1FJ0A

Structure determination of the ferricytochrome c2 from rhodopseudomonas palustris
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
EDAKAGEAVFKQCMTCHRADKNMVGPALAGVVGRKAGTAAGFTYSPLNHNSGEAGLVWTADNIVPYLADPNAFLKKFLTEKGKADQAVGVTKMTFKLANEQQRKDVVAYLATLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C2
publication title Cleavage of the iron-methionine bond in c-type cytochromes: Crystal structure of oxidized and reduced cytochrome c(2) from Rhodopseudomonas palustris and its ammonia complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 35
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1fj0A00
1ETPA 1NU1D 3CX5W 1YEAA 4WQEA 2PCCB 3H1JD 1PPJD 1CYJA 2N3BA 1COTA 4IL6V 4L1QA 1SQPD 2HV4A 1CXCA 1CXAA 3SVWA 1FI3A 1H33A 3HQ7A 1CSWA 1N15A 2N18B 1CIFA 351CA 3TGUD 2C2CA 3O1YA 1QL4A 1OAEA 2JTIB 1E8EA 3SJLA 1SQXD 3H1HD 5AURA 1K3GA 2FYUD 5CIBB 4EIEA 2MHMA 1CNOA 4GEDB 1R0QA 1B7VA 5B66V 3CYTI 3CP5A 3WFEC 1MG3D 5B5EV 1KB9D 5CIHB 5CIFB 1CHIA 3HQ8A 2ZXYA 1NMIA 1H1OA 2B4ZA 1IZL0 1CIEA 1I55A 3HQ9A 3OA8A 1DVVA 1SQQD 2ZZS1 4WQ9A 2C1UA 1JDLA 2GC4D 2GIWA 3OCDB 1DW1A 1KIBA 5C9MA 1CIHA 1IRWA 1LMSA 1NMLA 1YTCA 5C0ZA 1VYDA 4WQ7A 2LIRA 3L70D 5EXQA 1KV9A 3O20A 1NNOA 3VYMA 1AOQA 1H32A 4Y5RA 2A06D 1IO3A 3O5CA 1CRGA 1YICA 1GQ1A 1RAQA 1QL3A 1BCCD 3SXTA 1CRHA 3H1ID 3CX5D 1U74B 3PH2B 1HZUA 1NTKD 4YE1A 1E2RA 4N0KA 1C2NA 2QJYB 5B6QA 1C6SA 1H9XA 1C6OA 1BL9A 2YIUB 1DT1A 2C1DA 3WFBC 3DR0A 2ZBOA 4PD4D 2BLFB 3RN0A 4DY9A 1HCMA 2BCNB 3L75D 3BCCD 3HQ6A 1AOFA 2B0ZB 3TYIA 1HRCA 2N9JA 1W2LA 4L3HA 1DW2A 1S6VB 4NFGB 1AYGA 1HH7A 2BH5X 5KAFV 2QJKB 2D0SA 1KYOW 5CIDB 3VNWA 2QJPB 1CHJA 1CTYA 1NTMD 3PXSA 3A0BV 1CC5A 1CYCA 1CEDA 1DW3A 3SWSA 1H9YA 4P4QB 1YFCA 1A2SA 3L71D 1FI9A 1CSUA 5KLVD 3SLEA 2BGVX 3ZOOA 2YQBA 3PXWA 1DW0A 4FAVA 2EXVA 2DVHA 2MTAC 3VRDA 3RLMA 1IQCA 3CWBD 4GYDA 4J20A 4U3FD 2BH4X 1L9BC 1LS9A 1SQBD 1I8PA 4UB6V 4WQCA 3NWVA 1MZ4A 1BGYD 4O1QA 2ORLA 1CRIA 5E79V 3ORVA 2C9XB 1LFMA 1EB7A 1EZVD 1I6EA 1SQVD 1K3HA 1NTZD 4PJ0V 3DMIA 1CTZA 1GU2A 2OZ1A 1OCDA 2C1VA 3C2CA 5CIGB 1BE3D 1H33B 1CRJA 2BCCD 2V08A 1I54A 1H31A 4Q5PA 1YCCA 4AAMA 2GC7D 2CA3B 1YNRA 1FHBA 1GIWA 4FA1A 1KX7A 5DF5A 451CA 3L72D 3L4MA 3L74D 5DJQB 1I8OA 2V07A 4FANA 3A0HV 4O1WA 1LC2A 1L0LD 4KMGA 4AANA 1ZZHA 1E29A 1GDVA 1CYIA 3NBTA 2IBZD 4QAOA 1C52A 1KYOD 1IRVA 4V2KA 4PW9B 3WFDC 1QYZA 2PACA 5DFSA 1HJ3A 1FI7A 1WEJF 2YK3A 3RMZA 1S5LV 1LC1A 3OA8B 4FB1A 3M97X 3L73D 1CTJA 2N9IA 1CORA 3ZOXA 1L0ND 3ZIYA 2N18C 2B10B 1CSVA 1CCHA 1P84D 1DVHA 2YCCA 3WFCC 3MK7B 1HJ4A 5TISV 1M60A 1M70A 1N50A 5KKZB 1NIRA 3ZOYA 4JCGA 2D0WA 4XXLA 4LJIA 1MG2D 2VHDA 2LITA 1H32B 1RZ6A 2L4DA 1QN2A 5H2FV 1PP9D 1W5CT 5KAIV 4FA5A 1M6ZA 1YEBA 3OCDA 2BPBB 1CIGA 1L9JC 1HROA 1FOCA 4H0KA 3JBTB 4WQBA 3WC8A 