1FJCA

Solution structure of nucleolin rbd2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
b'SHMLEDPCTSKKVRAARTLLAKNLSFNITEDELKEVFEDALEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGGTRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOLIN RBD2
publication title Solution structure of the two N-terminal RNA-binding domains of nucleolin and NMR study of the interaction with its RNA target.
pubmed doi rcsb
source organism Mesocricetus auratus
molecule tags Structural protein
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fjcA00
1H2UX 1WWHA 1DHMA 1K9MT 2CQPA 1U6BA 1DRZA 2MY8A 4WCEQ 2DGWA 2LEAA 2DGSA 5LSOA 3VAMA 2MQQA 2MZTA 1WEXA 1VQ5S 2QA4S 3MUVP 2YH1A 3SXLA 2RT3A 5DETA 1WHYA 2WBRA 2EK6A 2FC8A 3CMAS 5DDOC 2HGNA 2LA6A 1WF2A 2N7CA 1M90T 3N9UC 5DM7Q 3CD6S 2KG1A 2F9JA 2CPEA 2LKZA 3S8SA 3H2UB 1NJIT 1VQ4S 3J7ZT 1K8AT 2CQHA 3CCJS 2QEXS 2KYXA 2RRBA 4U67Q 4IUFA 1OO0B 2KRRA 2X1AA 1BY9A 1VBXA 2DNZA 3CMES 2PEHA 1X4AA 1WI8A 1XN9A 3ULHA 1X5TA 4LJMA 1FT8A 2DK2A 4ZKAA 2AD9A 4QU7A 2LMIA 3OW2R 2D3OR 2E5HA 4P6QA 1X4DA 2ERRA 2XNQA 4WF9Q 1VC6A 4FXVA 3G8TA 1SJRA 1WEZA 2CQIA 2RNEA 1FNXH 3SDEB 2Q79A 3PIPQ 3EGNA 1X5OA 2DNMA 2DNKA 1H6KX 2KU7A 2LCWA 4F26A 4QQBA 1UP1A 2MKHA 2M52A 2MYFA 1X5SA 1Q86T 1VQ8S 1SXLA 2FPHX 5JVHQ 2CJKA 5GAHU 1N8RT 1G2EA 1U1PA 4OZ0A 4Y0FA 1VQMS 5GVQA 2RQCA 3VAKA 2MQLA 5LJ3Y 1X5PA 5D77A 2DH7A 2I38A 2MY7A 3BEGB 3MUMP 2OSQA 5EN1A 3CF5Q 2HGMA 5H1SV 1QVGR 2BZ2A 1HD1A 2DB1A 2NZ4A 3THTA 4TU9A 1WHWA 2MQMA 5IFMA 1FHTA 3P49B 5GAEU 1FO1A 3EGZA 2E5GA 4PR6A 1N88A 3VAJA 2HGLA 2VOPA 2KVIA 3BO3A 3P6YC 2MZRA 1U1MA 5CA5A 2DNRA 1F9FA 2G4BA 4Y00A 2GO9A 3ZZZA 2VODA 1M5KC 2CQ1A 3NS6A 4YOEA 5BJRA 2MGZB 2MKKA 4W90B 1WELA 3B4DA 1KQSR 2V94A 3BO2A 3NNAA 5GMKa 1O0PA 3CCQS 2DHSA 4CH0S 3G96A 1M5OC 3CUNA 2JRSA 3CTRA 2KH9A 2CQDA 1QM9A 2CPZA 1L3KA 1VQKS 4V19X 4LMZA 2LECA 5IQQA 2A3JA 3UCZP 2OJ3A 2CPJA 2MB0B 5D78A 2M70A 2B0GA 1A9NB 3Q2SC 3MD1A 1SJQA 3CCES 1FXLA 2MZJA 4OZ1A 1HD0A 2E44A 1NO8A 2X1BA 4YUDA 3VAHA 3Q2TC 1Q82T 2DHXA 3U1MA 2DH8A 4RU2A 2AYMA 2MGZA 4BS2A 5IM0B 3CPWR 2KN4A 1U1NA 2UP1A 1N52B 2MJUA 2MPUA 1M5PC 1YWXA 3B4MA 1KOOA 2LXUA 2DISA 4LIRA 2PE8A 2RQ4A 2D9OA 1U1KA 1S72S 2DNQA 1SJFA 2DGUA 3R1HA 1VBYA 1UFWA 1YTYA 5LJ5Y 2HVZA 2G0CA 2MQPA 2U2FA 3P3DA 1VC0A 3CXCR 2MQNA 2AYGA 1OPIA 4J5OA 3NNHA 2N3LA 3MI7X 3RW7A 2OIHA 4F02A 3TP2A 4TLQA 2DNNA 4W92B 4WIIA 5IM0A 3CCLS 1X4GA 2KXHA 5LXYA 3VAIA 1SJ3P 1JJ4A 4WFBQ 2X1GA 3PIOQ 2DGVA 2DGQA 2CQ4A 1UW4A 2OTLS 3G9CA 2JX2A 5ITHA 2JVRA 1ZH5A 3CCUS 1WHXA 1H2TZ 5DDQC 2MZ1A 1WG4A 2CQ2A 3CULA 2DHAA 1IQTA 1ZZNA 1U6FA 2K3KA 1OWXA 2N3OA 2LEBA 5GADU 4TU8A 2MQOA 2LA4A 4C7QA 3CC2S 1U1LA 4CQ1A 3MUTP 2YH0A 2DGOA 2BOPA 2FY1A 3SMZA 1DBDA 3THPA 2L41A 2KG0A 2OSRA 3TYTA 2OTJS 1WHVA 2F3JA 2M2BA 3S01A 2M9KA 2F9DA 2KXFA 5LXRA 3DLLQ 1VQ7S 2ZJQQ 1VQOS 4CH1A 3RW6A 3UD4P 3CCVS 1Q7YT 2D9PA 2MKCA 2CQGA 1CVJA 2J0SD 3BS9A 4QU6A 3S7RA 1KD1T 2DGXA 1ZZFA 1YJNS 2CQCA 4QPTA 1B7FA 1PGZA 2K8GA 2XS5A 3VF0B 3I56S 3UE2A 1VBZA 2MJNA 3MXHP 2DNLA 1WI6A 2KM8C 2E5IA 2DIVA 1S79A 3P5TL 2XNRA 1JJHA 2XSFA 2E5JA 1R8HA 2NLWA 2M0GB 2ADBA 3CC7S 4WKRA 3JB9k 1VQ9S 3VAGA 1X4CA 3MDFA 2J76E 3HI9A 1PO6A 3MOJB 4ED5A 4CIOA 1YJWS 1WG5A 4EGLA 2X1FA 2KFYA 3MURP 5FJ4A 1FJEB 2U1AA 1QVFR 3UD3P 4Z2XA 2KHCA 3CCRS 2EVZA 1Q81T 1X4HA 2MZQA 1M1KT 1VQNS 1K73T 1HA1A 1FJ7A 4UY8T 1VC5A 2GHPA 2MHNA 2RRAA 5GAGU 5HL7Q 1SJ4P 1WEYA 4ERDA 3EX7B 2EK1A 2MZSA 1D9AA 2ADCA 2YTCA 3L3CA 3H2VE 2KM8B 2SXLA 1FJCA 2J0QD 4C4WA 3LQVA 2MMYA 2DHGA 2M88A 2DITA 1P1TA 5DDPC 2JWNA 2DIUA 3LPYA 5DM6Q 5JVGQ 1X4EA 3G6ES 4TU7A 5MLCV 2KXNB 1YITS 1N54B 2G1DA 2KI2A 2CPIA 2YWKA 1RKJA 2AYEA 2RVJA 2CPYA 2DO0A 3K0JA 1YJ9S 3UCGA 2MXYA 3US5A 2M8HA 4C0OC 2M8DB 3R27A 1YI2S 1A7GE 4UQTA 3CC4S 2FHOB 2AYBA 2CQ0A 1WG1A 2DNOA 4IO9Q 2L9WA 2HYIB 2HZCA 1KC8T 2MKSA 1JJ2R 1U1QA 1YHQS 4WFAQ 3VALA 2I2YA 1U2FA 3NS5A 4WFNQ 3V4MA 3G71S 2QFJA 1KOHA 2XS7A 3U1LA 1UAWA 1U1RA 2LQ5A 3I55S 3S6EA 5HO4A 2DNGA 3NNCA 2KT5A 1W2BR 1HL6A 3FEXB 3R1LA 3J7YU 4PKDB 3BO4A 2XS2A 4A8XA 2JVOA 3UWTA 4PRFA 3G8SA 3CCSS 2DNPA 2YKAA 1U1OA 2LYVA 1WTBA 2L08A 2MSTA 1VQ6S 1VQLS 1VQPS 2VONA 1URNA 5CYJA 1P27B 2M7SA 3FEYB 1DZ5A 2RU3A 2XB2D 2DH9A 2CPDA 1RK8A 2CQBA 2RUGA 4M5DB 3SDEA 2ZJPQ 2O3DA 2MKIA 1D8ZA 3ZZYA 2VOOA 5DDRC 2FC9A 2DNYA 2ZJRQ 3TO8A 4IOCQ 1YIJS 2MKJA 1NU4A 4IOAQ 5CXTA 2DO4A 2LXIA 2N82B 3VAFA 2DNHA 1WF1A 1X4BA 2CPXA 4YB1P 2CQ3A 1WF0A 3IWNC 2M4MA 1OIAA 4FXWA 2RS8A 3HHNB 2KRBA 1H2VZ 3UCUP 3IRWP 3CCMS 2DGTA 5LSLA 3MD3A 4F25A 1X0FA 1JMTA 3DXBA 1X4FA 2MSSA 1AUDA 2CPFA 2CPHA 3G4SS 2RS2A 3NMRA 2J8AA 1R8PA 3D2WA 1M5VC
chains in the Genus database with same CATH superfamily
