1FJ1E

Lyme disease antigen ospa in complex with neutralizing antibody fab la-2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
251
structure length
251
Chain Sequence
b'SLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKCKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYBRIDOMA ANTIBODY LA2 (LIGHT CHAIN)
publication title Structural identification of a key protective B-cell epitope in Lyme disease antigen OspA.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Immune system
total genus 38
structure length 251
sequence length 251
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00820 Lipoprotein_1 Borrelia lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 1fj1E01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 1fj1E02
2OL7A 2I5VO 2G8CO 2OYBO 2OY5O 1OSPO 3AUMO 2OY1O 1P4PA 2OY8A 2HKDA 3CKFA 1FJ1E 2OL6O 2OY7A 2FKJA 2AF5A 5B2AO 2FKGA 2I5ZO 5B10O 5B3MO 3EC5A 2PI3O 5B11O 3CKGA 2OL8O
chains in the Genus database with same CATH superfamily
5BYPA 3SZHA 2UZ2A 5L8NA 2X46A 1S2PA 4YGZA 1SRJA 4WFAE 2KTDA 1QY2A 4NV8A 1O1UA 4COTA 3VHHA 4QAEA 1A18A 2FKGA 1VQ9E 1N9MA 4OMXA 3VG3A 3EMMA 2LFOA 1GX9A 1VQLE 3HWFA 4BCSA 1N8RG 1I78A 3WBGA 3CCEE 3OE3A 2A2UA 1FDQA 4KC7A 4QZTA 2RTIB 4Z2VA 2VFBA 1T68X 1NC9A 3FA7A 3CCUE 4DQ3A 1LIDA 4ZH9A 3WYQA 4CDCA 1VWDB 2FTBA 1SWDA 3EBWA 3BLGA 1SWOA 2A0AA 5HCEC 2OL6O 4HPDA 4FGIB 3WJCA 1SWHA 2QA4E 1KT7A 2G79A 2A3FX 1VQ6E 1SWFA 3APUA 2JW1A 1I9HA 3MG5A 2RTGB 1Y52X 1MK5A 2OTLE 1JJJA 5H1SI 3PP6A 5IRWA 3CKFA 1YWCA 3DLLE 1TXLA 1E06A 2FKJA 4CV7A 2OTJE 2IZDB 1W4TA 3X00A 1DZKA 1RAVA 4L1NA 3PIPE 3P6GA 1SWQA 4QNIA 4FBOA 4Y5DA 5DG4A 3HWEA 3WJEA 1AVEA 3FEKA 1NQMA 1GT3A 4BJ8A 1CBRA 2BS6A 5EDBA 3IA8A 1T8VA 1N7YA 2A13A 4A60A 4XMEA 4FBRA 4XMFA 1LUQA 1JV4A 1JJ2E 4GJVA 1GX8A 3P6CA 4GETA 2QO4A 3CQRA 1NGLA 4Z2OA 4ID2A 2Q39A 2KW1A 2BT9A 3TGCA 3CPWE 4WFNE 1N9YA 2MO5A 5B5GA 1NP4A 1VWBB 3SLTA 1SY0A 4JO6A 3LHNA 4ZHGA 3TF6A 4I3BA 4Y0RA 1SY3A 4I95A 1K9MG 2CZTA 1EPBA 4NNSA 3SAOA 3RBYA 4AZQA 1SWTA 1KL3A 1B8EA 4GNWA 3NQ9A 4GNYA 1PBOA 1M1KG 2JOZA 1QQSA 5DM7E 1LICA 4TJZA 2LBAA 3PEDA 4XMGA 2JMBA 1LDOA 1SWCA 4CDDA 3ZW1B 4JHQA 2HLVA 4AYHA 1X8PA 1W6FA 1Q82G 4MEEA 3E3CA 3CD6E 3UEVA 3VG5A 5HZ6A 1KQWA 3TGBA 3F9DA 3AEHA 2R73A 3VG2A 4Y0QA 1ML7A 2NNEA 3RDOA 2VDFA 2ZJPE 3ZI8A 2X8FA 4ZGUA 4OS3A 3C78X 1P4PA 1BRQA 1SXYA 2IFBA 3MBTA 2L67A 1MOYA 4IB6A 5LJHA 1KFFA 3IG9A 3GE2A 1LIEA 2LKKA 3OJYC 1A2DA 3NR3A 5GADG 2AT0X 3PIOE 5B27A 5CHKA 2JGSA 1OBUA 3H3IA 3EW1A 2RQ0A 3T6LA 2RTKA 5H9KA 3WJBA 2QOMA 1ICNA 4U46A 1SWPA 2PY1A 4BX5B 2HKDA 3KFIA 3APWA 5CYBA 3JQOA 5LJCA 4B55A 3K3LA 3WZQA 5K67A 5F2BA 4KH8A 1NBXA 1ZNDA 2ANSA 3G71E 3T6FA 1FE3A 2RTBB 2L5PA 3PH5A 2GTFX 2OF9A 2Q4NA 1X71A 2RTAA 3P02A 2RN4A 