFH 2YUWA 1UM5L 2X4PA 4GG8A 1OPGH 1U8NA 3D2UA 1CGSL 4UQ2B 3BP7B 1F3JA 3DXAA 1A6VL 1IC4H 3X13B 5JW5A 4MDIA 2I9TB 2DL2A 4XWGL 2A74A 2C3WA 1FP5A 1BF8A 3QWRA 3UJIL 4NHUA 2BY3A 1WWBX 3LN4A 1A2YB 4JE4B 1DVFA 5HHNA 5DK3A 3P9LA 4K7PL 3MV8B 3BN9C 1ACYL 3QQ3A 1MFEH 4YGVA 4NT6A 4YIQB 4GSDL 3QDGB 1PG7X 2VLRA 4UT6H 5FUOL 3T65A 4EI5B 4KJPD 3IDXH 4Z7QF 1YEEL 1D5MB 4NZTH 1WQVT 3QRGH 1PY9A 5I1GH 3V0WH 5I8EA 3CDFA 4HBCH 1NLBL 4UIKL 4HQQL 1MI5B 3FFCD 1BZ7B 3IKKA 1JIBA 3HMXL 3MRGA 4IOFC 4XNMB 2VTFA 2VZSA 1LNUA 1IGTA 4L8SB 2XY1A 1DEDA 3OBAA 5K59F 1HQ4B 1FC1A 3L1OH 1E6OH 2AJSL 2EE9A 3SDYH 4NFDA 4D0BB 3OXSB 3OB8A 1WITA 2GITA 4ZS6C 1R5VA 5CGTA 1I3GL 4OFYA 1F3DH 1ADQH 3OKDB 3O2WL 3BPLC 4KRPC 4JFZL 4S0TD 5INDB 4RZCA 3EUUA 2C9AA 2X1QA 1FCGA 3FHQA 3PABB 3T0VA 4PR5B 5FCSH 5JW4N 5D7JB 5E9DE 1GOFA 3UYRH 1S7TA 1AXSA 4RWHA 2YZ8A 3GIZL 3NCFB 1TCRA 4AJ0A 4OZHB 2D03H 2BNQD 1H5BB 1NL0L 3S36X 4LLDB 5JZ7D 2DJSA 2BXZA 4PYGA 4W68A 3LKSA 3PP4H 2CR3A 2NY4B 4OKVB 1F02I 4Q9CA 1BD2A 1A6TA 4LGPB 1K2DA 4UNVA 2AXJA 4H5SB 4LSPH 1K5NA 2OTUB 1T66C 1MRDL 4XBEH 3SKJL 3RVVC 3MA7A 2ZUQC 4HX1A 5TH2B 3RFZC 4NUGL 4QY8A 2X4UA 4FTVD 4LLYB 2CDFB 1EEUA 2EH8L 4NZUH 4K3DH 4LLDA 1EV2E 1DQQB 2D7OA 4XXDA 4LIQH 4JQIH 4S10A 4HUVA 3MRIA 3FO2A 4JREC 2P1YA 2DL9A 1V3JA 4YHKH 2WBKA 1KG0A 4YXKL 2FEDC 2QR0B 4F3FA 1NLDH 2D0FA 3DARA 5GGRY 1YMMB 2VB5A 4KAQH 1SJVA 1P4LB 4NO5B 4HH9A 4YX2L 1HHJB 5DVMA 2HJLA 3QXAB 4UV7L 3C5ZC 2OL3H 1X4YA 1JPSH 3GB7A 4LLUA 3OKEA 1F4XH 1LE9B 3GGWA 3DMMA 1EFXB 4KJQD 3LIZL 5F70A 5FHBH 1OP3H 2XQBH 1T03L 3MX0A 3C6LD 5DJAB 2JJTC 1QP1A 2F8XC 5ALCL 4XVSH 4Q74A 4NRXB 5ANMA 4Z7NF 2Z8SA 3U7WH 3WKNA 2E7HA 3TBYB 3I75A 2YPKB 5HHME 4XC3H 4PRHD 4R0LC 1KJVB 4FHBD 3PWJB 3O3AA 1LO2L 4JO3H 1S7UB 2NW2A 5IMMA 3ZL4L 3H7BB 2EZ0D 1I3GH 4ODXB 1BQHA 4OZIE 3VDAA 5EOCL 2R1YB 2PTTA 1ZS8B 4JFYA 3RWCB 3DVGB 4MQSB 2ENYA 4XNUH 5AZEH 5F71A 3Q3GA 3RWJA 5ADOH 5FDWA 2LVEA 4PJ5D 4Y19D 5FUCC 5FYJH 3BGMA 3A6CH 1EUTA 4HG4K 2EDDA 1ZEAH 5ITFB 4BH7A 1PGRB 2GK0A 3OKKA 4XVSL 1W72B 4M6AA 3OKOA 2PXYD 3BXNB 3VCLA 3TIEB 4PJHA 2G5RA 4NQUA 3CPLB 1LK2B 4JGUA 3TBSB 3R4DA 4NFBA 4B7IA 2YMXH 1A7RL 4MNGE 2MNUA 4APQB 5JOEA 1DZBA 5I17B 3W9EB 4X8XA 4EKXA 2EYTB 4KROB 3KAAA 1WEJH 1J0JA 1HI6A 3HNTH 5KSBB 3MRRA 2DDQL 1GGCL 3BEVB 2AXHA 1T2QL 1GJIA 4CW1B 4XH2A 3FQRA 1J8HB 4FQIL 5E6IC 5H37G 1MAJA 1IEBB 4UILL 1N6VA 1J0YA 1RUQH 5EIQA 4OLVH 3N1QC 1MFBH 1M6OA 3MO1A 3SEPA 4NSKB 4DGIH 2HJKB 3OGCB 2O5YH 4Y8DC 4HIXL 2LTQC 3SO3C 5DK0A 2XOTA 4HUUA 3S5LG 2EEAA 1MWAB 4LPXA 1P7QB 1QSFB 4U1GC 3EO1A 1SQ2N 1DCLA 4MA8L 4EDXB 5IJKC 2G2RA 1OGAE 3MLWL 5FYJE 4OLWH 3SKUD 5A2LH 4LHUD 2DICA 2ED7A 3B83A 3BEWA 3OR7A 4RA3A 2OZ4H 2Z31A 4P2CG 1BPVA 3BMVA 4IRJD 3LKPB 4MAYD 1N26A 3EOBA 3ROLB 3TJHD 3O2DA 3TBWA 4LAQH 5C08A 5F6IB 1G7QB 4D8PB 4DCQB 4ISVB 3ARGD 3K8KA 3FO0L 1R5IB 5GS2D 3BZFA 1I7ZA 1MWAL 1NC2A 3TYFA 4K3GA 1WTLA 1EXUA 2GT9A 1GOHA 4OLZH 2GT9B 3EYUL 2DB8A 4GT7A 1KIQB 2EXYC 1DBAH 1I8MB 2VLJA 1JHKH 2PETA 4KPHH 4CVWA 4JGJA 1T7VA 4JAMB 3VFOA 2HA1A 1XIWB 5EO1B 2IANA 3VXMB 2VQUA 1HKLL 1KEGL 4X6CB 3E6FA 5EU6D 1J12A 1UWXH 5EUOF 4NO0A 1YY8A 2N7BA 1RZ7L 4AIZB 2VABA 3L3DA 4OF6A 2DMCA 5ADOL 2O5YL 3QIBC 4X83A 1FZOA 3DROA 2YN3A 4X9GA 2VLKD 4AEHH 4ZYKA 1CFVL 4JFXB 1U92A 2A9MH 1JPST 1MPAH 4JZOA 3MBEA 4KQ4H 3FOMA 4H20L 4HC1A 1P9MA 1LMKA 2MKWA 5EZLA 2W9DL 2CRMA 3MCKA 3VFSB 5HD8C 1WEJL 2PYED 3U2SB 1WZMA 3OAZK 2R56L 3RWEB 3NIDE 2G60H 1T4KA 2NNAB 4L9LB 3RVTC 4DFHA 3WFDH 3MOAL 5DQJB 3CLEL 4K71C 2X9XA 4XAKE 5EDXA 4LVHC 1WJ3A 2BOCA 3C8KB 2X6MA 4MXWL 1EEYB 1DP0A 1NC4B 2V7HA 3T0AA 5DSCB 3LHPH 4HKZA 3GI8L 5CINH 1M4KA 2YR3A 1JJUA 3ECBA 4ZXBA 1F97A 4LVOC 4R9HA 1EHXA 4MD4A 3HC3L 2V2WA 5E9DB 1G7JA 2CK2A 2H26A 3I02B 4BUHA 1FJ1B 4U1MB 4KAQL 3TH3T 2YOCA 4JJ5B 5EO9B 3JV5A 1QR1A 3DSFH 1OAZH 4S1RL 3UBXB 4LCWA 3NCCB 4K9EH 5C0NC 1CLYL 3SCMD 1J7VR 1EJOH 3KXFB 4EUPH 1IAIM 4OM1L 1IC7H 2HFGL 4X6EB 3ULSA 1BQHB 3U36B 4M48H 4LQ1A 5J56B 4O2CA 1CGTA 3LHPL 5FOBB 4U6VH 3PWNA 3M17B 2CKBH 2NY4C 3WFBH 4YXLH 4GOSA 4WWKC 3TNNA 5FB8A 4PIRF 4GH7B 4IMLA 2HLAB 1JUFA 1AI1H 4I4WA 1RPQA 4P2RB 3RWGA 5C08E 4NZRH 5B8CC 5HXMA 2YA2A 1CBVL 5DDHA 1FZKB 4C56D 5L9DL 4X7DC 2CGRL 5C07A 2ADGB 1U3ZA 4U1GB 5E70A 3CJJA 5MEND 4XNYL 4F9LA 2BHYA 4KJQC 4LOUC 1NFDF 5CKGA 3WV0A 3ZKND 2Y5TB 4Q9RL 3MJ8A 5E5MA 3UTSD 1CXIA 1FYTB 3IU3A 2GJ6A 2DWEB 1F11A 2WIIA 3CFIC 3BI9X 3G5ZB 1C12B 3GMLB 3ARFD 3BYTA 4Y5VC 1YNLL 3FO2B 4HUVB 3PABA 1NANH 3PHOA 3W2DH 5DD3L 5C3LD 5TE4L 5JDJA 5IFJB 1QTYT 3FAWA 4M7JH 1J86A 2EE2A 2VKXA 5HDQL 