1FJ7A

Solution structure of nucleolin rbd1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
GSHMLEDPVEGSESTTPFNLFIGNLNPNKSVAELKVAISELFAKNDLAVVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDGTRGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOLIN RBD1
publication title Solution structure of the two N-terminal RNA-binding domains of nucleolin and NMR study of the interaction with its RNA target.
pubmed doi rcsb
source organism Mesocricetus auratus
molecule tags Structural protein
total genus 13
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fj7A00
3G4SS 2RRBA 2YWKA 4WFNQ 2MQLA 1B7FA 4PR6A 5CYJA 3UE2A 4CH0S 2KM8B 2LA4A 1W2BR 2RUGA 2YKAA 1NU4A 2AD9A 1WEXA 2Q79A 4QQBA 3RW7A 1VC5A 2EK6A 2DITA 3UCGA 3MDFA 3EGNA 2B0GA 2DGSA 2WBRA 1OPIA 3NNCA 2AYEA 2AYGA 1K73T 2L9WA 3CCRS 2QFJA 4W92B 3CCSS 2BZ2A 3CPWR 3MD3A 2E5JA 2GO9A 4FXWA 3MXHP 4IOAQ 3P49B 2DNLA 2VOPA 1X4AA 2KYXA 3VF0B 1S72S 3CCMS 4BS2A 3S8SA 2CPEA 1RK8A 4WF9Q 2F3JA 4LJMA 2DH8A 2FPHX 2MSTA 2KVIA 1M5PC 1U1PA 2OJ3A 2M8DB 1UW4A 2DNGA 2U1AA 2X1BA 2DIVA 1KD1T 5IFMA 1X4FA 2MY8A 2MZ1A 2I2YA 3CD6S 4C4WA 5GAEU 1G2EA 4CQ1A 1RKJA 3BO2A 2MZJA 3UCUP 1D8ZA 3VAJA 2DNYA 2DGUA 3CC2S 2HGNA 2OSRA 3UD4P 1VQLS 4PKDB 3J7YU 1U1RA 3VAIA 2KG1A 2DNOA 2CPYA 5LXRA 1YWXA 1VQMS 2KI2A 4LIRA 1WELA 1Q82T 3I56S 3S01A 2MQMA 1WTBA 3R1HA 3MUTP 2KRBA 2MB0B 3CUNA 4WIIA 1M5VC 2DHXA 2MQOA 2XB2D 4TU8A 3G6ES 2RS2A 2JX2A 5GAGU 2YH1A 3Q2TC 3R27A 2M8HA 1JMTA 3R1LA 4LMZA 3JB9k 1WF0A 5IQQA 3SXLA 5HL7Q 2MXYA 1YJ9S 2XS2A 2DK2A 4CIOA 1K8AT 2LECA 3CCQS 1YITS 3D2WA 2OIHA 2KXNB 2LXIA 3THPA 2CQPA 4F26A 5LXYA 2DHAA 4WCEQ 2MYFA 4YB1P 3P5TL 1CVJA 3VALA 3ULHA 2DO0A 1UFWA 2JRSA 3S7RA 2RVJA 2CQHA 3CCES 1HD1A 3K0JA 1NJIT 2XS5A 2CPFA 3CXCR 3MUVP 5LSOA 1KOHA 2J76E 3SMZA 2U2FA 2M52A 1VBYA 1IQTA 1HA1A 3NS6A 1WEZA 1DZ5A 2G0CA 1QM9A 2EVZA 1H2VZ 2HVZA 1VQKS 1M5OC 1VQ5S 2FC8A 2DGVA 3H2UB 1BY9A 5EN1A 3P6YC 2HGMA 2MZRA 3CF5Q 2LXUA 3ZZZA 2M0GB 2CPHA 2DNNA 5CA5A 2CJKA 5ITHA 3HI9A 1X5TA 3TYTA 4OZ0A 2SXLA 2MKJA 2X1AA 2CQBA 1VQ8S 3HHNB 2CQDA 1HD0A 2ZJPQ 1VBXA 1PGZA 2DIUA 5CXTA 5IM0A 1KC8T 1X4DA 3TP2A 5DDQC 4IOCQ 2DISA 2NLWA 2CPZA 2XSFA 4Y0FA 1VQ4S 1UP1A 4ZKAA 4ED5A 2D3OR 3G9CA 1KOOA 2KXFA 4V19X 3RW6A 1ZZFA 2JVOA 2ADCA 1WG4A 3P3DA 1M1KT 1VQ7S 2NZ4A 2OTJS 4WKRA 1WG5A 1FJ7A 2CPDA 1K9MT 2MJNA 3CC4S 1P1TA 1F9FA 2D9OA 2HYIB 3SDEB 2HGLA 3NMRA 1VQNS 1WHVA 4U67Q 2YTCA 1VC0A 2E5GA 2MKCA 1X5PA 2MKKA 1Q86T 2N82B 1WWHA 2XS7A 1YIJS 3OW2R 3L3CA 2CQCA 2LQ5A 4F25A 1UAWA 1FO1A 1WI8A 2MJUA 2MPUA 2PE8A 2M7SA 4IUFA 1VBZA 1QVFR 1A9NB 3VAGA 2CQ3A 3EX7B 5JVHQ 1L3KA 5MLCV 1FHTA 2RS8A 2KM8C 1ZZNA 1X5OA 2DNZA 1NO8A 4OZ1A 4Y00A 1M90T 1JJ2R 4A8XA 2V94A 3BEGB 3DLLQ 4P6QA 3V4MA 3U1MA 1VC6A 2ZJRQ 1M5KC 2N3LA 2MGZB 1VQ6S 2VONA 2KFYA 2CQIA 2OSQA 2MQNA 4TU9A 1H2UX 3SDEA 4FXVA 1WHXA 3NNAA 1DBDA 2J8AA 2XNQA 2CPXA 2YH0A 3G8TA 3FEXB 1YJNS 2M2BA 2JWNA 3US5A 2JVRA 2E44A 2DGWA 5D77A 3CCLS 2M70A 4C0OC 1DRZA 2DGTA 1U2FA 2N7CA 2AYBA 3LQVA 1JJHA 3CMAS 1X4GA 2CPIA 2J0SD 2MKIA 2CQ0A 4TLQA 1YI2S 2F9DA 2DB1A 2HZCA 2MQQA 3EGZA 2F9JA 1FXLA 2KG0A 2LA6A 1WF1A 1SJQA 2MHNA 3I55S 2MGZA 3PIOQ 5JVGQ 1N88A 1OWXA 3LPYA 2CQ2A 2LKZA 2DNMA 2KHCA 3THTA 2MKSA 2G1DA 2KT5A 4F02A 2EK1A 2CQ1A 1X0FA 1YHQS 2UP1A 1H6KX 3CCVS 1U1LA 1U1KA 1X4CA 2DGXA 1D9AA 5DM6Q 2K8GA 3BO4A 4YOEA 2CPJA 3NNHA 2I38A 2M88A 1WHYA 2DGQA 4W90B 2RRAA 1WHWA 2MZTA 2M9KA 3CMES 1URNA 4UQTA 1FT8A 1Q7YT 1P27B 3CC7S 2DNQA 2RNEA 2LEBA 1SJ4P 2MY7A 2QEXS 1SJ3P 2E5HA 1FJEB 3NS5A 3H2VE 1SJFA 3B4DA 4TU7A 1R8PA 2VODA 5DDPC 4WFBQ 1WEYA 1KQSR 2KXHA 3CTRA 1OIAA 3B4MA 2A3JA 2RU3A 2DGOA 1FJCA 2DHGA 3ZZYA 5DM7Q 2DNRA 2LYVA 3CULA 5GMKa 5DDOC 3MI7X 3MUMP 3PIPQ 2VOOA 2LMIA 2X1GA 1X4EA 2E5IA 1YTYA 2RQ4A 5H1SV 4YUDA 1U1OA 3BS9A 5LSLA 2L41A 2K3KA 3Q2SC 5GVQA 4RU2A 1X4HA 2KU7A 2O3DA 3UCZP 1O0PA 5D78A 3S6EA 3DXBA 3UD3P 5DDRC 1N54B 1U1QA 3MOJB 1N52B 2CQ4A 2DHSA 1Q81T 1PO6A 1OO0B 2LCWA 1WI6A 2ZJQQ 3MURP 4C7QA 3VAKA 1U1MA 2KH9A 1XN9A 1N8RT 3UWTA 3TO8A 4PRFA 2BOPA 3IWNC 2ERRA 2MQPA 2ADBA 2RQCA 2G4BA 2RT3A 1WF2A 2MSSA 3VAHA 1ZH5A 4QU7A 2OTLS 1U6FA 1U1NA 3J7ZT 1VQPS 4IO9Q 4J5OA 4QU6A 2PEHA 1SXLA 2M4MA 2DNKA 1WG1A 2FY1A 1R8HA 2L08A 4QPTA 1SJRA 4EGLA 3G8SA 2XNRA 1AUDA 2DO4A 2MMYA 1S79A 2LEAA 2D9PA 2MZQA 2DNPA 4ERDA 2MKHA 5BJRA 1VQ9S 3FEYB 1HL6A 5IM0B 1DHMA 1U6BA 5LJ5Y 4Z2XA 1X5SA 3G71S 3VAMA 2N3OA 3MD1A 2FC9A 1FNXH 1YJWS 2GHPA 1VQOS 2CQGA 3BO3A 4UY8T 2AYMA 4CH1A 2J0QD 2FHOB 5DETA 1JJ4A 2X1FA 2MZSA 4M5DB 3CCJS 3VAFA 2KRRA 3CCUS 5GAHU 3G96A 2QA4S 2DH9A 2KN4A 5HO4A 2DNHA 5GADU 3U1LA 3IRWP 5LJ3Y 3N9UC 5FJ4A 2DH7A 1A7GE 1QVGR 4WFAQ 1H2TZ 1X4BA
chains in the Genus database with same CATH superfamily