1OEJA 3CCJE 2OY1O 1WBIA 5AN9B 3RY2A 3VE2A 1KQXA 4I9SA 3CCVE 1VWJB 3FLLA 4JGLA 4IB7A 2WR6A 4IAXA 2Q9SA 1TVQA 4I9RA 4CPIA 4C5PA 3WZPA 1B4MA 1YIVA 3RDSA 1AVGI 5FQ8E 3RDUA 1DC9A 3L4RA 2OVAA 1SWSA 1SREA 3G4SE 1QG5A 5HWZA 5GAHG 1OBPA 1QABE 3HPEA 5H9AA 1HMTA 2RD7C 5EEDA 4EXZA 4Y59A 2MHDA 1KL4A 5D45A 4EEJA 4ZR2A 3F8AA 3NBXX 5K06A 4TNNA 1SLEB 1UZ2X 4IMOA 4YCHA 1LIFA 4ZJ0A 1PBYA 4U8UO 4WFVA 3CC4E 4QYNA 5D47A 1KGLA 1YWAA 2FLJA 3VU1A 1DFVA 3RSWA 5IRUA 2JU3A 2OVSA 2IZHB 1YITE 1VWOB 2K62A 5IO5A 4CPEA 3MX7A 2CM9A 5LJDA 2O62A 4TQ2A 1BLRA 1OEKA 4YH0A 2F01A 3J7ZG 1QVFE 3B2KA 3VPJE 2OFRX 4UU2A 5GAGG 1I4UA 1N43A 1SRIA 4TKHA 1JZUA 4R0BA 4UY8G 3I17A 5HA0A 5FQ7E 2POAA 2GJ5A 3ZW0A 1CJ5A 1VQME 3EBKA 4FQBB 4DCBA 1KL5A 3AKNA 1G5WA 5KICA 1SWJA 1H91A 3BDRA 1K8AG 1YP7A 2OY8A 2Z4HA 4L3RA 4BGFA 2JU8A 3TGAA 2C1QA 1E00A 1Y53X 5F1EA 5H9NA 4ZHHA 3P24A 4AZOA 4LKPA 4DNEA 2AL0X 4HPBA 2G78A 3TZSA 2WEXA 2HZRA 1BSQA 2BLGA 5F58A 1ZNKA 3RZYA 2I5ZO 4RUNA 3D4RA 4N7DA 4MVEA 4A8ZA 1OSPO 4GGTA 1SLGB 4HPCA 1S44A 1GKAB 5JD2A 5EZ2A 1RXKA 4IABA 3WZNA 2MM3A 4YKMA 3CWKA 3IFBA 2QOSC 1I04A 4YBPA 1QY0A 1QFTA 5D4AA 4PSQA 1YJNE 1OPAA 1LCWA 3F6ZB 1E02A 2RTMA 2FR2A 1B0OA 4D6BA 2X8SA 2ASNX 2OFBA 1MX8A 2WQ9A 3ZW2A 3HOEA 4IRWA 3CCSE 2WQAE 2ZJQE 2C4IA 4OMWA 5C0NA 1G74A 3STMX 2ALLX 4ZGFA 2FS6A 2W2AA 2AVIA 3SZIA 1STPA 1YJ9E 2YMSA 3ELZA 5LJBA 4GDZA 5IO6A 5FQ6E 3CMPA 2QCBA 3D96A 2YG2A 3HTYA 1RXJA 1Q81G 4ZFXA 1UREA 5FAZA 1U17A 3BRNA 4YFRA 4GK9A 4CDEA 2AT8X 2A5BA 1LNMA 4YDBA 1Y9TA 1FENA 1SRGA 2HMBA 1OEEA 4EDEA 1GXAA 4WF9E 4YVBA 3VHMA 3U0DA 2IZAA 1HY2A 2BHVA 3WJDA 2OZQA 1VWRB 2CM4A 1LFOA 2N93A 1VWHB 1GGLA 2Q2MA 3PQUA 4A1HA 4ON1A 4Y0PA 4GGRA 2IZIA 4O3XB 3FR2A 2G7BA 3OD9A 4GRJA 2P8GA 3WJGA 2IZKA 1DZJA 2FHLA 3B2LA 3HK1A 1KOIA 5EEEA 4ALOA 4IAWA 4YGGA 4GUZA 2DJFA 4LZVA 3MVFA 2MWHA 4BX7B 1ZNHA 2GTLO 3KZAA 2L68A 5LJKA 1KT6A 1O1VA 3FR4A 4A1YA 3FA6A 3CR6A 1X8QA 2XSTA 4MVKA 2VFCA 1Y9LA 4KCAA 2PI3O 2X55A 5HZQA 4N7CA 2LA7A 1HBPA 2GTLN 2HNXA 5H9LA 2R74A 4WFBE 5MLCH 1VWQB 4GE1A 3N91A 2MJIA 5L8IA 2CZUA 4Y0SA 1VWAB 2DM5A 4RUUA 4JNJA 3ZUIA 1GM6A 4GD9A 5LKEA 1VQ5E 1I05A 3U03A 5LJGA 1S7DA 1AELA 4ZHDA 2LBVA 2K23A 2A2GA 4ARHA 5BVTA 1JJXA 1FEMA 2GH7A 1ICMA 3EYCA 4YBUA 4ZHCA 1EXSA 1Z24A 4NP1A 3HWGA 3VHIA 1EQDA 4XMHA 1D3SA 2ZJRE 1QVGE 3BU9A 4YDAA 3T2XA 2OFAA 2AMMX 4BX6B 2OF8A 1MX7A 4OS8A 1RL6A 1SWNA 3S5VA 3WJFA 1YWDA 5F6ZA 3RKGA 5HL7E 5HZ5A 1WUBA 5HCCC 1GT5A 1N4JA 4HWMA 1QWDA 4D6AA 2WPUA 4BVMA 4NNTA 4ORWA 1SLDB 1JIWI 4GZVA 2I5VO 3RWXA 4AZNA 1JMZA 3CXCE 1R0UA 1VWIB 1YUPA 1JQPA 3DTQA 4QGWA 5CE4A 5B3MO 3UEXA 2FGSA 3OW2E 1KZXA 1VQ7E 3B2IA 2G8CO 1PTSA 3KQ0A 1LCZA 3VGWA 1DZMA 4IOAE 1K24A 3WOVA 2IZBA 3ZW1A 4OS0A 1PMPA 3CMAE 5IXGA 2L9CA 1YIJE 4WHIA 3EC5A 3FMZA 3P6DA 3FELA 3MM0A 