4W6YB 1NC4A 3LQMA 2M26A 4RBPK 1HQ4A 4OM0H 4UT9H 2BNRE 4X7EC 1OTTD 3VXQA 2APTA 3NN8A 2HLAA 5AAWA 3BP6B 1T7YA 3HPJA 2X89A 1BFTA 25C8H 2DQCL 3P73B 5IB4A 3WIHH 2DLTA 4KK5D 2VXVL 4HMEA 4HXAH 5HVFB 2CMRH 2FH8A 3NA4A 3ARDD 3AGVA 1KEMH 1HZHH 15C8H 1CS6A 2PKDA 4XP5L 5DT1H 4RGNE 2YBRA 2MWCA 4GQPH 4ZD3L 3VW3H 1E4XL 1KGCD 1T89A 4G6KL 5FM4A 3VXTA 3G6DH 4OI9A 3L3HA 1NBYA 1QYGH 1DQLL 4YHYC 3KLAA 2IGFL 4I77L 3OL2A 5BMFL 1IBGH 1KCRL 5KTEL 5JW5B 3KNBB 2ZWLT 3D85B 4GKNB 4QXTB 3SQOH 1EEYA 1JFQH 2CXGA 3JXAA 4E41D 4I13B 4FXLA 1FNLA 1RIUH 3VXOA 3ZT5A 5EUOB 4MHHG 4KK8C 3IFNL 4QT5B 3RUGB 3MRLB 1F2QA 4V1DE 5E8OA 2OL3A 3ULSB 4X6CF 4HMCA 1Y0LB 4LLMB 4LIQE 4NDMA 3G5VB 4N1CA 1EGJA 2DQDL 1JYXA 2VISB 1KBGL 5TFSL 4P23C 5C0FA 2ARJB 1IGMH 3HG1E 4F58L 1QBLH 3MRJA 3G9AB 5E08L 4Y5VA 5C0IA 2P8PB 3LOWA 2J2ZA 4JDVB 2VXQH 4JRYA 2CLZA 5FYJL 4Z8FL 5IOPA 3SKOB 2FIRT 4PJBE 2J88H 2KKQA 5EUOE 5HBBA 4DEPB 1ZWIA 2ERJB 1CFQB 1PYWB 3DIFA 4WUUA 2MPAL 5F21B 1RY7B 4MJ6B 3TVMC 4QRQB 1VGEH 4PJ9D 4QCIA 4NNXA 1NFIA 4LNRA 4U0RC 2FYYB 1LO3L 1FL5B 1M7IB 2FR4B 3MO1B 3V5DB 5IF0A 2CKBL 1MRCH 4J8RA 2J6EA 4R97B 2J12B 4U3CA 4Z78A 4N0UE 1I7ZB 3BZFB 1CG9B 1I1AD 4JZOB 3NFNA 2VL5A 5KSVA 1NGPL 5DWUH 1XR8B 1P4IH 3VXUA 3WFHB 4FZEH 5IUSA 1PAMA 4HHAB 1EERB 3O3DB 4JPKL 2XRAH 4TVPH 4BK4A 1XCTB 4OZFA 4M4RA 4Y5VB 4U1MA 5C0IB 1IGFH 1W72A 4X6CA 4HPOH 1YMMA 3M07A 1OTUC 2X5PA 3SKMA 5EOQL 1B9ZA 1O5DT 2BVEA 5T3XL 1N8ZB 1RJCA 3SDDB 3UTPE 3NH7H 4U31A 4LDLB 2B2XL 4ZTOH 1MQ8A 3VRJA 1K8IA 4ZPVB 1MCFA 4I3RL 1UQSA 4YO0B 3V7AE 4XP4H 2O5XH 4G3YH 3L5IA 3KJ6H 1JGUL 1EFQA 4ELKB 2V2XB 1FL5A 1M7IA 4QHUA 1N64H 3C5SB 4L9LC 3TBYA 2ENSA 4GXVL 1JZ8A 4Z7UA 1P4BL 1JN6A 1KJ2L 5GQBA 1U6AH 2E7CA 4EJ1C 1A9BA 3WL9B 3MLSH 2FRGP 4V2BA 3RPKA 3KYNA 1S7SA 3EYQC 1X6LA 4AYFA 5GGTA 1G0DA 2AQ1A 2DLHA 4I0PC 3R8BB 2G2RB 1HSBA 4ZUSB 5K9KA 1BLNA 3QCUL 1NL0H 1RK0A 4YPJA 3TFKD 3O6KH 2B4CC 3KPOA 4YDLC 4MHHI 5H35B 3SDCA 3FQUA 3D2UD 2KBGA 3AM8C 3MV9E 4XVUD 4KH2A 1E28A 2CO6B 4F58H 3EJYC 4PJ7B 1BX2A 4R4FL 1FN4B 3U0TA 1BVLA 5JNYA 1FZMB 5HVHB 5KOMC 3SN6N 1NCBL 1NMAL 2P5EE 4L4JA 5DMIH 1NC2B 2W9DH 1AR1C 1KLUB 3ZKNC 3PGDB 3BEVA 1R6VA 3VMOA 2XG4A 1CD8A 3PL6C 5DC4B 1QKZH 1UH4A 3PNWB 4V1DD 5CP7B 1C08A 4U1SA 1QPPA 2ZCLL 1F8TH 3LN9A 3V4PH 2F5AH 5JIKA 3TIEA 3IFLL 5DEGA 4GBXB 4FG6D 5D7JC 4PJCF 1KN2L 2MHAA 4LBEB 4ODHH 3MLTA 4PJIE 4XNXL 2DOCA 3LEXB 3PV6A 1Q1JH 4KDTC 4KK8D 4YHLL 3MV9D 1R3KA 1HNGA 3DGGA 3HI1B 1UM4L 5ESAA 4OFIA 4XPGH 1OL0A 3JV4B 2DKMA 4X5WA 2WLYA 4G6JL 4Y4KB 3U83A 4RIRB 4FXGB 3C2AL 4NZJA 3LMJH 5FA3B 2R0WH 4KJYA 5E8NB 3DX6B 3DRTA 2NYYD 4Z18A 5EA0H 5C0GB 4OLVL 1AY1H 3LQAC 5JR1L 3U0PA 3X3FH 2BNUA 4HPOL 1YC8A 4W4OA 1MSPA 1B0GB 2QQNH 5GJTH 5ALBL 4QRSA 1NCTA 4NYLA 4NYLB 1K8DA 4PS4H 4Z0BH 5GGRB 1LO4L 3IXTB 1NBZB 1LEKB 3S36H 1J1OH 3ILPA 1U58B 2D7TL 1G7MB 5IB1A 1MHCB 5H94A 1MHHA 5L88H 4PJ9C 1XGQB 1DN2A 2Q76B 4P2YA 4B50A 5KAQG 4D2NA 1MLBA 4KKAD 4JO1H 1D5MA 5DXWA 4RMTA 4F57H 1AD9B 5GISH 2Y06H 4KU1A 1RULL 4H1LG 1MUJA 4LSDA 4TYUA 1W72L 3ZTJG 2C7UA 2DWDA 3TCXA 3DSFL 1I1YA 5FHAL 1KPRA 4GFTB 1ZLVH 3WIFB 4N8PA 3Q5OA 2DDQH 3QO1B 4LHUA 1I8KB 2AQ3A 5C0CA 1DQJB 1R3IH 2R29H 4Z7UB 1TQBB 3RGVD 1KCUH 4G5ZL 4NQXA 4FQXC 1A6TB 1MVFA 3WO3B 3U9PL 1Z2KA 5F7EL 3M8OL 4RFOH 3ZYZA 1KENH 1YY9D 3N1MC 4PV9A 4KZDL 3L5JA 3B3IA 5DVKA 1E4XI 5DRZA 4DAGL 1NKOA 2FJHA 5D7LB 1CIDA 5F1NA 3MOBH 1GGBH 3L7FB 2VLKE 4Y4HA 1TNNA 2ICWJ 1MRFH 5EC2A 2PO6B 3F58H 3VWKD 3P4MB 4ONHB 4HWBL 5BO1H 3SE3C 4XXDB 3UBXG 1L6XA 1VFAB 1PKQA 2BNQE 4OGYH 3LCYA 1A6VH 1PJ9A 1S7SB 2GIYA 3NIGF 3CDGA 1DVFB 5GSRB 5M95B 3MJ9H 1FLTX 4IEFB 4XP1L 1INEH 3QDJB 4OD3L 1UM5H 5I1AA 2VQ1B 3CH1A 2VDKH 3PL6B 5TE7L 3TPUB 1OAYL 3DWTA 5DJCB 3THML 4X4ZA 4OCRH 2OL3L 3IDNB 4JO4H 2YD3A 3GSUB 1WWWX 3BHBA 3Q1SL 1CTOA 4LNRB 4R4ND 5MEOA 3SO3B 5DJ0A 3VFSA 1AXTL 3EOBB 3EOTH 1UCBH 4TTGA 4JM4H 5CSGA 4YXKH 1KB5B 3H7LA 4OCSH 3SE4C 25C8L 3RVUC 4XBPA 3VXSD 4FQ2L 4ZYKB 3RHWF 3BUYB 3QDMD 2OSLB 2A9ML 4PJ8C 1P84K 4J7RA 3JSSA 4GUPA 1YEFH 3HA0A 5JORA 4JG1H 3MV7D 3GMNB 3MJGX 3LVEA 1NBVH 3K2MC 1JNLH 1KACB 3BH9A 1WF5A 2VXUL 2Z8RA 3TESA 3TV3L 1OW0A 3GO1L 1D9KD 4HUUB 1F3JB 1WGOA 1OAUH 2H3NB 4LSVL 3T4YA 3ARSA 4RGND 1JNLL 5DR5L 3IDYC 3ULUE 3UDWC 5DUPL 3KPRA 5I73C 3D6GA 5IK3A 1N7MH 4IHOA 4PGEA 3VXOB 1MCRA 1RJYA 3TFKC 4HK3N 2AERT 1DANU 4MXQC 4R90H 4R7DA 4OIBA 3HZMA 1ZGLB 4ZDHB 3GMOB 4HQQH 5C0AE 1B88A 4JRXB 1TPXB 1IAOB 1F4HA 4H8WH 3GJFB 3CU1A 4G6ML 1UH3A 4TULL 4ZNEA 1WIUA 4HXBH 4P2OB 2I07B 3AM8A 1GIGH 4XXCC 3I84A 2Z91B 3PWVB 5DRNA 3VGGA 4Y16C 4G8GD 