1CRCA 5CIEB 3RN1A 2N3YA 1HJ5A 2C1DB 1A56A 3KZIV 4EIFA 4WQAA 4WQDA 1AKKA 1U75B 5CYTR 1WVEC 2DGEA 1KX2A 4K3IA 2CE0A 5GTHV 4RSZA 4EICA 3NBSA 4MU8A 1DIIC 4FA4A 1CSXA 4PWAA 1CHHA 5DJQC 4AALA 1F1CA 1YIQA 1N90A 3H1KD 1I6DA 2GB8B 4FA9A 2CE1A 4L3GA 1RAPA 1KB0A 2AI5A 3CU4A 1C7MA 3DP5A 5IY51 1I5TA 2FYNB 4EIDA 2ZOOA 3WU2V 1QKSA 2B12B 1FCDC 3CXHD 2ZONG 4AX3A 2PCBB 1CO6A 1ZRTD 1RZ5A 2B11B 4H0JA 2CA4B 5KLIB 2CXBA 3H1LD 3ZCFA 3L4OA 5GTIV 4UB8V 3MK7C 3PXTA 1FJ0A 1DIQC 2FWLA 2JQRA 1GJQA 3X39A 1A8CA 3ZBMA 1CRYA 1C2RA 2AIUA 2FRCA 1GKSA 3A9FA 2C8SA 3ZOWA 2AXTV 155CA 3CXHW 1C6RA 2OZ1B 1J3SA 4D6TD 1C75A 1N9CA 4WQ8A 5CICB 1F1FA 2XTSB 1H31B 3WUIA 4XYDB 2I8FA 1CCRA 3O0RC 1HZVA 4AAOA
chains in the Genus database with same CATH superfamily
1ETPA 1NU1D 3CX5W 1YEAA 4WQEA 2PCCB 3H1JD 1PPJD 1CYJA 2N3BA 1COTA 4IL6V 4L1QA 1SQPD 2HV4A 1CXCA 1CXAA 3SVWA 1FI3A 1H33A 3HQ7A 1CSWA 1N15A 2N18B 1CIFA 351CA 3TGUD 2C2CA 3O1YA 1QL4A 1OAEA 2JTIB 1E8EA 3SJLA 1SQXD 3H1HD 5AURA 1K3GA 2FYUD 5CIBB 4EIEA 2MHMA 1CNOA 4GEDB 1R0QA 1B7VA 5B66V 3CYTI 3CP5A 3WFEC 1MG3D 5B5EV 1KB9D 5CIHB 5CIFB 1CHIA 3HQ8A 2ZXYA 1NMIA 1H1OA 2B4ZA 1IZL0 1CIEA 1I55A 3HQ9A 3OA8A 1DVVA 1SQQD 2ZZS1 4WQ9A 2C1UA 1JDLA 2GC4D 2GIWA 3OCDB 1DW1A 1KIBA 5C9MA 1CIHA 1IRWA 1LMSA 1NMLA 1YTCA 5C0ZA 1VYDA 4WQ7A 2LIRA 3L70D 5EXQA 1KV9A 3O20A 1NNOA 3VYMA 1AOQA 1H32A 4Y5RA 2A06D 1IO3A 3O5CA 1CRGA 1YICA 1GQ1A 1RAQA 1QL3A 1BCCD 3SXTA 1CRHA 3H1ID 3CX5D 1U74B 3PH2B 1HZUA 1NTKD 4YE1A 1E2RA 4N0KA 1C2NA 2QJYB 5B6QA 1C6SA 1H9XA 1C6OA 1BL9A 2YIUB 1DT1A 2C1DA 3WFBC 3DR0A 2ZBOA 4PD4D 2BLFB 3RN0A 4DY9A 1HCMA 2BCNB 3L75D 3BCCD 3HQ6A 1AOFA 2B0ZB 3TYIA 1HRCA 2N9JA 1W2LA 4L3HA 1DW2A 1S6VB 4NFGB 1AYGA 1HH7A 2BH5X 5KAFV 2QJKB 2D0SA 1KYOW 5CIDB 3VNWA 2QJPB 1CHJA 1CTYA 1NTMD 3PXSA 3A0BV 1CC5A 1CYCA 1CEDA 1DW3A 3SWSA 1H9YA 4P4QB 1YFCA 1A2SA 3L71D 1FI9A 1CSUA 5KLVD 3SLEA 2BGVX 3ZOOA 2YQBA 3PXWA 1DW0A 4FAVA 2EXVA 2DVHA 2MTAC 3VRDA 3RLMA 1IQCA 3CWBD 4GYDA 4J20A 4U3FD 2BH4X 1L9BC 1LS9A 1SQBD 1I8PA 4UB6V 4WQCA 3NWVA 1MZ4A 1BGYD 4O1QA 2ORLA 1CRIA 5E79V 3ORVA 2C9XB 1LFMA 1EB7A 1EZVD 1I6EA 1SQVD 1K3HA 1NTZD 4PJ0V 3DMIA 1CTZA 1GU2A 2OZ1A 1OCDA 2C1VA 3C2CA 5CIGB 1BE3D 1H33B 1CRJA 2BCCD 3D0WA 2V08A 1I54A 1H31A 4Q5PA 1YCCA 4AAMA 2GC7D 2CA3B 1YNRA 1FHBA 1GIWA 4FA1A 1KX7A 5DF5A 451CA 3L72D 3L4MA 3L74D 5DJQB 1I8OA 2V07A 4FANA 3A0HV 4O1WA 1LC2A 1L0LD 4KMGA 4AANA 1ZZHA 1E29A 1GDVA 1CYIA 3NBTA 2IBZD 4QAOA 1C52A 1KYOD 1IRVA 4V2KA 4PW9B 3WFDC 1QYZA 2PACA 5DFSA 1HJ3A 1FI7A 1WEJF 2YK3A 3RMZA 1S5LV 1LC1A 3OA8B 4FB1A 3M97X 3L73D 1CTJA 2N9IA 1CORA 3ZOXA 1L0ND 3ZIYA 2N18C 2B10B 1CSVA 1CCHA 1P84D 1DVHA 2YCCA 3WFCC 3MK7B 1HJ4A 5TISV 1M60A 1M70A 1N50A 5KKZB 1NIRA 3ZOYA 4JCGA 2D0WA 4XXLA 4LJIA 1MG2D 2VHDA 2LITA 1H32B 1RZ6A 