1VYFA 3O19A 5LKFA 4U8UM 1OPBA 1MEPA 1GT1A 5DPQA 4ALBA 1Q86G 1PM1X 4NLIA 4GU8A 3UEUA 4GKCA 1HN2A 1SLFB 4ORUA 1TOWA 5JR8A 1KT3A 2ACOA 4EFGA 3FDCA 1FJ1E 3RE5A 2RTFB 2AF5A 2X4MA 3IGEA 2HZQA 4AZRA 2ZAGA 2FT9A 3T2WA 1BJ7A 3BS2A 3SLJA 5H8TA 2W2BA 2AT5X 3FENA 4O3YA 2A8GA 3BY0A 4O4XA 1D2UA 5HZ9A 2IZEB 5B29A 1VWMB 4IB8A 1JJUA 1RSTB 4UU3A 1LELA 4YGHA 1EIOA 4BX5A 1VYGA 1SWAA 3P6HA 2RTJA 1TW4A 5IRAA 2BC3A 4CK4A 4U8UN 4CPHB 2OL8O 5HTEA 4EQAC 1Y55X 2AT3X 3D9WA 2RTHB 3B2JA 1HBQA 1KD1G 3UEWA 1Y0GA 4GH7A 3VG4A 4Z2PA 1ZNLA 2LB6A 1VQNE 1HQQA 5AEOA 2WWPA 2NNDA 4IMNA 2Y32A 1NP1A 5DM6E 1SRFA 1KT4A 1OBQA 1BWYA 2QMIA 4LQZA 1U0XA 2OFMX 2ZSCA 2RTRB 1AVDA 4NV7A 1VWEB 3GAQA 1MM9A 3ZWEA 4M7MA 2RTEB 4I6SA 3U9PC 3BX7A 4HFOA 4CDFA 1FELA 5AQ6A 1B56A 1E5PA 1DZPA 3STKA 1YJWE 2DJGA 3FW5A 3EW2A 2A5CA 1RLBE 4YCEA 4MVIA 2IZLB 1YP6A 3NQ3A 1VWKB 4YKOA 1NJIG 4ES7A 3CC7E 4DQ4A 4IB9A 1GX3A 1VWGB 2RTOB 3PQSA 5HZ8A 1VQPE 1VQ8E 3APXA 1EI5A 3SLOA 1SWRA 4OELA 1SMPI 1JYDA 3SOTA 2FRSA 4CSBA 4PJ2A 4WFUA 5FENA 2AKQA 4NYQA 1G7NA 2RTDB 3D95A 2Y3FA 1W5RA 3NADA 4Z6JA 5D8JA 3WVMA 1E2TA 4CPHA 2IZCB 1ZNGA 1VQOE 4WCEE 3G7XA 2X8TA 3FR5A 1HXZA 5F6BA 4YFQA 5JVGE 5HBSA 4QGXA 1NQNA 2FR3A 1SRHA 3AKMA 4AZPA 3CCLE 1MVGA 2OVEA 4GDAA 1X8NA 2WSJA 3I55E 2QO5A 2OY5O 2F73A 2BSZA 1CBSA 1ERBA 4I3CA 4QQ1A 2G5LA 3P6EA 1LF7A 1VWCB 2QM9A 5CSEA 4QGVA 4NYRA 3CF5E 2KT4B 5HAEA 3Q34A 5F7GA 4YMYA 4INNA 3SZJA 2OYBO 2NNQA 1HXLA 3NPOA 2QEXE 2GTLM 3JSQA 1SWKA 4O4UA 3WXQA 2AT6X 1CBQA 4IBAA 3B2HA 4BBOA 1N0SA 3APVA 1VYOA 1LIBA 1STSB 2F09A 4K19A 4YFPA 4MISA 4FBVA 1IFBA 1AB0A 5HCDC 3NX2A 1VWPB 4I3DA 2R56A 1GKAA 2CBRA 2BS5A 1JBHA 1BRPA 1EALA 3CKGA 4U67E 1HMSA 3PPTA 1FTPA 1BEBA 1SWLA 1S72E 3CCQE 3BU1A 3FYFA 5D48A 1I06A 1VPRA 3JS1A 1JMXA 1AQBA 3C76X 5IO7A 3RY1A 1BSYA 3KVNA 2CQLA 1IKEA 1SWBA 4O9SA 4LKTA 3KFHA 4KT5A 2HYSA 1XKIA 4XMDA 2IZJA 1STRB 1SY2A 3NQKA 1SA8A 1X8OA 4HPAA 3HWDA 3S26A 2OL7A 5EDCA 1KXOA 5JVHE 1JYJA 2AH7X 3O2YA 1A3YA 4AZMA 3CQNA 3RDQA 1RJLC 1L6MA 3VE1A 3ELXA 1Q7YG 1O8VA 2RA6A 2XKLA 5B5FA 2RCQA 3FEPA 5HTDA 3S5XA 1RSUB 1TOUA 3UAQA 3ZUOA 1K3BA 3KFGA 3PDFA 2W2FA 1NDJA 1G85A 5GAEG 2X45A 1KQSE 3PECA 5AJBA 1PEEA 3WYPA 4ZHFA 4LZUA 1YI2E 2X34A 4MVLA 1DF8A 4M6SA 4IO9E 3QQ2A 3LV4A 2OY7A 1QFVA 4ZCBA 3CBCA 1VWLB 3NP1A 3KFFA 3G6EE 1SWGA 5KIDA 1RBPA 3LTWA 1ERXA 5HA1A 2X32A 4U3QA 1VQKE 1KZWA 3V8UA 4KIIA 4MIRA 1ACDA 3DSZA 1YHQE 1IKJA 1U18A 2RCTA 1EUOA 4NLJA 2IZFB 1IFCA 3AUMO 2QO6A 2CBSA 4BX7A 3STNA 3EM0A 5K68A 3Q6LA 1SWEA 2WEWA 2ACPX 1KT5A 5B10O 4QZUA 3VG6A 5L8OA 4KC8A 2C1SA 1VWNB 1A57A 2GC9A 1T0VA 3D97A 4QYPA 1IJ8A 1RXHA 1LKEA 4QRLA 1ZRYA 3ZQ3A 5B2AO 2NP1A 1VWFB 4ORXA 1LDQA 2JN3A 2RTNB 2M4LA 5BVSA 3CCME 3RDMA 4XMCA 2EU7X 3FW4A 1EW3A 1ALBA 1SXUA 1EIIA 2OVDA 1EPAA 3ZW0B 1VQ4E 3I56E 