4Z7NE 4KK9C 3CUPA 5F7EH 5MEPB 4X4XA 1Y6MR 4Y1AB 3TBVB 5FYLD 4RAHA 3EO0B 3P9WB 4OF7A 2P8LA 4Z7UF 4XAWH 5F1SA 5CS7A 3KYOA 1S7QA 1E0OB 4K94C 1A6PA 3FOLA 4RMWA 5E2JA 1GAFL 4FP8L 2N1KA 3BP7A 5HHPA 3BHBB 4GAGH 2BVOA 3VJ6A 5AG8A 5IB4B 3K8LA 2YC1B 4TN9A 4OAWB 4LKXB 4PRPB 4WFHD 4DOHB 3HZYB 2YA0A 4DQOH 3DNKA 1OAZL 4GAGL 5T1DH 1V3LA 4ZO7A 4NZTL 1FL6A 1MNUL 3T3PE 3EOAB 4N5UA 5LWYH 3G6JE 4S1SH 4JG0L 4N9GB 1PEZA 4OCYL 1VHPA 4NRZA 3QQNA 4G3YL 4MJID 1HH9B 3GMNA 3DX6A 4RWYH 2HH0L 5TGBB 3L3OB 2ZOKB 4HFWB 1A6AA 2Y7QB 5TQ2L 5GRJH 2YPVL 3FQUB 1CXHA 5DK2A 3QIWB 3VFUA 2DMKA 3EYVB 1ZT1A 5CBAB 5FGSA 1QSEA 5T1MA 2FJHB 5D7LA 2VDML 1HSBB 5K9KB 3ES6B 1MAKA 5DJ8B 3WCYA 4QXGH 5GGTH 5TH2A 3VXRB 4CMMB 4TPRL 4PJCA 1MJJB 2I9LA 3QFDA 5I18H 5HYSB 1FH5H 3TYGL 4Y19B 3WJJC 4P4KA 4YDVA 4GS7C 4YJZL 1QRNA 2A77L 1OTSC 3F6LA 1CU4L 3F7YA 3ME0A 1AH1A 5C0GA 1UH2A 1G7HB 3CZFB 1FNHA 3FT2A 3VG0L 2SEBA 5FYKL 1PW3A 3ULUD 4NQDE 3MLVL 5C8JA 1A6UL 1OAQH 4QF1B 5LCVL 1NSNL 3EDKA 2BSSA 3QEHB 3BD5A 3L3GB 5ID1A 5JOPE 1G9NL 4PGBB 1RQ5A 1D5BB 2HT2D 4G9FD 1VESA 4QWWC 4Z0BL 3P4OA 4UV7H 4WI8A 2EH7L 1ED3B 3FB7B 4NQED 5ETUA 4A2MA 4IBLT 3WKMH 5D2LA 5EZOH 4I3SL 2WLZA 2GJ6B 4UIMB 1E6JL 1BVKA 2FBJH 2LQRA 2VR4A 3QDME 1DQQA 3BIAX 3NGBB 3EFDH 3E3QE 5HGDB 2VH5H 2B8OT 2IQAB 1P7QD 2AK4D 2EDHA 3MUHL 3AROA 5EPMA 4KMLB 3EOAA 4ODWA 4X4YB 1GRWA 3THMH 3NFNB 5L6YL 4HV8A 4L4VB 5MENA 1AGEB 2DQDH 5DO2C 1RK1A 5FV2A 5KBNC 1WZLA 2NXYC 4MNGB 3EZJB 3UTSA 4ACPA 2LE9A 3C5SA 4LHUB 2J8UF 4FQXB 4I1NB 4O02L 4IRZH 1YJDC 1WFTA 4BQ6A 5IWLC 2H8PB 2WIMA 3MBXH 5DLML 4AEIH 4NNXB 3B2VH 1DBBL 3PDOA 5B38A 4DZ8B 2XZQL 5E00A 4N0FB 4C59B 2IGFH 2NX5D 4KUZH 5E99H 1C1EL 3FQNB 1X4XA 3BW9B 5CJXA 3DROB 2P7TB 1AHWC 2ZOLB 4OI8A 4J3SA 4L4TA 1ES0B 4NC0B 4KWUA 4XVJH 1GGIL 4PJEB 2EXWD 1KJMB 2IH3B 1JWUB 1F4YL 4NPYA 1UXSA 2VN7A 4ZO8A 4PJ7F 2QHRL 5MEQA 5EBWB 4O2FA 3SJVE 1UA6L 1YNKL 1U8JA 3UTTA 3RJQB 8FABA 4TSAH 5I2IA 4KK9D 4YDJB 3GJFK 1CK0L 3O41A 4MMZC 2RJMA 1F58H 3AB0C 3BKJL 3RHWK 4GKZA 1I9JH 3GBML 5KZCD 4PLJD 1G9MH 2I60L 1G1CA 2ITDA 5FKAA 2CKBA 3RA7L 4P23B 1RIHH 4QRQA 1LHZA 4BFEA 1CDHA 4PYHA 5C0DB 1O7SA 3MCLH 4OLYH 2FHFA 3T65B 4JFQB 2VIRB 1ZMYA 4EI5A 4YBHA 1U0QA 5C0EB 1VFBA 1R5WB 3HE7A 3MLTB 3QXDB 5FXCH 2ZUWA 2C1OB 3HTLX 3WHE0 4BSWB 1N59A 4X8JA 1GYAA 1KXTB 3BGAA 3V7MA 3LAFA 5T1LA 3T2NL 1MFAL 5KSVB 4KVNL 4L3EA 5D93C 2BZDA 4DEPC 2ERJC 1KN4L 3OJVC 1MREL 4NJAL 4ZFGH 5LJYH 3O3DA 1MCJA 3AS1A 1Q9KA 4U6YA 5J6HA 3WD5H 1XIWA 4DKDC 1ETZA 2VZVA 3C8DA 5FUZH 3IDNA 5C0BD 1YN7B 3ALWA 4OCLC 1WCQA 3E6HB 5JPNA 3S5LB 3BSZL 3S5LA 1U8PB 1J0ZA 5CJXC 2F54A 2NZ9D 4TRPL 3MRPB 3KPRB 4IRSB 4YHNB 1A7OL 5FECA 1YEJL 4H0HB 3DX8B 2AEIT 4N0UB 1MFAH 1JPGB 5CBEB 3LKNA 4BFIB 1OHQA 1IGYB 2A0LC 2FDBP 3MNVB 5GS2H 4M6ML 1FAKT 5JXEA 3LKRA 2NY4D 3ARZA 5BCAA 1HK6A 2E9BA 1PKOA 3FONA 4XWOC 4JFPB 5D72L 5EUKB 4H0GA 3JWOH 1RIHL 2VLLB 2NY6C 2NLJB 4DN4H 2R2EB 4N0FA 5I0ZA 2X4SA 4LCUA 3LQAH 5DRZB 2OJZL 3CFCL 5BZDB 2ADGA 2YK1L 2UWEB 1VERA 1AXIB 3D18A 1NEZB 4FTVB 3CFDB 1FYTD 2R1XB 1MH5B 3O2VH 4KY1H 4HC1L 5KN5A 5DJCA 3ZSTA 4TSAL 3SE3A 35C8L 3BP6A 4EN3A 2V5RA 1OARL 4NRXA 4R0LB 5ANMB 5HDLA 3CNKA 3NTCH 4PLKD 2BSRA 2YWZA 2YD8A 4RRPG 1FV1A 5EIIB 1YMMD 4WV1B 1RMFL 4HUWA 4G8FA 1HZHL 4E5XA 3TO4C 2QQKL 1YDPA 2P5WB 3BH8B 4CVZB 5KS9E 5GRZA 1W0VB 1KC5H 4KTEL 4LASH 1E6OL 1E4WL 4I3SH 1OSZB 2D31A 1HINL 5JOPD 1KJ3H 4JANA 1QO3B 3RUGF 2R23A 1UYWH 3W0WD 4MD5A 1A1OA 1FORH 4CJ0A 3QEUB 4KZEH 1MJUL 4MB4A 4UINH 4MDJA 5CEYA 3MNZA 2UVEA 4YWGH 1U3HA 3MR9B 4PRHA 2ZUSA 3GMQA 1IM3A 5L2JA 4JN2B 4NQCB 4PJ7E 5F9WB 1I9EA 2DLFL 4DW2L 4G8FB 5DSCA 3B9KB 1BQSA 4OQ1A 4Y5XB 4PJFE 2FJGA 4K55A 4NWUH 3OXRA 1NFKA 2P5WE 4IOFD 1RIVL 1AP2A 5JXEC 2D9CA 2EC9T 2B0SH 3OHXA 4U49A 5F44A 1NFDB 3P77A 3WNLA 4XNQB 1EEZA 2QSVA 1EHLL 4N0CD 4KJPC 2I27N 2X4TA 5F1KC 2WBJC 1VFMA 5IBTL 2R1WB 4PD4K 3UTPD 3D85D 3MRNB 3GKZA 4CVUA 4KROD 3SDXB 2FO4A 1I9RL 1LP9A 5CIPA 5IFHL 4NJAH 4AT6A 3KDMB 4OLWL 3HE6A 4U6XA 3QUXD 3NFSH 1G84A 2CIIB 5H2BA 1BVZA 4NQEE 5DJ2A 3N9GH 3ILQD 3G5VA 2FX8L 1FJ1A 2X40A 3R0MA 3VU2A 4FMKA 4ODVH 3HC0A 3GSWB 4WO4A 5E94B 1GZPB 4QHLA 3TO4A 2W0FB 1CFNA 1QSZA 2J3SA 1KPUA 5EULV 2E5EA 1JK8A 4Z7OE 2A6DB 3B9KA 4Y5XA 1Q38A 3KPLA 4PJAA 2CLVB 2YEZA 3BQUB 2EC9U 5E8PA 4KI5C 1EXUB 4MYWB 3CMOL 4HWUA 4ZUVA 3BDXA 3LRGA 2EC8A 3CMGA 2ZG3A 5D2NB 4JQXA 4FTVA 2CIIA 4PJ9B 1Q9KB 4U6YB 1G9MC 5FM8A 4AY0A 1U91B 1XR9B 1SJEB 1KF9B 3CAFA 1P53A 3O4LD 4ZUTA 1N5YH 4R7NA 5BOZG 3U9UB 3O4LE 1NGXB 1FVCA 4XP6L 5DS8B 1I9IL 4Z5RA 3IDGA 2Q3ZA 3TNMB 5I1KL 3ARGB 