4DV4J 2AJ0A 4WXWA 3GE9A 2LQ8A 2YKAA 2Q79A 1RJJA 4JOUA 1NMEB 4Y6IA 2L9WA 3ISND 5A6PA 3VZHA 4YB7A 4DL6A 3EMTA 1F60B 2DNLA 3QQCD 1S76D 2ZVSA 2GZOA 3GCXP 3P8BB 4KKOB 2VQFJ 4QWEA 3TAMA 5EX0A 5IFMA 1X4FA 3H98A 3M30B 4I64A 4PQUA 3KMSA 2DGUA 2F5GA 2OSRA 2XCAA 2XCPA 2BDPA 2GGPB 1UVNA 4CM0A 1FRIA 3CUNA 2YWWA 1Q1KA 2DHXA 4DPOA 2KTQA 2JHEA 4M5KA 2OH2A 3NXZA 2JX2A 5I42A 2YH1A 2A18A 1J5OB 2R7WA 2HFNA 2J0XA 3GCWP 1FX2A 1J5EF 1TKTB 4RUBA 3J80U 5LMNF 2UUCJ 4OI0A 4ZP8A 2POKA 2AQ4A 3MM7B 2XM3A 1VHIA 4UOHA 3D28A 3FCHA 3EWGA 1HD1A 4IH6A 4ED7A 4J9MA 3QJPA 4FN5A 2M52A 1ZM4A 2HVZA 4DS5A 4I7FB 1CULA 1G1XA 5KFXA 1RHJB 2W2PP 1S6PB 1CJUA 3HI9A 3KK1A 1GQEA 2RF2B 3W2VB 1LW0B 3CT9A 1AT1B 1TMMA 1IKVB 5DDQC 2WB1D 3FCWA 2F4FA 1DFDA 2XSJB 5F8NA 2QTWA 3TUIC 4B02A 3TZYA 3DOLA 3SCJE 4OYPA 1WC5A 3KJVB 1VC0A 4OIXA 5J2QB 3HZGA 1TKXB 2NYHA 3FMWA 7FDRA 2N82B 5DGBA 1JLGB 3L3CA 2CQCA 1W25A 4PPZA 4TYAA 3ENQA 3SV3A 1M5SA 2D7SA 2EG2A 1JJ2R 3CDWA 3BQ0A 3UN3A 4TY8B 3MEGB 3IS9B 3RRHA 3ZXWA 1MN7A 1TUWA 3DGVA 2QMUB 3KLGB 2YX4A 3LUYA 4WZQA 1YJNS 2NXCA 3M30A 1WDTA 4CLTA 4C0OC 4DPWA 2NPFA 3AB2B 1BWEA 1EP4B 2E1PA 5ETMA 4GMKA 1CJKB 4OV6A 3A3NB 1LV5A 2VICA 2RKIA 1SC6A 1QUVA 2E1AA 1Y4ZB 3T5KA 1P9YA 3MZIA 5AE2A 3FC9A 4PXBA 3KHLA 4DQRA 1UA0A 2BRLA 4OZNA 3D67A 3VQSA 5A8KB 1GXUA 3MGJA 2RRAA 2BR0A 3CMES 4K0KF 3CDBA 2BEFA 4UQTA 4V1Ak 5IT0A 1UL3A 1FJEB 2VQEF 4C8MA 3AT1B 1WEYA 5LT5A 3K5NA 4RW9B 4DPUA 3RB3A 3ZZYA 3TX0A 3B78A 3H8YA 2RF2A 3W2VA 4YUDA 5LSLA 1JLCA 5GVQA 2AZ3A 2BBEA 4X4OA 4P52A 1QSLA 2XSJA 1HWJA 1OO0B 2HKEA 2I5JA 4A8QA 2ZC4A 3BGFA 3KG1A 3TO8A 4F8RA 2MLXA 2DVIA 3CJSA 3KLIA 4UT4A 3C15B 2CYYA 4BLGA 1TQLA 2AJFE 4QPTA 4N5SA 2HRUA 4DN9A 1XK8A 2DY9A 1K47A 3HHLA 5JJBA 1RI7A 3QBCA 3HD1A 1ROFA 4TY8A 1DAXA 3IS9A 4JI7F 3I5CA 3ILJA 2HVDA 2JL9A 2OPQA 4ANEA 3KLGA 2J9DE 3QT7A 4OX8A 2AJ2A 1IJEB 1CS4A 2IAJB 1U45A 4PWDA 3WBZA 3CVKA 5CCLA 2VDIA 3V4IB 5J1NA 4DN0A 1S0NA 4DV3J 1KNZA 5H9EJ 3OL9A 2YNHA 4B3SF 3OFHA 7AT1B 1XEZA 2DITA 1Q0NA 1E6VB 2GJIA 1K73T 4W92B 2GA7A 3G82A 3KDNA 2VC1A 2VOPA 4LF9J 1X4AA 1T02A 2XMUA 5KG3A 4OLPA 2EXUA 2A1BA 1U1PA 5A8KA 2YKNA 4KE5A 4DR3F 2DNGA 3G2XA 2OPSB 1TL5A 1DARA 1D8ZA 4DQIA 3UD4P 5KFQA 4M5MA 2PMWA 5KFMA 2FZCB 2EFOA 4RW9A 2YPZA 1R0AB 1S9FA 5GAGU 1FNOA 2HQIA 3BH7B 1UEVA 4LFAJ 4PG4A 3MM8A 5IQQA 3LP1B 1QSSA 4F0HA 1WNEA 3I96A 3H5SA 2WAQD 4OZJA 3IAM9 1VK3A 3THPA 2NSCA 4YB1P 4A8KA 2O01C 2CIMA 4A48A 4P72A 4LF1A 3DLKA 3FKBA 4EZ9A 3D6MB 3W8PA 1E6YA 1WEZA 1RLDA 4CLSA 1VQ5S 3R7BB 5F9NA 2WOMB 1N32J 4ZJOA 2DNNA 4AQYF 4EZ6A 1ZETA 4DLGA 2B9XA 4PXEA 4MK8A 1T95A 4LF6F 5CXTA 2HZVA 5KFSA 2DISA 2GAGC 4K4YA 1QE1B 4ZKAA 5BYSA 2Z4PA 3RW6A 2QLJB 4K59A 3PO5A 3P3DA 1M1KT 1MMNA 2NZ4A 4KFBB 3I87A 1KVIA 3MPVA 1N5YA 3MR7A 2OKQA 4KGZB 2B8PA 3RBXA 1REGX 1KP6A 2HBYB 4HACA 4IDKB 4RNHA 1OS5A 9ATCB 1UWBA 4CNYA 3JSMB 1YIJS 3MMJA 2MTLA 2MJUA 1VBZA 4ETXA 2AV5A 2ZITA 3W5XA 2GQ2A 1R8AA 4KO0B 1H38A 2MGZB 2B8QA 4MKBA 2OSQA 2W9AA 1TU0B 5K20B 1DBDA 5K5MA 4WWSA 2OPSA 3MPYA 3M8SA 5F8JA 4LR7A 4C6AA 2MEWA 1T3NA 2JEGA 2DCUB 2GV1A 2DB1A 3LWMA 4ANDA 4ID5A 5DS7A 3M6WA 5KFOA 5HQLA 3J7A1 1QJHA 4I56A 3T1YF 1XMOF 4E2FB 2KT5A 2LEPA 4IFYB 2Z2YB 3WIVA 3J81U 3FZBA 5F8LA 1CJTA 3BO4A 1LWCB 4C3MA 5F41A 2QLXA 4LFCJ 4ED2A 1Q7YT 2HS0A 1KEKA 2FHMA 2CVEA 3G87A 1PC5A 5E3AA 3GWCA 4B9MA 2IRXA 1EIYB 3Q8UA 4QCLA 1FDBA 3FEZA 2DNRA 3SCKE 4PEOA 1S1XA 4NLSA 1C4AA 5KFAA 1XMQF 2WB4A 2YQ3A 2JEIA 2DR8A 4UF4A 2VBXA 5ETVA 4DV4F 3OVBA 1U1QA 2VG5B 1OMSA 3B82A 1EJ7L 2EW9A 4P71A 4DL4A 4QIGA 3IWNC 4ZVGA 1W26A 2IJNA 4IDKA 2G4BA 3BSAA 4MYTA 3DRRA 2IHR1 2V2ZA 3JSMA 3HM9A 3OQ2A 1VQPS 3OPKA 4J5OA 2LLZA 2VQFF 2HHXA 3LAKA 2ZWPA 3AXMA 4NXNJ 3TOQA 3NWGA 4HDHA 3IM8A 3R7SB 2VHGA 2EEYA 2HQGA 5LJ5Y 3I82A 5J2MA 2IM1A 3OVSA 3QJJA 5D4PA 3MM5B 2X1FA 5CCMA 2FHJA 2QSWA 4W98A 2UUCF 4A4JA 4NLDA 3W1YC 1Y3KA 4CH0S 3FDSA 5J1EA 2AD9A 4DSIA 3O2IA 4DR6J 4OHVA 1WKLA 2D74B 2AYGA 5ETNA 1NH7A 3O44A 3A8KA 4MIAA 3SQGB 4FXWA 3UDEA 4LBIA 4IG3A 2I6WA 4ALZA 2WK4A 2CDQA 1VLYA 2FPHX 2VKZG 4B08A 2W4CA 3CIZA 5F0WA 1WD6A 2QJ3A 2BA9A 2HGNA 2AGOA 1U1RA 2KG1A 4NLRA 4FYXB 3K5PA 2DR9A 2CNOB 5KG5A 4ES2A 4M95A 2CJYB 2H1YA 1TL7B 3G6ES 4J9UE 4ENOA 3JB9k 1WF0A 3JTNA 5HL7Q 2BKPA 4TVAB 2XS2A 2YQ1A 4QW8A 2IMOA 3OXGA 3D2WA 3RAXA 3W63A 2ZNZA 2NS1B 3VVTA 3K7RA 1B0VA 3MCMA 5DG8A 3Q83A 4IH5A 4NX9A 4MT1A 4USWA 1VBYA 2W2OP 4N8NA 4LQ3A 4DX6A 4MK9A 2DGVA 1XR5A 5EN1A 2F63A 3KLHA 3CF5Q 3RB0A 1U25A 2GX8A 4NWBA 3Q86A 2H54B 5D0EA 3T1HJ 4YB6A 2CQBA 1RUSA 1FTCA 1XNRJ 1OY6A 4G1IA 2DIUA 1UP1A 3ADAC 2LQJA 1WG4A 5I4MA 4WE1B 1TL4A 2FJWA 1PAUB 3TI0A 1P1TA 3GR1A 3GIIA 2IM2A 2GC8A 4C8ZA 2HGLA 1ZPVA 4DV6J 2I0XA 2AP6A 2Y1IA 1RU1A 1BD6A 4O4GA 2OEKA 4R0EA 4U95A 1JX4A 1WWHA 2F4VJ 4G3IA 3NEKA 2OUGA 4FXDA 1S1WA 3UR3C 3JQMA 3ENAA 3I9V9 1KRPA 2CA9A 2C22A 1KVJA 4OZ1A 2YWFA 3GILA 4A8XA 3SQGA 5EUHA 2CG8A 1RWVB 3HT3A 1SB6A 4RNFA 4WTYA 4FXVA 4B9UA 2EKYA 5ETTA 3IR6B 2B9YA 3V6KA 4ZPTR 3KWMA 3ET6A 1GMWD 2UXCJ 4WK1A 2FGOA 2NXNA 1WORA 3RBEA 3X1LB 2J0SD 1CC7A 2F9JA 3JAMU 1FXLA 2VIHA 4DV7J 1LWEA 3FK4A 4A46A 4HYKA 1UVIA 1TL7A 4DI6A 5JVGQ 3FSXA 4JI6J 4EK2A 1KQKA 4K4VA 4UOGA 3ZZ0A 1D9AA 2K8GA 5CYQB 1L3VA 2GO8A 4U8VA 1URNA 3A1YG 4FYDA 1Y5IB 3KLEB 3M2VA 4AL6A 2E5HA 2NPIA 3PV8A 2RMLA 5D0GA 2A3JA 2ATCB 3K8WA 3PTWA 4Y2IA 4EI2A 3IM9A 4DQPA 3MI7X 2IBOA 2QT7A 1X4EA 1SBRA 1QDUB 2AWZA 3BS9A 3LH2S 4OHWA 5KFHA 1SUQA 4YMEA 2O3DA 4DV3F 4KBIA 1N54B 2R8HA 2GHVC 3W60A 4OL8A 2DHSA 1F9HA 4MAKA 2WHOA 4WE1A 1RHUB 3ZNJ1 4WKYA 3M8YA 3PEHA 2OO4A 1S6QA 3MMAB 1DY3A 2ADBA 1OY8A 3CDUA 3HVWA 