1DV9A 4ZH6A 2IZGB 1X8UA 4O4OA 3FIQA 2RTLA 3P6FA 1HQPA 3WZOA 3CCRE 5L3YA 1ADLA 2Z4IA 2FHNX 3FA8A 3O22A 3BX8A 1SXXA 4O49A 2Q2PA 5KHPA 1LPJA 5LJEA 4BX6A 1CBIA 4ORSA 2RTQB 1SWUA 1P6PA 4Z27A 1LCVA 4I60A 4TKBA 2KTSA 2Y3EA 3S60A 3CBSA 1X89A 4O3WA 4NW4A 3RDXA 3CMEE 4GGZA 3I0AA 3RE6A 4EKVA 1BSOA 4O4SA 3T1DA 1IW2A 2ZAIA 1W2BE 2CAMA 1ZNEA 3FA9A 1BM5A 5AJCA 2FS7A 4TKJA 4U9CA 4AW8A 2JU7A 1CRBA 1UYNX 3OBLA 5EPQA 1QY1A 3FIDA 1IIUA 1K73G 1MDCA 5BVQA 3PK2A 1M90G 2UYWA 3C77X 2KD2A 1SXWA 4ORRA 2WUTA 4O3ZA 4Z28A 4CPFA 3QKGA 2RTPB 3PH6A 1BBPA 4OEMA 5FFHA 2RTCB 1UYOX 4OKAA 3HOLA 4ML7B 1MUPA 4TLJA 4BQUA 2X56A 1KC8G 1SY1A 1GT4A 3VG7A 3BSZE 4ODDA 3ZZVA 1XCAA 3NX1A 2E4JA 2FWVA 1HMRA 1YWBA 1DF3A 4GJSA 3CC2E 4BOEA 4ORYA 4IOCE 5B11O 4WBKA 2MF6A
chains in the Genus database with same CATH topology
2OL7A 2I5VO 2G8CO 2OYBO 2OY5O 1OSPO 3AUMO 2OY1O 1P4PA 2OY8A 2HKDA 3IG9A 3CKFA 1RJLC 1FJ1E 2OL6O 2OY7A 2FKJA 2AF5A 5B2AO 2FKGA 2I5ZO 5B10O 5B3MO 3IGEA 3EC5A 2PI3O 5B11O 3CKGA 2OL8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OL7 A;  2I5V O;  2G8C O;  2OYB O;  2OY5 O;  1OSP O;  3AUM O;  2OY1 O;  1P4P A;  2OY8 A;  2HKD A;  3CKF A;  1FJ1 E;  2OL6 O;  2OY7 A;  2FKJ A;  2AF5 A;  5B2A O;  2FKG A;  2I5Z O;  5B10 O;  5B3M O;  3EC5 A;  2PI3 O;  5B11 O;  3CKG A;  2OL8 O; 
#chains in the Genus database with same CATH topology
 5BYP A;  3SZH A;  2UZ2 A;  5L8N A;  2X46 A;  1S2P A;  4YGZ A;  1SRJ A;  4WFA E;  2KTD A;  1QY2 A;  4NV8 A;  1O1U A;  4COT A;  3VHH A;  4QAE A;  1A18 A;  2FKG A;  1VQ9 E;  1N9M A;  4OMX A;  3VG3 A;  3EMM A;  2LFO A;  1GX9 A;  1VQL E;  3HWF A;  4BCS A;  1N8R G;  1I78 A;  3WBG A;  3CCE E;  3OE3 A;  2A2U A;  1FDQ A;  4KC7 A;  4QZT A;  2RTI B;  4Z2V A;  2VFB A;  1T68 X;  1NC9 A;  3FA7 A;  3CCU E;  4DQ3 A;  1LID A;  4ZH9 A;  3WYQ A;  4CDC A;  1VWD B;  2FTB A;  1SWD A;  3EBW A;  3BLG A;  1SWO A;  2A0A A;  5HCE C;  2OL6 O;  4HPD A;  4FGI B;  3WJC A;  1SWH A;  2QA4 E;  1KT7 A;  2G79 A;  2A3F X;  1VQ6 E;  1SWF A;  3APU A;  2JW1 A;  1I9H A;  3MG5 A;  2RTG B;  1Y52 X;  1MK5 A;  2OTL E;  1JJJ A;  5H1S I;  3PP6 A;  5IRW A;  3CKF A;  1YWC A;  3DLL E;  1TXL A;  1E06 A;  2FKJ A;  4CV7 A;  2OTJ E;  2IZD B;  1W4T A;  3X00 A;  1DZK A;  1RAV A;  4L1N A;  3PIP E;  3P6G A;  1SWQ A;  4QNI A;  4FBO A;  4Y5D A;  5DG4 A;  3HWE A;  3WJE A;  1AVE A;  3FEK A;  1NQM A;  1GT3 A;  4BJ8 A;  1CBR A;  2BS6 A;  5EDB A;  3IA8 A;  1T8V A;  1N7Y A;  2A13 A;  4A60 A;  4XME A;  4FBR A;  4XMF A;  1LUQ A;  1JV4 A;  1JJ2 E;  4GJV A;  1GX8 A;  3P6C A;  4GET A;  2QO4 A;  3CQR A;  1NGL A;  4Z2O A;  4ID2 A;  2Q39 A;  2KW1 A;  2BT9 A;  3TGC A;  3CPW E;  4WFN E;  1N9Y A;  2MO5 A;  5B5G A;  1NP4 A;  1VWB B;  3SLT A;  1SY0 A;  4JO6 A;  3LHN A;  