2L4DA 1QN2A 5H2FV 1PP9D 1W5CT 5KAIV 4FA5A 1M6ZA 1YEBA 3OCDA 2BPBB 1CIGA 1L9JC 1HROA 1FOCA 4H0KA 3JBTB 4WQBA 3WC8A 1CRCA 5CIEB 3RN1A 2N3YA 1HJ5A 2C1DB 1A56A 3KZIV 4EIFA 4WQAA 4WQDA 1AKKA 1U75B 5CYTR 1WVEC 2DGEA 1KX2A 4K3IA 2CE0A 5GTHV 4RSZA 4EICA 3NBSA 4MU8A 1DIIC 4FA4A 1CSXA 4PWAA 1CHHA 5DJQC 4AALA 1F1CA 1YIQA 1N90A 3H1KD 1I6DA 2GB8B 4FA9A 2CE1A 4L3GA 1RAPA 1KB0A 2AI5A 3CU4A 1C7MA 3DP5A 5IY51 1I5TA 2FYNB 4EIDA 2ZOOA 3WU2V 1QKSA 2B12B 1FCDC 3CXHD 2ZONG 4AX3A 2PCBB 1CO6A 1ZRTD 1RZ5A 2B11B 4H0JA 2CA4B 5KLIB 2CXBA 3H1LD 3ZCFA 3L4OA 5GTIV 4UB8V 3MK7C 3PXTA 1FJ0A 1DIQC 2FWLA 2JQRA 1GJQA 3X39A 1A8CA 3ZBMA 1CRYA 1C2RA 2AIUA 2FRCA 1GKSA 3A9FA 2C8SA 3ZOWA 2AXTV 155CA 3CXHW 1C6RA 2OZ1B 1J3SA 4D6TD 1C75A 1N9CA 4WQ8A 5CICB 1F1FA 2XTSB 1H31B 3WUIA 4XYDB 2I8FA 1CCRA 3O0RC 1HZVA 4AAOA
chains in the Genus database with same CATH topology
1ETPA 1NU1D 3CX5W 1YEAA 4WQEA 2PCCB 3H1JD 1PPJD 1CYJA 2N3BA 1COTA 4IL6V 4L1QA 1SQPD 2HV4A 1CXCA 1CXAA 3SVWA 1FI3A 1H33A 3HQ7A 1CSWA 1N15A 2N18B 1CIFA 351CA 3TGUD 2C2CA 3O1YA 1QL4A 1OAEA 2JTIB 1E8EA 3SJLA 1SQXD 3H1HD 5AURA 1K3GA 2FYUD 5CIBB 4EIEA 2MHMA 1CNOA 4GEDB 1R0QA 1B7VA 5B66V 3CYTI 3CP5A 3WFEC 1MG3D 5B5EV 1KB9D 5CIHB 5CIFB 1CHIA 3HQ8A 2ZXYA 1NMIA 1H1OA 2B4ZA 1IZL0 1CIEA 1I55A 3HQ9A 3OA8A 1DVVA 1SQQD 2ZZS1 4WQ9A 2C1UA 1JDLA 2GC4D 2GIWA 3OCDB 1DW1A 1KIBA 5C9MA 1CIHA 1IRWA 1LMSA 1NMLA 1YTCA 5C0ZA 1VYDA 4WQ7A 2LIRA 3L70D 5EXQA 1KV9A 3O20A 1NNOA 3VYMA 1AOQA 1H32A 4Y5RA 2A06D 1IO3A 3O5CA 1CRGA 1YICA 1GQ1A 1RAQA 1QL3A 1BCCD 3SXTA 1CRHA 3H1ID 3CX5D 1U74B 3PH2B 1HZUA 1NTKD 4YE1A 1E2RA 4N0KA 1C2NA 2QJYB 5B6QA 1C6SA 1H9XA 1C6OA 1BL9A 2YIUB 1DT1A 2C1DA 3WFBC 3DR0A 2ZBOA 4PD4D 2BLFB 3RN0A 4DY9A 1HCMA 2BCNB 3L75D 3BCCD 3HQ6A 1AOFA 2B0ZB 3TYIA 1HRCA 2N9JA 1W2LA 4L3HA 1DW2A 1S6VB 4NFGB 1AYGA 1HH7A 2BH5X 5KAFV 2QJKB 2D0SA 1KYOW 5CIDB 3VNWA 2QJPB 1CHJA 1CTYA 1NTMD 3PXSA 3A0BV 1CC5A 1CYCA 1CEDA 1DW3A 3SWSA 1H9YA 4P4QB 1YFCA 1A2SA 3L71D 1FI9A 1CSUA 5KLVD 3SLEA 2BGVX 3ZOOA 2YQBA 3PXWA 1DW0A 4FAVA 2EXVA 2DVHA 2MTAC 3VRDA 3RLMA 1IQCA 3CWBD 4GYDA 4J20A 4U3FD 2BH4X 1L9BC 1LS9A 1SQBD 1I8PA 4UB6V 4WQCA 3NWVA 1MZ4A 1BGYD 4O1QA 2ORLA 1CRIA 5E79V 3ORVA 2C9XB 1LFMA 1EB7A 1EZVD 1I6EA 1SQVD 1K3HA 1NTZD 4PJ0V 3DMIA 1CTZA 1GU2A 2OZ1A 1OCDA 2C1VA 3C2CA 5CIGB 1BE3D 1H33B 1CRJA 2BCCD 2V08A 1I54A 1H31A 4Q5PA 1YCCA 4AAMA 2GC7D 2CA3B 1YNRA 1FHBA 1GIWA 4FA1A 1KX7A 5DF5A 451CA 3L72D 3L4MA 3L74D 5DJQB 1I8OA 2V07A 4FANA 3A0HV 4O1WA 1LC2A 1L0LD 4KMGA 4AANA 1ZZHA 1E29A 1GDVA 1CYIA 3NBTA 2IBZD 4QAOA 1C52A 1KYOD 1IRVA 4V2KA 4PW9B 3WFDC 1QYZA 2PACA 5DFSA 1HJ3A 1FI7A 1WEJF 2YK3A 3RMZA 1S5LV 1LC1A 3OA8B 4FB1A 3M97X 3L73D 1CTJA 2N9IA 1CORA 3ZOXA 1L0ND 3ZIYA 2N18C 2B10B 1CSVA 1CCHA 1P84D 1DVHA 2YCCA 3WFCC 3MK7B 1HJ4A 