4LF9F 2JH3A 2FY1A 4EO6A 1R6VA 1SJRA 2LQ9A 2HBQB 2APOA 3VGUA 1T03B 3OUYA 3NGTA 3KG4A 2MZQA 3PRDA 3M8WA 1VQ9S 1N5TA 2W24A 4X62J 3I9ZA 2IDLA 4Z2XA 2GVZB 1FFWB 3MD1A 2GHPA 4E8UA 2L9DA 4B3TJ 2VG6A 2YKPA 3LTOA 2QGFB 1QTNB 4LFBJ 3V6DA 4ECTA 2E9RX 4LFAF 2HNDA 2E1RA 2CNNB 3DXSX 2BJ9A 5C42A 3DYAB 4IYQA 2WVEA 2MQLA 4ECQA 3PFOA 4QBUA 1FEEA 4AL7A 1HMVB 2VG7B 2KM8B 2ZH4A 5KG1A 8AT1B 2AYEA 1RQ0A 3NCRA 4A8YA 1OQ3A 1LK7A 3CJ2A 2ZM6J 3HSZA 1CJVB 2GQQA 1N32F 4IG0A 3BSCA 2HHVA 1M5PC 2AMCB 2W7AA 3V81B 4GVBA 2DKOB 3A8JA 4O3PA 3IP0A 3CC2S 3OXFA 1VQLS 3J7YU 5LL6d 4NRUA 1FKPB 1VQMS 4RO0A 1HFEL 3ETMA 1IR2A 3PYGA 4LF2A 4KRWA 3OFEA 4DZDA 2NSBA 2HK2A 4F4XA 4JV1A 2MXYA 5ETKA 1WKKA 2IYIA 4K50A 2UVVA 4G6VB 2UUAJ 2WVDA 3LP0A 1CVJA 5KFIA 3GFXA 1NK7A 3VGSA 4IFVA 4PCQA 3K58A 1KONA 4O4RA 2G0CA 4PUOA 1UVMA 2EC2A 3BGOP 2OHDA 2F65A 3GG0A 2EBGA 3GTYX 3GV7B 2HHUA 2JEFA 1V3RA 5A2QU 4JYAJ 2X1AA 1GT8A 2QZ8A 4ZCLA 2CQDA 1BXNA 2XZWA 4B17A 4ED6A 2V67A 3OJSA 4HEA9 2Z2MA 1FVSA 1VIXA 2NXUA 1V6HA 2ZBCA 4FYYB 2FJDB 2H3EB 4ECZA 2ZZTA 3IG1B 2YTCA 5H9FK 2ZUGA 3M8PB 3POTA 4PG7A 2A2CA 2ZOGA 3C66A 5L9NA 3KLFB 3OTCA 4OQJA 1H98A 2O5DA 1VS3A 4TY9A 4LFCF 4X84A 4KR0B 2VBYA 4TLRA 3GR0A 4H4KA 5F3TA 1VC6A 1JXEA 1CJVA 2YNGB 1VQ6S 7FD1A 1Q95G 2MQNA 1H2UX 2YNFB 1FRXA 1UFKA 1RT4A 3QT5A 1TTHB 1FRMA 4NLQA 4CO0A 1RYRA 5D77A 2BJDA 2M70A 3BGRA 1DRZA 2N7CA 1ZS6A 3NMAA 4DPXA 1N34J 3EM1A 3M2RB 1M0SA 2D3ZA 3K8VA 2RQKA 4WZMA 4NYZA 4QZVB 4QOTA 4RW6A 1C1CA 1FDNA 2B3TB 5L1LA 1AZSB 4HI2A 2DGXA 3Q8VA 4Q2LA 1UJ6A 1TVRB 4NXNF 1OQ6A 3KJNB 1RBLA 4Y2KA 3R5BA 3KUEA 3J7YI 1KBRA 4ETZA 2NREA 3NS5A 1RZMA 1KQSR 2BM1A 2IVMA 3B4MA 4MK7A 3RZAA 4Q2MA 3MUMP 3PIPQ 2VOOA 2UUWA 5H1SV 1U1OA 4EFAC 4EBEA 2XO7A 4WIQA 4RU2A 1X4HA 3D54A 1VI7A 4X4VA 1PCAA 3HFVA 2WZ1A 2IM0A 4U96A 3MOJB 2XY7A 3TRGA 3R5AA 1N52B 2LCWA 4ZPCA 4DR6F 1IBMJ 2V8PA 3J7AN 2C28A 1N8RT 4DR4J 2PO4A 4L75A 3IG1A 5M2UA 4DMZA 4NMLA 3FQLA 5AXNA 3M8PA 1YZ6A 1RAHB 3MEDB 2J7WA 4QU6A 2V8DA 2M4MA 1WG1A 3P4UB 3L7UA 2D3UA 5C24B 5BR8J 2HFSA 3QLHB 3LGHA 2ZH1A 5BJRA 3MEEA 2JDJA 5FIIA 4P10A 4LRAA 3MPWA 3EVOA 2XC9A 2R3VA 2UXBJ 3GG1A 3W3SA 1S4FA 5IQ6A 4QWDA 1JQGA 5GAEI 3EE3A 3CJTA 3W5ZA 2V4RA 5D15A 2YWKA 3QAEA 2VH7A 3N79A 4X64J 4NLYA 4XAKA 3GONA 2YWEA 4MKVA 4F36A 1QD1A 2B0GA 3V2UC 4CO2A 3G8QA 1Z2LA 2UXDJ 2CZ9A 4RW4A 3KK2B 3X3UA 3P49B 2IIHA 3C8YA 3CCMS 2ROPA 1FWPA 3S8SA 3TA2A 2R8KA 1DURA 2KVIA 1PYTA 2U1AA 1JK9B 2DIVA 5K8PA 3T1HF 1RKJA 3TUPA 4Y34A 1XNRF 2CPYA 5LOQA 4LIRA 1Q82T 2DT9A 5CAAA 4I2PB 1QY7A 2JLGA 1HI0P 1B99A 1NXIA 1S59A 3OFGA 1S1UB 2AZ1A 2WSEC 4DV6F 3BM7A 4I2QB 1HW8A 2XMVA 1LFWA 3FSYA 4OFZA 2KT2A 2QYGA 3TJ8A 2DK2A 3CCQS 1X7VA 3MMBB 2F4VF 2F1FA 3MF5A 3OFFA 2JRSA 2RVJA 4ZVQB 3D6TB 4KGXB 1VMBA 1HHTP 5HVHA 3VZIA 2Z0GA 3M32B 1SKSA 3NP5A 3W66A 4DF8A 3FBCA 4DV1J 1M1HA 3MEDA 2ZUAA 4N41A 4ZVSB 1SQEA 5HQMA 4DSLA 2IY5B 5C24A 3ELHA 2UXCF 4O3OA 2ZBIA 1PGZA 2IBKA 2KL8A 3N6MA 1KC8T 1N0VC 4Y0FA 3N28A 2IC3B 2R8GA 2PT0A 2D3OR 2W9CB 3PRBA 4RLEA 5E2QA 4V19X 4XO0A 1ZZFA 2ZH3A 1HQ2A 5KFBA 4X4PA 1FJ7A 3ETOA 2CPDA 4FPIA 4X4NA 4JI6F 1AXQA 2E5GA 1HQUA 3NGRA 3BN7A 1T9XA 5ETPA 5DRKA 1JLQA 2P6TA 3OW2R 4DV0F 1U8WA 2K3IA 3LA0A 1JXLA 3DFEA 4WK3A 1NZAA 2WTFA 4ECWA 4F4AA 2AJ1A 3KK2A 3NBPB 4NASA 4CWBA 3KYLA 4YDDB 5L1KA 4NI2B 3FBEA 4JP8A 2W25A 4ELUA 5C5JA 2VF3A 4RW7B 4RUAA 4ELVA 2XNQA 5CABA 3FEXB 2OELA 2UVRA 2BQ3A 1YKWA 2MLZA 3LQVA 1PBAA 2HPUA 4FVMA 2YKQA 4LSLB 4I2PA 3KUGA 4PWWA 1R89A 2HHWA 4HVZA 2EWHA 4XDDA 3OHBA 1HHSA 1MWZA 4AXIA 2V4JB 1XBWA 2KFZA 1H7WA 4DR2J 1YLXA 5DM6Q 3MMBA 3PYDA 2M88A 2Q6CA 4UQGA 3MTKA 3BKFA 3OV7A 3CC7S 2HLUA 1L3SA 3NGKA 4MH8A 3R2CJ 1LEOA 4X62F 1GX6A 1APSA 2CDRB 2FLOA 4K8RA 3MMCB 2F40A 2WONB 3D4JA 3KK3A 4B3TF 2RQMA 2QA2A 2VD3A 1ZM3A 3K5OA 1XC9A 5CQGA 3O8WA 3TJ9A 2Y1JA 5MAOA 1U47A 1NPKA 4DEZA 4YHHJ 4ZIVA 2LMIA 4LFBF 1FD2A 3N6NA 4WTOB 4C48A 2VFUA 2IC3A 2W9CA 1P1LA 3DGPB 1VQSA 5ETLA 2RH3A 3HVRA 1PO6A 2FHJD 1WI6A 1FD8A 1U1MA 2VU5A 3BQ2A 3CSKA 4PQAA 2D69A 4FF4A 5DZ7A 1RWUA 1F2GA 4L76A 1EQ0A 4K2JA 5KFPA 3RG6A 1JNZB 3OL6A 3FRZA 2ZEJA 4Y3CA 1YJUA 2KT3A 4EGLA 1FERA 4AYBD 1F9EB 3M2UB 3B8HA 1RAEB 4KC5A 5IC6B 2BANB 3NBPA 2YWGA 4C11B 3DRXA 1RT3B 3PHEA 3BR9A 2QV6A 1FNXH 2ZOMA 1WSRA 4M94A 3I4HX 3EZOA 1JJ4A 3VAFA 3DRYA 2VJVA 3I32A 3PFEA 1R0CB 4KV8B 1IJFB 4LSLA 2FIUA 2UUAF 1TUVA 1W2BR 3RW7A 5L1JA 1JLBB 3A8EA 1U2CA 4WXOA 2W9BA 1L3TA 3QNWB 3CPWR 4OZLA 3MD3A 2KKHA 3F73A 2FDNA 2D41A 3JSBA 4FKXA 1V9OA 3GZ7A 3ZZOA 2QLWA 2OJ3A 3EGVA 2ALZA 3THVA 1RGVA 4JYAF 3CCZA 4TKTA 1ACMB 2VKRA 3P96A 3W2WB 3D5MA 1S10A 2XGPA 3PJ9A 1RHQB 3I56S 3MMCA 2WONA 1WOPA 2UUBJ 2MQOA 4ZPDA 3ZZTA 3PKMA 3CMQA 2D3O1 1B4SA 1VRQC 2GW8A 2W7PA 2P9GA 3BREA 4P2XA 1X8DA 2YNIB 4ZVRB 1YBAA 3UD5A 3KDOA 3DGPA 4F26A 1RTZA 4Q5VA 1JKHB 1G7CB 2DO0A 4WP3A 3FMBA 3PJWA 3ZTSA 1IQTA 1ZBTA 3H90A 1M5OC 4P9SA 1RT6B 2XY5A 5H9EK 3IMQJ 3QJLA 2HSEB 3N6LA 1ZA2B 4RL1A 1WJ9A 3HHNB 2DD8S 3JQKA 4R8UA 4HI1A 3EJMA 3AXKA 3IWXA 4C11A 4NCGA 1NK5A 1RT3A 3ONQA 2Y8YA 2KXFA 1N34F 2HHPA 1RWMB 1VQ7S 3MM9A 2HAFA 2MJNA 4X4UA 1I51B 3H5YA 1H7XA 3TEGA 4G1QA 1RU2A 4JV2A 4B3OB 3Q89A 2P8IA 1X5PA 2MKKA 3BBBA 