1KCUL 1KV3A 2NY0D 2C1OA 4BSWA 1QLEL 5ISZA 3MV8A 3REVB 2CLRA 4GAFB 1JYNA 3TBTA 2OK0L 4A6YH 3DJ9A 4JFED 1G7JB 2H26B 4G7YH 5LGKA 4BFIA 1TVDA 3C5ZD 3HKFA 3OHXB 1V8HA 1AO7A 3H2WA 4FQCL 1C08B 5IMLA 1EEQA 3QEQA 3W9DB 3D3VD 2CPCA 3U2SA 4GW5B 5LQBL 5KG9A 1KT2B 2AEPH 5EOCJ 2HWZH 1N3NA 1CE6A 1IM3B 1DQLH 3DPBA 1H3VA 4JKPH 5F89B 5FM5M 4JO2L 2W92A 2LVCA 1JWMA 2IBGA 4Z7WE 5FHBL 1DL7L 3G04B 4D9QD 3HE6B 2DKUA 3OPZL 5DQ9B 1C5CL 3FOLB 2BK8A 3GMRB 3OX8A 3MLRH 1EGJL 2PO6C 1IKFL 1KCLA 3IKCA 5E2UL 4F7MB 4IOIB 4RGOL 2A1WH 2AJ3A 1QR1B 3BXNA 2VLRB 4I3GA 4XPFH 1NAKH 4DK3A 5AEAA 2ED8A 4XMKH 1MWAH 2UYLA 4M7ZB 4POZD 3VH8B 2VOTA 3QCVL 3O4LA 3HR6A 4HKBB 4ZSOB 3X3FL 1TTFA 2UWEF 1AE6H 4QRPD 4XPTL 5BRZB 1RHFA 5ICXB 2AJXH 2L7UA 5TDNA 2AXGA 2YN5A 2PUQT 4FN0A 4J12A 4JFDA 3TN0B 3B9KC 4Y5XC 4AQ1B 2X1XR 1BIIA 4WWKB 3U4BH 5HJ3A 2R0KL 4CMHC 5DRXB 3SKJH 3PQYD 5IBUB 5K33A 3D2UB 4MJ5A 5IMKA 4OGAD 3O2DH 3VH8G 4P5KA 4IRSC 3BE1L 3KYMA 3F12A 2Z31B 1N5AA 3MR9A 1GGTA 4X6BA 3SCMB 3GEWB 4CDHA 4PB0H 3EJYD 3BMWA 1N8ZA 3RWFA 1IFHH 1T89C 1JHTA 3OAUL 4Z76B 3RZCA 2W9EL 3C09B 4NWTL 4F37F 1KFAL 5BO1L 5CZXD 4QXGL 5GGTL 4IOIA 5KSBF 1W0YT 5D7KD 5EC2B 1PSKH 4NGHH 4HHAA 4X5XB 5I75C 3F7RA 3OB0H 2ARJA 1HHHB 1GPOH 3O0RL 3OGCA 2HJKA 5CLWA 4XPFL 1AFVL 3QEGL 1CFTA 4RCAA 1UJ3A 1X5IA 3CDYA 1TDQA 3TYFB 1J9CT 1HCFX 1A6UH 5F96L 3C60B 3ZYOA 2FZ3A 3LRSB 5GGSA 4WRLA 5FYKU 2OYPA 2HKFL 3MV9B 2NY5H 4F33A 1A9EA 1NEZA 3UTSB 3TT1L 2AJZB 4JM2A 5B39G 1JV5B 1A7QL 4R3SB 2YK1H 4YNYA 1C5DA 2B20A 1SYVA 1ULVA 2RB8A 1HYSD 4WUUB 3ARFB 1T0MB 1HHKB 3JV6A 3NIFF 3OR7B 2EDYA 4P4KB 1BD2B 2G9HA 2XTJB 4GAJL 4YAQB 2IAMA 1DN0B 3TCLA 1PKQE 1JGDA 3GSXA 4U1IB 5DJ6B 2IJ0C 4HKBA 2QSCH 1MCWM 2IQAA 3RNQB 3F62A 1EZVX 4TQEL 3TZVC 3GKWL 3TLRA 3WEXA 3ZDXF 4UAOC 3S34H 1SVZA 1P4LA 2Q20A 4NO5A 1V7MH 4M00A 4ODXA 3I9GL 5J6GA 3T0EA 3W0WE 4NC2B 3VFGH 5I30H 3P4OB 3WNOA 4MJIE 5I1KH 3S4SG 3MRCB 1OWWA 2K9UA 1QPXA 3INUH 1OSPL 5BZWA 4P2QD 4N68A 4UTAH 5A3IC 3QI9B 1RFDH 3V52H 2UY6A 3MNWB 2LU3A 4GRWE 5FO7A 2ICEB 4HS3B 1K8DB 3O9WD 2ICWI 1MOEA 4TQEH 5E7FA 4NHCL 5C08B 3V5KA 1GHFH 2VDNL 2BY0A 3UAJD 3GB7B 4LLUB 1S9VA 5T3ZE 3VFPB 2AW2A 1T6VN 3LV3A 3G6AB 5IVZB 3HE6C 3QFDB 1P4IL 2VZUA 5HYSA 5I1HL 4QRRD 4HWEH 3LD8C 4MCZB 3QUZB 2R69L 5HYJA 2J8UB 4D0CB 5BS0B 1CLZL 2V9TA 4Z6AT 3BE1H 5CJQH 1FE8L 2GCYA 4DZ8A 4X4XB 3H7BA 2YD7A 3O6MH 2BSSB 4NN5C 1FZKA 4F7PB 1HDMB 4L3CB 5FO9A 5E1AB 5GRVK 3P9LB 1E27B 1G7MA 3JBG7 2IBZY 4OD1L 5C0AD 1TVHB 1FLRH 1SYVB 4BZYA 1R5VB 2F54E 5EU4B 4HIJB 3I6GA 5H8DA 4WHTA 1UCBL 3TVMA 1EHNA 4Z95H 5HGGS 3FB5A 1EA9C 3I6LD 1ZTXL 5MEQB 3BRFA 2QHRH 2A83A 4X7CC 1EDQA 1CIUA 2UZYB 4I18B 1DVFD 4YHOH 4JFZH 1WSST 3FRUA 5E2UH 4MNQB 5GPRA 3B9EA 3QIUA 1NH6A 3O8XC 1CLOL 4FXGA 4LPYA 4FABH 3IS0X 3MGOB 4AT6B 1NANI 5FDWB 4HT1L 1ZLVK 3L3OA 4XCNB 2X1PA 3VMPA 4G80B 3GSOA 3IFLH 3VGEA 4PRHE 5I75B 3QHZH 3DECA 4U3HA 5FCUL 2WQ8A 3I3DA 2BY1A 3IDJB 2AEQL 5DVNA 3V4VL 1G6RL 5E6YA 3BD4A 3VXSB 4LHQB 1RUQL 3JTSB 4HKJA 5C6PB 4FQ1L 2FB4L 3VXUD 1JV5A 1IILE 3ZDZF 1JGLL 4OZHF 3BESR 3K4ZA 4JN1H 3TM6A 1OTUD 1KYOJ 3WHXA 4PJXF 4YR6A 2ZZUT 1UB6B 3M45A 4PG2A 2P5ED 5C7XH 2PR4H 3V0VA 5C0BA 2K7PA 3KYKL 2HFEB 4DKFH 1CE1L 4MSWB 3VFWB 4K3HA 3MRGB 4WDIB 5IFAH 3VFUB 4U1KB 2R2BA 4QHMB 1NDMB 5ACZB 1KSRA 5LQBH 1WC7B 3SE8L 2XWTA 3PWPA 3KG5A 1JCKA 4UNTA 3EYSL 3O3UN 5TGBA 2CDGA 3IKCB 1ERNA 4LLYA 5I9QB 4R6UA 4QTHB 1Q0XL 1P5VA 3CVHB 1W0WB 4FFYL 1YJDL 3TCLB 5GISL 4P2QE 4M6NH 4R8WL 1RZJH 3QRGL 2VNCA 4KRLB 4XB8A 5FO8A 3DUUA 1M1SA 5EIIA 4U33A 5GSVB 4YHNA 2Q8BH 5C86A 1SEQL 1N3NB 3BN9D 1L7TL 2JJSC 1DR9A 1LNUB 1KJ2A 4PRIA 3BVNA 4NNYA 2I9LB 4NNYB 3BKYH 2D7TH 4NWTH 4PLOB 3E8UH 4X6DE 4M62H 4J4PC 1T6WA 1FL3B 3UJIH 1J87A 1DQJA 4URTB 1P9MC 2DJ4A 3BH9B 1CFQA 1NCDL 3N0PB 1AIFA 3SKNA 1N4XH 2BRQA 5E2VL 4UU9A 3MRHB 4PRPD 1IGIL 1AGDA 1IGCH 2DLIA 3W82A 5MEPA 1JGEA 1UFUA 3ZE1E 4EZMA 3C09C 1IRAY 3HE7B 2Y06L 4JRXE 3MA9L 1FPTH 3KVQA 4YHZL 3U7YH 1U8HA 4PY7A 3LKNB 1KBGH 2GITB 1F13A 4XPAL 5LGJB 1SMAA 1TZIB 1MY5A 3FCTB 3DVIA 4QRTA 3P0VL 4U1HB 5IBLC 3V4UL 2ADJB 2X7LA 2FX9L 3KPNB 4G8EA 4G8EB 2HRLA 3BPNB 2BVPA 1NAKL 2YD2A 1D5IL 3H9YA 1RURL 3UJJH 4XNMA 4OZGB 4HKXA 2DLGA 2VDKL 4Q6IA 1NAMA 4LRIA 5AZ2L 3A67L 5IROA 4FP8H 2WUCL 3MXWL 5KVEH 2VDRH 2W91A 1EJ6A 4BZ1L 4IDLA 2DQJH 2KUTA 1I8KA 3O8XA 4YHML 1E27A 2HRPH 4P4KC 1TZGH 1ZLUH 5DZNA 4PB9H 4YBLB 4XAWL 2GK0B 2IC2A 1TFHA 1T5XB 3H9SD 2B0SL 4RIRA 3MZTA 4QOKE 2ADIA 1UKSA 3L9RB 4XPGL 3RTQA 3KYAA 2VL4A 5KSUA 3ZZ1A 2ZUUA 3TZVB 3IJYA 4M1GL 1QBLL 5C7XL 4NKMB 2DYPD 4ZOBA 1BFVL 