5TISV 1M60A 1M70A 1N50A 5KKZB 1NIRA 3ZOYA 4JCGA 2D0WA 4XXLA 4LJIA 1MG2D 2VHDA 2LITA 1H32B 1RZ6A 2L4DA 1QN2A 5H2FV 1PP9D 1W5CT 5KAIV 4FA5A 1M6ZA 1YEBA 3OCDA 2BPBB 1CIGA 1L9JC 1HROA 1FOCA 4H0KA 3JBTB 4WQBA 3WC8A 1CRCA 5CIEB 3RN1A 2N3YA 1HJ5A 2C1DB 1A56A 3KZIV 4EIFA 4WQAA 4WQDA 1AKKA 1U75B 5CYTR 1WVEC 2DGEA 1KX2A 4K3IA 2CE0A 5GTHV 4RSZA 4EICA 3NBSA 4MU8A 1DIIC 4FA4A 1CSXA 4PWAA 1CHHA 5DJQC 4AALA 1F1CA 1YIQA 1N90A 3H1KD 1I6DA 2GB8B 4FA9A 2CE1A 4L3GA 1RAPA 1KB0A 2AI5A 3CU4A 1C7MA 3DP5A 5IY51 1I5TA 2FYNB 4EIDA 2ZOOA 3WU2V 1QKSA 2B12B 1FCDC 3CXHD 2ZONG 4AX3A 2PCBB 1CO6A 1ZRTD 1RZ5A 2B11B 4H0JA 2CA4B 5KLIB 2CXBA 3H1LD 3ZCFA 3L4OA 5GTIV 4UB8V 3MK7C 3PXTA 1FJ0A 1DIQC 2FWLA 2JQRA 1GJQA 3X39A 1A8CA 3ZBMA 1CRYA 1C2RA 2AIUA 2FRCA 1GKSA 3A9FA 2C8SA 3ZOWA 2AXTV 155CA 3CXHW 1C6RA 2OZ1B 1J3SA 4D6TD 1C75A 1N9CA 4WQ8A 5CICB 1F1FA 2XTSB 1H31B 3WUIA 4XYDB 2I8FA 1CCRA 3O0RC 1HZVA 4AAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETP A;  1NU1 D;  3CX5 W;  1YEA A;  4WQE A;  2PCC B;  3H1J D;  1PPJ D;  1CYJ A;  2N3B A;  1COT A;  4IL6 V;  4L1Q A;  1SQP D;  2HV4 A;  1CXC A;  1CXA A;  3SVW A;  1FI3 A;  1H33 A;  3HQ7 A;  1CSW A;  1N15 A;  2N18 B;  1CIF A;  351C A;  3TGU D;  2C2C A;  3O1Y A;  1QL4 A;  1OAE A;  2JTI B;  1E8E A;  3SJL A;  1SQX D;  3H1H D;  5AUR A;  1K3G A;  2FYU D;  5CIB B;  4EIE A;  2MHM A;  1CNO A;  4GED B;  1R0Q A;  1B7V A;  5B66 V;  3CYT I;  3CP5 A;  3WFE C;  1MG3 D;  5B5E V;  1KB9 D;  5CIH B;  5CIF B;  1CHI A;  3HQ8 A;  2ZXY A;  1NMI A;  1H1O A;  2B4Z A;  1IZL 0;  1CIE A;  1I55 A;  3HQ9 A;  3OA8 A;  1DVV A;  1SQQ D;  2ZZS 1;  4WQ9 A;  2C1U A;  1JDL A;  2GC4 D;  2GIW A;  3OCD B;  1DW1 A;  1KIB A;  5C9M A;  1CIH A;  1IRW A;  1LMS A;  1NML A;  1YTC A;  5C0Z A;  1VYD A;  4WQ7 A;  2LIR A;  3L70 D;  5EXQ A;  1KV9 A;  3O20 A;  1NNO A;  3VYM A;  1AOQ A;  1H32 A;  4Y5R A;  2A06 D;  1IO3 A;  3O5C A;  1CRG A;  1YIC A;  1GQ1 A;  1RAQ A;  1QL3 A;  1BCC D;  3SXT A;  1CRH A;  3H1I D;  3CX5 D;  1U74 B;  3PH2 B;  1HZU A;  1NTK D;  4YE1 A;  1E2R A;  4N0K A;  1C2N A;  2QJY B;  5B6Q A;  1C6S A;  1H9X A;  1C6O A;  1BL9 A;  2YIU B;  1DT1 A;  2C1D A;  3WFB C;  3DR0 A;  2ZBO A;  4PD4 D;  2BLF B;  3RN0 A;  4DY9 A;  1HCM A;  2BCN B;  3L75 D;  3BCC D;  3HQ6 A;  1AOF A;  2B0Z B;  3TYI A;  1HRC A;  2N9J A;  1W2L A;  4L3H A;  1DW2 A;  1S6V B;  4NFG B;  1AYG A;  1HH7 A;  2BH5 X;  5KAF V;  2QJK B;  2D0S A;  1KYO W;  5CID B;  3VNW A;  2QJP B;  1CHJ A;  1CTY A;  1NTM D;  3PXS A;  3A0B V;  1CC5 A;  1CYC A;  1CED A;  1DW3 A;  3SWS A;  1H9Y A;  4P4Q B;  1YFC A;  1A2S A;  3L71 D;  1FI9 A;  1CSU A;  5KLV D;  3SLE A;  2BGV X;  3ZOO A;  2YQB A;  3PXW A;  1DW0 A;  4FAV A;  2EXV A;  2DVH A;  2MTA C;  3VRD A;  3RLM A;  1IQC A;  