3DLEB 3M9OB 4ZP9A 2V6AA 1FO1A 5B0GA 3ZZRA 2XGQA 3NOGA 2CQ3A 1VJWA 1O5JA 1RTIB 2DNZA 1YBUA 3J80Y 4P6QA 4B9NA 3U1MA 4I0WA 2ZJRQ 4URGA 1LNQA 4NMXA 1M5HA 2CQIA 2QG9B 4RR5A 4HT7A 3GB0A 1HBNB 3NNAA 5KTQA 3W2WA 5F9LA 3T9ZA 3C46A 3MTJA 4Z7YA 4QYZK 4DG1A 2AKWB 2HZCA 4M5GA 2KG0A 2J6UA 3DKDA 5FDLB 2MHNA 1IBMF 3W8GA 4CTAB 4DR4F 4OX6A 3LPYA 4K4XA 2MKSA 3GJSB 3PACA 4OZ3A 4F02A 5HQ8A 4NCAA 1YHQS 3TVYA 3RBDA 3FJ2A 1TL1B 4ZP6A 1NK4A 5KG6A 1O51A 2H4WB 3MM6A 3GPAA 3GYXB 3H5UA 1WHYA 3I6PA 1NPRA 2VPYB 1WHWA 5BR8F 4J9PA 2KYZA 4IH7A 2RNEA 1ULRA 5C25B 1U0SA 1HWLA 5CYMA 3TZWA 2W2MP 2EFNA 2BJ1A 1MW7A 4Q8FA 2BJ8A 3MEKA 2UXBF 3HSJA 2LU1A 1S6OA 4M63A 1FTRA 4MFBB 3RR8A 2N4CA 5L1IA 3BKTA 3UO0A 4USKA 3NY0A 3BSOA 5IT9U 4PG8A 4OJGA 4ZCIA 4PRFA 2XWYA 3AJ2A 3T5HA 2MQPA 4M8LA 3Q22A 4KH0B 2UV8A 3L4BC 1IKXB 4HTJA 4MKYA 2FHKA 1N0UA 2XLJA 3BDPA 3OLAA 2R9LA 2DO4A 1TK8A 3CIMA 4QIWD 2J5AA 4DLEA 2ILZA 4YY3J 5FLXU 3CEDA 5T7LB 3C6UB 4YR2A 4C8NA 3IWLA 5SUHA 4LF7J 2V8GA 2AYMA 2O67A 5DETA 1ZM2A 4F3OA 1Y00A 3H2LA 2UV8G 1HNVB 3PHTA 1FK9B 3RRKA 5FJ4A 4MIWA 9RUBA 3F0NA 3BZQA 3NGUA 3IBWA 4QQBA 4H4MB 3CGIA 3BB5A 4JI2J 4XK8C 1NJXA 1RTHA 4J9RA 1YQHA 1SI9A 3UNGC 1JJCB 2V50A 3R5JB 4ZLNA 3H20A 4DV1F 4L72B 5KFFA 1S72S 2CPEA 4O3NA 5KT7A 4LSNB 3DM2A 2M8DB 3QSYB 1UW4A 3CD6S 2X1BA 4C4WA 3UCUP 2EBEA 1MROB 3MHYA 3VAIA 2Z8QA 1LKZA 4ZIWA 1S9GA 2QC3A 3Q23A 4WIIA 3AHPA 1S9EB 1RWWB 4C9DA 5EWFA 3UNYA 1SCJB 1TL3A 3SXLA 3EXCX 2DPJA 3DCAA 2EFVA 4MFBA 3T1AA 3TVKA 1UFLA 1RTDB 1MLAA 4J37A 3ISNC 1RHKB 3ULHA 2C3YA 2DHHA 5J2NA 2PIIA 1NJWA 3OHAA 5K14B 2RAQA 2MHEA 5IV3A 2AEFA 1YVFA 3Q8QB 2BACA 4KPYA 4DX8H 1KHWA 4DL5A 4LVOP 2CJXB 4L3NA 3QFWA 2M0GB 4DX5A 2XYGB 4E0DA 3G6VA 5G0RB 5T7LA 3C6UA 5HMZA 1YJ7A 1Q79A 4F04B 4LRCA 2JVOA 2HNZB 2WSCC 1KFDA 4ANCA 1IM6A 4DR1J 1AW0A 3HVTB 3NMRA 3JYTB 1VQNS 1WHVA 1FK9A 1NJZA 2ZH8A 3C16A 1QAXA 2DCLA 4DR2F 1S1VB 3DRPB 2XS7A 4ILMA 1FKOA 1ZTWA 5B7WA 5I3UB 1UAWA 5JVHQ 4KIAA 3JS9A 4CO1A 5E3CA 1ZZNA 4EEYA 3C14B 3WIUA 4Y00A 5I3QA 1Q53A 1KWMA 5KFGA 3W9HA 1RWPB 2IRUA 1QTMA 4OYAA 2EFGA 1X0PA 3HFZB 4TU9A 2K06A 2HMIA 2FJEB 1V3ZA 2BOAA 2ASJA 5AJ3J 3H59A 2J8AA 4YHHF 4RW8A 4PWUA 1LQ9A 3RB4A 2DXFA 3M1VB 2PEBA 2NZCA 3FFIA 2QYCA 4GVLA 3DLGB 4A47A 4H4OA 4TNOA 2IVFB 1L3UA 4O0NA 5B0AA 4TQRA 1S57A 3R97A 4NEZA 3RAMA 4P2FA 1NB7A 1M1GA 4Y65A 4JB8B 4FF2A 4PYDA 1WC0A 2GNKA 1IKWB 3CJRA 3GJTB 4YOEA 3HD2A 1G3OA 3ZZPA 1NPPA 1VRUA 2OAUA 1P27B 1NLKL 4WJBA 1IR0A 1RT7B 5K14A 4DFKA 2ASYA 2XMMA 2BQRA 1DTQA 1FJCA 1C1BB 1Y10A 5DDOC 4LF5J 2G0IA 4RPFA 1Q7LB 4TYBA 2RQ4A 5BYQA 1RT2B 2BMBA 1RWOB 2LU2A 1S7IA 3EDRB 5HMXA 2HNZA 3M7VA 3UN2A 1XJWB 2B7CB 1N6QB 4Q0BB 1VOMA 4J9OA 1T9TA 3E01A 4NCBA 1YJVA 1S0VA 2RT3A 3DDIA 1LFPA 1EETB 4QU7A 3EPGA 2HWHA 3OR2B 3I0RB 4ZA1A 4O3SA 1SXLA 2L08A 5I3UA 1HYSB 1HQEB 1RAFB 2CJ9A 2HNYA 3ITHB 3MCNA 1U0HB 2B51A 4F7VA 2I1RA 3J81Y 5A8WA 3FRYA 4KHRA 2UUBF 5T41A 2CQGA 1S1TA 4CO5A 2FUG9 1U7LA 3KNGA 3BF4A 2FD2A 4L74A 1J27A 3G96A 4JI8J 5LJ3Y 4OYXA 1H73A 5E0OA 1VDHA 1RP5A 2BW2A 4R5PA 3G4SS 1Q78A 2HIQA 5A8RB 5CYJA 3DOMA 5IXUA 4KHPJ 2WBMA 1NCLA 3JTOA 1TP7A 3DRSA 5LSRA 3F56A 3CCSS 2DR7A 5KT6A 5K8MA 5L38A 3MXHP 1UVLA 5HVFA 4LJMA 4C98A 5HMWA 2F8EX 2QL7B 4YR0A 1PC4A 3M8ZA 1RTJB 3VV2B 2AEJA 3UFCX 3W9JA 5AT1B 4Q45A 3QZ8A 1CC8A 3R8YA 4Y2MA 1C1BA 2G2YA 2HZAA 1BQNB 4K2XA 3IFEA 3R27A 1RT2A 4LMZA 3VGTA 5HP1B 4KKOA 3L95X 2W7OA 2CVIA 4DQSA 4G65A 6FDRA 1N6QA 2LVWA 4URSA 1NJIT 2GGPA 2OLWA 2PD1A 2ZKUA 2YPYA 3EXYA 1HWUA 4X4QA 1HA1A 3CJ3A 1H2VZ 4YEAA 1VK8A 4NZ6A 1J5OA 2EFQA 2KJWA 1NH8A 2VPWB 1HKAA 1HQEA 1TKTA 1X5TA 3TYTA 3M9NB 4P7TA 1CPZA 4B3MJ 2RUSA 5DLGA 1GX5A 2ZDPA 1U0HA 2ROEA 2VFSA 2CWKA 3MM7A 2CPZA 2R7VA 1VQ4S 5IS2A 5KOXA 3G9CA 2KZZA 1N5SA 3MPDA 4DSFA 2BUNA 2LXFA 2HFOA 4I7FA 3O3LA 3HP6A 3HHKA 5HROB 4LRBA 2CRLA 1S6PA 2B4VA 4DL7A 3M8RA 1MU2B 3BBCA 1KS2A 1LW0A 1A9NB 4Z37A 4DV5J 2GVDB 1IKVA 2R2SA 1NO8A 3SSQA 4ZJLA 1T8EA 2C2KB 2V94A 3V4MA 4ZP7A 3DHWC 3OVAA 1PKUA 2Z2ZA 4CLYA 1QSYA 4HTIA 2Y0BB 1WTFA 3KJVA 4JV0A 2NUUG 5J2QA 3M4XA 1NB2A 2CPXA 1BWVA 1TKXA 3US5A 2E1MC 1JLGA 3RGIA 4CT8A 4RKUC 1YRTA 3UN5A 4J90A 1JJHA 3CMAS 1GK8A 4OHYA 3AJ1A 1N4LA 4TLQA 2F9DA 5B09A 3JSYA 1WF1A 4JBCA 3V5RA 4CYUB 3MEGA 1P8GA 3D0HE 4KGMA 2FJXA 3G6YA 5B0BA 5HP1A 3RJMB 5F8GA 1DQ9A 2UZAA 3SEOA 3UQSA 3TAPA 3GP9A 2HQCA 5KT3A 2YKMB 3T41A 2KB2A 2XI3A 1B7YB 3PVXA 1EP4A 2MY7A 4NLWA 2QEXS 3FCVA 1CJKA 3K57A 3L9ZA 2XWXA 1RBOB 3SCIE 1OIAA 4IQMA 4OI4A 4CRJA 3OD2A 4LF7F 2XZDB 4J9LA 1R7IA 2G9OA 1EARA 1YRXA 5D3GB 5EWEA 3Q24A 4UZBA 4RWWA 2L41A 2IDEA 2HHQA 2NYIA 3S6EA 1VFJA 1DTTB 4F2SA 3GIRA 1S0OA 4CO4A 3MURP 3VAKA 4NZ0A 5KFEA 5HROA 3D3CJ 5T14A 2OTLS 1DQAA 5JXSA 1RABB 4GKKJ 1NUEA 5D0HA 5GADI 3JAMY 3RR7A 4OYIA 1MU2A 4OJ3A 4USTA 2XNRA 4OYOA 3RRGA 2LEAA 3DU5A 4DHVA 3DOKB 1FDDA 4O23A 3IN5A 3D0GE 3ZTOA 3FEYB 1U6BA 5IM0B 4UY85 4EBDA 2ZC3A 4J9SA 4C2MA 1JLAB 2K1RB 3G71S 4N56A 2FC9A 2A0FB 5HMYA 3BO3A 2HWIA 4UY8T 3KXDA 3HDSA 1TAUA 3SSRA 4CH1A 3CE8A 4QYZJ 1Y0HA 5U47A 5HLFB 2YKOA 3C15A 1NJYA 5HO4A 5G4DA 5D8HB 2P9EA 3FZ2A 3PZPA 1QUPA 4KGVB 2ZBQA 2HURA 1I1GA 2C2NA 2JC0A 3MDFA 3EYZA 3MPUB 1IVZA 4RZRA 