3DBXA 3UPRA 4P2OA 5HHNB 4D9RD 4LVEA 3O3EA 4G6MH 1FVDB 2XT1B 3FZUD 9CGTA 4I5BB 1I1AC 4G9FB 5LAXB 3VDCA 3QYCA 2XZCL 3HG1D 1ZGLA 3K2UL 5EFIB 3RU8L 3S35H 1VEMA 1U58A 2X4PB 1XF4A 1FG2A 1M7XA 4FQQB 4WO4D 4GW5A 3VFMB 4MVBD 3B2VL 3V95A 1NLBH 1UWGL 1I7UA 2H3NA 3WLBA 4GRMB 5IKCA 1B0GA 3OF6A 3EIFA 4RISH 3TO4B 5E7BA 3H8NA 4YEFA 1KEGH 1QFWL 1IKNA 3V6OE 3QH3A 1Z3GH 1ZV5A 5J1TC 3RZWA 1IAKB 2HFFB 3GK8H 3GRWH 4PP1D 1K4CA 1CR9H 4JHAH 4X5WB 1T83C 3C6LC 4Y4HB 4FQXD 3D0LA 4JDTL 4ODUA 4JHZA 4WFED 2AJVL 4I0PD 4YLQT 5DTFB 3NOIA 4HGKC 4MWFB 3HCVB 3STZA 2Z8WC 3L7EB 1DQML 1KPVB 3B5TA 2NX5B 3IDUA 4GBXA 4OLXH 2ZSWB 3KYNB 1PEWA 4LKCA 4XPBL 1A1MA 3TGXA 3QCTL 2YD1A 4R96B 3QRFM 5KSAC 3ARVA 2OXGA 2NY1C 2EDLA 4I2XB 3RVXC 1CICB 5TE7H 4G9DB 4WFGE 1AO7D 1GVIA 1OWRM 5HI4D 1MJJA 4H25A 4NQDA 5FA3A 4XX1E 2UZXB 3PGFH 4JB9H 5E94A 1IMHC 3GSWA 5C09B 4P9HC 2BSTA 2GSGB 2XQYK 1G1YA 1GGUA 2KZWA 3U0TB 4QGTA 2R0WL 3ORJA 3LEXA 5I1HH 3WE6A 1M05A 1I1CA 1X5LA 4PJCE 5BV7L 4OCWH 3SE4A 2FATH 1TJIH 1FO0A 5F9DC 3ULUH 3IU3B 1Z3GL 5GRVL 3MC0A 2H32B 1OW0C 1RVFH 3BZ4A 3PWLB 2E9IA 3BKJH 4QOKD 2L7JA 2UZIH 4MD4B 4R4BA 1XGPB 4ODBD 4NQDB 1I7UB 5TPWL 5GS0C 5I1JL 1INQA 4X6BB 4HS3A 2ICEA 1BAFH 1HIML 1ZVSA 2XWJB 5ACLA 3FMGL 2DQTL 2PYEE 3LKQA 3MRPA 2J5LB 4IRSA 2Y6SD 2XXCB 2F19H 4X80L 4M5ZH 2AEWA 4WENB 5DD5H 3OXRB 4OFDA 4PJCB 1IC5L 1IKNC 3MV7A 4L8DA 4NN6C 1VKXB 4LFHG 4AIOA 3FN0L 5EZLB 2QL1A 4PY8J 5C9JB 1RMFH 3SGEH 3ESUF 3TA3A 5JHDA 1HN1A 3I85A 2MFNA 5BS0A 5EUKA 4OV6F 4RGNB 5FYJU 1YZZA 3KPRD 3IAGC 2FD6H 3IDMB 4M9PA 1CDJA 3FT3B 4JDVA 4JFHD 3QAZB 3RZCD 4LCYA 1UJ3C 4TVPD 2VLKA 2Z4QA 4OJFH 3REWB 4CNIA 4RAUB 4JY5H 4XTRD 3QJFB 1H3PH 2HKFH 5SWSE 2A73B 3Q2CA 4QGYA 2AJZA 3H3PH 4JM2B 4AENB 1JPSL 3VXMA 4O9HH 2CD0A 4KRMB 2B1AH 3O4OC 5F9JB 3OTTA 5AWNL 4D0BA 2G75A 4ZS7H 3WN5A 5IJVB 4X6DA 4HIHB 3K1KC 1MCNA 3QWOA 3MNWA 2BFVH 1UZ8A 3EAKA 1AQKL 1U8PA 1A22B 5SWZA 1IL1A 5EORH 3QNYB 4PTUA 3V5DA 5JQ6L 1UM6H 3SQOL 1T0NB 2YD5A 3PHSA 1VACB 4DVBA 4I5BA 1G7IA 2XY2A 5LAXA 4LSTL 4W70A 4J6RH 7FABH 2Q87A 4WGVB 4XHJC 2IH3A 2XPGB 3G5XB 1ZTXH 1W8OA 4K8RD 2F74B 2D9QB 4WNQB 5BXFB 5E6IA 3P0YL 1S9YB 4JKKA 4YBQC 3QUYD 4NN7C 3D69B 3ZHKA 2E27L 5DEGB 3ARQA 4NO0B 1QLFA 1MI5D 5C0EA 2RFXB 3PDDA 2D7MA 2P44B 3OKNA 1MCEA 2XN9A 2A6JB 3B5HA 1X5ZA 2CIKA 1MVUB 2E8YA 3DYPA 4I8DA 3PP4L 3U1SL 4HAFA 5D1ZB 3K4DA 1R0AH 4OFPA 5IROC 4MLIA 3VGHA 1U8IA 2DQHL 5EOTA 4HBQA 3T4AB 3NIFE 3L5WA 4N8CH 4PY8I 2DBJA 4F80A 5SV3A 2HT4D 4DCQA 1U8JB 4QRPE 5FIEA 1NCWH 1HH6A 4X6DF 2CLZB 2V17H 1K6QH 5EZJA 1QUNA 5DHVA 4IOSD 3I50H 4RAUA 4OV5A 3LQZA 1YQ2A 2F53A 4A6YB 5I0DA 1MLCB 5H2BB 2GEEA 4LSSL 1RAMA 3GMRA 2F8OA 2IFFH 1AKJB 4LQFH 3CFJB 5C3TA 3L7FA 2DQFB 1FHGA 2ESVA 3ULUC 3IXAA 5I1EH 5IMOB 2VISA 5GHWL 1FVCB 6CGTA 4JFQA 4XPTH 5E00B 4LARH 4KGJA 5CUSL 5A16B 5T5NF 5IF0B 3RVUD 1Z0MA 1A6ZA 3QQ9C 4K9EC 4ETQB 2L0DA 1KTDB 3FAXA 4EOWL 1NMBL 3H42H 4WWKA 4DAGH 3JTTB 3ARFC 4X99A 1HQRA 3OPZH 2IPUK 2Y07L 1NBYB 1A7PH 4MLSA 1EFXA 1AO7E 4YDIH 5EU5B 3HC4L 4E0RA 3O3BB 5FM5O 3U30C 3SGDH 2WBJA 3I2CL 2R56H 5ISZE 1IZKA 2NY2B 3QXAA 1DANT 5CBAA 1ZT1B 5DO2D 2Y6SC 4XNUL 5E2TH 1T1YA 4G8IB 2HVKB 5AZEL 5MERA 2D7QA 3AFLA 3P9MB 4Q6YA 3UO1H 2UWEE 3FQXB 1WK0A 1ZHKB 2P7TA 4XNZB 1K6QL 4PJDF 5D6CA 1EHAA 4RMUA 4JQXC 3U46B 4Y5YC 4PJ5E 5HGBA 1LDSA 3D25B 4JJ5A 4FA8A 3DURA 1ZANH 2HLFC 3K8MA 4ORZC 3ARDC 2W65B 1YPZB 2OR8A 1LDPL 2VERN 2OZ4A 1X5KA 4XMLL 2DBLL 2NY1B 4KK5C 3WNNA 1DQTA 4H5SA 3UZEA 1I7RA 1N0XH 3LY6A 4O5LH 2QADC 3NA9L 2GTZB 3OAYK 3SGJA 4PJGB 3JTSA 1E4KA 3HFMH 3LDBB 3C5ZB 4HCRH 1RVFL 3VXRA 1FNSL 2F5BH 2JTDA 3CSYB 2APXA 3NCMA 4EDWH 1I4FB 4PJ5B 4F7CB 3NCBB 1RD6A 1YYMH 2CO7B 5CD5C 5I19L 2HKHL 5DS8A 3BP4B 3BP4A 3VA2C 3D87B 1RUAL 3RX8A 4M02A 4NKMA 2I5YL 3NACL 4D3CH 2DI7A 1H15A 1RV6X 2FECL 3AS0A 3WE6B 1F4AA 2YKLH 4U4BA 4WU5B 5INCA 4HIIB 4X9FA 3PWPD 4YPGA 5T33L 2WZPD 2WBWB 4XNYH 3P77B 4HK0B 4ZAKC 2EDTA 4PBWD 3VFVA 4P23D 1JI1A 5FUCE 3GRWA 2KQMA 1LP9F 1KN2H 2VLRD 5FB8B 5EU5A 1J8HE 5EH1A 1B6DA 1OY3B 3U0WH 3TA3C 2J5LC 3M1BB 1NUNB 3JV0A 3RWDA 1IGJB 3E6HA 5JPNB 1HE7A 4Y4FC 3HMWH 1ORQB 3INUL 4LVNC 1H8OA 1JZ4A 2Y07H 1YUHB 1FNAA 1FN4A 1LO0H 4DVRH 1QSFD 3F58L 3BP5A 3MJ9L 4JEGB 1U8LB 2R39A 4JY5L 4OCYH 2VWEE 5HHOB 3OG6B 4NIKB 1KGCE 3FOMB 3L3JB 1NEZG 2A1WL 1QLRA 3BEWB 5E6ZA 3OKMA 3PQYB 4K7FB 5T1KB 5JORB 2QSCL 1HSAA 1Z0NA 4U6HA 5CIPH 3MRMB 4QEGA 4RFOL 2R1WA 3QAZC 4IRJB 2AXFB 1XGRA 3ARDA 3L5XL 1UWEL 3OR6A 1FQ9C 1P7QA 2O5ZH 5KVDL 4F15C 5I15H 5CGYD 3L1OL 1ITBB 3DO7A 4FS0A 3OJMB 4KTDL 4NRYB 5ENWA 5IG7B 4L4TE 