4ZHG A;  3TF6 A;  4I3B A;  4Y0R A;  1SY3 A;  4I95 A;  1K9M G;  2CZT A;  1EPB A;  4NNS A;  3SAO A;  3RBY A;  4AZQ A;  1SWT A;  1KL3 A;  1B8E A;  4GNW A;  3NQ9 A;  4GNY A;  1PBO A;  1M1K G;  2JOZ A;  1QQS A;  5DM7 E;  1LIC A;  4TJZ A;  2LBA A;  3PED A;  4XMG A;  2JMB A;  1LDO A;  1SWC A;  4CDD A;  3ZW1 B;  4JHQ A;  2HLV A;  4AYH A;  1X8P A;  1W6F A;  1Q82 G;  4MEE A;  3E3C A;  3CD6 E;  3UEV A;  3VG5 A;  5HZ6 A;  1KQW A;  3TGB A;  3F9D A;  3AEH A;  2R73 A;  3VG2 A;  4Y0Q A;  1ML7 A;  2NNE A;  3RDO A;  2VDF A;  2ZJP E;  3ZI8 A;  2X8F A;  4ZGU A;  4OS3 A;  3C78 X;  1P4P A;  1BRQ A;  1SXY A;  2IFB A;  3MBT A;  2L67 A;  1MOY A;  4IB6 A;  5LJH A;  1KFF A;  3IG9 A;  3GE2 A;  1LIE A;  2LKK A;  3OJY C;  1A2D A;  3NR3 A;  5GAD G;  2AT0 X;  3PIO E;  5B27 A;  5CHK A;  2JGS A;  1OBU A;  3H3I A;  3EW1 A;  2RQ0 A;  3T6L A;  2RTK A;  5H9K A;  3WJB A;  2QOM A;  1ICN A;  4U46 A;  1SWP A;  2PY1 A;  4BX5 B;  2HKD A;  3KFI A;  3APW A;  5CYB A;  3JQO A;  5LJC A;  4B55 A;  3K3L A;  3WZQ A;  5K67 A;  5F2B A;  4KH8 A;  1NBX A;  1ZND A;  2ANS A;  3G71 E;  3T6F A;  1FE3 A;  2RTB B;  2L5P A;  3PH5 A;  2GTF X;  2OF9 A;  2Q4N A;  1X71 A;  2RTA A;  3P02 A;  2RN4 A;  1OEJ A;  3CCJ E;  2OY1 O;  1WBI A;  5AN9 B;  3RY2 A;  3VE2 A;  1KQX A;  4I9S A;  3CCV E;  1VWJ B;  3FLL A;  4JGL A;  4IB7 A;  2WR6 A;  4IAX A;  2Q9S A;  1TVQ A;  4I9R A;  4CPI A;  4C5P A;  3WZP A;  1B4M A;  1YIV A;  3RDS A;  1AVG I;  5FQ8 E;  3RDU A;  1DC9 A;  3L4R A;  2OVA A;  1SWS A;  1SRE A;  3G4S E;  1QG5 A;  5HWZ A;  5GAH G;  1OBP A;  1QAB E;  3HPE A;  5H9A A;  1HMT A;  2RD7 C;  5EED A;  4EXZ A;  4Y59 A;  2MHD A;  1KL4 A;  5D45 A;  4EEJ A;  4ZR2 A;  3F8A A;  3NBX X;  5K06 A;  4TNN A;  1SLE B;  1UZ2 X;  4IMO A;  4YCH A;  1LIF A;  4ZJ0 A;  1PBY A;  4U8U O;  4WFV A;  3CC4 E;  4QYN A;  5D47 A;  1KGL A;  1YWA A;  2FLJ A;  3VU1 A;  1DFV A;  3RSW A;  5IRU A;  2JU3 A;  2OVS A;  2IZH B;  1YIT E;  1VWO B;  2K62 A;  5IO5 A;  4CPE A;  3MX7 A;  2CM9 A;  5LJD A;  2O62 A;  4TQ2 A;  1BLR A;  1OEK A;  4YH0 A;  2F01 A;  3J7Z G;  1QVF E;  3B2K A;  3VPJ E;  2OFR X;  4UU2 A;  5GAG G;  1I4U A;  1N43 A;  1SRI A;  4TKH A;  1JZU A;  4R0B A;  4UY8 G;  3I17 A;  5HA0 A;  5FQ7 E;  2POA A;  2GJ5 A;  3ZW0 A;  1CJ5 A;  1VQM E;  3EBK A;  4FQB B;  4DCB A;  1KL5 A;  3AKN A;  1G5W A;  5KIC A;  1SWJ A;  1H91 A;  3BDR A;  1K8A G;  1YP7 A;  2OY8 A;  2Z4H A;  4L3R A;  4BGF A;  2JU8 A;  3TGA A;  2C1Q A;  1E00 A;  1Y53 X;  5F1E A;  5H9N A;  4ZHH A;  3P24 A;  4AZO A;  4LKP A;  4DNE A;  2AL0 X;  4HPB A;  2G78 A;  3TZS A;  2WEX A;  2HZR A;  1BSQ A;  2BLG A;  5F58 A;  1ZNK A;  3RZY A;  2I5Z O;  4RUN A;  3D4R A;  4N7D A;  4MVE A;  4A8Z A;  1OSP O;  4GGT A;  1SLG B;  4HPC A;  1S44 A;  1GKA