2CQPA 1F5CA 3MM6B 3BGOP 4K4VA 1RT4B 3CJ2A 1VQ5S 4P74A 4DV4F 4D3GA 3G6XA 1S9EB 3MR5A 2CNKB 3N5FA 1J5OB 3H8YA 1DQAA 4Q2LA 2CJQA 4EI2A 2H5IB 2V8VA 2W25A 1FRLA 1KWMA 3LWMA 2DNZA 2L3MA 3POTA 3QQCD 2W1BA 4G1IA 2XTJP 2AF6A 4KKOB 5EX0A 1GH8A 1HW8A 4ELUA 5A2QY 2VKZG 4QYZK 2CDRB 3QSIA 4ECYA 3LH2S 2E1MC 2NSBA 1DTQA 5DGBA 3KLHA 2CJKA 2J6TA 1QAXA 3CJ3A 2VHGA 4J9KA 4ZIVA 4K4UA 3D28A 1RT7B 2RQCA 1VQSA 1HMVA 3CF5Q 3QAUA 4LBHA 2WOMA 2C2DA 4LF9J 1L3SA 4WU3A 5A8RB 3KJVA 3EGZA 4K7QA 3DI6A 2KVIA 5D0RA 4YY3J 3BO3A 3HJFA 4M63A 1CJKA 1IBCB 4M5NA 1REGX 4Q0BA 2YX1A 4KBIA 1NB7A 3SYZA 2X51A 4B08A 2EBEA 1T3NA 3B4DA 1GXUA 5BYQA 3Q8UA 1DFDA 3BBCA 1YVFA 2V6AA 1C0TB 1ACMB 2JFDA 2C28A 2A3JA 3GG0A 5ETTA 1A9NB 2IC3A 3AOCA 1SUQB 1RHQB 4N77A 3CJ0A 1SC4B 2BA9A 2WHOA 2LQBA 1M5PC 1YWXA 4ECUA 3FCVA 3TX0A 5J2QB 4RNFA 3CD7A 3HVTB 1V3ZA 3HZEA 4DL5A 2WVDA 2OPQA 2V4JB 4J5OA 4B17A 2OIHA 1PYSB 3D68A 4DG1A 4JI2J 3H25A 2CQ4A 1DJ0A 3A3OB 3UR3C 3OR2A 4EU0A 3X1LB 4DZDA 5GADU 2K06A 5I42A 5ETVA 4C7QA 4NPOA 3M2UA 4QIGA 4RNHA 2L9DA 2HFUA 1MLAA 2P6TA 3HCXA 4ZHRB 3BH6B 2XMMA 2YKOA 3PVXA 1VQOS 2V8DA 2QL5B 3DOKB 2OLWA 4NA3A 1Q79A 2R8GA 2DHHA 1HIYA 2Z58B 3DLKA 4IRCA 2LVWA 4WKRA 5HK4A 3W5XA 2FLNA 3AQOA 5GMDA 1UTAA 2Y0BB 2AHOB 2R7TA 2QFIA 1XK8A 1N0UA 4EFAC 3HMJG 2XC9A 3MTJA 3UO0A 1HA1A 1RTDB 3IP0A 5T14A 3HLUA 5GAGU 1VRUA 2CXEA 2H3EB 4LRBA 2GIRA 3QBCA 1HQEA 2XSJB 3RB0A 2UU9F 1S6PB 2Z56B 1ZM9A 4C8LA 2HWIA 2D3UA 1GMWA 4DR3F 4KC5A 2AU0A 1P6TA 3FQKA 2IVMA 3CC4S 5BR8F 2L9WA 3DXSX 3L7UA 1U1QA 1F3VA 3K57A 3V4MA 1SIWB 4L72B 2CAJA 2DR5A 4O3SA 4P73A 2ZEJA 4Y6IA 2E5LF 4DS4A 5IV3A 4X2BA 1RA7A 5HBMB 1N6QA 2VH7A 4F0MA 4ER8A 4HKQA 1GX5A 4LSNA 4NYOA 4PYAA 3FK4A 3PW5A 4A4JA 5KOXA 4LREA 1UKUA 3LGNA 3DFEA 5JXSA 1ZAWA 2MQ8A 4QWAA 1JX4A 3SDEA 2H54B 3NAIA 3AODA 2HHTA 1EKRA 4OV1A 2GHWA 2DBBA 1NU4A 3EGVA 4XDDA 1X4BA 1TK5A 3W7BA 1YJ7A 4FZVA 2V50A 2CJXB 3E3XA 4ZK7M 1IR0A 1IM4A 4ILLA 1DHMA 1LWXA 5M2UA 3MM9A 2MY8A 4O23A 4FVMA 1MWQA 2VZ9A 2LQ9A 4ZVRB 1UZDA 4ZCLA 3QJLA 2WBRA 4GO5X 3QT5A 3ZZ0A 3GFXA 3MEKA 3VWSA 4HR2A 1XC9A 2AP6A 1QE1A 2N7YA 2DCLA 2WB1D 4RZRA 4UY85 5B0DA 4WYLA 4OIXA 4PUOA 3J7YI 4I6WA 3UVJB 4QU7A 1VS3A 3EZ5A 1S9GB 3C46A 4JB8B 2FDNA 5L39A 2CQIA 1LXNA 3EGNA 2B7BB 2DNMA 4QYRA 1RBLA 4C11B 4QWBA 2W2NP 3UPFA 4Y0FA 4IR1A 1U6ZA 4YB7A 3HSJA 4WJBA 4QIVA 3CT9A 1P9YA 4ZPBA 5EN1A 2RU9A 3SSRA 2BBEA 2BZ2A 2NUHA 3TA1A 1LFWA 1Q16B 1BC6A 2GVZB 1TL3A 2HS0A 3HULA 1HKAA 1H7WA 2VODA 2MKKA 4NWBA 1W26A 1RT2A 5GAGI 2WW8A 3CJ8A 3JTOA 2XO7A 3CUNA 4H4KA 1RT1B 2HMIB 1BMQB 2CPZA 2ROPA 3AFGA 3LP1B 2NPFA 1HD0A 1X7VA 2DHXA 3IGNA 2DH8A 4RU2A 5E3PA 3L09A 4X4RA 3TVYA 4LIRA 2DKOB 1UVJA 1HPZB 2I9SA 5I4MA 5J1EB 5LJ5Y 5CYQB 1PJ6A 3BBBA 2BE7D 2EW9A 4NLDA 5F8MA 2MQNA 3GFHA 1BUXA 4U9RA 1BWEA 1K44A 5KFZA 4W92B 2CVIA 4KPYA 3B54A 3EVWA 3HFVA 3GE9A 2LU1A 5I3PA 1V9OA 4URGA 2P8IA 3GFYA 1X8DA 2JSXA 4OI6A 2B3TB 2OD6A 6FD1A 2YWFA 2V5HG 4X4NA 3LGHA 3L9ZA 3SEOA 1C1BA 4QR2A 5A8WB 2IVYA 2HK2A 2CQCA 1TKDA 3DRRB 4KV8B 3MXHP 1MMLA 2OMLA 1RZMA 4GC7A 5RUBA 3IBFB 3W5YA 4RO0A 4LF6J 4B9VA 3GLJA 4FDFA 3DLBA 5DLFA 3BQ0A 5D3GB 1RYRA 3BGUA 4IRDA 1JLGA 4PXEA 4NLRA 1HWUA 2QG9B 2HQGA 4LSLB 3W2VA 4KAIA 4GVLA 5KT5A 3VVUA 2UXDJ 4CLYA 3GG1A 3RBZA 3EM1A 2ZNZA 1KTVA 5KAKA 3PX4A 4PWDB 2CIMA 1B0VA 1KLNA 4TNOA 1R7IA 5HP1B 5FIIA 4LFCJ 4PQUA 2VG7A 5KFLA 4KGKA 4OX7A 2CRLA 1FDBA 3WC0A 2HFSA 3RYLA 1RKJA 1QAIA 2B6AB 4K5SA 4CT9A 1XNRJ 3P96A 2GMHA 2FLPA 3DYAA 1A7GE 2G2YA 3KDOA 2GJ2A 2GJIA 1TKTA 2HYIB 3BZQA 5U47A 1SC1B 2VQEJ 4ZA1A 4U8YA 2EWHA 4DV1J 5F9LA 1KOHA 1UAWA 3QJJA 1P9QC 4OYAA 2QTWA 2UVRA 3KYLA 3MEEA 1XMBA 4PRFA 3G8SA 3HD1A 3M1VB 3PHTA 2UUBJ 3SCIE 2AJ4A 3OFGA 2ZH3A 1VQPS 1CG2A 4M5JA 2UUTA 1QAJA 2Q66A 2CPDA 1OJ4A 1HQUB 4ECRA 3JQMA 4LF2A 2DNYA 1IBMF 1CULA 2R8IA 1JLBA 2BKOA 3FBBA 2CPXA 1N4LA 4RWWA 2M3DA 4FXWA 4YFUA 5L1IA 3RR8A 2RS8A 3GIIA 4J9SA 1BXNA 2AQ4A 2IYGA 3MD3A 1C1CA 1GMVA 2HNZA 2JEJA 1KLMB 3TR5A 1HNVB 4NZ7A 1HBOB 3FUYA 1XNQJ 3EMTA 1LW0B 2G13A 4TQRA 5DDOC 3OFFA 3A8EA 1RHUB 4DL3A 1N5YA 1M90T 1QDUB 5DM7Q 1AFIA 1HYSB 2FJDB 3UW1A 4NMLA 3TVZA 4U67Q 4C97A 1VBXA 4U95A 1FT8A 3Q24A 4NXNF 3OW2R 3D1QA 4WF9Q 1VC6A 1TK8A 4HYKA 3RAXA 1I1GA 1WUUA 1FD8A 5DRKA 2M52A 4OFZA 5D4LA 3M32A 2DVIA 4JI4J 1SV5A 5GAHU 3KLIB 2PMWA 4OZ0A 3F44A 1EJ7L 3VQSA 4ICLA 4GKJJ 3WZ0A 2VD3A 4IDKB 5KFBA 4HT5A 5EX3A 2JJ4D 3NXZA 4ECXA 3QLHB 1KN6A 4K4YA 3QWUA 3LA0A 1U1MA 4M95A 3M8PB 1T05B 2ZBRA 5F8LA 4J9QA 3BREA 4RBVA 1OPZA 1GNKA 1KVIA 2XBPA 4JYAF 1R0BG 1MWYA 2WONA 1B4SA 4NCGA 4QW8A 3C6UB 4DN0A 5F3TA 2IA6A 1VQKS 2IRUA 2IM2A 3CCES 1S4EA 4OZNA 2B7CB 4KTQA 4XIUA 3M2RA 2KN4A 5HQLA 2VJUA 3B4MA 4I2PA 2LXUA 2RQ4A 3CIZA 1V5VA 1JLCB 3CJQA 3R1HA 1YTYA 4ZPAA 4B3OB 1RCXB 4WTYA 1MROA 3M6WA 3NNHA 3MI7X 2GV1A 2V68A 4CT8A 3MM5B 2R2TA 3TZXA 2VPWB 4YHHJ 2RIJA 1M5HA 2OTLS 3QNWB 4DSEA 1IR1A 3CULA 2XY7A 1U6FA 1LK5A 1ZM3A 2LA4A 1S1WB 3R5CA 1BWVA 1WHVA 1ICEB 5B0CA 1JLFB 3DLGA 2IJRA 1L5UA 1FJGJ 1NDKA 3PJ9A 1TKZA 2HFVA 7AT1B 2Y8YA 2IC3B 4ALZA 2IMOA 4ZIWA 2FJBB 2LP4A 4DV5F 1U47A 1B64A 2HPUA 3T5KA 4FPIA 2MLXA 1YJWS 4ZLPA 2X1FA 3VGUA 3DM2B 2F4FA 4H4MA 1AB8A 5KG4A 1B99A 1OY9A 2CFXA 2JLEA 3C16A 3GILA 2NXUA 1BGXT 3NCQA 4JI2F 2HVDA 4ZVFA 2ADCA 3MM8B 4ZPWR 1OY6A 2IJFA 4AYBD 5F8HA 2EFOA 5HMZA 5I42B 2Q6BA 1YITS 2F5GA 2KI2A 1AW0A 2DT9A 2RVJA 5HSPA 2VPXB 2CPYA 1JNRB 4B9SA 2HAFA 4UQTA 2J0WA 2V2VA 2BE2A 1P1LA 4DR6J 3GB0A 1U2FA 4WFZA 3AAWB 2VDIA 2QFJA 3BSCA 5GAHI 2LQ5A 3EXCX 1S1TA 4EK2A 3PYEA 4Y65A 1Q4RA 4A46A 1HBNA 4DR1J 2EFVA 1NDLA 5J2MA 3IWLA 1QSLA 4ED2A 3T1YJ 2R7OA 2IDEA 2VFTA 2FHKA 