3CWB D;  4GYD A;  4J20 A;  4U3F D;  2BH4 X;  1L9B C;  1LS9 A;  1SQB D;  1I8P A;  4UB6 V;  4WQC A;  3NWV A;  1MZ4 A;  1BGY D;  4O1Q A;  2ORL A;  1CRI A;  5E79 V;  3ORV A;  2C9X B;  1LFM A;  1EB7 A;  1EZV D;  1I6E A;  1SQV D;  1K3H A;  1NTZ D;  4PJ0 V;  3DMI A;  1CTZ A;  1GU2 A;  2OZ1 A;  1OCD A;  2C1V A;  3C2C A;  5CIG B;  1BE3 D;  1H33 B;  1CRJ A;  2BCC D;  2V08 A;  1I54 A;  1H31 A;  4Q5P A;  1YCC A;  4AAM A;  2GC7 D;  2CA3 B;  1YNR A;  1FHB A;  1GIW A;  4FA1 A;  1KX7 A;  5DF5 A;  451C A;  3L72 D;  3L4M A;  3L74 D;  5DJQ B;  1I8O A;  2V07 A;  4FAN A;  3A0H V;  4O1W A;  1LC2 A;  1L0L D;  4KMG A;  4AAN A;  1ZZH A;  1E29 A;  1GDV A;  1CYI A;  3NBT A;  2IBZ D;  4QAO A;  1C52 A;  1KYO D;  1IRV A;  4V2K A;  4PW9 B;  3WFD C;  1QYZ A;  2PAC A;  5DFS A;  1HJ3 A;  1FI7 A;  1WEJ F;  2YK3 A;  3RMZ A;  1S5L V;  1LC1 A;  3OA8 B;  4FB1 A;  3M97 X;  3L73 D;  1CTJ A;  2N9I A;  1COR A;  3ZOX A;  1L0N D;  3ZIY A;  2N18 C;  2B10 B;  1CSV A;  1CCH A;  1P84 D;  1DVH A;  2YCC A;  3WFC C;  3MK7 B;  1HJ4 A;  5TIS V;  1M60 A;  1M70 A;  1N50 A;  5KKZ B;  1NIR A;  3ZOY A;  4JCG A;  2D0W A;  4XXL A;  4LJI A;  1MG2 D;  2VHD A;  2LIT A;  1H32 B;  1RZ6 A;  2L4D A;  1QN2 A;  5H2F V;  1PP9 D;  1W5C T;  5KAI V;  4FA5 A;  1M6Z A;  1YEB A;  3OCD A;  2BPB B;  1CIG A;  1L9J C;  1HRO A;  1FOC A;  4H0K A;  3JBT B;  4WQB A;  3WC8 A;  1CRC A;  5CIE B;  3RN1 A;  2N3Y A;  1HJ5 A;  2C1D B;  1A56 A;  3KZI V;  4EIF A;  4WQA A;  4WQD A;  1AKK A;  1U75 B;  5CYT R;  1WVE C;  2DGE A;  1KX2 A;  4K3I A;  2CE0 A;  5GTH V;  4RSZ A;  4EIC A;  3NBS A;  4MU8 A;  1DII C;  4FA4 A;  1CSX A;  4PWA A;  1CHH A;  5DJQ C;  4AAL A;  1F1C A;  1YIQ A;  1N90 A;  3H1K D;  1I6D A;  2GB8 B;  4FA9 A;  2CE1 A;  4L3G A;  1RAP A;  1KB0 A;  2AI5 A;  3CU4 A;  1C7M A;  3DP5 A;  5IY5 1;  1I5T A;  2FYN B;  4EID A;  2ZOO A;  3WU2 V;  1QKS A;  2B12 B;  1FCD C;  3CXH D;  2ZON G;  4AX3 A;  2PCB B;  1CO6 A;  1ZRT D;  1RZ5 A;  2B11 B;  4H0J A;  2CA4 B;  5KLI B;  2CXB A;  3H1L D;  3ZCF A;  3L4O A;  5GTI V;  4UB8 V;  3MK7 C;  3PXT A;  1FJ0 A;  1DIQ C;  2FWL A;  2JQR A;  1GJQ A;  3X39 A;  1A8C A;  3ZBM A;  1CRY A;  1C2R A;  2AIU A;  2FRC A;  1GKS A;  3A9F A;  2C8S A;  3ZOW A;  2AXT V;  155C A;  3CXH W;  1C6R A;  2OZ1 B;  1J3S A;  4D6T D;  1C75 A;  1N9C A;  4WQ8 A;  5CIC B;  1F1F A;  2XTS B;  1H31 B;  3WUI A;  4XYD B;  2I8F A;  1CCR A;  3O0R C;  1HZV A;  4AAO A; 
#chains in the Genus database with same CATH topology