B;  5JD2 A;  5EZ2 A;  1RXK A;  4IAB A;  3WZN A;  2MM3 A;  4YKM A;  3CWK A;  3IFB A;  2QOS C;  1I04 A;  4YBP A;  1QY0 A;  1QFT A;  5D4A A;  4PSQ A;  1YJN E;  1OPA A;  1LCW A;  3F6Z B;  1E02 A;  2RTM A;  2FR2 A;  1B0O A;  4D6B A;  2X8S A;  2ASN X;  2OFB A;  1MX8 A;  2WQ9 A;  3ZW2 A;  3HOE A;  4IRW A;  3CCS E;  2WQA E;  2ZJQ E;  2C4I A;  4OMW A;  5C0N A;  1G74 A;  3STM X;  2ALL X;  4ZGF A;  2FS6 A;  2W2A A;  2AVI A;  3SZI A;  1STP A;  1YJ9 E;  2YMS A;  3ELZ A;  5LJB A;  4GDZ A;  5IO6 A;  5FQ6 E;  3CMP A;  2QCB A;  3D96 A;  2YG2 A;  3HTY A;  1RXJ A;  1Q81 G;  4ZFX A;  1URE A;  5FAZ A;  1U17 A;  3BRN A;  4YFR A;  4GK9 A;  4CDE A;  2AT8 X;  2A5B A;  1LNM A;  4YDB A;  1Y9T A;  1FEN A;  1SRG A;  2HMB A;  1OEE A;  4EDE A;  1GXA A;  4WF9 E;  4YVB A;  3VHM A;  3U0D A;  2IZA A;  1HY2 A;  2BHV A;  3WJD A;  2OZQ A;  1VWR B;  2CM4 A;  1LFO A;  2N93 A;  1VWH B;  1GGL A;  2Q2M A;  3PQU A;  4A1H A;  4ON1 A;  4Y0P A;  4GGR A;  2IZI A;  4O3X B;  3FR2 A;  2G7B A;  3OD9 A;  4GRJ A;  2P8G A;  3WJG A;  2IZK A;  1DZJ A;  2FHL A;  3B2L A;  3HK1 A;  1KOI A;  5EEE A;  4ALO A;  4IAW A;  4YGG A;  4GUZ A;  2DJF A;  4LZV A;  3MVF A;  2MWH A;  4BX7 B;  1ZNH A;  2GTL O;  3KZA A;  2L68 A;  5LJK A;  1KT6 A;  1O1V A;  3FR4 A;  4A1Y A;  3FA6 A;  3CR6 A;  1X8Q A;  2XST A;  4MVK A;  2VFC A;  1Y9L A;  4KCA A;  2PI3 O;  2X55 A;  5HZQ A;  4N7C A;  2LA7 A;  1HBP A;  2GTL N;  2HNX A;  5H9L A;  2R74 A;  4WFB E;  5MLC H;  1VWQ B;  4GE1 A;  3N91 A;  2MJI A;  5L8I A;  2CZU A;  4Y0S A;  1VWA B;  2DM5 A;  4RUU A;  4JNJ A;  3ZUI A;  1GM6 A;  4GD9 A;  5LKE A;  1VQ5 E;  1I05 A;  3U03 A;  5LJG A;  1S7D A;  1AEL A;  4ZHD A;  2LBV A;  2K23 A;  2A2G A;  4ARH A;  5BVT A;  1JJX A;  1FEM A;  2GH7 A;  1ICM A;  3EYC A;  4YBU A;  4ZHC A;  1EXS A;  1Z24 A;  4NP1 A;  3HWG A;  3VHI A;  1EQD A;  4XMH A;  1D3S A;  2ZJR E;  1QVG E;  3BU9 A;  4YDA A;  3T2X A;  2OFA A;  2AMM X;  4BX6 B;  2OF8 A;  1MX7 A;  4OS8 A;  1RL6 A;  1SWN A;  3S5V A;  3WJF A;  1YWD A;  5F6Z A;  3RKG A;  5HL7 E;  5HZ5 A;  1WUB A;  5HCC C;  1GT5 A;  1N4J A;  4HWM A;  1QWD A;  4D6A A;  2WPU A;  4BVM A;  4NNT A;  4ORW A;  1SLD B;  1JIW I;  4GZV A;  2I5V O;  3RWX A;  4AZN A;  1JMZ A;  3CXC E;  1R0U A;  1VWI B;  1YUP A;  1JQP A;  3DTQ A;  4QGW A;  5CE4 A;  5B3M O;  3UEX A;  2FGS A;  3OW2 E;  1KZX A;  1VQ7 E;  3B2I A;  2G8C O;  1PTS A;  3KQ0 A;  1LCZ A;  3VGW A;  1DZM A;  4IOA E;  1K24 A;  3WOV A;  2IZB A;  3ZW1 A;  4OS0 A;  1PMP A;  3CMA E;  5IXG A;  2L9C A;  1YIJ E;  4WHI A;  3EC5 A;  3FMZ A;  3P6D A;  3FEL A;  3MM0 A;  1VYF A;  3O19 A;  5LKF A;  4U8U M;  1OPB A;  1MEP A;  1GT1 A;  5DPQ A;  4ALB A;  1Q86 G;  1PM1 X;  4NLI A;  4GU8 A;  3UEU A;  4GKC A;  1HN2 A;  1SLF B;  4ORU A;  