1RADB 2EFNA 3T5LA 3ZZOA 5J1NA 2GVDB 1P27B 1YBTA 3VGTA 3W2WA 2G9OA 2ZJPQ 2CA9A 2VKRA 3ITHA 4ECWA 4IOAQ 2XMTA 2BQRA 1SH3A 3OJUA 3NBPA 3DRXA 4GVBB 2YKPA 2FVQA 4WBFA 1UFLA 3IWNC 2M4MA 4AE5A 2QE5A 4ANEA 2Z4PA 3TWZA 2E7VA 4OX8A 4QWEA 4OLPA 3FZBA 3SQGA 4IFYA 1K9MT 2BM0A 3R5DA 2MQQA 1ZM2A 2XI2A 3KXDA 5DZ7A 2ABYA 4TYBA 3OLBA 3E01B 4NEYA 1NJIT 1K8AT 3VQTA 1NHVA 3LP2A 2FD2A 3AA9A 1TU0B 2FGCA 1QTNB 5CHCB 3PW4A 3BV8A 5IS2A 2J9DE 3W3SA 2G1HA 2FJEB 4NYPA 1RWOB 3SDEB 3PIPQ 1X5OA 2DNKA 1YX2A 5H9FJ 2LCWA 1RTHB 3BSNA 4JV5J 1UJ4A 2FHJD 4I2QA 2YKMA 4UT4A 3KK1A 3TNVA 1RAIB 2W2QP 3SCLE 4C48A 3HVRA 1BQMB 2Z2MA 3UD5A 2JDJA 5H1SV 2V9WA 1FVQA 2CJYB 1FCAA 3P5BP 4PR6A 5KG5A 2GO9A 1OYEA 3W5ZA 2F8HA 3LPEA 4ILMA 4GMKA 1WOOA 4BWJA 4NZ6A 3VTIA 3GYXB 2AJ0A 2CZ4A 2E66A 3OFEA 4NLWA 3GCXP 4G65A 4PXBA 3JQKA 4Y2IA 3HD2A 1LWFA 5IM0B 5KFWA 2YWGA 3OL7A 3Q22A 2PE8A 4PUOB 3KNGA 2RE1A 4HACA 2D9OA 5E3CA 2BV3A 2NCKL 2GHVC 3TW0A 1O5JA 5KT2A 1NK6A 3DLEB 3GYGA 3THVA 2GMJA 4FF1A 4F02A 5F41A 1CQNA 2Q1LA 1KSPA 1TMJA 2AMCB 3CJKB 4CM0A 2HVHA 5LXYA 2FZCB 4RW4A 4B9TA 1I51B 3D9BA 2HHWA 3OFHA 5BXIA 3ELHA 4DI6A 2QT7A 8AT1B 5AXLA 1U1LA 2BX6A 1T95A 3GYNA 2OSRA 4RL1A 4CLFA 3DLLQ 2EFQA 3K7RA 1FWKA 3MMBA 2YWWA 1IKVA 1KD1T 5HN0A 3IS9A 1YJNS 4IOBA 1VRTA 3CGIA 4UOCA 5K8OA 1TKXA 3T1HJ 2QL7B 1NRKA 4IH5A 4ID5B 1VQ9S 2R42A 3BKTA 1TL4A 1FRKA 3DRPA 2VL1A 1IBKJ 4NLQA 2C2EA 5E33A 3CCRS 1F6TA 4LFBJ 1FX2A 4QR1A 1T8EA 2C3MA 2CYYA 4L6V3 5HL7Q 4CO0A 1KNZA 3EX7B 3GTYX 3M9NB 4PG6A 4P2FA 2SXLA 1DURA 3QFWA 4QPXA 2RKIB 3FC9A 1JLQB 1UCNA 4KHMA 2KXNB 3K58A 2AYBA 1AYEA 2V2ZA 4IO9Q 3L7PA 1BQXA 4IO1A 3M7VA 1XMQJ 2XY5A 1RAAB 4GC6A 3G71S 2ZWOA 1BLUA 3LO3A 2XS7A 2GAHC 4C3MA 1PJ5A 2FQQB 3PZPA 3R3TA 4CCHA 4MKBA 3GIJA 4LF6F 4DSJA 1EP4B 5A2QU 3QJPA 3IR5B 4A8XA 5KFUA 3UWTA 2OPRA 4WIQA 3BBFA 2W9CA 1YDLA 3RU0A 3IG1A 2HQFA 1Q8IA 2A6MA 3B82A 2DH9A 3CCTA 4IG3A 1U0SA 1YZ6A 1D8ZA 3D6HB 4F67A 5KFAA 5DDRC 5L1LA 1QSYA 4K4ZA 2IM3A 5L8RC 5E3RA 3C6TA 4YB1P 2WRMA 1JLEB 3K5PA 4KFBA 4DUTA 3NGKA 3KNAA 3PEHA 1XNRF 1X0FA 2LFVA 3PFEA 1Z1ZA 4B3RJ 4LF4J 3DYAB 3SBMA 4MKAA 2LEAA 1PIEA 2MZTA 4OMFG 4USMA 1HHQA 5C2CA 4CRJA 3UNYA 2CNNB 3I82A 5AXKA 2N7CA 2ZE2B 2F63A 3OUYA 4OZ5A 4RW7A 2IIHA 2KYXA 2FHJA 1FKOA 2QJ3A 1SI9A 1FWLA 2HEKA 4CLUA 2AD9A 1TELA 2HK3A 3VGVA 2E9TA 2OFGX 1LFPA 1CJUB 4DFPA 1FRXA 2EKYA 3IBCB 1CJVB 2YNFA 2XI3A 3OBIA 1FVSA 1RHKB 2BW2A 2O67A 4LFAJ 1Q1KA 5L9XA 1KFDA 2MQLA 2HGMA 2UXBF 1TV6B 4BDPA 1RHMB 1WJ9A 4NX9A 2HBRB 3JTNA 2E5GA 2HNZB 2HGLA 4P2XA 2O66A 1H3DA 5CA5A 2XMKA 1XNQF 4WK3A 3OT9A 4YOEA 3D1HA 3BQ2A 3HHEA 1KONA 3M30A 1KQSR 3RBXA 1HNZF 5B08A 2JRSA 2EC2A 3HP6A 3K89A 3CDWA 4F7VA 4DV3J 2YNIA 1M0SA 4LVOP 5J2PA 4NXMJ 2ILZA 2MTLA 2AYMA 1XIQA 3T19A 5KFQA 4N41A 1XBWA 2RHQB 2B43A 1KOOA 2NUUG 3H5UA 3MFIA 3W1YC 1NZAA 2DNQA 5LMUJ 4F4KA 2G0CA 3GMGA 1FKPB 3CXCR 3N6MA 3H42A 4DQRA 4JI0F 4DQPA 5DS7A 1B3TA 4ETZA 3PO5A 1N33F 3NMAA 4ZPTR 2IHR1 4EYHB 1FTCA 4BCAA 3CCUS 2CQ2A 5A8KA 3NGRA 2COLA 3WQPA 1Y9OA 4TU8A 3MMJA 4CQ1A 3PW2A 4F2RA 3G82A 3FBEA 2FY1A 2KG0A 2BVZA 2VBXA 4DV0F 1Y3KA 2OPSA 3S01A 1UFKA 2KJVA 1U24A 3V6DA 3AJDA 1JIHA 3KLVA 2QMXA 2JEGA 4CNYA 1SL0A 1SCJB 5LMNJ 1VBZA 1HLWA 1WI6A 4KO0A 1S79A 3ZTRA 1VIXA 1PC5A 4WE1B 2QN6B 2ZH7A 4LBIA 4NLTA 3OVSA 2QSFA 1X4CA 1BQNB 4MMOA 4C3LA 2HG4A 5ETKA 1IJEB 4JI1F 2CWKA 1FJEB 4F0HA 2U1AA 1F0XA 1MROB 1N0VC 3AQPA 1HI8A 2NREA 1LWCA 4LF1A 4WP3A 2KFNA 4YHHF 1H38A 3OSPA 2AEFA 4OHZA 2B4OA 3TAMB 3BYPA 1WC5A 1L3UA 3MEGA 1LW2A 1U8WA 5KG7A 1NAQA 4DFJA 2DIUA 4FNHA 1R27B 3IO1A 1H73A 3V4IA 4UF4A 1YJVA 1VHFA 5H9FK 2ASYA 3DNCA 4DL2A 4HDHA 1P8GA 2HLUA 1X31C 2D1CA 2XGPA 3DLGB 3HHLC 1J27A 2MKSA 4GRSA 1X9WA 5H9EJ 3VALA 4ZOSA 3I4PA 3M9MB 2E9RX 3I0RA 2ZZTA 4BHQA 4K2JA 2AJ2A 4F3QA 3M2VA 3J80Y 2RF2A 3P45B 4O44B 3T3FA 2RMLA 1MSWD 3NRBA 1VQ6S 3PV8A 1RTZA 4P52A 4ITSA 1TUGB 3ISND 3QWPA 2K7JA 3C16B 5HQ8A 4XDCA 1RU2A 2VOOA 8ATCB 1U02A 4IOCQ 2BOAA 3RG6A 2MKYA 4CDIA 1S0MA 3MGJA 1TAQA 2NPIA 4ELVA 3GV5B 2AX0A 5LSLA 2NS1B 3CDUA 4F8RA 5J2NB 4DR4F 1HFEL 1R8PA 2HVEA 2HS3A 2BE2B 2HRUA 3QMQA 3OTOF 3LGMA 1FTRA 4WK1A 2C2KB 1RU1A 1NSAA 4DR7F 1SQFA 1JKHB 3ENWA 2ZD1A 5CH7B 4EUVA 1ELOA 4IFVA 4K4TA 2PEBA 1WF2A 4EMDA 3CD6S 4RUHA 2YNGB 3OXFA 5C5JA 2I5JB 1NLKL 4A8SA 2F4VJ 5EWFA 5J2MB 1TL7A 3T1YF 1GXTA 4ZPCA 2AZ1A 4H4OA 1VI7A 3G87A 3JSRA 4XPCA 3OVAA 1WC1A 4DSFA 1X4AA 2WBMA 1IXKA 4M5IA 3TUJC 1X4DA 2E1CA 4I7FA 3OR1A 3E8OA 3DRSA 1S0NA 4Q45A 2DXEA 1RT6B 1UP1A 2MYFA 3C14A 1VQ8S 4B3SJ 3GV8B 4CTAA 2Q3PA 1G2EA 5K8MA 4U7UD 3QPIA 4PPDA 3CDBA 2I0XA 5AE3A 1VHIA 2NXJA 4DX8H 3A4TA 2EFPA 3AY0A 1WHWA 1M5SA 3P49B 1UPPA 3VAJA 1NSQA 1DARA 4WKYA 4QYZJ 1BD6A 3ZZZA 3MM7B 4RBUA 2CQ1A 3TOQA 2D41A 3Q8QB 2XHWA 1LNQA 5GMKa 4AQYF 3RRHA 2XMUA 1LK7A 2VICA 3UCZP 2OJ3A 3MD1A 2V67A 5DLGA 2BKNA 2YKNA 3I5AA 5EHHA 1UVLA 1U8SA 3KHRA 4NLGA 4DPOA 1U1NA 4UUXA 2UP1A 2MPUA 3SV4A 1SC3B 3BGLA 1Z4UA 1RBAA 3OTEA 4TY8A 3RB3A 4NE9C 1VBYA 3N6LA 2OPPA 3H90A 4X62F 3RB4A 4DJBA 4JV5F 2DRBA 3RAQA 3RW7A 4WWSA 4I2QB 5KG1A 2YKMB 4XO0A 3KK1B 3MMAA 3AXMA 1KHVA 1KDNA 2PA3A 3ZTSA 5DDQC 2MZ1A 1VISA 2R7WA 2XZDB 5CZVA 1RWNB 2IM1A 4CH7A 