5LMUJ 2JOQA 3I31A 4DUTA 3MFIA 3ZTRA 3IRXB 4KB7A 2KYXA 4U7UK 2P6SA 4EU0A 2IAJA 4ZVEA 2YKMA 4KPCA 2Z58B 2I2YA 2Z30B 2ZHOA 2G1HA 4CQ1A 3V4IA 2XMKA 2FVQA 2YX1A 3HX9A 1C0TB 3NKYA 2V68A 5LXRA 4ED1A 4ICLB 1NDCA 3T3FA 1E6VA 2HVIA 1T7PA 1T9UA 1M5VC 4F3MA 2W2QP 1JLEB 4DR1F 4I68A 2KO1A 2I8EA 3UVJB 1IWGA 2HS3A 2OIHA 1JB0C 3LGMA 2HQFA 4P74A 1DTTA 3QZ7A 1JLFB 3S7RA 3AA8A 2CQHA 4JI4J 4FBTA 1FRKA 4ZCMA 1PILA 3HHEA 1T05B 1QM9A 1R0AA 1R31A 1B64A 2N4DA 1DJ0A 1RHMB 1LWFB 3OLBA 2HGMA 5D4OA 4J9QA 5DLFA 3LP1A 5AJ3F 1HBMB 5KFLA 2OMLA 4OZ2A 2X7IA 3MR5A 3OTBA 1NDLA 4DPYA 2R7SA 2RHSB 3CJ4A 3TX8A 5IM0A 2VC0A 3GIJA 1JLAA 4ECRA 1I3OB 1KOOA 3QIDA 1HW9A 4DFMA 1K9MT 1QAYA 2D9OA 1J2VA 3MR6A 1VBKA 2WOMA 4O44B 3SDEB 3MR3A 1TZ0A 2XG8A 2BE2B 3AFGA 3CJQA 4IRCA 4M1KA 1Q86T 3M9MB 3EICA 1SL0A 1HNXJ 3DLJA 5AE1A 2B43A 4ZVFA 4IUFA 2IRYA 4X4RA 3R5CA 3EX7B 3DU6A 1FHTA 1HBUB 1QE1A 5KAKA 1MG7A 2MKYA 1M90T 1DLOB 3BEGB 1GEHA 4B9VA 3G86A 4KFBA 1TKDA 5DQGA 4HDGA 4RX6A 5ETSA 1CQMA 2JJ4D 4LF5F 3VQTA 3G8TA 4F4WA 2DGWA 3LP2B 2ZVIA 3MECB 3C19A 4DFJA 4LVNP 4DU7A 3QIPB 5A2QY 1Y5LB 5KFDA 3SFGA 2WVFA 2YWHA 1FX4A 4F0MA 4USMA 4A8FA 4TXSA 4KO0A 2MGZA 4KJIA 1SJ1A 1N88A 1V3SA 2BQUA 4I6AA 3T5LA 1UJ4A 1HLWA 2KHCA 3AD8C 2DBBA 3NGSA 3UVJA 1R6YA 3K5MA 4YQWA 1XIQA 4ZHRB 2E1CA 5F8IA 4YP3A 2I38A 1JLFA 1U4BA 4X2BA 3C3LA 2B5JB 1R8CA 3TQEA 1KLMB 4ZOSA 3VTIA 4OI3A 1SJ4P 2DR5A 4RUHA 1RISA 3I0SB 4O3QA 1T05A 3B4DA 2HRTA 3LPEA 4TU7A 1R8PA 2VODA 4WFBQ 4DU8A 1S77D 2ZHAA 4ZVUB 5DM7Q 3ILOA 2GJ2A 5GMKa 1SC1B 2R8JA 2VFRA 4IFYA 4DR5J 4OX9J 2OPRB 2OPPB 4FS1A 3Q2SC 1P9QC 3E3XA 2HRYA 1LWCA 4QIVA 1HWIA 3LWLA 1X31C 2L48A 1S4EA 4KHPF 1HNZJ 1Q81T 2UVUA 2W1BA 5A0YB 2ZJQQ 4C8OA 3R9LA 2C3MA 1DQ8A 4O44A 3F44A 1S0MA 3AODA 3T19A 1WOSA 5J2PB 1N5VA 2CNLB 4NXMJ 5KFCA 3NS7B 2PEHA 3PNIA 2HS4A 1AUDA 2PGCA 2GFFA 1QLNA 5E3RA 1HPZB 1HBUA 4OHXA 4XPCA 1TAQA 4ER8A 3E2EA 4WFYA 4JI0J 2FLNA 2CNKB 3HMJG 3LOUA 1PYOB 2VG5A 2Z56B 2ZFHA 2YQ0A 5CHCB 4F4YA 4WYLA 2C2ZB 2KRRA 1U24A 2ZKTA 3PR5B 3LP2A 3TAMB 4QYRA 1UA1A 3BR8A 5DO2A 3MECA 2DH7A 3OTDA 4CLPA 4KQZA 1HNWJ 4PQUB 2OGUA 4FNHA 1CBKA 5C2GA 1REVB 4P2MA 1VCTA 3MM5A 2OD6A 5B0FA 5I42B 2H5JB 2RSQA 4M5IA 2N7YA 1RK8A 3PW0A 2ACMA 4CNZA 2BXJA 1G2EA 2MY8A 4WU2A 3GIKA 4B3MF 2HIYA 4URQU 2DNOA 4TN2A 4QWBA 1UZDA 1YWXA 2JNJA 1JWWA 2JFKA 2FGCA 3S01A 5A76A 3F41A 2QL5B 3HZEA 1Z1ZA 1HI8A 3T1YJ 3G6XA 2XB2D 4D3GA 4KT0C 2HHTA 2OPRA 2LDIA 4X65J 1YJ9S 3KK1B 4CIOA 2LECA 5F0UA 1UPPA 2LDYA 2C3PA 3ENVA 1BE4A 3MAQA 5A0YA 4DV5F 1GXLA 2J6TA 4Q8EA 4A8OA 5IZHA 3ZNUA 2U2FA 3AD7C 1DZ5A 2VUGA 1IM4A 4RJVA 3A4TA 1IUJA 3AJDA 3K5LA 2KFNA 1H72C 1HPZA 1NNDA 4OI1A 3D0IE 1GFWB 1X4DA 3TP2A 3TZZA 2C3OA 4E98A 4WP8A 3EGWB 4NE9C 3FGVA 4OYMA 4M5JA 2L9NA 3SZ2A 1T9YA 1SPBP 4DDFA 2XULA 1I6JA 1EQMA 3DLHA 4WBFA 2EFPA 4U7CA 2NCKL 1TR0A 2LQ5A 3SV4A 3R6LB 1QVFR 1SH2A 4LBPA 3DDNA 2H5IB 1REVA 2E7WA 2ZH7A 4AE5A 1VLOA 2RKIB 2C2OB 3ISZA 3EDQB 4RBUA 1S5ZA 2XQCA 3PYFA 4JUZA 1PG5B 3U1NA 4DFPA 5K9FA 4C3KA 4YFUA 1C2PA 2DGTA 1YJRA 2KZMA 1PIEA 4YN3B 4DBQA 4UTGA 3T6BA 3KLVA 1GNKA 3GYGA 1UETA 3PX0A 2MQQA 5CH7B 3H4DA 1F3FA 1SJQA 4NLGA 3P45B 2AF6A 4ZN1A 2DPIA 1SC4B 1UEUA 2WCXA 4DOZA 2V5HG 1GXTA 1T94A 1NDPA 2CWXA 1VGYA 2LKZA 3HF5A 2EK1A 3CD0A 4GKKF 3GFHA 3KHGA 1NDKA 1JLCB 1UZHA 2IA0A 3QWUA 4C97A 2NQPA 3SBMA 4ECUA 3LO3A 4FYWB 5LM7E 4KGKA 2B9WA 2IPOB 4PG6A 2I5JB 1SH0A 4X66J 2CJBA 1SKUB 1AUSL 2Q6BA 4NZ7A 4JI1J 2DHGA 3KLIB 2B4OA 2FVPA 5CYQA 1Y7PA 2J7KA 4DXLA 1W2IA 4LQ9A 1ZA1B 3EVWA 2Q1LA 3HHLB 4B9TA 1LK5A 1XWLA 3KLEA 3PW5A 3AOAA 1GMUA 4Q44A 4C7QA 3QMQA 1R27B 4HH0A 5LMUF 2OPQB 4ZVTB 3D1QA 5GAHI 1CSJA 1CS4B 1AFJA 4RUCA 4K4UA 2J7UA 5GMEA 4PWDB 3OXLA 3NAHA 2BW7A 1K1QA 3B54A 6AT1B 2HQDA 3G8SA 1OJ4A 2YNHB 3UW1A 3LGNA 4LSZB 2XMJA 1F6TA 5KFTA 3HHLC 2BJ7A 2QA1A 3G82B 2ILYA 3MMAA 2IA6A 1BC6A 5FD1A 3OR1B 1Q5VA 3TVZA 1AROP 3CCUS 4UZCA 2FLPA 2RDDA 4IRKA 2YKNB 1QVGR 5ETRA 4WFAQ 4UOFA 4IQXA 1T03A 2BE9B 2Q66A 3R5DA 1ZPWX 2GJFA 2FYXA 2NR0A 4ATNA 1X9WA 3NGDA 4JI4F 3H7HB 2GVZA 5KFKA 3CCRS 2QFJA 1X9SA 4LT6A 1AFIA 4DL0C 2HW3A 1FWLA 2EKNA 4BBYA 5EHHA 3VF0B 1VYAA 3MM8B 5AXKA 2DH8A 1RACB 5IV4A 1GH8A 1RBAA 3GYNA 5GAEU 3DYAA 3TWZA 3CO9A 4USHA 1NHVA 4PKDB 1HMVA 2VG7A 3KJFB 3DLKB 2CFXA 4XTTA 3IC1A 2RJZA 1E6YB 3Q8YA 3D7SB 2DEJA 4IKAA 4ES3A 4F2RA 3R1LA 3K59A 2YVSA 2CQPA 1HNXF 3V81A 5IOLA 3P5TL 5HSPA 1FKPA 1U26A 5F8HA 4B3RJ 2CPFA 3OTOJ 3J81j 3M8QB 3WX8A 3PJXA 4K4SA 1N5YB 1RDRA 4I67A 1VQKS 3LALA 2IM3A 2COLA 4MJKA 4HACB 3WC0A 1YX2A 1UWBB 4ES1A 1PJ7A 1ELOA 2E66A 2M5YA 3QRQA 1VBXA 2AJ4A 1FVQA 2IMWP 4GKJJ 3HK2A 2ZHBA 2C2RA 3I4PA 2VB6A 3KG0A 3OT9A 1FEHA 2FY8A 2OTJS 8ATCB 5D0RA 3OR1A 4YDXA 3AD9C 2PN6A 2ROGA 5CZXA 1EAYC 3HHLD 4R25A 4F25A 2LFVA 2ZH6A 4U8YA 2GIFA 4M5LA 2FTRA 4XDCA 1VISA 1X5OA 2V4QA 3C6TB 1YRUA 4YS2A 1OPZA 1ITPA 4ID5B 1S7HA 2KFYA 5KT2A 1V5IB 2BYCA 4EYHB 1NAQA 1U8SA 3ZC4A 4OX9F 4DR5F 1CJTB 4HLBA 4I69A 4FNIA 3KLFA 1U2FA 4PAAA 3AB4B 2QN6B 1HNZF 3EGZA 4DJBA 1W7WA 4ED0A 2YNGA 4LF8J 2GAHC 4FDFA 1KKHA 2HAIA 3QRPA 2BABA 3BYRA 3FVYA 4K4WA 2YNFA 3W64A 3AY0A 1RT5B 4MYUA 5B0EA 1S1XB 3CCVS 4NXMF 2R4FA 1IN0A 2BE7D 2PI5A 1D3WA 