 1ETP A;  1NU1 D;  3CX5 W;  1YEA A;  4WQE A;  2PCC B;  3H1J D;  1PPJ D;  1CYJ A;  2N3B A;  1COT A;  4IL6 V;  4L1Q A;  1SQP D;  2HV4 A;  1CXC A;  1CXA A;  3SVW A;  1FI3 A;  1H33 A;  3HQ7 A;  1CSW A;  1N15 A;  2N18 B;  1CIF A;  351C A;  3TGU D;  2C2C A;  3O1Y A;  1QL4 A;  1OAE A;  2JTI B;  1E8E A;  3SJL A;  1SQX D;  3H1H D;  5AUR A;  1K3G A;  2FYU D;  5CIB B;  4EIE A;  2MHM A;  1CNO A;  4GED B;  1R0Q A;  1B7V A;  5B66 V;  3CYT I;  3CP5 A;  3WFE C;  1MG3 D;  5B5E V;  1KB9 D;  5CIH B;  5CIF B;  1CHI A;  3HQ8 A;  2ZXY A;  1NMI A;  1H1O A;  2B4Z A;  1IZL 0;  1CIE A;  1I55 A;  3HQ9 A;  3OA8 A;  1DVV A;  1SQQ D;  2ZZS 1;  4WQ9 A;  2C1U A;  1JDL A;  2GC4 D;  2GIW A;  3OCD B;  1DW1 A;  1KIB A;  5C9M A;  1CIH A;  1IRW A;  1LMS A;  1NML A;  1YTC A;  5C0Z A;  1VYD A;  4WQ7 A;  2LIR A;  3L70 D;  5EXQ A;  1KV9 A;  3O20 A;  1NNO A;  3VYM A;  1AOQ A;  1H32 A;  4Y5R A;  2A06 D;  1IO3 A;  3O5C A;  1CRG A;  1YIC A;  1GQ1 A;  1RAQ A;  1QL3 A;  1BCC D;  3SXT A;  1CRH A;  3H1I D;  3CX5 D;  1U74 B;  3PH2 B;  1HZU A;  1NTK D;  4YE1 A;  1E2R A;  4N0K A;  1C2N A;  2QJY B;  5B6Q A;  1C6S A;  1H9X A;  1C6O A;  1BL9 A;  2YIU B;  1DT1 A;  2C1D A;  3WFB C;  3DR0 A;  2ZBO A;  4PD4 D;  2BLF B;  3RN0 A;  4DY9 A;  1HCM A;  2BCN B;  3L75 D;  3BCC D;  3HQ6 A;  1AOF A;  2B0Z B;  3TYI A;  1HRC A;  2N9J A;  1W2L A;  4L3H A;  1DW2 A;  1S6V B;  4NFG B;  1AYG A;  1HH7 A;  2BH5 X;  5KAF V;  2QJK B;  2D0S A;  1KYO W;  5CID B;  3VNW A;  2QJP B;  1CHJ A;  1CTY A;  1NTM D;  3PXS A;  3A0B V;  1CC5 A;  1CYC A;  1CED A;  1DW3 A;  3SWS A;  1H9Y A;  4P4Q B;  1YFC A;  1A2S A;  3L71 D;  1FI9 A;  1CSU A;  5KLV D;  3SLE A;  2BGV X;  3ZOO A;  2YQB A;  3PXW A;  1DW0 A;  4FAV A;  2EXV A;  2DVH A;  2MTA C;  3VRD A;  3RLM A;  1IQC A;  3CWB D;  4GYD A;  4J20 A;  4U3F D;  2BH4 X;  1L9B C;  1LS9 A;  1SQB D;  1I8P A;  4UB6 V;  4WQC A;  3NWV A;  1MZ4 A;  1BGY D;  4O1Q A;  2ORL A;  1CRI A;  5E79 V;  3ORV A;  2C9X B;  1LFM A;  1EB7 A;  1EZV D;  1I6E A;  1SQV D;  1K3H A;  1NTZ D;  4PJ0 V;  3DMI A;  1CTZ A;  1GU2 A;  2OZ1 A;  1OCD A;  2C1V A;  3C2C A;  5CIG B;  1BE3 D;  1H33 B;  1CRJ A;  2BCC D;  3D0W A;  2V08 A;  1I54 A;  1H31 A;  4Q5P A;  1YCC A;  4AAM A;  2GC7 D;  2CA3 B;  1YNR A;  1FHB A;  1GIW A;  4FA1 A;  1KX7 A;  5DF5 A;  451C A;  3L72 D;  3L4M A;  3L74 D;  5DJQ B;  1I8O A;  2V07 A;  4FAN A;  3A0H V;  4O1W A;  1LC2 A;  1L0L D;  4KMG A;  4AAN A;  1ZZH A;  1E29 A;  1GDV A;  1CYI A;  3NBT A;  2IBZ D;  4QAO A;  1C52 A;  1KYO D;  1IRV A;  4V2K A;  4PW9 B;  3WFD C;  1QYZ A;  2PAC A;  5DFS A;  1HJ3 A;  1FI7 A;  1WEJ F;  2YK3 A;  3RMZ A;  1S5L V;  1LC1 A;  3OA8 B;  4FB1 A;  3M97 X;  3L73 D;  1CTJ A;  2N9I A;  1COR A;  3ZOX A;  1L0N D;  3ZIY A;  2N18 C;  2B10 B;  1CSV A;  1CCH A;  1P84 D;  1DVH A;  2YCC A;  3WFC C;  3MK7 B;  1HJ4 A;  5TIS V;  1M60 A;  1M70 A;  1N50 A;  5KKZ B;  1NIR A;  3ZOY A;  4JCG A;  2D0W A;  4XXL A;  4LJI A;  1MG2 D;  2VHD A;  2LIT A;  1H32 B;  1RZ6 A;  2L4D A;  1QN2 A;  5H2F V;  1PP9 