5C42A 2N4DA 4C6AA 2YBVA 1R8CA 4OHXA 1XR6A 4MFBA 4ZJOA 4DU7A 3O3LA 1OSDA 1YRXA 2CADA 3WIVA 1U09A 1FD2A 2QSWA 2ALYB 1DLOB 3QAEA 3PX6A 5F0UA 4ZVTB 1OS5A 2MJNA 5LT5A 3MCSA 2R2RA 3BGRA 3EYZA 2WB4A 2GCFA 3BN7A 2GGPA 2FTRA 3IR7B 3VAGA 1S1UB 2XMVA 3UN5A 3K5OA 4QOTA 1HI1A 3GJRB 3LTOA 1IBLF 2IDLA 1Q8LA 1IR2A 3MURP 1YSJA 1QJHA 4K50A 1DY3A 3TQEA 1IKWA 2PFFB 1S12A 1RLDA 1I5OB 2F8MA 2ROGA 5B0GA 3RAMA 4NI2A 3CD0A 4UOHA 4OX9F 4OI3A 4I68A 4C4WA 2J0XA 3J7A1 4USVA 3TARA 4MIBA 1UWBB 2Y1LB 1NK7A 3CB4A 3R7NB 4DCJB 4Z37A 3G8QA 4J9PA 4N7TA 4U6PA 4J37A 3T1AA 1HBUA 2CVEA 3LANA 4FKYA 3H2LA 3TRGA 4Z7YA 1SQEA 3DHXA 4BLGA 5KFOA 1CQMA 1LEOA 4DUYJ 1NKEA 1N34J 2XQCA 1N48A 4USUA 3NS5A 2ALZA 1IWGA 2RDJA 3KK2A 1U1RA 3T1HF 1ZS6A 2ACMA 1NKCA 3DLJA 4KY3A 4A8OA 2UXCF 1U7LA 2W9BB 2W24A 1IBKF 1CS4A 2OEMA 3K2YA 1TR0A 4LQ9A 3DMJA 1TL1B 2LQJA 4FYWB 1EZZB 1URNA 1EETA 3W9HA 2NYHA 3M8QA 2UVUA 1U2CA 4N47A 4A8WA 1PYOB 3EVMA 4I67A 1UA0A 2O3DA 4RW8A 4F3MA 1IKYA 3M8ZA 2HQDA 1Y5NB 5G0RB 2ZNYA 1QSSA 5AXMA 4ZS6A 4FYVB 4ECTA 2K1RA 5D8HB 3HK2A 1WF1A 3KK3A 3HZGA 4WZMA 2VDHA 1TK0A 4DN9A 4P75A 1NHKL 5ETQA 1K47A 3PYGA 5HAOA 4RUCA 3JYTB 1E6YA 4JI6J 1AUDA 4NLVA 4F4AA 4IRKA 4Z7CA 3MMCA 1FRJA 2RS2A 1RTIA 4FN5A 3QZ8A 1FRIA 1H2UX 3BF4A 2VG6A 2GC8A 2FYXA 3GIMA 1RBOB 3CMAS 3QGGA 2HGNA 3LP0A 2LA6A 5HLFB 2F9JA 2CPEA 2LKZA 4O3NA 4USWA 2HHVA 4O4RA 2CQHA 5F8NA 2Z30B 4H4KC 5E3AA 2NQPA 4YDDB 2B9EA 3ZC4A 1JB0C 3OVBA 2VC0A 4K0KJ 2W2PP 4R5PB 4O3PA 3D1OA 3T6BA 2KU7A 3QO9A 4F26A 3M8SA 4MTPA 1Y4ZB 1REVB 4OYXA 3U7JA 2B51A 1S1XB 1NK5A 4ANCA 2KO1A 4KFBB 4RNMA 3ZNJ1 1IN0A 1N36F 3K8VA 2N4CA 1QVGR 2VIHA 4CP5A 1FO1A 1I94F 3NAHA 4TVAB 1YLXA 2OEKA 3M8YA 1TVRB 2WCXA 4Y00A 4OYIA 3AB4B 3KLEA 3X3UA 2MGZB 2XMAA 1DQ9A 1WELA 3MECA 1O0PA 3UDVA 1FEHA 1JWWA 3PJXA 4AD6A 4CH0S 2KZMA 2E29A 1T03B 4A47A 3KUHA 2M70A 4NLOA 2YQ0A 1FKOB 3Q89A 1N52B 1JJCB 3B8HA 2BANB 1HNIA 4QZVB 4ZVUB 2YPZA 3JXOA 2MQPA 2U2FA 3DN9A 2HAIA 3FBCA 2B5JA 1YBUA 1U0HA 3C2PA 4LFAF 3I32A 3M8RA 2YY3A 4OJ1A 1F9HA 3PW7A 1X4GA 3MPUB 1R0AB 2X1GA 2XG8A 1LXJA 4U96A 4ZP9A 1ZH5A 1WHXA 1H2TZ 2UUCJ 3DDIA 4GKKF 4J7CA 3OL8A 2LEBA 5C25B 4EO8A 4X65J 2LDIA 5ADZA 2PA8D 3HJVA 2VB6A 2EFGA 2RJZA 5I3UA 4WXOA 1HW9A 3TYTA 2FZGB 4B02A 1XMOF 2B9WA 1MNEA 2MKCA 2CQGA 4Q8EA 2FJXA 3TA2A 7FD1A 1M1HA 1UL3A 2PI4A 1AFJA 1S6QB 3SIPB 2E5IA 2AW0A 1N32J 1JJHA 3KHGA 2CDQA 2R8JA 5BYSA 2ASJA 4WU2A 3CJTA 1JLAA 1DQ8A 1PJ7A 4PAAA 3DKDA 3K5LA 1SPBP 4IR9A 2IA0A 1S97A 4OYOA 1T3OA 3CEDA 4PG7A 1KHWA 4PCQA 4NRTA 3EDQB 4DPXA 2YPYA 2R4FA 4YR0A 4UY8T 2MHNA 4YB5A 3T9NA 1ZAVA 2EK1A 3R5JB 4ECZA 3DRYA 3ET6B 2YTCA 3H2VE 1FJCA 1BE4A 2WZ1A 1GFWB 3MOZA 5DM6Q 3JSMA 1FXRA 5THWA 4HH1A 1KP6A 3PEJA 3G82B 1YJ9S 1VK3A 2FGOA 1H74A 1F2HA 1YRTA 5IC4B 3VZHA 3DOMB 4OQJA 3MAAB 3IMQJ 4JI3J 5HI7A 2IBOA 2NZCA 1NKBA 5LMNF 2QLJB 4C8MA 1NK4A 3MCMA 3ZO7A 2Y9HA 2KT5A 3MAQA 4K2XA 1HL6A 3NGTA 4QCLA 2HNDB 1VYAA 2VG5A 3A3PB 2ATLA 1U1OA 4RW6A 3CD5A 2D74B 1J2VA 1HQ2A 2OH2A 4C8ZA 3PHEA 4OI0A 2B56A 1Q0NA 3WC2A 4LR8A 4MYTA 2HLTA 3D0GE 5DG8A 2FC9A 2FLOA 4U8VA 3PDNA 3AD7C 3KLFB 4HI2A 5KFXA 3CJ4A 4QR0A 2CQ3A 2P2CB 3CO0P 3HHNB 1HNWJ 3FCHA 1NJXA 4J9OA 3DOLA 1X9SA 3D7SB 1JMTA 1AZSB 2ZOFA 4OYPA 1HNXJ 5HJYA 2YNHB 5KFYA 1C2PA 2RT3A 3MFHA 4B3MF 5A6PA 4JI8J 3DGPA 5D0GA 3LWLA 4CYUB 2FVRA 4KQZA 2KG1A 2G2ZA 2IAJB 3KLGA 2FZKB 3MM6A 3CCJS 4DR2F 1F60B 2HSEB 2RRBA 4IUFA 3MCNA 3CMES 3K5NA 4DV4J 1S9EA 3HO1A 3BGFA 3SV3A 3P4UB 5KFJA 3FVYA 1J5OA 4NEZA 5FLXY 2IVFB 4FF2A 1Y10A 3MPDA 3OHBA 3VAKA 4ZVOB 2RRNA 3MUMP 2OSQA 2OMOA 1HWKA 4RPFA 1GTEA 5KG2A 1L3VA 2XMJA 5HMXA 1N88A 2OO4A 3PNIA 3F41A 2V9KA 2J9DA 3KOAA 4Y2CA 3IM9A 1WC6A 3CJ5A 1RT7A 4DWIA 2E7XA 3MEDB 2YQ1A 1Q78A 1QM9A 1SKWA 4LMZA 2LECA 3DU5A 2R2SA 1D8YA 4OZLA 3O6QA 1F3FA 1IKXB 3SCJE 3GWCA 2XGQA 5K8NA 3NCRA 1C0TA 1S6OA 1Q8KA 2PMZD 2V8HA 3P3DA 5CZXA 1SUQA 3TEGA 2PD1A 2ZWPA 4TLQA 1RWXB 1FEEA 2HWHA 1NPPA 1F5AA 3VAIA 4HHJA 3EPIA 1URRA 1XQIA 2Z2YB 2JX2A 1JQGA 2V34A 5J2QA 5HANA 3HVTA 4LVNP 2K3KA 2A18A 1FRMA 2L41A 3FMBA 4HVZA 2F3JA 4L76A 2M9KA 2KXFA 4J9LA 4CLPA 1GT8A 2J6UA 2NXNA 2JH3A 3D6MB 2J0SD 2RQKA 4QPTA 3D0IE 4IQXA 3QZ7A 3RBDA 2QYCA 4OYZA 3MWBA 2X3DA 1X9MA 4X4VA 1T9XA 3DOKA 5IV4A 4ED0A 4JI5J 3MOJB 2XYGB 3UN3A 1UW9A 4LQ3A 2RUSA 3RR7A 3W62A 3I0SB 1M1KT 4C9DA 2ZUGA 2X7IA 2A2DA 1WKKA 1WEYA 2BW7A 3MMAB 4LIWA 5ETOA 2J0QD 1TAUA 2DHGA 4R8UB 2QA4G 3Q23A 1ZPVA 1X4EA 5MLCV 5T7LB 2LDYA 4RUAA 2DRAA 1RTDA 1G4CA 2VA3A 2IJNA 1YI2S 1CC8A 4USKA 5AJ3J 2XSJA 3QIPB 3D66A 2BM1A 1S6PA 5GADI 4WFAQ 2EXUA 5FD1A 4ZVQB 2HZVA 4WFNQ 4DR3J 3L4BC 3NNCA 5E41A 1NMEB 2Z2LA 2GGPB 4G1QB 4NA2A 1S1VB 3WX4A 5C2GA 4Y34A 3KUEA 5CAAA 2XS2A 5BR8J 1RKIA 2XCAA 1SJ1A 1WKJA 4TY9A 2XYPB 4YP3A 2D3O1 3NEKA 4Q7AA 4WFYA 1UETA 2E5LJ 3I96A 5HBMA 2ZH9A 3VHQA 2RUGA 5KFVA 4M5DB 3MPYA 4Q43A 3N79A 2ZDPA 3C15B 2DO4A 4RR5A 2DNHA 4C8YA 5CCLA 3LUYA 1CJTB 3H4BA 3VCDA 2A2CA 1FNMA 2KRBA 3F56A 3HSDA 5C24B 3CCMS 3R6LB 5B0AA 2HBYB 3W8PA 4MKYA 4ZP8A 3HSZA 5FDLB 5K14B 3I9V9 2CNLB 3NMRA 1G6BA 4PXCA 3OD2A 4IG0B 2A0FB 4KT0C 1N34F 4V19J 2YXLA 1RWWB 3QT8A 2QLBB 1AXQA 3SXLA 5DETA 3KK2B 4CLSA 3SSSA 2VA2A 4KH0B 4ZN1A 