4LBHA 4FVCA 3MWBA 2BKOA 5KFNA 3D3BJ 3HULA 1UJ5A 3M8QA 4NRTA 4JI0F 1FRHA 1YG0A 3FBBA 3QAUA 2LQBA 3M2RA 2VDHA 3KKFA 3H2VE 1HHQA 5M2RA 1XR6A 2J9DA 1SKRA 3DRRB 2QE5A 2KDOA 1AZSA 1HWKA 2C2MB 3DHXA 4KYZA 4P2SA 5D78A 1HNWF 1TVRA 2J0WA 4QJVA 4HKQA 4MKAA 1QAIA 4G1PA 2CQ4A 2OMOA 4FF3A 1Z2ZA 1UWAA 1TKZB 5J2MB 4GC6A 4K5RA 2HFZA 1H0HB 2F8HA 2QIFA 1ZTTA 1R0BG 1U6FA 3HPOA 5HBMB 1Q8IA 2OP5A 1YSJA 2MMYA 2RIJA 1NKBA 1RSCA 1VRTB 5J1EB 4ERDA 3C6TA 2G0JA 2FVCA 2EC0A 3VAMA 1FRLA 4N47A 2YXLA 4LUBA 1WC3A 1HR0J 4IG3B 3CJ5A 4JI5J 3KHRA 4M5DB 1F2HA 2MDAA 5DG9A 4J9NA 4DCPB 4ECYA 1MMDA 2AHOB 4D3HA 4X65F 3N9UC 4RU9A 1OSDA 2RRBA 4WFNQ 1SC3B 1T9WA 3QLHA 4BDPA 4ZLJA 2Y8WA 3H25A 2H9ZA 2RUGA 4ZPVR 5ETQA 4OMFG 3NNCA 4CO3A 2QL9B 3A3PB 4RBTA 3TNVA 3SIPB 4L3KA 2ZOFA 4NOHA 5GAGI 2WRMA 4DV7F 1RT5A 4MMOA 3BH6B 5K8OA 5IT9Y 4BS2A 2G2OA 3HLUA 4ILLA 3GSDA 2MSTA 2B56A 3SQOP 4OZ5A 1KD1T 2MZ1A 4RNMA 1ZYQA 2JC1A 1SH3A 2V69A 3N0VA 1VIOA 3BPSP 1RT1B 3QGPA 1N36J 4QR2A 4C0HA 3CB4A 2KI2A 3VHQA 3EUNA 5KFRA 2FLLA 4IOBA 1R43A 3VCDA 3ILIA 1RLCL 5FLXY 3KLHB 1RAJA 1JMTA 4ZITA 1C4CA 4WU3A 1WDDA 1IBLJ 2VFTA 1YITS 2YBVA 4EUVA 4WCEQ 3NG8A 3ZZUA 2CZ4A 3B6BA 4AFFA 1XTZA 1EHWA 1TKZA 3O1LA 5F8MA 4I6WA 4XIUA 1RKIA 2PA3A 1MMLA 3RYLA 1VHFA 2HLTA 1WUUA 1R8BA 2V63A 2H4YB 1S1UA 2QMXA 2R7QA 1BY9A 5HBMA 1Q4RA 2AW0A 5K8NA 3EVMA 4O4GB 4I2QA 4M5HA 1RCOB 1VRTA 2ZE2B 4GO7X 4Q43A 2ZJPQ 3R2DJ 1S1WB 2XMTA 1UKUA 3GQCA 3TUJC 1TFYA 4N77A 3ILLA 4NA1A 3PX6A 3M32A 4IRDA 4M5DA 5IWAJ 2RILA 3CW2C 3W5YA 4U67Q 3BYPA 1BHNA 1YDLA 3ET6B 3PW2A 2J9CA 1NSKL 4I4BA 2YY3A 3VAGA 3DI6B 1L3KA 2RS8A 2CJQA 1EX8A 2RDIA 2V2KA 4ECXA 2R7OA 1LWEB 4X66F 1M5KC 2LP4A 3GSIA 4NA2A 1T0TV 4JI1F 1G4CA 3U02A 3UR0A 3WC2A 2ZM6F 2VA3A 4EYIB 4CI0B 2E7VA 2GMLA 3CCLS 5SZTA 1RT1A 4USIA 4NLPA 3N5BA 4QPXA 2WVBA 3M2VB 3TUZC 2DTJA 2VBWA 3WQPA 2P9CA 1TK0A 1KLNA 2CQ2A 4NI2A 2DNMA 3THTA 3PW7A 2V0NA 4GC7A 4B9LA 2UP1A 1FNMA 4RW7A 3H0PA 4USUA 3KOAA 5HANA 3HFKA 1SUQB 3RU0A 4DZ6A 2CPJA 3NNHA 4Q7AA 2K7KA 2ATLA 3MAHA 1SVDA 2ABYA 1FT8A 1S48A 3D9BA 4PG5A 1SJFA 3UDLA 5E33A 1S6QB 3FSIA 4DX7A 2H5EA 2DGOA 3IR7B 3MCOA 2QX0A 2X3DA 3TA0A 1HNIB 2V4JA 3L7OA 4KY3A 1KQFB 1Y3JA 2X1GA 2E5IA 2RU9A 1FJGJ 1KR4A 2ZE2A 2Y9HA 3OSPA 3L09A 3OUYB 4FP9A 1PBUA 1O0PA 3Q8RB 3DXBA 2HHSA 5I3PA 1WSVA 1KDNA 3BSNA 3PXGa 4N8OA 3IGNA 2KH9A 3UWTA 2XMWA 5KFWA 2VG6B 4NYOA 2PI4A 4OI6A 3IA0A 4CM2A 1U1NA 3U7JA 3V6DB 2HNDB 4IO9Q 4J91A 2DNKA 5C42B 1R8HA 2C3UA 1OY9A 3DI6A 2D9PA 2AJQA 2XYHB 2FZGB 2DY1A 4O0IA 3IXQA 5D6GA 2F7VA 3IAS9 4DV2J 4C8LA 4KSEB 4AXJA 4IG0B 4EO8A 4DV0J 5KFVA 3CDEA 2QA4S 5B0CA 3IRWP 1Y11A 4KTQA 1TFWA 1FA0A 3K2YA 4GVBB 1NZ8A 4OLOA 4WP9A 3M2UA 4PR6A 3UE2A 4BHQA 2LA4A 3CWJA 1RCXB 4C3LA 1L5UA 1F5BA 2R8IA 2BANA 3TW0A 4DUZJ 5E7OB 4B3RF 3HSGA 3OTOF 1F0XA 4QIFA 4BC9A 4EBCA 2GO9A 1MWYA 3SFUA 1S49A 2JSXA 1CG2A 4USJC 3H5XA 1NSQA 3JTPA 1LWXA 4FBUA 5D4LA 3CO0P 3V6HA 1NBEB 4KV8A 2C2EA 3MR2A 1BQMB 3PDNA 3VAJA 3NOCA 4HHUA 3LP0B 3CJKB 2QSFA 3K17A 2IFXA 2WSFC 4IFVB 3HVAA 4GKJF 1JLBA 2KHDA 2DRDA 2MB0B 3MUTP 1ZAWA 2RD5C 4PUOB 1AB8A 4I6YA 1HNIA 4W4MA 2RB7A 2QMWA 2M8HA 1KHVA 1HIYA 4DWIA 2D1CA 4ZLLA 1K8AT 3TQ1A 3EZ5A 3GJQB 2LXIA 2GIQA 2MYFA 4K5SA 4J9KA 3ZO7A 1UFWA 1VQYA 1U2RA 1PAEX 3BKUA 3MUVP 2J76E 3HSDA 4Y2CA 3SMZA 3VGVA 4NYPA 2GIRA 2X3GA 3FUYA 2WW4A 5J1PA 2JEJA 5ETOA 2FC8A 4NL5A 3TA1A 5KT5A 3ZZZA 3QRRA 3HJVA 3NCPA 1KTQA 1N56A 3POTB 2JLFA 5CA5A 2YNIA 3KTQA 2PMZD 4CLWA 1HD0A 2RHQB 3AAWB 1JKHA 2NLWA 2XSFA 2H65B 1YZ7A 3BQ1A 2DXEA 2ADCA 3PYEA 2DEIA 4NLXA 4RNNA 4DUYJ 4WKRA 4PXDA 1X9MA 2XLKA 1F9FA 4J7CA 4LF8F 5D4NA 2OFHX 2HYIB 2A6OA 1RT6A 3IGVA 1MN9A 1RB0A 1RT4B 3GIMA 4ZCKA 4NA3A 4A8WA 5AXMA 3T9NA 2R2TA 3BGRB 2BX6A 2X51A 1B0PA 2Y1LB 4RBVA 2VJUA 2WW8A 2KM8C 4X64F 2CXEA 3AA9A 2ZH5A 3DLLQ 1WC1A 2PA8D 1IQZA 2ALYB 3FNNA 1KTVA 2XTJP 1NKCA 4RW6B 3SSSA 4ILRA 1C1CB 4H4KC 3H4BA 3CD7A 2HHHJ 2UXDF 4NLOA 3PX4A 1WHXA 4B3OA 2YH0A 2EG1A 2JWNA 1BQMA 1SQGA 2ZBPA 3DLEA 4DF4A 3CJKA 3PW4A 4XPEA 3CCTA 3I5AA 5KT4A 1D9DA 1PJ6A 3WDOA 3RTVA 5BXIA 1RTIA 3IBCB 2LA6A 4YR3A 4PPDA 3PCOB 3D6HB 2HQ3A 3PIOQ 4OV1A 1NK6A 2Q43A 3QWPA 2G1DA 2OEJA 1HBNA 3KJQB 3R5GA 1X4CA 3HKWA 1UCNA 1PSDA 2XBPA 3U27A 1LXJA 4W90B 4EMDA 1SL2A 3KHHA 2I9SA 1OYDA 1FE4A 4GO5X 2FJAB 2AIRB 4DR7J 1Q5YA 1SJ3P 5FDLA 1GTEA 1NK9A 2AX0A 4CTAA 1HR0F 5DG7A 4JI5F 2R42A 2XEXA 1TL1A 4ZVPB 2E7XA 1FFSB 3UD3P 3MEEB 1P6TA 1IBKJ 4U9RA 5C25A 1U48A 3AOCA 1H3DA 4JV5J 1R3NA 2BOPA 2MSSA 1ZH5A 2ZH2A 2ZWOA 3TJAA 4ED8A 4WFZA 3HHDA 1PYSB 1EZZB 1B70B 3E51A 3M05A 2DNPA 2EPIA 1N36F 2AX1A 4FKYA 2ACYA 5EWGA 3N4WA 2R7TA 1YJTA 2G13A 5KG4A 3RB6A 4RW4B 1VQOS 1S97A 1XQIA 1IKXA 1RA7A 3DNCA 2DH9A 3W65A 3W7BA 1IBLF 3NAIA 4OHZA 2KJVA 5AE3A 2GHWA 3EZUA 3LAMA 1NU4A 1XNQJ 1VR6A 1KSPA 2FZKB 1JIHA 3EGNA 2DGSA 3QFHA 4LREA 3DDKA 4F4ZA 4QR0A 5KFUA 2V9WA 1NHUA 1TV6B 3LW5C 3SYZA 2BZ2A 2E5JA 2UU9J 4IOAQ 1MSWD 1XR7A 4JI3J 2RE1A 4MTPA 3C2PA 1HNVA 2J9EA 3VWSA 4ITSA 4HHHA 1KQGB 2GMHA 4LIWA 2XO6A 4OYBA 4FF1A 2QO3A 4OI2A 4H4MA 2XHWA 4NLUA 2QLBB 4C8YA 3PRVA 1WTBA 3R1HA 2YX7A 4CLUA 2ZD1B 2V2VA 4TU8A 5IWAF 2RS2A 5DQHA 3TEHB 1O6XA 2E9ZA 2W01A 2HVEA 3GFZA 