D;  1W5C T;  5KAI V;  4FA5 A;  1M6Z A;  1YEB A;  3OCD A;  2BPB B;  1CIG A;  1L9J C;  1HRO A;  1FOC A;  4H0K A;  3JBT B;  4WQB A;  3WC8 A;  1CRC A;  5CIE B;  3RN1 A;  2N3Y A;  1HJ5 A;  2C1D B;  1A56 A;  3KZI V;  4EIF A;  4WQA A;  4WQD A;  1AKK A;  1U75 B;  5CYT R;  1WVE C;  2DGE A;  1KX2 A;  4K3I A;  2CE0 A;  5GTH V;  4RSZ A;  4EIC A;  3NBS A;  4MU8 A;  1DII C;  4FA4 A;  1CSX A;  4PWA A;  1CHH A;  5DJQ C;  4AAL A;  1F1C A;  1YIQ A;  1N90 A;  3H1K D;  1I6D A;  2GB8 B;  4FA9 A;  2CE1 A;  4L3G A;  1RAP A;  1KB0 A;  2AI5 A;  3CU4 A;  1C7M A;  3DP5 A;  5IY5 1;  1I5T A;  2FYN B;  4EID A;  2ZOO A;  3WU2 V;  1QKS A;  2B12 B;  1FCD C;  3CXH D;  2ZON G;  4AX3 A;  2PCB B;  1CO6 A;  1ZRT D;  1RZ5 A;  2B11 B;  4H0J A;  2CA4 B;  5KLI B;  2CXB A;  3H1L D;  3ZCF A;  3L4O A;  5GTI V;  4UB8 V;  3MK7 C;  3PXT A;  1FJ0 A;  1DIQ C;  2FWL A;  2JQR A;  1GJQ A;  3X39 A;  1A8C A;  3ZBM A;  1CRY A;  1C2R A;  2AIU A;  2FRC A;  1GKS A;  3A9F A;  2C8S A;  3ZOW A;  2AXT V;  155C A;  3CXH W;  1C6R A;  2OZ1 B;  1J3S A;  4D6T D;  1C75 A;  1N9C A;  4WQ8 A;  5CIC B;  1F1F A;  2XTS B;  1H31 B;  3WUI A;  4XYD B;  2I8F A;  1CCR A;  3O0R C;  1HZV A;  4AAO A; 
#chains in the Genus database with same CATH homology
 1ETP A;  1NU1 D;  3CX5 W;  1YEA A;  4WQE A;  2PCC B;  3H1J D;  1PPJ D;  1CYJ A;  2N3B A;  1COT A;  4IL6 V;  4L1Q A;  1SQP D;  2HV4 A;  1CXC A;  1CXA A;  3SVW A;  1FI3 A;  1H33 A;  3HQ7 A;  1CSW A;  1N15 A;  2N18 B;  1CIF A;  351C A;  3TGU D;  2C2C A;  3O1Y A;  1QL4 A;  1OAE A;  2JTI B;  1E8E A;  3SJL A;  1SQX D;  3H1H D;  5AUR A;  1K3G A;  2FYU D;  5CIB B;  4EIE A;  2MHM A;  1CNO A;  4GED B;  1R0Q A;  1B7V A;  5B66 V;  3CYT I;  3CP5 A;  3WFE C;  1MG3 D;  5B5E V;  1KB9 D;  5CIH B;  5CIF B;  1CHI A;  3HQ8 A;  2ZXY A;  1NMI A;  1H1O A;  2B4Z A;  1IZL 0;  1CIE A;  1I55 A;  3HQ9 A;  3OA8 A;  1DVV A;  1SQQ D;  2ZZS 1;  4WQ9 A;  2C1U A;  1JDL A;  2GC4 D;  2GIW A;  3OCD B;  1DW1 A;  1KIB A;  5C9M A;  1CIH A;  1IRW A;  1LMS A;  1NML A;  1YTC A;  5C0Z A;  1VYD A;  4WQ7 A;  2LIR A;  3L70 D;  5EXQ A;  1KV9 A;  3O20 A;  1NNO A;  3VYM A;  1AOQ A;  1H32 A;  4Y5R A;  2A06 D;  1IO3 A;  3O5C A;  1CRG A;  1YIC A;  1GQ1 A;  1RAQ A;  1QL3 A;  1BCC D;  3SXT A;  1CRH A;  3H1I D;  3CX5 D;  1U74 B;  3PH2 B;  1HZU A;  1NTK D;  4YE1 A;  1E2R A;  4N0K A;  1C2N A;  2QJY B;  5B6Q A;  1C6S A;  1H9X A;  1C6O A;  1BL9 A;  2YIU B;  1DT1 A;  2C1D A;  3WFB C;  3DR0 A;  2ZBO A;  4PD4 D;  2BLF B;  3RN0 A;  4DY9 A;  1HCM A;  2BCN B;  3L75 D;  3BCC D;  3HQ6 A;  1AOF A;  2B0Z B;  3TYI A;  1HRC A;  2N9J A;  1W2L A;  4L3H A;  1DW2 A;  1S6V B;  4NFG B;  1AYG A;  1HH7 A;  2BH5 X;  5KAF V;  2QJK B;  2D0S A;  1KYO W;  5CID B;  3VNW A;  2QJP B;  1CHJ A;  1CTY