1T66D 4UOJA 1RZIA 1CGSH 1J88A 1A9EB 3MXWH 5KVEL 4JFFD 4K8RC 5J13C 1FIGL 4K3EH 5IVOA 5FKAB 3TNNB 2BC4B 1MH5A 1UKQA 3QB7C 3UJTH 2AV7A 3EO9H 4P46D 3MLSL 3DVFA 3MOAH 3P4NA 3DV6A 5JXAL 3PQYE 4WV1C 5F7FA 2DQUH 1SM3L 1XF3B 4MD0B 3FFCE 3QQ4B 3DUUB 4TULH 1BX2B 2HAZA 2R4SH 1Q9OB 3NABL 4OCXL 3W9EA 1XMWA 3CZJA 5FYLE 5J3HC 1BAFL 1HIMH 4E41A 1CD1B 1I1FB 2EKSB 3E2HB 3QZWG 5SX4I 4P5TD 5CSZB 2YPLE 1XAUA 5E5MB 2VLKB 2P8LB 5ESVA 1IGYA 5HGAB 1A7NH 2HYMA 3TPKA 5IFHH 4ONOA 4ZUSA 4GMSL 4PP2B 3RWHA 3ET9F 1N7ML 1NMCC 4Y5YB 4ZODA 3WJLC 3GI9H 5TDPA 3QDGD 5T3XH 3ZLQC 2BCKB 1G6VK 2IANB 4RGMC 2XTJD 3EGSB 5IR1A 4TSBL 1A9BB 1VPOH 3GSVB 3WL9A 1N5AB 3F12B 1N4XL 2P46B 1SYSB 2A74B 3FFCB 4PV9B 3V2AR 1NAMB 4EVNA 1U9KA 3IDIB 4I9WE 3O11A 1SY6L 5EU7C 4JFDE 4OGZA 2XV6B 2EH8H 4KVNH 1T83A 3X12A 1A6ZB 3CFDA 2VDPL 4S1QL 4Z0XB 1LEGA 3LDBC 1KB9K 4CW1A 4YDKH 5DJAA 2X9YA 4G8GE 2XXMB 4M43H 4A2LA 5JW4M 2WP3T 3RPIB 2EXWC 3V0AC 1TZIA 3FCTA 2BRRH 3MV7E 4OD2B 5HVWA 3VGBA 1J1OL 3HNSH 5D1QD 1K85A 2VZTA 2DQUL 2M8XA 4ZNCD 4X6FB 4FG6C 5D7JD 1KXVC 5EWIL 2R2CA 5F93C 4CN1A 2MOVA 5EZJB 5CSBA 3UTOA 1JHTB 1K3ZA 1HWGB 5D7SH 3IT8D 3MBED 3G04A 4DGYH 3DX8A 2VMFA 2AP2A 2CKBB 4OZ4A 4QRRB 2VXQL 3ALXA 5H94B 1A7NL 3JUYA 2X09A 3DLQR 4FTVE 2FD6L 4G6JH 2XZAL 2IWGA 2PYEA 4NKDB 2J8HA 4Z7VA 5DD0H 3PDOB 4WTZG 5EO0B 3QULA 4KTYA 2NYYC 2VXSH 1DUZA 1MRDH 4OQTL 3MLUL 4XNXH 1G7QA 2NCMA 3ARYA 2EYTA 4JRYE 2HN7A 3CFEB 1LO3H 4ZOCA 4ZQKA 1FFPA 1SM3H 4L4VA 4KY1L 5MENB 1QBML 3QUXB 4GAYA 1BJ1H 4HV8B 2FO1A 1S9KC 4L8CA 1CT8A 1EZVY 5C0AB 1CL7L 1S7RB 3L3HB 1MFDH 4HLZH 4LSRL 4R4FH 5LGHH 4QHNB 4QTIL 4EXKA 2YMXL 1S9YA 2QSTA 5BV7B 2NY2C 4JZNB 3FFDB 5JDSB 1NGXA 2GUOA 1ZK9A 4O02H 1F5WA 3TH2T 3IF1A 2E7MA 5D7JA 1U8LA 3O3AB 3NPSB 4OCMC 3LEYL 1OT1A 5L0QB 4JN1L 4JPIA 2CDFA 4GRLC 4WHCA 4DTGL 4KDTA 3FQRB 5GGVY 3P4NB 2BNRB 4KHTL 15C8L 1YN6B 3IFNH 3CSPA 3ZE0E 5HYSG 1S3KH 3MSPA 4LP5A 4DGYL 5FGCE 3CFKA 2R4RH 4X7SH 4OFYD 2BXYA 4JB9L 5EBWA 3MOQA 4YQXL 2BNUB 4JFFE 3D5OF 3HI6H 3KJ6L 5ERWA 4YDKL 3HRZA 5D96B 2QADB 4J3XA 3MMEB 1K2DB 2OJEA 4XCYA 5FCUH 3MREB 4KKAC 3WLWD 3VXSA 3U6RB 1KPRB 2MCG1 4J3OC 4HF5H 1KJ2H 4YC2C 4F7PA 4QNPF 1IQDB 4DUWA 1FPTL 5HYIA 2CXKA 1LEIB 4OB5L 4N1HB 3FJTA 2R9HD 3DGGB 3HI1A 4XZUA 4G80A 4M7ZC 3MLVH 2P5EB 1QLRB 1KYOK 4M8QA 4J23A 4C83B 4YHOL 2ILLA 2X4TB 1URLA 5GZOC 3MA9H 5DD1L 5EU6A 4IS6A 4HIXH 3P2TA 3OF6D 3TN0C 2SEBB 2AKRA 4ALAH 3ZKXC 3N85L 5J3HD 5KSAB 5DJYA 3T2QA 1A21A 1FFPB 2FX7L 1PD6A 5MHSD 1GZQB 4N9GA 4Q6IB 4UZGA 4M7LL 1XGUB 1MF2L 1T22A 1B4JH 2V2XA 4PFEA 5E8DH 1U8NB 2J8UE 2W65A 4R4BB 3T0WA 3SCMC 4YHPA 3AREA 2OR9L 3W11D 3RIAK 4HZLA 1A7RH 5HHOE 3ZDYE 1X5XA 1S5HA 1JF1B 1RU9H 3RNKB 5LGHL 4XMLH 3HI6L 2J88L 4HULB 1MFDL 3BO8B 4ZO6A 4Y2DB 1H15B 2Q8BL 5FKPB 2EDKA 1ZHKA 1AXSB 3VD9A 1JPTH 2AK4E 4JJHA 1FIEA 3QFJD 4LEOB 3N50A 1BQLH 4OGXL 3RP1A 4J1UB 4LOUD 1SJHB 3BGFB 4ZTPH 1CDBA 3KPSA 5B39B 5GXBB 3HUJA 5IHZB 5CUSH 1ZHBB 4MQ7A 1XZ0B 2I07A 3AAZB 3CZFA 1KB5A 4F15B 3NABH 3MTRA 3O6FD 1FSKB 2XFXB 5DQJA 4K2UH 3CFEA 4FRWA 3NAAL 4MDIB 3MGTB 1UGNA 5FA4A 3T08A 2AQ2A 1IGTB 2EYSB 4UB0H 5MI0C 4WEBL 1PLGH 2VDRL 3OKEB 3GSNA 5DJ8A 2VQ1A 3N1PC 5I1AB 2IMMA 2XTJC 2ATPA 4MA1C 1TIUA 5DYOA 3SO5A 3D25A 4JG0H 4I77H 3CSGA 5IMOA 5BW7C 2XQYG 1E28B 3TZVA 3ZKQD 4D0DB 1QEWA 3B9AA 3GSRB 3LRHA 5C71A 1J0IA 3CCHB 3P9MA 4NOFA 4KUZL 5E99L 3MUY1 1CLOH 1FZJB 3HMWL 4H20H 5HDBF 1U8KB 2RAMA 4R2GC 4KXZH 4PJBB 4KI5D 1ZHLB 4XBGA 1A5FL 4PREB 4GUPB 1YNTA 3EBAA 2H6PB 3K1DA 1H8NA 1DFBH 5SX5H 3VG9C 3PP3H 3AREC 1HOCA 2XA8L 3H6JA 1FNEB 1RJLB 4YFDB 3GM0A 4P4KD 1BEYL 5F7HA 2HFEA 2J6EH 2BVPB 1E6JH 3ZT6A 4EN3B 5IM7B 1YN7A 2JCCA 3QG6B 4JZJC 4FQPA 4K94L 3BPCB 3BPCA 5D5MF 3KPQB 5D5ME 1MI5E 1D6EB 1XF5B 2O26U 4OQTA 1B3JA 1D5XA 1WBYA 2MCPH 4N1EA 1MCDA 2Z0BA 3U4BL 3QDJA 1UQSB 4LRIC 3P0VH 5TDNB 2JKXA 1EK3A 1P84J 1ZHNA 5K9QI 1BZ9B 1XGTB 4NOBA 2AJYH 3NVQA 5J11B 2DQHH 4FQJL 1W0WA 4PGDA 1BHGA 5E9DD 4BQ9A 4NCC1 5JQ6H 4ORGB 4P2QA 5KSUB 4P2QB 5DC0A 4DUVA 5BXFA 1AXTH 4GKOA 1CDIA 3CH8A 1OGAB 4XT1C 2YPVH 2AGJH 3HMXA 3RBSA 1TQCB 1RJZB 3O6ML 3CX5K 3F7VB 1B0WA 4K3JH 5I18L 5C08D 3ZE1F 2B4CH 3MLRL 5EB9A 2QTEA 4U1KA 3QISA 4IJ3B 3RNKA 1A0QL 2H2SD 4GMTL 5EZIL 3EYSH 3UROR 3WFBL 3DTXB 3QNZB 1X7QB 4UBDC 1NMBH 3H42L 3V6ZB 4GG8B 3CH1B 3PL6A 4LP4A 2RHEA 3Q6GL 3VE0A 3VE0B 4YZFE 4PP1C 4PG2C 2OTPA 3TP4A 3TYGH 4RSVA 3QUZD 5IEHA 3DYOA 5AYQA 1G7PA 3WHXB 5D8JH 3T4YB 1TJGL 4WTWA 2CRIA 2W1NA 1CLYH 2GHWB 4MAUL 2PR4L 4IMKC 3TBWB 1SEQH 2CGRH 4OSUL 5J06A 5GHWH 5KSAA 4Z7VF 1U8KA 5BRZA 4IIQB 3RJDA 3U4EB 