2BMBA 3F0NA 4JP8A 3OHAA 3J7ZT 1LWEB 3IAS9 1BY9A 4U7CA 4Y2KA 3H5SA 5MAOA 5DGAA 4EEYA 2VFRA 3M8QB 2RNEA 4LF7F 4UUWA 1WC0A 4F2SA 3ILLA 5L1JA 4ZPDA 2B4UA 2AEMA 3KK3B 1NK8A 3UVJA 1PKUA 2FB0A 1S9GA 2BABA 4DZ6A 3MF5A 4URQU 4KYZA 5HROB 4JI6F 1FFSB 3O5TB 1HI0P 2ZZNA 4OHVA 3M6VA 4C11A 2F1FA 2R7UA 4YQWA 2RQMA 3P6YC 5IWAF 4I56A 4C2MA 4B9UA 1VLYA 3JS9A 2QL9B 4EBDA 3R7SB 3WDOA 2C42A 2CQDA 4M5MA 4QJVA 2GVZA 5ETPA 4I0WA 4YN3B 1SJQA 1WACA 3SFUA 1NO8A 2HBQB 3WHIA 3SCKE 3PR4A 3VAHA 1Q82T 4BS2A 2P9EA 3QRPA 2I8EA 1N5TA 4DR5J 1Q5YA 1ZAXA 4K0KF 1RT1A 2HMIA 2PIIA 1MN9A 3G86A 2NXCA 1VC0A 1FK9B 2ASDA 4NLYA 2QYGA 2DNNA 2UUAF 4PPZA 4F0KA 1JJ4A 4WFBQ 3T9ZA 2FJWA 1RT5A 5J1EA 2GFFA 1IQTA 5CYQA 2NSCA 4MIWA 3TANA 2JC0A 3DU6A 5KT3A 3NGUA 4N8NA 4FKXA 3SMZA 3FQLA 3TZZA 3ZTPA 1VMBA 1D9DA 2AV5A 5I3QA 3CCVS 1HWIA 3J80U 5A0YB 2HZAA 4R0EA 1E6VA 5IOLA 2WSEC 3TUIC 3P5TL 2XSFA 2ADBA 3GQCA 3CO9A 5AT1B 5A8WA 4B3TF 5KT7A 2E1AA 4AUKA 5L38A 2BACA 3DRRA 2ZBIA 1RSCA 1X4HA 3GSDA 3MAHA 2HNYB 3WIUA 4P2MA 1AA1B 1S5ZA 4O4GB 2V4QA 3NS7B 3ZTOA 5F8JA 1YRUA 4DLGA 2HHHF 2CJ9A 3AD9C 1EX8A 2UUCF 3IM8A 4HDGA 3LQVA 4ZP7A 1FKAF 3J81Y 3RBEA 2DITA 2JWNA 3AHPA 2AGQA 4LSLA 4RNOA 1MW7A 4ENOA 3R2CJ 5I3UB 2H9ZA 4PWDA 3PXGa 1J5EJ 3H7HB 3OSNA 2FHOB 1NEEA 2CQ0A 2YWEA 5HP1A 1RAFB 2AWZA 2HZCA 4DUZF 2L9NA 3FCWA 2G2OA 2KHDA 2JEIA 2KZZA 3PX0A 2XEXA 2NXEA 4YEAA 4HL9A 5DQIA 2B6AA 3DLHA 2GIFA 4UOGA 1DAXA 3V6HA 1MU2B 3BSOA 3J81j 5CABA 2E7WA 2DNPA 2GIQA 2VBWA 3N28A 4ZLJA 3W9IA 1YJUA 3HHLB 3ZNUA 1MMNA 2HFZA 3H5YA 3GU0A 4KR0B 3VVTA 3TO8A 2OGUA 3M1VA 2MKJA 3V81A 1ZM4A 3ONQA 4C8OA 3NGDA 4HH0A 4PG8A 4LRFA 2HHPA 3PKYA 5DJBA 1SQGA 1HQUA 2ZM6J 2FY8A 4EZ9A 3ZZTA 2HHSA 4O0IA 2L48A 3KTQA 2J8AA 1IBMJ 2HHXA 2MEWA 1TFWA 4WCEQ 2BRLA 3M6XA 3VAMA 4F50A 2H65B 1EAYC 1JK9B 2CZVC 2QA4S 3MUVP 3POTB 3JSYA 2QA1A 4KRWA 1UVKA 4USJC 3UFCX 1TZ0A 1KLMA 2H5JB 1HNVA 2W2OP 2OKQA 1VQ4S 5KFCA 1HBOA 1WSRA 1DTQB 3KLHB 2D7SA 1LW0A 2PEHA 4NMXA 2BJEA 2J9CA 4DFMA 2HFOA 2DR8A 4WTOB 1HMVB 1HYSA 1SJRA 4LF9F 1UWAA 1FNXH 2WOMB 1KBRA 4QQBA 2QLWA 4YY3F 2MKHA 3KJVB 3DI6B 1G7CB 1K1QA 5CD4A 1CJKB 1S6UA 4Q0BB 5ETLA 1HNWF 1Q95G 1RI7A 4NXNJ 1HR0J 2DB1A 1YGYA 2NR0A 4QBUA 5GAEU 3KWMA 4OJGA 2VOPA 3FRYA 2XMWA 3KLIA 4OZJA 1U45A 1IWAA 4IDKA 3NNAA 2V4RA 3QLHA 3IC1A 3UDLA 4ZVPB 4WZQA 3Q2SC 2DD8S 2OPQB 5LSRA 3M8PA 1T05A 3Q2TC 2A10A 2KT2A 3R7BB 5EDWA 1S0VA 1MN7A 2XLIA 4DG1B 4C98A 4JYAJ 2MLYA 1FDDA 3AOAA 5IT9Y 1HWLA 4MIAA 1SJFA 3W60A 3C6UA 3RUBL 3OR2B 4NA1A 2IMWP 1FDAA 4ED3A 4V1Ak 4O3OA 1WC3A 1XEZA 3TUZC 3M2UB 1T9UA 2AIRB 2XZWA 1NK9A 1FESA 3PIOQ 4CWBA 1JLCA 3RTVA 4I1TA 4B3OA 1ZZNA 3AJ1A 5L1KA 4OL8A 2LXFA 2BJ8A 3PACA 1RCOB 5LL6d 1N5SA 1IJFB 2W7AA 2YH0A 4CM2A 3MM5A 2DGOA 3DLKB 1SKUB 4TXSA 4XK8C 3Q8VA 1F1BB 2XULA 2QGFB 5CD4H 2XCPA 2D9PA 5G4DA 3BS9A 1UVNA 1B7FA 1NH8A 1S1WA 1GXLA 4KIAA 1NHUA 5F3ZA 5KG0A 3BDEA 2ZH1A 2F8EX 1JLFA 1ZA2B 2W8LA 1ZTTA 5A76A 3QSYB 1VRUB 4KSEB 3T5JA 4CIOA 2JL9A 2HHQA 1HQEB 4MJKA 2KVQE 4A8QA 4WYWA 2EVZA 3RJMB 1CPZA 1Q81T 5E0OA 1JXLA 3Q86A 1VC5A 1KVJA 2BXJA 2VFVA 4E2FB 2XHCA 4DV5J 1AROP 4B9NA 4KPCA 2AJFE 3DM2A 2P6SA 1VDHA 4NLXA 3LPYA 4LRCA 2BJ3A 2D3ZA 5JVGQ 4K5RA 1SH2A 4J9NA 2GX8A 1NNDA 2CPIA 2W4DA 4DDFA 4ZLLA 1QLNA 2H4YB 4MYUA 2M8HA 3FSXA 3KUGA 3I31A 1N6QB 3MM8A 4RW9A 4AL6A 3IWXA 3I6PA 1YKWA 3D6FB 1RYSA 4CLTA 3CVKA 2XY6A 2JLGA 4LSNB 5HO4A 4RWXA 3J7YU 1VJQA 4PKDB 1ZETA 1QUVA 2QZ8A 4O3QA 2GQ2A 3TZYA 2CJAA 2X3GA 4JI5F 1UEKA 3ISZA 2QX0A 4KH1B 5GAEI 1HBMA 2YKAA 2L08A 1FI4A 2QA2A 4DPYA 3M4XA 3KJQB 2C3YA 1SH0A 1S99A 1OY8A 3R5AA 5D4NA 1ZBTA 1XTZA 1R6YA 4DCPB 3MM9B 4J91A 2R7QA 4PYDA 2VFSA 2GVDA 1B0TA 2BJ1A 4URSA 2C3OA 2MDAA 3D3CJ 6AT1B 1FFGB 1R8AA 2MSSA 5AJ3F 1K1SA 1G1XA 4TLRA 4DX6A 1QE1B 4Y2MA 3DHWC 1XR5A 2P9CA 4GVBA 4JI7J 4LF8J 1B0PA 2R8KA 2XZTB 2FC8A 4DPWA 4DCOB 3C8YA 2DR6A 1RTJA 2VUGA 1FRHA 2RDDA 3AH6A 5K8PA 3PCOB 2OI2A 1HHSA 3GJTB 3IFEA 5HVFA 1KKHA 3EDRB 4NOHA 3TQ1A 4P6QA 4C8NA 4WP9A 2VPYB 2Q79A 3H4DA 1T9VA 3KG0A 3E01A 4HTIA 1GX6A 4ED1A 2HQ3A 2QMUB 1TL3B 4NCBA 2FPHX 1UVIA 2I1RA 4QIEA 5JVHQ 1U1PA 1NH7A 4ZVHA 1HHTP 1GAOA 5GVQA 2DY9A 2J6SA 3V6KA 2KL8A 1MMDA 4P2SA 5D77A 3BJYA 1RT2B 2DYAA 2DPJA 3OL6A 4TU9A 5IFMA 1FHTA 1RTHA 5CQGA 5SUHA 1NZ8A 2MZRA 4ATNA 2W9AA 4DBQA 4EYIB 4C0BA 3RGIA 5BJRA 4W90B 3D4JA 4HI1A 1BQMA 2B9XA 1M5OC 1FERA 4AT1B 3IN5A 4Q2MA 1RWPB 2CPJA 2O5DA 4OI2A 1VJWA 4OZ1A 1PC4A 5HQMA 3OJSA 1N5VA 4MK9A 4NL5A 2MJUA 3M6UA 3QATA 1Q5VA 1UA1A 4IKAA 2ZDOA 2HQIA 4AXJA 4Y3CA 5IM0A 3CCLS 1YBAA 1FFWB 1FWPA 2DGVA 3NLCA 1Z2LA 4M8LA 3G9CA 2JVRA 4OI4A 1C1BB 4DOZA 2FVSA 2DHAA 2N3OA 3DLEA 3CC2S 4P71A 2ZITA 2RSQA 4UTGA 4JV0A 1FDNA 2BOPA 3EVOA 3CJKA 1N5QA 4IYQA 3D67A 3UDEA 5LXRA 2ZJQQ 3UD4P 2AEJA 4QW9A 1Q7YT 2BJDA 4QU6A 3NKYA 2AGOA 3G6YA 2FJVA 4ZCKA 5A6WA 1SB6A 1JLGB 2GO8A 2DIVA 3W2VB 4GO7X 2UXDF 2R8HA 3JB9k 4DR5F 4I69A 2ZVSA 2J76E 2FVPA 3IA0A 1AUSL 2V8GA 3ISNC 4LFCF 4EGLA 2V2QA 5FJ4A 3SI8A 4PQUB 3GCWP 1QVFR 2VG7B 4PWWA 2PSZA 4ES1A 1NPRA 3DGVA 1FJ7A 4ID5A 1ZOTA 3PY8A 3BPDA 1B70B 3G6VA 4L73A 2A6OA 1RT5B 2V0NA 1TKTB 9ATCB 2VQEF 2JNJA 3EZOA 5B0BA 4NYZA 4DV1F 3IAM9 1WORA 1NDCA 3W9JA 