1TOW A;  5JR8 A;  1KT3 A;  2ACO A;  4EFG A;  3FDC A;  1FJ1 E;  3RE5 A;  2RTF B;  2AF5 A;  2X4M A;  3IGE A;  2HZQ A;  4AZR A;  2ZAG A;  2FT9 A;  3T2W A;  1BJ7 A;  3BS2 A;  3SLJ A;  5H8T A;  2W2B A;  2AT5 X;  3FEN A;  4O3Y A;  2A8G A;  3BY0 A;  4O4X A;  1D2U A;  5HZ9 A;  2IZE B;  5B29 A;  1VWM B;  4IB8 A;  1JJU A;  1RST B;  4UU3 A;  1LEL A;  4YGH A;  1EIO A;  4BX5 A;  1VYG A;  1SWA A;  3P6H A;  2RTJ A;  1TW4 A;  5IRA A;  2BC3 A;  4CK4 A;  4U8U N;  4CPH B;  2OL8 O;  5HTE A;  4EQA C;  1Y55 X;  2AT3 X;  3D9W A;  2RTH B;  3B2J A;  1HBQ A;  1KD1 G;  3UEW A;  1Y0G A;  4GH7 A;  3VG4 A;  4Z2P A;  1ZNL A;  2LB6 A;  1VQN E;  1HQQ A;  5AEO A;  2WWP A;  2NND A;  4IMN A;  2Y32 A;  1NP1 A;  5DM6 E;  1SRF A;  1KT4 A;  1OBQ A;  1BWY A;  2QMI A;  4LQZ A;  1U0X A;  2OFM X;  2ZSC A;  2RTR B;  1AVD A;  4NV7 A;  1VWE B;  3GAQ A;  1MM9 A;  3ZWE A;  4M7M A;  2RTE B;  4I6S A;  3U9P C;  3BX7 A;  4HFO A;  4CDF A;  1FEL A;  5AQ6 A;  1B56 A;  1E5P A;  1DZP A;  3STK A;  1YJW E;  2DJG A;  3FW5 A;  3EW2 A;  2A5C A;  1RLB E;  4YCE A;  4MVI A;  2IZL B;  1YP6 A;  3NQ3 A;  1VWK B;  4YKO A;  1NJI G;  4ES7 A;  3CC7 E;  4DQ4 A;  4IB9 A;  1GX3 A;  1VWG B;  2RTO B;  3PQS A;  5HZ8 A;  1VQP E;  1VQ8 E;  3APX A;  1EI5 A;  3SLO A;  1SWR A;  4OEL A;  1SMP I;  1JYD A;  3SOT A;  2FRS A;  4CSB A;  4PJ2 A;  4WFU A;  5FEN A;  2AKQ A;  4NYQ A;  1G7N A;  2RTD B;  3D95 A;  2Y3F A;  1W5R A;  3NAD A;  4Z6J A;  5D8J A;  3WVM A;  1E2T A;  4CPH A;  2IZC B;  1ZNG A;  1VQO E;  4WCE E;  3G7X A;  2X8T A;  3FR5 A;  1HXZ A;  5F6B A;  4YFQ A;  5JVG E;  5HBS A;  4QGX A;  1NQN A;  2FR3 A;  1SRH A;  3AKM A;  4AZP A;  3CCL E;  1MVG A;  2OVE A;  4GDA A;  1X8N A;  2WSJ A;  3I55 E;  2QO5 A;  2OY5 O;  2F73 A;  2BSZ A;  1CBS A;  1ERB A;  4I3C A;  4QQ1 A;  2G5L A;  3P6E A;  1LF7 A;  1VWC B;  2QM9 A;  5CSE A;  4QGV A;  4NYR A;  3CF5 E;  2KT4 B;  5HAE A;  3Q34 A;  5F7G A;  4YMY A;  4INN A;  3SZJ A;  2OYB O;  2NNQ A;  1HXL A;  3NPO A;  2QEX E;  2GTL M;  3JSQ A;  1SWK A;  4O4U A;  3WXQ A;  2AT6 X;  1CBQ A;  4IBA A;  3B2H A;  4BBO A;  1N0S A;  3APV A;  1VYO A;  1LIB A;  1STS B;  2F09 A;  4K19 A;  4YFP A;  4MIS A;  4FBV A;  1IFB A;  1AB0 A;  5HCD C;  3NX2 A;  1VWP B;  4I3D A;  2R56 A;  1GKA A;  2CBR A;  2BS5 A;  1JBH A;  1BRP A;  1EAL A;  3CKG A;  4U67 E;  1HMS A;  3PPT A;  1FTP A;  1BEB A;  1SWL A;  1S72 E;  3CCQ E;  3BU1 A;  3FYF A;  5D48 A;  1I06 A;  1VPR A;  3JS1 A;  1JMX A;  1AQB A;  3C76 X;  5IO7 A;  3RY1 A;  1BSY A;  3KVN A;  2CQL A;  1IKE A;  1SWB A;  4O9S A;  4LKT A;  3KFH A;  4KT5 A;  2HYS A;  1XKI A;  4XMD A;  2IZJ A;  1STR B;  1SY2 A;  3NQK A;  1SA8 A;  1X8O A;  4HPA A;  3HWD A;  3S26 A;  2OL7 A;  5EDC A;  1KXO A;  5JVH E;  1JYJ A;  2AH7 X;  3O2Y