3ARPA 1CGUA 2XN9D 4C56B 2CK0H 3ELAT 3UTQA 3X14B 2XKUA 4LCYB 5HVHC 1F3RB 5TQ2H 5AYUH 5B39A 2IG2L 3G5ZA 2M2DA 3Q3GB 3RWJB 2E7BA 1ACZA 4PGZA 2P4AB 1WZ1L 4XCNA 1NDGA 3GJEB 3SKNB 1AIFB 5DYOB 4OGAC 4D9RE 2AEQH 1OAXL 5HI4C 3RAJH 2WINA 2I9TA 4S1SL 4X5LA 1AC6A 1TTUA 5GGVL 1PQZA 3OJDB 4XB7A 2C1PA 3AMKA 2IPUG 5L0QC 2Y36L 4GBXC 3WNKA 4G42B 3VMNA 1JNNL 3ILPB 5EOCH 1S8DA 3RUGA 3H0TB 4PJHE 4UILH 1L9MA 1AP2B 4JY6A 4L29B 4NUJB 2KPNA 3WYRA 4MCYA 5JO5A 1IC5H 1GAFH 4QOKB 3O45A 2G60L 1XGUA 3QZWA 1P2CA 4PBXA 5IMLB 2APWA 5F88A 1UXSB 1KELL 1Z5LA 5GZOD 1HXYA 4HIEA 1OLZA 2IPTH 5HGDA 3DX9A 3U0PB 5BZWB 3CVIL 1T1XB 1FZJA 3KXFA 3VCLB 4MAUH 4YC2B 3N9GL 3LZFH 1HKLH 5TPWH 3L5HA 3MFFA 4TUJB 5D8JL 3DO3A 3TF7C 1NDMA 4QHMA 3VXTB 1H3TA 1PX3A 1P1ZA 3RL1B 1CGYA 5I9QC 3PV6B 4O5LL 3CFBB 3V9FA 1RK0B 4XZUB 1PSKL 4NGHL 3AREB 4MJIA 2X4UB 3VFNA 1A0QH 4XVTL 3GMMA 1P2CB 3UBXI 1DN0A 3I3BA 2IAMB 2ZP0T 2VXUH 4WHTB 2IPTL 5DJZB 2VAAB 1FV1B 1ZLWK 4F7TA 4LLQA 2AJVH 1JN6B 3IETA 1I3UA 2NW3B 3Q1SH 4Q6IC 1GOGA 1KOAA 3EYUH 4OCRL 1UM4H 5D7LD 2A2QT 2DQIH 4F2MA 1CN4A 3O6LL 1ZXQA 5CJ5A 4RMQA 4F9LC 2OI9B 3DMMD 1IM9A 3HUJB 4XVUC 3V8CA 2Y36H 4OLEA 4OJFL 1KULA 1KCKA 3WIIH 3S36L 1UB5A 4Q2ZA 3GJEA 2MCPL 3RDTB 1VADA 1ZE3C 3I6KB 1N0XL 3FB6B 5DK2B 1NGYA 1SMOA 2QQNL 3KHQA 2WUBH 1AJ7L 2ZG2A 4G8IA 5MERB 1PZUB 5B22A 1QFWM 1PLGL 1I8IA 3LV3B 1H3GA 1OF2B 4OT1L 2F53E 4HWEL 1QR4A 3D0VA 3OV6A 3O45B 5C0AA 3L6FA 4LSTH 1L0XA 1QFHA 4NM8H 1YN6A 3MLUH 1HQRB 2XKSA 4XPHH 1J1PL 1YEIH 4Y89A 5JNYB 4Y4FB 5SWSB 3VXPB 3UDWA 1CDYA 4NFCA 4GQ9H 2YRPA 4KI1A 5GGVH 2ZSWA 3ZT7A 2E6PA 4BM7A 2D0GA 2OK0H 2YWYA 3K80A 3MXVH 1RZGB 3QDMB 1MVUA 3U82B 3GSQB 3CFBA 4XP9H 4BQ8A 4PG9B 4Q0XL 5LBSH 3MRKB 4WEBH 1G7LA 3CXHJ 2A0LD 2ADIB 3L9RA 4Z7WF 2IALA 4XXCA 3VI3F 5I1GL 1D9KB 4L4VE 3QUMB 1VFBB 2NZ9C 1JMXA 2BRRL 4JVUA 4AG4H 4I48B 4GJTB 3UYOD 1AR2A 3T0XA 2ZUVA 1RU9L 3VG9B 2F8VA 1JPGA 3N1GC 3UZVB 2GAZB 4HKXB 5DMGC 3O8XD 4FFWD 2BVTA 4LGSB 3BZDA 1AKJD 2UZIL 3QXUA 5I1LB 4F8TA 3QUKA 3S7GA 2ADJA 4ETYA 3RTQD 5DZOA 4JRXD 3RWEA 1ND0A 3WDIA 1IAII 1X3DA 5HHPB 5CWSA 2H9GA 4P2OD 1RUML 3ZE0F 2J6EL 3KS0H 2XQBL 5IBTH 3SE9H 3FRPA 1HHIB 5ITBH 4MMXC 4OB5H 2A6JA 2IEPA 4KV5E 3C2AH 1U8OA 2R0KH 3HG1B 1ZT7B 4XC1L 3WXWH 4OLUH 4UDTA 2JCCF 3DXAE 1Q8MA 4ONGH 5CD3A 5JTWA 4BUGA 4YIQA 1L0QA 2WSKA 3IB4A 3QG7H 2FGZA 1T5XA 1T0PB 2EIBA 1NLDL 1EO8H 5KSBE 1OD9A 4OCXH 2DLFH 4DW2H 4YAQA 4PLKC 3MCG1 5IVXB 3FTGB 3Q5YA 5JHDB 3OAUH 2OM5A 3QDAA 3WUWA 3ARXA 4J8RB 4M9OA 3TO4D 4IJ3C 1GSMA 1I7TA 2HVJA 1D6VL 2ZSVB 4XPBH 3VWJB 1VACA 4XWGH 3S88L 5T3XE 2FLBT 5GGSB 4ZUVB 3EYOA 5HJ3B 1F6FB 3BKCL 1S7WB 1CXEA 5I1LA 4JPKH 4ZPVA 3V6ZA 5ESQB 5I15L 4KHXL 1P69B 1GXEA 2Q86A 2OR7A 2G75B 5J1AA 5J57B 5IHZA 4NZDA 1L7TH 2UYLB 3MFGB 2X2YA 4S2SA 4UUJB 2IADA 2PXYA 3RIFF 4G8GA 3GFUA 4M7KH 2CH8A 3ABZA 3S35L 4GBXD 2NY1D 3QIWD 1XGRB 4PJAE 1EBPA 2FSEA 4X6FA 5CJBA 1CVRA 3NMEA 4P3CL 1NGZA 2BJML 3HS0B 4W81A 5JW3H 4LHUG 5TE6L 5D1XD 1LK3L 3NIGE 5T1KA 2B1AL 4BJLA 3P11H 3LH2L 4K3EL 3VFTA 4J4PD 3KPRE 2YPLA 1FL3A 3QXWA 2ZJSH 5JXED 5KG9B 1LK3H 3GIVB 1KNOA 1SBBA 3FQWB 2DQGL 2EIZA 1PX4A 4EUPG 3BFOA 1CTNA 3EJZC 3FFCA 3KWWB 3KPPB 1TCMA 2NXZB 4CKVX 1A3RH 1MCOL 5DJXA 2PYFB 5GS1B 4HKJB 4PJAB 4DN3L 1CXKA 4X4YA 5TFSH 3GGWB 1MCBA 4M1CC 1I1YB 5C0CD 1K3IA 2H6PA 4DFIA 4ZTOL 1YEJH 3GSNL 4ZOAA 5GS0D 2VH5L 2QJDA 3BIBX 5DTFA 3SDCC 4PJGE 5TQ0L 3PIQB 3BWAA 4NJ9H 3MRJB 4AL8H 3OMZA 4PJFA 5EBMA 4F3FB 3H9ZA 4Y16D 3W81A 1VDGA 5SWQA 1NBQA 3CC5A 2AVGA 4ZFOB 4P9HL 3R06A 2XKNA 5JUEL 1KB5L 3ZHLA 1JTPA 5ISZD 4R97C 1YUHA 1ZS8A 5E0QA 43CAA 4NRZB 3MYJB 4NKIH 1LEKA 4L4VD 4LPWA 3WN5C 1SY6A 3LB6D 1DBJH 4HX1B 4W6XB 5FUOH 5T1KD 1KB5H 2JB5L 1B4JL 4YX2H 1ZGLP 1BOGB 3WJLA 1AGBA 4HH8A 4DGVH 5E56A 3D3VE 2WM0A 3D3VA 4YFLF 4XNQA 5KS9B 2BNRA 4LNVA 2YKLL 1AD0A 5TQ0H 2ITCA 1TVBB 5DT1L 3B2UC 3SHSA 3IFPA 3TEUA 3R8QA 4JR9L 2AKRB 3PXHA 3ZE2F 2YUZA 2CLRB 5DWUL 2MJWA 3IJSA 5EU3B 4CMMA 3AXLA 1B0RA 1QA9B 2VLJE 4NUGH 2GW5A 1BFOB 4NWUL 3QG7L 4K07A 43CAB 3V8OA 1MCOH 5F72S 1QFWI 2P45B 1EH9A 2PO6D 1KTRL 5CCKH 1SJEA 3CFJA 4JFPA 4PJFB 5EBMB 4HDIA 2HJFA 1CDCA 3UBXA 3EO9L 1S5HB 5LCVH 4CL7A 4QTIH 3BIKA 4KZEL 1KCSL 4PGBA 2I60H 2EDOA 3AMLA 5LVEA 2C3VB 3IXTA 2CDEB 5HI3C 2EDBA 1S9WA 2NY7H 2YEZB 3BQUA 1DBMH 5AD0A 2R9HC 3PJSB 1ZANL 1BOGA 4GO6B 5D2LF 2HTLC 2IAND 4AEEA 4POZC 4LPVA 4OQTH 1WVZA 4WVRA 4D8PA 4OKVA 4GAJH 4KTDH 4LCCA 4NO0D 5F6HI 1MI5A 4B0MM 5IW3A 1VGKB 3IFOA 5SWQB 3E1F1 2WINB 4L8BA 3I2CH 1C16B 3MJ7B 1YEHL 2GCYB 1KIRA 1T20A 4KHXH 4XCFL 5GRYA 2AJSH 2DS4A 2R2EA 