3TX8A 3OXGA 1VQYA 3US5A 5HVGA 3R27A 2BRKA 3MEEB 2EG1A 2AT1B 2JLFA 4XTTA 1JJ2R 4DQIA 2R9LA 2RKIA 2UUBF 3O1LA 2HRYA 1JLQA 2BJ7A 4XPEA 1TL5A 1E6VB 4ECSA 3U1LA 3I55S 4EWTA 3A12A 2XLJA 1TP7A 1R6VA 2KJWA 3N01A 4MKVA 3L7OA 2JVOA 3FSIA 5DO2A 3FNNA 4RUBA 1S9FA 2FVCA 1CULB 2PMHA 3OQ2A 5FLXU 1WTBA 3MR2A 4N8OA 1JLBB 4R0JA 3ZXWA 3MPWA 1Q8BA 7FDRA 3FEYB 4O0NA 5K9FA 3AJ2A 4X64J 1RT3A 1EP4A 2IYIA 1I6JA 2W4PA 1C1CB 3HHKA 2ZHAA 3HX9A 5CXTA 5HMYA 1NXIA 1WF0A 5F9NA 4RBTA 3QGHA 1OIAA 1UJ6A 3IRWP 2GQQA 5KG6A 2BUNA 4DV6J 4F25A 2WSFC 4ED6A 1J5EF 4DPUA 1N5YB 3A3NB 4EBEA 2CZ9A 2ZH6A 2DXDA 2XO6A 2QC3A 1M5VC 3AXKA 3D3BJ 2VQFJ 1RB0A 2CJBA 2DGSA 3AD8C 2ZHBA 2FLLA 4IH7A 2PFDA 1JLEA 1WEXA 1F2GA 5M2PA 1WHYA 1D9FA 1SVDA 1PBUA 3SFGA 4PG5A 2F40A 3W63A 2QLXA 3TAPA 2VF3A 4DF4A 3TA0A 4DX7A 2WVEA 5AE1A 4JI4F 3VGSA 3M32B 3H0PA 1SV5B 2X1AA 5AXNA 3MHYA 2FJAB 3N6NA 1XN9A 4GKJF 4J9VA 4LJMA 1MG7A 4ICLB 3BSAA 1ZPWX 3LW5C 5KTQA 2MLZA 4FXVA 3OTDA 2VFUA 2ZE2A 1VCTA 4DV7J 1SC6A 4LF5J 3M8WA 3V81B 1D1UA 5KFGA 4CLLA 2C1EB 1BHNA 1VK8A 2WONB 2MY7A 4ZJQA 1CJUA 2ZM6F 4NCGB 5ETSA 1CJVA 2VASA 2EC0A 2DEJA 4OLOA 4YDXA 1KR4A 1R0CB 4FVCA 4LSZB 3M2RB 3UN2A 4I2PB 1TFYA 2MHEA 1TV6A 4BBYA 3A8IA 2KH9A 2UXBJ 2ZKUA 2ZC4A 3PM9A 4V19X 1FNOA 3W8GA 2MB0B 5D78A 2YKQA 1RXOB 1FXLA 1OQ3A 2YWHA 4WFXA 1NSKL 3G2XA 3ZZPA 3BH7B 1B7YB 3FEZA 5IXUA 1EKSA 4CO4A 1HNZJ 4DHVA 1YK9A 3FZ2A 1WTFA 1UMJA 4OI1A 2N3LA 2Z0GA 3JAMY 4H54A 1VR6A 5EUHA 4ED8A 1NDPA 1UW4A 2ZBCA 1T9TA 2C2NA 2WVCA 4NZ0A 1FJGF 5HATA 1HR0F 5IC6B 1TKZB 1FKPA 4F3OA 3KHLA 3KHHA 4HTJA 1H72C 4FYYB 4E0DA 3E2EA 1DBDA 4JI0J 4FF4A 5J1PA 1VBKA 4DFKA 4CH1A 1N33J 1OYDA 1A6LA 1U49A 1YG0A 4BC9A 4G6VB 1RWVB 1UPMB 1ULRA 3BQ1A 4H4MB 4K8RA 2KM8C 4JV2A 1CEZA 1R8HA 1TMMA 4EO6A 3QYYA 4DV0J 2DR9A 2BEFA 3MDFA 2QIFA 4ZJLA 4JOUA 2ZUAA 3HI9A 2EG2A 2B8PA 1R3NA 5B0EA 3TI0A 2KHCA 2ROEA 1RGVA 3M05A 4TQSA 3GIKA 4WE1A 1ITPA 1S0OA 1XJWB 1BQNA 3ADAC 4ERDA 4CI0B 1T9YA 2K3IA 3TJ9A 3O2IA 4X4UA 2JHEA 3BKFA 4DV2J 4DR6F 3W66A 4JI1J 2MMYA 5B09A 3ZZUA 1P1TA 2J7WA 2Y0SD 4RKUC 4DSLA 3HF5A 2YWKA 2HWTA 3TJ8A 1S1TB 2DO0A 3CJRA 4DR1F 3LOUA 4NLSA 3TAMA 4OHWA 4JBCA 1HBNB 2ZH8A 4UZCA 4ZCMA 4UZBA 2ZZMA 2DNOA 1NUEA 1W25A 1Y3JA 4MT1A 3PYFA 3FGVA 3GONA 1UJ5A 2HIYA 4J9UE 2WTFA 3AT1B 3U02A 1WC4A 3B78A 4N5SA 3W2WB 3FEXB 4KGMA 4DU8A 1FE0A 3BO4A 3NOGA 2C22A 3ITHB 3V6JA 3CCSS 3J7Z5 3FDSA 1Y7PA 4YB6A 1NK0A 1VQLS 4HEA9 3NBPB 2VONA 2APOA 4JV1A 1KTQA 1RK8A 2RHSB 3HDSA 2MKIA 3PRBA 5K5MA 4O44A 4KGXB 3PG9A 2LXIA 5K20B 3SQGB 4IFYB 3S1TA 2KFZA 4WP8A 4CNZA 2VJVA 2YQ3A 2Y1JA 3DCAA 1EIYB 5KFNA 4P7VA 4X84A 3D54A 1T0TV 3PYDA 3HVWA 4CLKA 4RW9B 2CPFA 3IXQA 4ED4A 1RABB 4X4TA 4L75A 1WWHA 5HMWA 6FDRA 3LALA 5LSOA 3LP2B 1EB0A 3Q83A 2IBKA 1S49A 4UQGA 4F4XA 4DL0C 5J2NA 4USIA 1G3OA 2EBGA 4DR4J 2EPIA 3GR0A 1WKLA 4PZVA 3S8SA 2C2ZB 2FIUA 3R2DJ 2KTQA 1HBMB 3OTOJ 1OO0B 2ILYA 1JKHA 2I6WA 4DR7J 4N76A 1EARA 4EZ6A 2POKA 1FA0A 2ERRA 2E1RA 2YNGA 3G8TA 1R89A 2I5JA 1SBRA 9RUBA 4DS5A 1H7XA 3NOCA 3RRKA 1X5PA 5T41A 2DH7A 3BEGB 2CWXA 2P9GA 5KFPA 1KVKA 1HD1A 2V69A 4ZVEA 2MQMA 1RT6A 4AFFA 1SL1A 3TJAA 3TAQA 4JI7F 2C2MB 3NS6A 4LF8F 4ZN3A 1LWFB 3MR6A 2E9ZA 4C0HA 3ZZRA 4HACB 1PAEX 2DTJA 4RLEA 1RHRB 5DG9A 1RTJB 3ETMA 1RAGB 2B0GA 2RB7A 2Y3YA 4CO3A 4YUDA 3MM7A 3U1MA 4RW4B 1RISA 5JUMA 2D69A 3TZWA 3NCPA 4F04B 4RJVA 2R3VA 4AQYJ 3J81U 2HVZA 2UVWA 2BJ9A 3TP2A 2HIQA 1D0EA 4DX5A 5AE2A 3FFIA 5ITHA 4DXLA 3MMBB 4LRDA 5HVHA 4B9MA 5DQHA 1OWXA 1IKVB 4M1KA 5D15A 3IS9B 2AKWB 2MQOA 4X62J 3KJFB 2AX1A 1VRTB 5JMNA 1TKXB 5E7OB 3ENVA 4LR7A 2UV8G 4E8UA 1O8BA 3ICLA 2QMWA 3RW6A 3FBFA 3DRPB 2AJQA 3N5BA 4MK8A 5CYMA 3ETOA 1PGZA 2K8GA 2XS5A 2WVFA 4LFBF 1QY7A 3P8BB 3PRVA 1CSJA 4KGVB 3LF0A 2BE9B 2NLWA 3A13A 4HT7A 1V3SA 1QD1A 4KJIA 4X4QA 1C0UA 2QLFB 2Z2ZA 1PO6A 1LKZA 4ED5A 2KDOA 4YMEA 2OELA 3HXMA 1DLOA 4K4WA 2GAGC 3UD3P 4TN2A 4C3KA 2MZQA 1K73T 3K8WA 1RWKB 2RRAA 1F9EB 1S1UA 1S59A 5L9NA 3KDNA 4DPTA 4F4YA 2GA7A 4FS1A 2JFKA 1QTMA 4P7TA 1XMQF 1ZA1B 1IBLJ 2M88A 4FXDA 4LT6A 4TU7A 2PC6A 3R5GA 3HVAA 3R9LA 1RE1B 1WSVA 2OP5A 3B6BA 4C0OC 4J9RA 1JNZB 4U7UK 3PTWA 1WG1A 3GR1A 4R25A 5KFDA 4OX9J 1KQFB 2OPRB 2ZOMA 1YHQS 1RWMB 3DDKA 2W9CB 8RUCA 3FRZA 1CLFA 2KYZA 1UWBA 1WDTA 2ZBQA 2IRYA 3IG1B 5DQGA 3L95X 3CWJA 4NLUA 1W2BR 2Q6CA 3GJQB 2XWXA 5KFSA 4IG3B 4WPAA 1W7WA 5KOWA 3N0VA 2O01C 3IBWA 3PR5B 2MSTA 3H5XA 4UOFA 2KB2A 3JSBA 2ATCB 1F5BA 3C6TB 3JTPA 1S77D 2M7SA 3TUPA 3O44A 2UXCJ 2W9BA 4LF4F 4B3RF 1T9WA 1SIZA 1D09B 1YIJS 2VC1A 1TL1A 4L3NA 4OJHA 4RX6A 3W61A 3TEHB 3D6TB 1H2VZ 2W01A 3UCUP 2DY1A 1NBEB 2OAUA 1RAEB 3NY0A 5B7WA 4PQAA 3PO4A 5G0RA 3OUYB 5L46A 4OYWA 4RW7B 5HJXA 2DGWA 5KFIA 3CMQA 3A8JA 4CO1A 2OFHX 1HWJA 5KFFA 4OYBA 4ZPVR 2YH1A 1R8BA 5KFMA 2EK6A 5IT9U 3JYTA 3N9UC 2BYCA 3MR3A 3RB6A 3GJSB 4HHHA 4L74A 4M5GA 2GQCA 3QGPA 4F4ZA 3H2UB 2YNFB 1X0PA 4A8FA 3AA8A 1S57A 3CDEA 2KRRA 3OLAA 4DL6A 2B8QA 1SKSA 1O51A 4ECQA 5DZ6A 2DK2A 3H98A 2D3OR 1Q7LB 4X64F 1T94A 3LAKA 2RD5C 3HPOA 5HLFA 4BC7A 1RT3B 2GMLA 2C2OB 4L3KA 1NJWA 2VBZA 1VQMS 3EGWB 3H20A 4FYDA 1K0VA 4NCAA 1WOSA 3M30B 4YR3A 2I38A 4DV6F 1I3OB 4R5PA 1IQZA 1VIOA 3PW0A 2NZ4A 5D0HA 3FSYA 