A;  1A3Y A;  4AZM A;  3CQN A;  3RDQ A;  1RJL C;  1L6M A;  3VE1 A;  3ELX A;  1Q7Y G;  1O8V A;  2RA6 A;  2XKL A;  5B5F A;  2RCQ A;  3FEP A;  5HTD A;  3S5X A;  1RSU B;  1TOU A;  3UAQ A;  3ZUO A;  1K3B A;  3KFG A;  3PDF A;  2W2F A;  1NDJ A;  1G85 A;  5GAE G;  2X45 A;  1KQS E;  3PEC A;  5AJB A;  1PEE A;  3WYP A;  4ZHF A;  4LZU A;  1YI2 E;  2X34 A;  4MVL A;  1DF8 A;  4M6S A;  4IO9 E;  3QQ2 A;  3LV4 A;  2OY7 A;  1QFV A;  4ZCB A;  3CBC A;  1VWL B;  3NP1 A;  3KFF A;  3G6E E;  1SWG A;  5KID A;  1RBP A;  3LTW A;  1ERX A;  5HA1 A;  2X32 A;  4U3Q A;  1VQK E;  1KZW A;  3V8U A;  4KII A;  4MIR A;  1ACD A;  3DSZ A;  1YHQ E;  1IKJ A;  1U18 A;  2RCT A;  1EUO A;  4NLJ A;  2IZF B;  1IFC A;  3AUM O;  2QO6 A;  2CBS A;  4BX7 A;  3STN A;  3EM0 A;  5K68 A;  3Q6L A;  1SWE A;  2WEW A;  2ACP X;  1KT5 A;  5B10 O;  4QZU A;  3VG6 A;  5L8O A;  4KC8 A;  2C1S A;  1VWN B;  1A57 A;  2GC9 A;  1T0V A;  3D97 A;  4QYP A;  1IJ8 A;  1RXH A;  1LKE A;  4QRL A;  1ZRY A;  3ZQ3 A;  5B2A O;  2NP1 A;  1VWF B;  4ORX A;  1LDQ A;  2JN3 A;  2RTN B;  2M4L A;  5BVS A;  3CCM E;  3RDM A;  4XMC A;  2EU7 X;  3FW4 A;  1EW3 A;  1ALB A;  1SXU A;  1EII A;  2OVD A;  1EPA A;  3ZW0 B;  1VQ4 E;  3I56 E;  1DV9 A;  4ZH6 A;  2IZG B;  1X8U A;  4O4O A;  3FIQ A;  2RTL A;  3P6F A;  1HQP A;  3WZO A;  3CCR E;  5L3Y A;  1ADL A;  2Z4I A;  2FHN X;  3FA8 A;  3O22 A;  3BX8 A;  1SXX A;  4O49 A;  2Q2P A;  5KHP A;  1LPJ A;  5LJE A;  4BX6 A;  1CBI A;  4ORS A;  2RTQ B;  1SWU A;  1P6P A;  4Z27 A;  1LCV A;  4I60 A;  4TKB A;  2KTS A;  2Y3E A;  3S60 A;  3CBS A;  1X89 A;  4O3W A;  4NW4 A;  3RDX A;  3CME E;  4GGZ A;  3I0A A;  3RE6 A;  4EKV A;  1BSO A;  4O4S A;  3T1D A;  1IW2 A;  2ZAI A;  1W2B E;  2CAM A;  1ZNE A;  3FA9 A;  1BM5 A;  5AJC A;  2FS7 A;  4TKJ A;  4U9C A;  4AW8 A;  2JU7 A;  1CRB A;  1UYN X;  3OBL A;  5EPQ A;  1QY1 A;  3FID A;  1IIU A;  1K73 G;  1MDC A;  5BVQ A;  3PK2 A;  1M90 G;  2UYW A;  3C77 X;  2KD2 A;  1SXW A;  4ORR A;  2WUT A;  4O3Z A;  4Z28 A;  4CPF A;  3QKG A;  2RTP B;  3PH6 A;  1BBP A;  4OEM A;  5FFH A;  2RTC B;  1UYO X;  4OKA A;  3HOL A;  4ML7 B;  1MUP A;  4TLJ A;  4BQU A;  2X56 A;  1KC8 G;  1SY1 A;  1GT4 A;  3VG7 A;  3BSZ E;  4ODD A;  3ZZV A;  1XCA A;  3NX1 A;  2E4J A;  2FWV A;  1HMR A;  1YWB A;  1DF3 A;  4GJS A;  3CC2 E;  4BOE A;  4ORY A;  4IOC E;  5B11 O;  4WBK A;  2MF6 A; 
#chains in the Genus database with same CATH homology
 2OL7 A;  2I5V O;  2G8C O;  2OYB O;  2OY5 O;  1OSP O;  3AUM O;  2OY1 O;  1P4P A;  2OY8 A;  2HKD A;  3IG9 A;  3CKF A;  1RJL C;  1FJ1 E;  2OL6 O;  2OY7 A;  2FKJ A;  2AF5 A;  5B2A O;  2FKG A;  2I5Z O;  5B10 O;  5B3M O;  3IGE A;  3EC5 A;  2PI3 O;  5B11 O;  3CKG A;  2OL8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...