2FB4H 1WFOA 1Q0XH 3K46A 2ARJQ 2VDQH 4F7EA 2FCBA 4NKOA 1BLNB 1Q94A 5I16A 4CJ1A 4FFZH 1IJ9A 4QHNA 4ZXBB 4YZFF 1NUGA 3CSYA 3Q5TA 5IJKA 3IAPA 1LD9B 1D6VH 2A6IB 3HNVH 5D1QB 3E6FB 3MZGB 1P4BH 1OTSD 5INDA 4PD4J 2DM7A 1HHIA 2OBGA 1ZA3A 4RFEB 3KPPA 5EBGA 1D3CA 4Y88A 5D2NE 4IRSD 1MJ8L 3PGDA 1NCUA 5ICYB 1KLUA 2HG5B 4HFUH 2H41A 4O2CB 4XH2B 3T3MF 3H9HA 4MA1B 3VXME 4PRIE 3IVKB 2YSSA 4LEXL 1X5AA 1XGYH 1YYLL 5D93B 4QRRA 5KW9L 2HKHH 4O2FB 2EIDA 2FEDD 1YYML 4YXHL 1WBXB 1F90H 1RJZA 5GGSY 2GUOB 4LCWB 3TBSA 4P9ML 2RFXA 3V5HB 5LXGL 3V5HA 1CGVA 4G8GB 1F6AB 4L3EE 5BJTA 4D3CL 1DDHB 1G6RA 1I1AA 4ESKA 1QFOA 3O0RH 1YDPB 4HSQA 4N0UA 4M5YL 5CBEA 4UDTB 3PWPE 1BZ9A 4NO3A 1B2WH 4M61B 3BJ91 3ETBF 4OD1H 3L5WB 4WW2F 4OLUL 3ZSSA 3ZKSD 4MJ5B 4LDEB 1IFHL 1YA5A 3KLHC 4OLYL 3QDJE 1G9NH 4NQXB 2BVQA 4FNLL 3VFRB 5J89A 4P9MH 5IM7A 4WHDA 2XN9E 1AR1D 4R2GD 2YXFA 4L9DA 5IESH 2NZIA 3STLA 3TN0A 1E4KC 5FEBA 2JF1A 2X4SB 4LCUB 1AGEA 1NUFA 1FIGH 4L3EB 3VG0H 4BH8A 2VDMH 5CHNA 3VDBA 1S5IL 2BCKA 3VGAB 4LSQL 1TXKA 3IRPX 1GCFA 4ZFGL 3OB0K 3UTSE 5HHQA 1FH5L 3KPSB 1DE4B 3JZ7A 3RWIB 1MQKH 5MENE 3QUYA 2B5IB 1VCAA 1CCZA 1SBSH 2QADD 4WTZA 3HI5H 3VFGL 5DK0B 3QJHA 1T0NA 4WDIA 4XMKL 3DVNB 4MNQA 1U93B 1CG9A 3QA3B 1Y0LA 4LLMA 1BOYA 3K74B 3VXRD 1A1NB 3RL2B 4O9HL 3B8SA 4X80H 3SBWC 2Z9TA 4YR6B 5EN2A 4HAGA 3SDCD 2P47B 5I1DB 3OSKA 1INDH 3M8OH 1GHFL 1ETZB 1CDUA 1L7IL 4Y4FA 5SWSA 1JP5A 1T04A 3HPLB 3S98A 1I7TB 4W4NA 1AFVH 2XFXA 3QEGH 4ZO9A 2LV4A 2WWKT 1SYSA 5GS1C 4MJ2A 5IB3B 1ZVSB 1I75A 2VO5A 1OAXH 1L7IH 3WFCH 3KYKH 4N0YL 4AM0B 1BQHG 4L8SC 4G6KH 1FYTE 3QSKB 4OIAA 1JNHB 3ALPA 5BV7H 1OGTB 5CD3B 1MRFL 2APBA 3WFDL 4DJMA 3DHJA 3OKMB 5SWZE 1UACH 3P4LA 4JPWL 4ONHA 4LSQH 3P4MA 5M7QA 5ADPL 3QUZA 4FQ1H 4Z95L 1QLEH 5DFVC 2HT4C 3GMPA 3SDAC 1U42A 4NBXB 2V17L 1X9QA 3LS4L 5BS0E 3TV3H 4LPCA 1MQKL 4WUUE 2DIJA 1FNSH 2F5BL 3L3GA 5DC9B 4ELMF 1CFVH 5FGBC 5L2KE 5I1IH 2X4QB 3F5WA 2IH1B 2HMIC 4F9PC 5HDBE 3WIIL 5AD0B 4OF5A 4L29A 5F9JA 4FQQA 1B2WL 2AJYL 5T33H 4YDVB 4OCSL 2DJUA 3G6JB 1LK2A 4JM4L 3ULVD 3RX7A 5D9SB 4LIQL 2EDRA 5CJ8A 1NCWL 1RULH 3MUZ1 3MUGA 4GXUN 4MNHB 4WI3A 1U2CA 3BDYH 1N0LA 1B6UA 1JE6A 2ICWA 4P3WA 1A5FH 1R3KB 3U7WL 5F3BA 4U3XA 4F7EB 2PTTB 2X1WL 3ARBA 2ZUQB 1UM6L 4JFEB 1QBBA 3T2PA 3WFCL 4HEME 4PJ9A 3P30L 1D5ZB 4PJXA 4ZOEA 1Z9MA 5CGMA 4G7VL 3QHTC 2FWOA 4Y7MA 3OZ9L 3KPMB 4K94H 1IGJA 3RWDB 1MJUH 1AD0B 1FE8H 1X5YA 5HPMA 3LKQB 2A6KB 4WI2A 3O2DL 1SEBA 4MA3A 3P0YH 1A14L 2A6DA 4PJ8A 4YXLL 1JZ5A 4P5TB 2VDQL 3ARGC 5T3ZD 1PBYA 4KHTH 1XCQB 4YUEL 3MLYL 1ZT4B 5BQ7B 4PRNA 5C2BH 4RQQB 1KTLA 1HXMB 3DURB 4YH6A 4LLAA 5C0JA 4OSUH 1FFQA 4CRPA 3K0WA 2BOBB 5JMOC 2XA3A 2VR9A 4EN3D 1H3PL 5ABDE 4KKCC 3O3EB 5FF6A 2FSEB 3I6KA 2YS4A 2DYPA 5T3ZL 3HC3H 1RHHB 5F8QC 3TBVA 3ULVF 3HAEA 1WBZB 2CSPA 1F6LL 3QXVA 5BRZE 2O61A 1JRHI 2X4OA 1IM9B 4KFZC 5C07B 2N56A 4HKZB 5A2JH 4P57A 5CHNB 3C5ZA 3MA7B 3AS2A 2VYRE 3P40A 2QQQA 3UPAA 3VD4A 1WLHA 3D39A 1RUKH 5A2KH 1T0MA 2EICA 2XZCH 4EOWH 4QHKJ 1FRGH 4MNQE 1QRNB 5MEOB 1GIGL 1C5BL 3S37L 5CCKL 4N8CL 3KPQA 4YGAB 5DJZA 3SPVA 4LLVA 2APFA 3O11B 2BMKB 1OM3L 1PZ5B 4M7KL 2IPKA 2V5YA 5D7IB 4PGEB 3KLSA 1RZKL 4OF0A 1QFPA 4U1JA 2X4RA 4WJ5B 3HN3A 4PJ8D 5DFWH 4KROC 3MBEB 2WANA 1H5BA 2IBBA 5FAAA 3UPCA 1HYRC 1OP9A 5C07E 1JYWA 1CFSA 2E6QA 2GFBA 4LSSH 3QEUA 3HAEG 1IT9L 3FONB 5L8JB 5E6IB 1JPFB 1PY4A 4I0KA 4U0RB 4HFWA 2F19L 4O00A 3L3IA 4PBVC 1OAUL 3ULUL 1IZJA 1PG7W 2AJ3B 5EO9A 3HR5A 5J9PA 3RWIA 5FUZL 1E4JA 1ORSB 3S88H 3OKDA 4P4RA 2LTQB 2VRAA 4S2SB 3SDAB 3N85H 4UIKH 2VE6B 3RWFB 3UC0L 1J05A 3PWUA 4HJJH 5IV2B 1BJ8A 4GRLB 3QCTH 2OTWB 3OAYH 4H88H 4JY6B 2X4RB 2OL3B 4NUJA 2VLJD 4MQXC 4WJ5A 3WUZA 1XCQA 1LEGB 4Y0GA 4OUUA 3T4AA 2I24N 3QWOB 5EFIA 1A14H 2IFGA 4WUUD 1P6AB 1MFEL 4X7SL 4M5YH 4YFLI 3C6LA 1BD2D 1RZKC 4JCMA 4OZIF 4M6NL 4TNVK 1C8PA 5GGUA 4N0RA 8CGTA 1V5JA 3QO0B 4IMKA 2J4WH 2MPAH 1CR9L 4JHAL 2IQ9H 2JJUA 2DM3A 3FZUC 3PGFL 5EBLB 3EO0A 3DRQB 4FFWC 2LU4A 3TC9A 3LKOB 1A3RL 3RWHB 1UG9A 2K3TA 3QQ3B 1JMZA 5DRWA 3QBTB 3T0EC 3RTQC 4I0PA 3W0WB 2NXYB 4C4KO 1I9RH 3L3JA 4YWGL 5JIHA 4ZUTB 4JVPA 3WS6C 5CEXA 4JRXA 2P49B 5DJ0B 3ZKXB 1NGWB 2BOBA 4JPVL 3QI9D 3VWJC 1XF5A 2Z8VC 2AI0H 5FECB 4MVBC 3O9WB 3VXPA 4Z78B 3QCVH 2BFVL 1I85A 3O41B 1SJXA 4J3UA 1ZLUK 3L6FB 4TOYL 2VDOH 3WFZA 2C4FT 3EW3B 3H3PL 5I76A 1XF2B 1ZLSH 5J6HB 2XTJE 4OCNC 5HI5D 3P11L 3ZDZE 3NCJL 2EDNA 1FFRA 3U9PH 5A43C 3QWQB 4JO2H 3JWOL 5J9PB 3HR5B 35C8H 5D1QA 4PJHB 4JFOB 3WBDA 4Y2DC 5BS0D 1CF8L 4H26B 4BZ2H 2DQGH 4H0IA 1CE1H 3T3ME 1WBZA 1A4JA 3BGFC 4OZIA 5IHLB 3BW9A