1T11A 2B4PA 4ES3A 4X66J 4DV3F 4NXMF 4FF3A 2VQFF 1REVA 2YNIB 5J2PB 2G4BA 1PAUB 1M5KC 1S1XA 4I6YA 3GIRA 1FXDA 3BN4A 2DHSA 3G96A 1XWLA 4NRUA 3Q8RB 5LMUF 3CTRA 1N36J 1DTTA 4KHPJ 3E51A 4UW2A 1I94J 3I9ZA 4FYXB 1TVRA 2MGZA 3IRXA 3CPWR 2ZFHA 3IR6B 2YX4A 1RDRA 4DLEA 1U1KA 1T03A 2DRDA 5A8KB 1KFSA 4DV7F 2AYGA 5E5NA 1OPIA 2VU5A 2ZH4A 4LF5F 4W98A 2R7VA 2CNOB 3SSQA 4DL7A 1Y11A 5KT6A 4DMZA 3BM7A 2KXHA 4ECVA 1APSA 3NP5A 2BANA 2OPSB 2HURA 1QAYA 2HFNA 2WAQD 3QT7A 3V6DB 4ELTA 2ZC3A 4J90A 3MUTP 3K59A 2RDIA 4KO0B 1NPKA 2PDAA 3CE8A 3THPA 1AT1B 1R0AA 2M2BA 4ZP6A 5F0WA 1ZYQA 2ZBPA 4PWUA 3HM9A 3Q8SB 1KEKA 2KT3A 4G1PA 4RU9A 2Y8WA 4GKKJ 4Q44A 5C25A 3I56S 3H40A 1LWCB 2DCUB 3CCZA 2W2MP 2B9YA 3BB5A 5E2QA 2VV5A 4ANDA 2J7UA 1XMOJ 1H0HB 1WG5A 3MEGB 3I4HX 5CCMA 4HHUA 2KFYA 1LQ9A 1LW2B 2B4VA 4BWMA 4QIWD 1S6QA 4DEZA 5D4OA 1VQNS 4DL4A 3V4IB 3K5MA 2GHPA 4P9SA 2ZHOA 2MZSA 1D9AA 3L3CA 3QRRA 4ZVSB 5KFTA 2WVBA 2EKNA 5DDPC 2BQ3A 1NJZA 1YJRA 2QO3A 1N54B 2G1DA 3QIDA 2OUGA 3UCGA 3I0RB 3ET6A 3T6JA 2V63A 3LAMA 3M2VB 3PKMA 1R31A 2RF2B 1V5IB 3IGVA 4ZMMA 1RT4A 5DG7A 1JXVA 3ILOA 3O8WA 4KGZB 3S6EA 1X60A 4O3RA 3CNQP 1IVZA 1GTHA 1UVMA 1RLCL 1T02A 3DOMA 4YR2A 4LUBA 3MAAA 4PXDA 4FNIA 3VV2B 3C3LA 3NWGA 2HW3A 2GS8A 3BKUA 1Q53A 4KKOA 5CYJA 1DZ5A 4CLWA 4M5KA 1VFJA 4ZDNA 4ILRA 2PGCA 1KQKA 1JXEA 2GJFA 4K4SA 2HNDA 1YJTA 2ZJRQ 1QUPA 4DV2F 2R2UA 2FHMA 4KE5A 2H51B 1HARA 2BQUA 4DSIA 2H1YA 2ZVIA 3OTCA 2ZD1B 2W7OA 2DGTA 4IFVB 1X4FA 3RZAA 1KRPA 5A8RA 4HLBA 2F4VF 1U26A 4FP9A 3KLFA 1TL7B 1RUSA 1KS2A 1U6BA 2DJWA 4H4OB 2PO4A 2J5AA 3NGSA 5IZHA 1IM6A 4P10A 3T5HA 2C3UA 3UR0A 1V6HA 5KFRA 4OV6A 4I7FB 1AZSA 3NWRA 3OR1B 4QWDA 3DRSB 2FUG9 2EEYA 2YNHA 2QEXS 4B3SF 3C14B 2G0IA 4OX6A 4CTAB 5IQ6A 3ZFVA 1Y0HA 1X5TA 1NSPA 4B3MJ 4IQMA 2XNQA 4CYUA 1U2RA 3C66A 2OD4A 3A1YG 2IAJA 1WEZA 1WDDA 5F8IA 3GZ7A 1H6KX 2V4JA 3OXLA 4A8YA 1X5SA 1Q86T 3KMQA 5ETNA 4DR2J 4A48A 1U25A 2C2RA 5C7PA 4I4BA 4AL7A 4CO2A 3ILIA 2UV8A 4Y28C 1K0TA 5LJ3Y 1VRQC 3QFHA 2W8KA 3FKBA 4E98A 1C4CA 3KJNB 3EUNA 3BYRA 2XYHB 3Q8PB 4DQSA 2GZOA 1TUWA 1F9FA 2DNRA 2YKNB 4ZHRA 2KKHA 3EXYA 1OMSA 2PT0A 2V94A 3BO2A 3CCQS 1V3RA 4TY8B 4NASA 3W65A 2Y1IA 2OPPB 4I6AA 2MZJA 2E44A 2AGPA 2YVSA 3MPVA 3Q8YA 2BDPA 3QRQA 3MEDA 2DISA 2Z8QA 3SZ2A 1S72S 2DGUA 3VR1A 5M2RA 5EWEA 3HHDA 4PG4A 4FBTA 2WK4A 3BDPA 4WXWA 2W4CA 2P5VA 3EWGA 5C42B 1IKXA 1WD6A 2NYIA 4ES2A 3I5BA 4MFBB 3ENQA 2DGQA 3K17A 4D3HA 3HFZB 4I64A 1S10A 3GV7B 3OL9A 4G3IA 2UU9J 3R6GB 4ZCIA 3R5BA 1CC7A 2LEPA 3PFOA 1EQMA 3BGRB 4OYMA 3AOBA 4Y2AA 1TUVA 1NB2A 2F9DA 1VQ7S 3EJMA 1U4BA 2OEJA 2DR7A 2VPZB 3FMWA 1XERA 2JEFA 2CKWA 2DGXA 3HKZD 4TKTA 3UE2A 1RAOA 4W4MA 2XNRA 3BR9A 1IKWB 2M0GB 1S4FA 4QWCA 4USTA 3QGIA 2A1BA 1OQ6A 2AZ3A 3Q0AA 2V8PA 1EHWA 1RP5A 4NI2B 3OTBA 4Z2XA 4MH8A 4A8MP 5IT0A 2RH3A 3D0HE 2ZOGA 1HBUB 3UDCA 1SJ4P 3FFIB 1U48A 2ASLA 4DUYF 1RWUA 4NLPA 1RACB 2AJ1A 3WBZA 1D3WA 4FBUA 2G0JA 3KG1A 3I0SA 4OJ3A 5KFKA 5B0FA 3G6ES 4CZCA 2E1PA 2IFXA 2Z57B 4M5LA 2MXYA 2F65A 2QV6A 2QRRA 4LBPA 1TQLA 2UZAA 5ETMA 1CS4B 1KC8T 3J7AN 4R8UA 5CYMB 2XLKA 3HT0A 3DMJB 5T7LA 3VZIA 1PILA 3PJWA 3V2UC 2DNGA 1EETB 3R1LA 4MAKA 2O1PA 2JZ5A 4YS2A 4J9MA 1TTHB 2WW4A 3QIPA 2ACYA 4RW8B 1C0UB 1IKYB 5EGYA 1SL2A 4X4PA 2LYVA 2K1RB 3KFWX 3UQSA 4KHRA 2W7PA 2RU3A 3MCOA 2XWYA 1PCAA 2CQBA 4G1QA 1S1VA 1GEHA 5D0EA 3KKFA 1RA6A 1E6YB 3ZZYA 3MMCB 3R97A 1RTIB 3I87A 4F36A 4LR9A 2N82B 1S7HA 4A8KA 2VG6B 2CUYA 2HKEA 2PI5A 2F7VA 3U1NA 4CO5A 4X4SA 4M5DA 1WNEA 3LP0B 2PN6A 2Y1RI 1M1GA 4USHA 2CPHA 3D2WA 3GP9A 3C15A 3D5MA 1T7PA 5JJBA 2R7SA 1DRZA 3KG4A 4ZVGA 5EWGA 1RJJA 1CJTA 4ED7A 1LV5A 4FS2A 3HHLD 4OZ3A 3GPAA 1WOPA 5C24A 4B9LA 1RHJB 1SKRA 3I5CA 1R43A 5ETRA 1S7IA 5FDLA 2J9EA 5K14A 5LOQA 3LP1A 4IG0A 2HRTA 2UUWA 3QO9B 1Z2ZA 3JAMU 4S0MA 3ULHA 1FE4A 1WI8A 4ZKAA 4TYAA 1HPZA 3AB2B 1EQ0A 2LMIA 2IM0A 2E5HA 2H5EA 2LQ8A 3EZUA 1N56A 2UVVA 1CBKA 3EICA 2K7KA 4AL5A 4ID8A 1A0OB 1LWEA 2Q43A 3TVKA 1SXLA 3V5RA 4K59A 5KFHA 4DSKA 2RAQA 1N8RT 3NL0A 3QT6A 5F8GA 3CW2C 3KLEB 3CCWA 4AXIA 1Y5IB 3MECB 4M94A 4M5HA 3THTA 4LF7J 2IRXA 3ILJA 4XAKA 1S48A 2LU2A 5KT4A 4EBCA 4CLZA 2ZH5A 2R7RA 2ZKTA 4C8KA 5HROA 3ENAA 1HNIB 2DPIA 3EE3A 1VOMA 1L3KA 4KV8A 5IQQA 5SZTA 3KMSA 3DDNA 5KFEA 2B5JB 4N56A 2X1BA 1KQGB 1U0HB 5IWAJ 1NJYA 2JC1A 1L3TA 2H4WB 5IT4A 3A8KA 3EPGA 1ZTWA 1MWZA 5D3GA 4OHYA 1UFWA 3CSKA 1GK8A 3N4WA 2JOQA 4X65F 4PABA 3W64A 1GQEA 2HS4A 3BR8A 3U27A 2HBZB 4ZLNA 4WIIA 1SJ3P 3HFKA 5D4PA 4PEOA 4Q5VA 1C4AA 1RAJA 1WG4A 1XR7A 1LOUA 3MZIA 2LLZA 4K4XA 1O6XA 1FK9A 4X66F 1N32F 2OTJS 3WX8A 1JLAB 2UUAJ 2DEIA 2ZH2A 5GMEA 1CVJA 3S7RA 1DTTB 1ZZFA 4KHPF 1RQ0A 4JUZA 3VF0B 1Y5LB 2HHUA 3RRGA 2DNLA 2E5JA 4OZ2A 3CC7S 3GSIA 4P72A 3IRXB 1PYTA 3CIMA 1NM2A 4QIFA 2BKPA 2J8SA 2M5YA 4Q8FA 5A0YA 1NCLA 1UEUA 3CJSA 3HKWA 2V2KA 2GNKA 1YZ7A 3JSMB 2EI5A 3HT3A 4DQQA 3CDAA 3JQJA 1FF2A 4DF8A 5H9EK 2HQCA 3R8YA 2KM8B 4B3TJ 4JI3F 2YX7A 1H98A 2RILA 1RAHB 1OSCA 3T41A 2HNYA 3MR7A 1S76D 2AYEA 4O4GA 2GW8A 3K0JA 3PRDA 4F4WA 2M8DB 2CG8A 4RNNA 2HHHJ 2IPOB 1ROFA 4ETXA 2VG5B 4FPRA 1Y00A 1GMWD 2I2YA 2DXFA 2J7KA 4RW6B 2K2PA 4LRAA 3UNGC 3MTKA 3SQOP 5BYRA 1PG5B 1UEVA 1VLOA 5LM7E 3H59A 2OHDA 2IY5B 5KG3A 4X4OA 4DUZJ 2C3PA 1GMUA 3OV7A 1IUJA 5E3QA 1UZHA 2R7XA 3F73A 3FJ2A 2BR0A 2XB2D 3NG8A 1W2IA 3M9OB 3UI3A 3DOLB 4IH6A 1MU2A 2HVIA 1HNXF 4MK7A 2XM3A 3C19A 1PBAA 1VGYA 4KB7A 2H48B 3VAFA 2CG4A 1PSDA 4JI8F 3HHLA 5D6GA 1YQHA 3DC2A 3DGPB 3ZTQA 3OPKA 3BPSP 3GFZA 3DXBA 1FX4A 4ZITA 3G4SS 3KLGB 3HSGA 2VBYA 2WSCC