A;  1NTM D;  3PXS A;  3A0B V;  1CC5 A;  1CYC A;  1CED A;  1DW3 A;  3SWS A;  1H9Y A;  4P4Q B;  1YFC A;  1A2S A;  3L71 D;  1FI9 A;  1CSU A;  5KLV D;  3SLE A;  2BGV X;  3ZOO A;  2YQB A;  3PXW A;  1DW0 A;  4FAV A;  2EXV A;  2DVH A;  2MTA C;  3VRD A;  3RLM A;  1IQC A;  3CWB D;  4GYD A;  4J20 A;  4U3F D;  2BH4 X;  1L9B C;  1LS9 A;  1SQB D;  1I8P A;  4UB6 V;  4WQC A;  3NWV A;  1MZ4 A;  1BGY D;  4O1Q A;  2ORL A;  1CRI A;  5E79 V;  3ORV A;  2C9X B;  1LFM A;  1EB7 A;  1EZV D;  1I6E A;  1SQV D;  1K3H A;  1NTZ D;  4PJ0 V;  3DMI A;  1CTZ A;  1GU2 A;  2OZ1 A;  1OCD A;  2C1V A;  3C2C A;  5CIG B;  1BE3 D;  1H33 B;  1CRJ A;  2BCC D;  2V08 A;  1I54 A;  1H31 A;  4Q5P A;  1YCC A;  4AAM A;  2GC7 D;  2CA3 B;  1YNR A;  1FHB A;  1GIW A;  4FA1 A;  1KX7 A;  5DF5 A;  451C A;  3L72 D;  3L4M A;  3L74 D;  5DJQ B;  1I8O A;  2V07 A;  4FAN A;  3A0H V;  4O1W A;  1LC2 A;  1L0L D;  4KMG A;  4AAN A;  1ZZH A;  1E29 A;  1GDV A;  1CYI A;  3NBT A;  2IBZ D;  4QAO A;  1C52 A;  1KYO D;  1IRV A;  4V2K A;  4PW9 B;  3WFD C;  1QYZ A;  2PAC A;  5DFS A;  1HJ3 A;  1FI7 A;  1WEJ F;  2YK3 A;  3RMZ A;  1S5L V;  1LC1 A;  3OA8 B;  4FB1 A;  3M97 X;  3L73 D;  1CTJ A;  2N9I A;  1COR A;  3ZOX A;  1L0N D;  3ZIY A;  2N18 C;  2B10 B;  1CSV A;  1CCH A;  1P84 D;  1DVH A;  2YCC A;  3WFC C;  3MK7 B;  1HJ4 A;  5TIS V;  1M60 A;  1M70 A;  1N50 A;  5KKZ B;  1NIR A;  3ZOY A;  4JCG A;  2D0W A;  4XXL A;  4LJI A;  1MG2 D;  2VHD A;  2LIT A;  1H32 B;  1RZ6 A;  2L4D A;  1QN2 A;  5H2F V;  1PP9 D;  1W5C T;  5KAI V;  4FA5 A;  1M6Z A;  1YEB A;  3OCD A;  2BPB B;  1CIG A;  1L9J C;  1HRO A;  1FOC A;  4H0K A;  3JBT B;  4WQB A;  3WC8 A;  1CRC A;  5CIE B;  3RN1 A;  2N3Y A;  1HJ5 A;  2C1D B;  1A56 A;  3KZI V;  4EIF A;  4WQA A;  4WQD A;  1AKK A;  1U75 B;  5CYT R;  1WVE C;  2DGE A;  1KX2 A;  4K3I A;  2CE0 A;  5GTH V;  4RSZ A;  4EIC A;  3NBS A;  4MU8 A;  1DII C;  4FA4 A;  1CSX A;  4PWA A;  1CHH A;  5DJQ C;  4AAL A;  1F1C A;  1YIQ A;  1N90 A;  3H1K D;  1I6D A;  2GB8 B;  4FA9 A;  2CE1 A;  4L3G A;  1RAP A;  1KB0 A;  2AI5 A;  3CU4 A;  1C7M A;  3DP5 A;  5IY5 1;  1I5T A;  2FYN B;  4EID A;  2ZOO A;  3WU2 V;  1QKS A;  2B12 B;  1FCD C;  3CXH D;  2ZON G;  4AX3 A;  2PCB B;  1CO6 A;  1ZRT D;  1RZ5 A;  2B11 B;  4H0J A;  2CA4 B;  5KLI B;  2CXB A;  3H1L D;  3ZCF A;  3L4O A;  5GTI V;  4UB8 V;  3MK7 C;  3PXT A;  1FJ0 A;  1DIQ C;  2FWL A;  2JQR A;  1GJQ A;  3X39 A;  1A8C A;  3ZBM A;  1CRY A;  1C2R A;  2AIU A;  2FRC A;  1GKS A;  3A9F A;  2C8S A;  3ZOW A;  2AXT V;  155C A;  3CXH W;  1C6R A;  2OZ1 B;  1J3S A;  4D6T D;  1C75 A;  1N9C A;  4WQ8 A;  5CIC B;  1F1F A;  2XTS B;  1H31 B;  3WUI A;  4XYD B;  2I8F A;  1CCR A;  3O0R C;  1HZV A;  4AAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...