4LSNA 2B9EA 5EDWA 4DSJA 2XYPB 2KXNB 1S12A 1RAAB 2ZBRA 1AYEA 3VALA 1MROA 1XERA 1F1BB 1BQXA 3NS6A 1UTAA 1S9EA 2EVZA 2XI2A 2GCFA 5JMNA 2MZRA 1HQUB 4N7TA 1JLQB 3MCSA 3TZXA 2E5LJ 2R2UA 1N33J 4S0MA 1VQ8S 1RTDA 1SQFA 5EGYA 1LOUA 4ZPBA 1FRJA 3QO9B 2HK3A 4ED5A 3AQPA 2DJWA 1MWQA 2PMHA 3OBIA 3QGHA 1NK8A 1WG5A 2CUYA 4KH1B 1NM2A 2W4DA 4USVA 4ECVA 1UMJA 3WX4A 2JFDA 1Y5NB 4HL9A 1RHRB 4CZCA 4WFXA 4ZPWR 4FPRA 1Q8KA 1Q8BA 5HK4A 3LF0A 3AH6A 2XMAA 5G0RA 3CJ8A 3CDAA 4ZLPA 1D1UA 5BYRA 2OEMA 5MLCV 3IBFB 2DXDA 1TV6A 2PDAA 4CLFA 1RAGB 4ECSA 1VJQA 2Y0SD 4UUWA 2V2QA 3O6QA 4C0BA 1H74A 2DR6A 3HVTA 1F5CA 3JYTA 4BWJA 1SKWA 4OYZA 5ADZA 2M2BA 1FJGF 1UEKA 1S1VA 3DRPA 4CP5A 2B7BB 1JXVA 5DZ6A 1NK0A 2NXEA 3GJRB 4ZMMA 2GQCA 3M6VA 2IJRA 3NCQA 3C14A 4ELTA 4ID8A 4BCAA 2ZD1A 1I94J 5L46A 2IVYA 3KK3B 3TR5A 3PR4A 1PJ5A 2P2CB 3GU0A 2CQ1A 5DJBA 4DL2A 1X0FA 1U1LA 1U1KA 1B3TA 4QR1A 3T5JA 2W8KA 4J9VA 2DGQA 3UDVA 1A0OB 2MZTA 3M1VA 1FCAA 2DNQA 4BWMA 5M2PA 2LEBA 3QT8A 2AGPA 3DLGA 3PO4A 2BJEA 3OTEA 5DDPC 1XMBA 1TMJA 2Q3PA 4DV2F 3O5TB 2F8MA 1YBTA 2LYVA 4CLLA 2CKWA 5IC4B 4ZS6A 4CH7A 3I5BA 1IKWA 2K3KA 3QO9A 3Q0AA 1Q16B 2GMJA 2KU7A 4TQSA 1RE1B 4LF4J 2J8SA 1IBCB 2CJAA 3M6UA 2VA2A 2IJFA 1RT7A 3Q8SB 4DUZF 1KVKA 3D66A 3BV8A 1T9VA 5B0DA 2ERRA 4Y28C 2O66A 2C1EB 1IKYB 1RWNB 3R7NB 3VAHA 4ZVHA 2EI5A 3R3TA 1RAOA 4UW2A 1SL1A 4V19J 5HVGA 4IR1A 2MKHA 4O3RA 4I1TA 1TELA 2BRKA 5HJYA 1DHMA 1Q8LA 2CG4A 4FZVA 3RUBL 5IT4A 4Q0BA 2W9BB 3TANA 2J0QD 5L39A 1KFSA 3UI3A 2MZSA 1BLUA 3CCJS 1EETA 3OR2A 3I0RA 3ZTPA 2KN4A 5GADU 3U1LA 3GLJA 4ZPAA 1X4BA 1HYSA 3MAAB 1UVKA 1NSAA 1WKJA 3BGLA 3PEJA 2A6MA 3ITHA 1RA6A 3CCWA 2EK6A 2WBRA 1OPIA 3T6JA 2NXJA 1NKEA 1D9FA 2L3MA 3FQKA 4HH1A 4LR9A 2FQQB 1MNEA 2BV3A 4C8KA 2VFVA 4MIBA 4U6PA 2MZJA 4FYVB 1Z4UA 1F3VA 2DNYA 5A8RA 5AXLA 4AT1B 4PZVA 1BGXT 2MQMA 3ICLA 2KRBA 4DUYF 2VV5A 3JQJA 2V34A 1D09B 1CEZA 3ENWA 3Q8PB 4B9SA 1K44A 4ZK7M 3BJYA 2W8LA 5CD4A 2B6AB 4ZVOB 2HVHA 4R8UB 5LXYA 3OJUA 1RTJA 5HATA 5DGAA 4NCGB 3QATA 3CCES 3NRBA 2AU0A 2XS5A 4HHJA 5LSOA 3MM9B 1IKYA 3UPFA 2CAJA 1UVJA 5KG7A 4AUKA 4OX7A 4DCOB 1N48A 1EKSA 3H2UB 5THWA 4G1QB 1SIZA 1BQNA 2LXUA 3IO1A 2HHHF 1B0TA 2CPHA 3QGIA 2A10A 3PM9A 4UUXA 2CJKA 4OZ0A 2SXLA 2G2ZA 2V8HA 1QAJA 1TK5A 2O1PA 1X60A 1RWXB 2Z2LA 1EB0A 2XLIA 4YY3F 3W62A 5JUMA 1I5OB 2CADA 2J6SA 3CC4S 1G6BA 4UOCA 2V8VA 5HI7A 2HWTA 2VPZB 1J5EJ 4R0JA 3VR1A 2QFIA 3MAAA 3W9IA 5LMNJ 2E9TA 1WC6A 2M7SA 3BDEA 1NHKL 4DG1B 1WC4A 4DR7F 3PY8A 3TAQA 2ZDOA 4JI2F 2VONA 1GMVA 1T3OA 3SCLE 1HARA 2XZTB 4GRSA 4NEYA 3AQOA 4H54A 2HFUA 4KHMA 3DMJB 3MM6B 4NLVA 4CLKA 1UPMB 3KFWX 1X4GA 2OD4A 3SI8A 2GVDA 1IBKF 3HCXA 5CYMB 3IR5B 3GFYA 4YB5A 3I55S 1C0UB 4JV5F 2HBZB 3A13A 3GV5B 4IR9A 5CD4H 2VZ9A 1OWXA 4KAIA 2B6AA 3D6FB 4CT9A 2Y3YA 3NL0A 2JLEA 4AD6A 1FKAF 1CQNA 3A3OB 2UVWA 1YK9A 3A12A 5E3QA 2BJ3A 2PSZA 1U02A 4A8MP 4OJHA 3D1OA 1Y9OA 4NLTA 3TARA 3OSNA 3BBFA 2E29A 4N76A 3CTRA 2VASA 4CYUA 2BKNA 3CULA 5L9XA 5EX3A 3OL7A 4CCHA 4DSEA 3R6GB 2PFDA 4DSKA 5DDRC 3EPIA 2R2RA 2VL1A 1XNQF 5L8RC 1AA1B 1XN9A 2BM0A 2MQ8A 4HT5A 4K7QA 1WF2A 2UU9F 2UUTA 4NPOA 5D3GA 5F3ZA 4JI3F 3QYYA 1FI4A 2VPXB 5KFYA 1RWKB 3N5FA 3KMQA 2B4PA 3D68A 1CLFA 1S79A 4K0KJ 4F4KA 2RRNA 3L7PA 4F50A 2GS8A 4F0KA 1RTHB 2VQEJ 1X5SA 5C2CA 1FDAA 2K2PA 2A2DA 4P7VA 2Y1RI 2HBRB 1FESA 2FHOB 1D8YA 4X4TA 4QWCA 1KN6A 4ED4A 2OFGX 3DMJA 3DC2A 3DM2B 1K1SA 4FS2A 2DNHA 3HKZD 1A6LA 4OJ1A 5HJXA 3HXMA 3LANA 1B7FA 4QIEA 3OL8A 2OI2A 3DOKA 1WEXA 1VC5A 4ZDNA 1WOOA 4EWTA 3WZ0A 3UCGA 2RDJA 1S9GB 1C0UA 3P5BP 4P73A 4WYWA 3NLCA 2MLYA 2K1RA 2K7JA 3N01A 4PYAA 3DLBA 5A6WA 2HFVA 4DPTA 2ZNYA 1UW9A 1RYSA 4X4SA 1IXKA 1TL3B 4WF9Q 2F3JA 5HAOA 5HLFA 3RBZA 2PC6A 2E5LF 1N33F 3BO2A 1FFGB 2C42A 1NSPA 5H9FJ 4DCJB 4M5NA 4F67A 3D1HA 2NUHA 1IWAA 1NEEA 1WELA 4JI7J 5J2NB 3E8OA 8RUCA 1D0EA 4L73A 1U6ZA 2Z57B 2DYAA 3BPDA 3WHIA 4BC7A 5E3PA 5E41A 3Q2TC 3NWRA 3IRXA 3JSRA 4LR8A 3QGGA 4IO1A 1U49A 2ZZNA 1EKRA 3CNQP 3ZFVA 1LW2B 2ZZMA 4B3SJ 2DHAA 1C0TA 3S1TA 2W4PA 5KOWA 1HBOB 2P5VA 1LXNA 3K0JA 3QSIA 3CXCR 4ICLA 1KOHA 3FBFA 1T11A 4A8SA 1NRKA 2DRBA 3KUHA 3HO1A 1ZM9A 1JLEA 3P6YC 2H51B 3C16B 1S6UA 3DN9A 3GMGA 3MFHA 4DR3J 5ITHA 4QW9A 5KG2A 2MKJA 1FKOB 4WPAA 4DS4A 3M6XA 1URRA 4DL3A 3MOZA 2PFFB 3H42A 3VVUA 4IOCQ 5B08A 1SIWB 2B4UA 1TUGB 1WACA 2AEMA 2R7XA 2KVQE 2R7UA 1F5AA 1I94F 2ASLA 5CZVA 2XY6A 2HMIB 1LWFA 3K89A 4RNOA 2MKCA 4RW8B 3HT0A 4AL5A 3ZTQA 1HBMA 4JI8F 4CDIA 1WI8A 2MPUA 2PE8A 3KNAA 3A8IA 1FWKA 2V9KA 3AOBA 3BN4A 3FFIB 1ZAVA 4Z7CA 4H4OB 1FF2A 3JXOA 2XHCA 2N3LA 2AT1B 4LRDA 3SDEA 2JZ5A 4AQYJ 2BE2A 2IYGA 1BMQB 5RUBA 2JVRA 2E44A 1ZOTA 2H48B 1GAOA 2ASDA 3QT6A 2AYBA 4LF6J 1SV5B 1VRUB 1FE0A 4P75A 4PABA 3GV8B 2CPIA 1V5VA 5E5NA 4LF4F 2MKIA 2CQ0A 1YI2S 2WVCA 4Y2AA 1ZAXA 1DLOA 2ZH9A 1DTQB 3PKYA 3QPIA 1H6KX 1LW2A 4PXCA 4HR2A 1HBOA 5GMDA 3PG9A 4CLZA 2M9KA 5KFJA 1U09A 2FB0A 3RAQA 3W61A 5DQIA 2M3DA 3QIPA 1S99A 5HN0A 1K0VA 1GMWA 1RXOB 3E01B 1K0TA 2KXHA 2RU3A 1BUXA 3HJFA 4F3QA 3H40A 1YTYA 4U7UD 2C2DA 4RWXA 2QA4G 4ZHRA 5C7PA 4OYWA 2FVRA 2W2NP 3UCZP 2HNYB 4DQQA 2B5JA 2FVSA 1KLMA 1OYEA 4ED3A 5A8WB 3I0SA 4K4ZA 1S1TB 2AGQA 6FD1A 3J7Z5 3CD5A 2RQCA 1OSCA 1XMOJ 1FXDA 4LRFA 1O8BA 2HG4A 2QLFB 1CULB 2QRRA 3CJ0A 3J7ZT 2VBZA 2OPPA 4R5PB 1CJUB 1N5QA 1HI1A 2FJVA 3DOMB 1YGYA 2BVZA 4K4TA 3UDCA 4QWAA 1HL6A 4ZN3A 4ZJQA 5KG0A 3DRSB 2N3OA 2CZVC 5KFZA 1YJWS 1RADB 2R7RA 1RAIB 3BGUA 1IR1A 3DOLB 1ICEB 5J2PA 2HEKA 5GAHU 1JNRB 2FJBB 1XMQJ 1GTHA 4L6V3 3V6JA 1A7GE 1FXRA 1SV5A 2DRAA 1H2TZ