chains in the Genus database with same CATH topology
1WWHA 5HMWA 2CQPA 1F5CA 4KT0C 1N34F 3MM6B 6FDRA 3LALA 4V19J 4MKAA 2LEAA 5LSOA 1AXQA 3LP2B 2MZTA 1RT4B 3CJ2A 4K4VA 4OMFG 1VQ5S 3SXLA 5DETA 3KK2B 2IBKA 3SSSA 2VA2A 3I82A 5AXKA 1S49A 4DV4F 4UQGA 4D3GA 4F4XA 4DL0C 2N7CA 5J2NA 4USIA 3G6XA 1S9EB 1G3OA 3MR5A 2EBGA 2EPIA 2ZE2B 3GR0A 3OUYA 3S8SA 4OZ5A 2FIUA 3N5FA 3OHAA 1J5OB 3H8YA 1DQAA 3J7ZT 4Q2LA 1LWEB 2CJQA 4RW7A 2KTQA 2KYXA 2FHJA 2V8VA 1HBMB 1OO0B 2W25A 1FKOA 2ILYA 3IAS9 1BY9A 4U7CA 1FRLA 4Y2KA 3H5SA 3LWMA 5MAOA 2DNZA 1JKHA 1SI9A 2L3MA 3POTA 4G1IA 5DGAA 4N76A 4EZ6A 2AF6A 4KKOB 4EEYA 2VFRA 2POKA 2AD9A 5EX0A 2E9TA 1FA0A 2ERRA 2E1RA 2OFGX 3M8QB 1GH8A 1LFPA 1HW8A 2YNGA 4ELUA 5A2QY 2VKZG 3G8TA 4DFPA 1FRXA 1R89A 2RNEA 4LF7F 2I5JA 2EKYA 4UUWA 1SBRA 4F2SA 2YNFA 2XI3A 3OBIA 1FVSA 4ECYA 3LH2S 2BW2A 2E1MC 2NSBA 5L1JA 1DTQA 2O67A 4ZPDA 5DGBA 4DS5A 2B4UA 3KLHA 1Q1KA 2CJKA 2J6TA 1QAXA 3CJ3A 1H7XA 4J9KA 5L9XA 1KFDA 4K4UA 3KK3B 3D28A 1RT7B 2RQCA 1NK8A 3RRKA 1VQSA 2FB0A 1S9GA 2MQLA 1X5PA 2BABA 5T41A 2DH7A 3BEGB 1HMVA 2P9GA 3MF5A 2HGMA 4URQU 5HROB 3CF5Q 2UXBF 5KFPA 4JI6F 1TV6B 3O5TB 2WOMA 3QAUA 2C2DA 4ZVEA 4BDPA 1HD1A 4NX9A 2MQMA 1HI0P 1RT6A 1L3SA 2ZZNA 4OHVA 3M6VA 4WU3A 5A8RB 3KJVA 3JTNA 4C11A 2E5GA 3EGZA 2F1FA 3DI6A 4YQWA 2HNZB 2R7UA 2HGLA 2RQMA 2KVIA 4AFFA 3BO3A 1SL1A 3HJFA 3P6YC 4M63A 2O66A 1H3DA 5IWAF 5CA5A 4I56A 4C2MA 4Q0BA 3TAQA 2XMKA 2YX1A 4B9UA 4KBIA 4JI7F 1NB7A 3SYZA 1XNQF 2X51A 3NS6A 4WK3A 4LF8F 4YOEA 1LWFB 1VLYA 3MR6A 2E9ZA 3D1HA 4B08A 3BQ2A 2EBEA 1T3NA 3HHEA 3B4DA 1GXUA 5BYQA 1KONA 3M30A 1KQSR 4C0HA 4EBDA 3WDOA 1HNZF 5B08A 3ZZRA 1DFDA 2DTJA 2JRSA 1YVFA 4RLEA 2C42A 1C0TB 2CQDA 4QJVA 2JFDA 2C28A 3HP6A 2A3JA 5DG9A 1RTJB 4I0WA 2B0GA 2RB7A 3GG0A 1A9NB 3CDWA 1SJQA 1WACA 2IC3A 1SUQB 2YNIA 3SFUA 1M0SA 1NO8A 4LVOP 3SCKE 4CO3A 4YUDA 3PR4A 3VAHA 5J2PA 3MM7A 2ILZA 4N77A 3CJ0A 1Q82T 3U1MA 2AYMA 2BA9A 2WHOA 3T19A 4BS2A 2LQBA 5KFQA 4N41A 1XBWA 2B43A 2P9EA 1YWXA 1M5PC 1KOOA 2I8EA 2NUUG 3H5UA 4RW4B 1N5TA 3MFIA 4ECUA 1RISA 5JUMA 1ZAXA 1NZAA 4K0KF 2DNQA 1RT1A 3NCPA 5J2QB 2HMIA 4F4KA 2PIIA 4RNFA 3CD7A 3HVTB 1V3ZA 2HVZA 2G0CA 3G86A 2UVWA 3GMGA 1FKPB 1VC0A 3CXCR 3HZEA 1FK9B 2ASDA 4DL5A 4NLYA 2OPQA 2V4JB 3N6MA 4J5OA 4B17A 2OIHA 3TP2A 4DQRA 4JI0F 2HIQA 4DQPA 2DNNA 5DS7A 4DG1A 2UUAF 1D0EA 4PPZA 4ETZA 5AE2A 3PO5A 1JJ4A 1N33F 3NMAA 3FFIA 4WFBQ 3H25A 4ZPTR 2CQ4A 3T9ZA 2IHR1 2FJWA 1DJ0A 1RT5A 5ITHA 5J1EA 1FTCA 4EYHB 4BCAA 3CCUS 3UR3C 3OR2A 2GFFA 2CQ2A 3MMBB 4EU0A 3X1LB 1IQTA 5CYQA 2NSCA 5A8KA 4B9MA 5DQHA 1OWXA 4MIWA 2COLA 5GADU 1IKVB 4M1KA 1Y9OA 3IS9B 4TU8A 2MQOA 5I42A 3TANA 3MMJA 4C7QA 2JC0A 3DU6A 2AX1A 4NPOA 4CQ1A 5KT3A 3M2UA 1VRTB 3PW2A 4F2RA 4QIGA 4RNHA 1TKXB 4N8NA 5E7OB 2L9DA 3SMZA 2KG0A 2FY1A 2P6TA 2BVZA 2VBXA 4DV0F 4ZHRB 1Y3KA 2XMMA 3ENVA 2OPSA 3FQLA 3S01A 2YKOA 3PVXA 2UV8G 4E8UA 1VQOS 2KJVA 1VMBA 2V8DA 1D9DA 1O8BA 3ICLA 2AV5A 2QMWA 1U24A 5I3QA 3RW6A 3CCVS 3DRPB 3DOKB 3V6DA 1HWIA 2OLWA 4NA3A 2AJQA 1JIHA 3N5BA 4MK8A 5CYMA 1Q79A 2QMXA 3KLVA 2JEGA 4CNYA 1SL0A 2R8GA 3ETOA 5A0YB 4R0EA 1PGZA 2K8GA 2XS5A 4LFBF 1E6VA 1QY7A 2WSEC 1VBZA 3TUIC 1WI6A 1CSJA 4KO0A 1S79A 3P5TL 1VIXA 2XSFA 3LF0A 3DLKA 4IRCA 1PC5A 4WE1B 2NLWA 2LVWA 4HT7A 2ZH7A 2ADBA 1V3SA 3GQCA 4WKRA 4NLTA 3OVSA 2FLNA 2QSFA 3AQOA 1X4CA 1BQNB 3CO9A 5A8WA 4MMOA 4C3LA 4X4QA 4KJIA 1C0UA 1PO6A 1LKZA 4B3TF 5KT7A 2KDOA 4YMEA 4ED5A 2R7TA 2E1AA 3HXMA 2HG4A 1DLOA 1XK8A 4AUKA 1IJEB 4JI1F 4K4WA 5L38A 2BACA 3DRRA 1FJEB 1N0UA 2U1AA 2ZBIA 3UD3P 1F0XA 1MROB 4TN2A 4EFAC 1N0VC 1X4HA 4C3KA 2MZQA 3AQPA 3GSDA 3HMJG 2XC9A 1HI8A 2NREA 1K73T 1LWCA 3K8WA 3MTJA 3MAHA 2HNYB 1HA1A 1RTDB 2KFNA 5T14A 4O4GB 2V4QA 2RRAA 4YHHF 1H38A 1S1UA 3HLUA 5GAGU 3OSPA 5L9NA 4OHZA 5F8JA 1VRUA 1YRUA 2B4OA 3TAMB 4DLGA 2HHHF 2CJ9A 4F4YA 2GIRA 2UUCF 1L3UA 1HQEA 2XSJB 3RB0A 2GA7A 3MEGA 4FS1A 2JFKA 1QTMA 4HDGA 3LQVA 4P7TA 1S6PB 4ZP7A 1LW2A 1XMQF 1FKAF 3J81Y 1ZM9A 5KG7A 2M88A 3RBEA 4C8LA 2DITA 2HWIA 4FXDA 1NAQA 2D3UA 2DIUA 2JWNA 3AHPA 4LT6A 4DFJA 2AGQA 4FNHA 4DR3F 4LSLA 4RNOA 4TU7A 1R27B 4KC5A 1MW7A 3IO1A 2PC6A 3V4IA 3HVAA 1YJVA 1VHFA 2AU0A 5I3UB 1P6TA 2ASYA 3DNCA 4DL2A 4HDHA 2H9ZA 2OP5A 4PWDA 1P8GA 2HLUA 1JNZB 3FQKA 3PXGa 4C0OC 4J9RA 4U7UK 2D1CA 2IVMA 3OSNA 3CC4S 2FHOB 1NEEA 5BR8F 2XGPA 2CQ0A 3DLGB 1WG1A 2YWEA 3GR1A 3HHLC 2L9WA 4R25A 5KFDA 5HP1A 2AWZA 2HZCA 1KQFB 4DUZF 2OPRB 2L9NA 3DXSX 2MKSA 2ZOMA 1U1QA 2KHDA 1YHQS 1X9WA 3DDKA 2W9CB 2JEIA 3FRZA 1CLFA 2KYZA 1UWBA 5H9EJ 3VALA 4ZOSA 3I4PA 3K57A 2KZZA 3V4MA 1SIWB 3M9MB 4L72B 2IRYA 3IG1B 5DQGA 3PX0A 2XEXA 4YEAA 2DR5A 2E9RX 4O3SA 4HL9A 4Y6IA 3L95X 5DQIA 3CWJA 2B6AA 2E5LF 4NLUA 1W2BR 3DLHA 4DS4A 4X2BA 1RA7A 2Q6CA 5HBMB 3I0RA 1N6QA 2XWXA 2VH7A 5KFSA 4IG3B 4BHQA 1DAXA 3V6HA 4HKQA 4F3QA 3M2VA 1MU2B 1GX5A 3J80Y