chains in the Genus database with same CATH topology
3FZ2A 2V4RA 3PZPA 3K2YA 2YWKA 3QAEA 4OLOA 2AJ0A 2VH7A 3N79A 4WXWA 1QUPA 3GE9A 3M2UA 4PR6A 4NLYA 4XAKA 3UE2A 4BHQA 2YWEA 1I1GA 2LA4A 3CWJA 2YKAA 2Q79A 4C3LA 1RJJA 1L5UA 1F5BA 2R8IA 2JC0A 4JOUA 2BANA 3MDFA 4Y6IA 3TW0A 2B0GA 3V2UC 5E7OB 3EYZA 4CO2A 4B3RF 3OTOF 3G8QA 1Z2LA 2L9WA 4RZRA 3ISND 2JOQA 4RW4A 1F0XA 3I31A 5A6PA 3KK2B 4QIFA 3VZHA 3X3UA 4BC9A 4EBCA 2GO9A 1MWYA 3SFUA 4YB7A 4DL6A 3P49B 1F60B 2DNLA 1S49A 3MFIA 2JSXA 1S76D 1CG2A 3C8YA 3IRXB 4KB7A 2KYXA 4USJC 4U7UK 2P6SA 4EU0A 3CCMS 2ZVSA 2ROPA 3S8SA 3H5XA 2IAJA 3TA2A 2R8KA 1DURA 3JTPA 4KKOB 4ZVEA 2KVIA 4QWEA 2YKMA 4FBUA 3TAMA 5D4LA 5EX0A 2U1AA 3V6HA 1JK9B 2DIVA 5IFMA 1X4FA 5K8PA 3T1HF 2I2YA 4KV8A 2ZHOA 3V4IA 4CQ1A 3H98A 2C2EA 2XMKA 3MR2A 1RKJA 3M30B 1BQMB 3PDNA 4I64A 4PQUA 2FVQA 3VAJA 3KMSA 2YX1A 2DGUA 4Y34A 3LP0B 1XNRF 2OSRA 1C0TB 3HX9A 3NKYA 3CJKB 2QSFA 2IFXA 2XCAA 2WSFC 2XCPA 2CPYA 3HVAA 4IFVB 5LXRA 4GKJF 2BDPA 2GGPB 1JLBA 4LIRA 4ED1A 4ICLB 2KHDA 1Q82T 2DT9A 4I2PB 3T3FA 1UVNA 1E6VA 2HVIA 1FRIA 1QY7A 2JLGA 1HI0P 3MUTP 2MB0B 1T7PA 3CUNA 1Q1KA 1ZAWA 2RD5C 1M5VC 2DHXA 4PUOB 4DPOA 2KTQA 4F3MA 4I6YA 2JHEA 3OFGA 1S1UB 1HNIA 2OH2A 2JX2A 1JLEB 5I42A 2YH1A 2RB7A 2QMWA 4DR1F 2A18A 2WSEC 2M8HA 1J5OB 4I68A 2HFNA 2J0XA 2R7WA 1KHVA 2KO1A 3BM7A 4DV6F 2I8EA 4I2QB 4DWIA 2D1CA 1HW8A 2XMVA 1J5EF 1LFWA 1TKTB 3FSYA 4OFZA 2KT2A 2DK2A 1K8AT 3CCQS 2HS3A 5LMNF 1X7VA 2OIHA 1JB0C 3TQ1A 3LGMA 3EZ5A 2LXIA 1DTTA 3MMBB 4OI0A 2F4VF 4ZP8A 2GIQA 2MYFA 4K5SA 2F1FA 4J9KA 2POKA 3MF5A 2AQ4A 3MM7B 3QZ7A 1JLFB 3OFFA 1UFWA 2JRSA 3AA8A 2RVJA 3S7RA 1VQYA 1U2RA 2CQHA 3D28A 3FCHA 1HD1A 4IH6A 4ED7A 4FBTA 4J9MA 1FRKA 1VMBA 3MUVP 3QJPA 2J76E 4ZCMA 4Y2CA 1PILA 4FN5A 3SMZA 2M52A 4NYPA 3HHEA 1HHTP 2GIRA 1ZM4A 2Z0GA 3VZIA 2X3GA 3M32B 1SKSA 1T05B 1QM9A 1R31A 3NP5A 5J1PA 2HVZA 4DF8A 4DS5A 2N4DA 4I7FB 1R0AA 2JEJA 1G1XA 1DJ0A 1LWFB 2FC8A 4NL5A 3MEDA 3OLBA 3TA1A 2HGMA 5D4OA 5KT5A 4J9QA 5KFXA 3ZZZA 5DLFA 3NCPA 1KTQA 1N56A 3LP1A 5AJ3F 3POTB 2JLFA 1S6PB 5CA5A 4N41A 1SQEA 4DSLA 5C24A 3HI9A 1HBMB 3KK1A 5KFLA 2YNIA 3KTQA 2OMLA 1GQEA 2UXCF 2RF2B 3W2VB 2PMZD 4O3OA 3MR5A 3OTBA 1LW0B 1HD0A 3CT9A 2R7SA 2ZBIA 1PGZA 2IBKA 3AAWB 1JKHA 3CJ4A 3N6MA 3TX8A 1IKVB 1N0VC 5IM0A 2VC0A 5DDQC 1KC8T 3GIJA 2NLWA 1JLAA 2WB1D 2XSFA 4Y0FA 3N28A 4ECRA 2IC3B 2R8GA 2PT0A 2D3OR 2W9CB 3PRBA 4RLEA 5E2QA 1KOOA 4V19X 4XO0A 1ZZFA 3QIDA 3BQ1A 2ADCA 1DFDA 4RNNA 2XSJB 1HW9A 4NLXA 2ZH3A 5F8NA 5KFBA 4WKRA 4X4PA 4PXDA 1X9MA 4DFMA 2XLKA 3ETOA 2CPDA 1FJ7A 3TUIC 1K9MT 4B02A 3DOLA 3SCJE 1QAYA 1F9FA 1J2VA 2D9OA 3MR6A 5D4NA 4LF8F 2OFHX 2HYIB 4X4NA 1RT6A 2WOMA 3IGVA 4O44B 4JI6F 3SDEB 3MR3A 1TZ0A 2XG8A 3KJVB 1AXQA 1RT4B 3GIMA 1VC0A 2E5GA 2BE2B 4OIXA 4ZCKA 1HQUA 5J2QB 3BN7A 4NA3A 4A8WA 4IRCA 3HZGA 4M1KA 1TKXB 5AXMA 3T9NA 1Q86T 3FMWA 5DRKA 7FDRA 1JLQA 2N82B 3M9MB 5DGBA 2P6TA 1JLGB 3OW2R 3L3CA 2CQCA 4DV0F 2R2TA 1SL0A 3DLJA 5AE1A 3BGRB 1W25A 4PPZA 2K3IA 2B43A 4TYAA 4ZVFA 3ENQA 4IUFA 1JXLA 2IRYA 3DFEA 2X51A 3R5CA 4X4RA 4WK3A 1B0PA 3SV3A 1M5SA 1NZAA 3EX7B 4RBVA 3DU6A 1FHTA 1HBUB 2D7SA 2EG2A 2WW8A 2KM8C 2WTFA 4ECWA 4X64F 1QE1A 5KAKA 3AA9A 1M90T 1JJ2R 1DLOB 2AJ1A 2ZH5A 3CDWA 3BEGB 3DLLQ 3BQ0A 3KK2A 4B9VA 3G86A 2PA8D 3NBPB 4KFBA 4TY8B 1IQZA 3MEGB 3IS9B 3FNNA 3KYLA 3RRHA 1TKDA 4YDDB 1KTVA 5DQGA 5L1KA 4HDGA 1NKCA 4RW6B 4RX6A 3SSSA 2W25A 4ILRA 1C1CB 4H4KC 4ELUA 3H4BA 3CD7A 2UXDF 4NLOA 5C5JA 3PX4A 1WHXA 4B3OA 3KLGB 1CQMA 2YX4A 2JJ4D 3LUYA 4RW7B 4RUAA 4LF5F 4ELVA 4WZQA 2XNQA 3VQTA 2YH0A 3G8TA 1YJNS 3FEXB 2EG1A 4F4WA 2JWNA 1BQMA 3M30A 3DLEA 2UVRA 2BQ3A 2DGWA 3LP2B 4DF4A 3CJKA 3MECB 4C0OC 3PW4A 2NPFA 4XPEA 3LQVA 3AB2B 3CCTA 3I5AA 1BWEA 2HPUA 4DFJA 4FVMA 5KT4A 1EP4B 4LVNP 2YKQA 1D9DA 4LSLB 4GMKA 4I2PA 3QIPB 3WDOA 5A2QY 3RTVA 1Y5LB 5KFDA 3SFGA 1RTIA 2YWHA 2LA6A 1R89A 4YR3A 4PPDA 1LV5A 4A8FA 2RKIA 1SC6A 1QUVA 4TXSA 2HHWA 2E1AA 4KO0A 4HVZA 2HQ3A 2MGZA 1Y4ZB 2EWHA 4OV1A 4XDDA 3PIOQ 3T5KA 1SJ1A 4KJIA 1N88A 1V3SA 3OHBA 2BQUA 3MZIA 4I6AA 3T5LA 1UJ4A 1HHSA 1NK6A 2Q43A 2KHCA 1MWZA 4AXIA 3QWPA 5AE2A 2G1DA 2V4JB 2DBBA 1XBWA 4PXBA 1H7WA 2KFZA 1HBNA 3KHLA 1R6YA 4DQRA 3K5MA 4YQWA 1X4CA 1UA0A 3HKWA 5DM6Q 3MMBA 2BRLA 4OZNA 4ZHRB 2E1CA 5F8IA 4YP3A 1PSDA 2I38A 2M88A 3VQSA 2XBPA 3U27A 5A8KB 1GXUA 1JLFA 1LXJA 2Q6CA 4UQGA 4W90B 3MGJA 2RRAA 3KHHA 1U4BA 2I9SA 1SL2A 3MTKA 4X2BA 1FE4A 3C3LA 2BR0A 2B5JB 4GO5X 3CMES 1R8CA 4K0KF 2FJAB 3CDBA 4UQTA 1KLMB 4ZOSA 5IT0A 3OV7A 3CC7S 3VTIA 4OI3A 2HLUA 1SJ4P 1L3SA 3NGKA 2DR5A 4MH8A 4RUHA 1SJ3P 1UL3A 1FJEB 1RISA 3I0SB 4X62F 4O3QA 1GX6A 2VQEF 4C8MA 1T05A 3B4DA 1APSA 5FDLA 4TU7A 1R8PA 1GTEA 1NK9A 2VODA 2FLOA 4WFBQ 1WEYA 5LT5A 3MMCB 2F40A 2WONB 2AX0A 3K5NA 4RW9B 1S77D 3KK3A 2ZHAA 4B3TF 4CTAA 3RB3A 2RQMA 2QA2A 2VD3A 1ZM3A 3K5OA 3ZZYA