1FJGI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1fjgI00
5LMNI 4YHHE 3WU3A 2UUBE 1HNXE 2HHHE 1ELOA 3K17A 5BR8E 4DPWA 4GKKI 4USMA 4JI2I 4NXNE 1FJGI 1OJ4A 2V34A 1KKHA 4GKJE 2HFUA 1XMOE 2HKEA 2HKJA 4DV4I 4EMDA 3WU6A 3F0NA 3JAMQ 2VF3A 4JI1E 1HNXI 4JI1I 4YHHI 2V2QA 4DR2E 2UUCE 4DR7I 2J7KA 4JI5I 4UTGA 4P7AA 2GS8A 1Z0CA 4DPTA 1N33I 2BV3A 4JI4E 4URLA 3J81C 3J81Q 4DPUA 4DR3E 4DR1I 2ZBKB 2HK3A 4HY1A 4DR5I 1XNRE 4LF8E 1B63A 1XNRI 2X7IA 1H74A 1H7SA 2CZ9A 4LFBE 1NHHA 4LFAI 4DV2I 4LF6I 1Z5CA 3K1JA 4B3TE 1XNQI 4R1FA 2X36A 1XHKA 4WUCA 1U2RA 1A6FA 5IT9C 4LF7I 1BKNA 1HNZI 2UU9E 3QT6A 1Z0TA 1ZXMA 2Q2EB 2VQEE 4X64E 4DR4E 4DR4I 4XTJA 1S4EA 3QT5A 4LF4I 1Z0VA 4FWDA 1QZRA 1PIEA 1XMOI 4DV0I 4PU9A 3J7AG 4JG4A 2A2CA 4DV4E 4X66I 3V5RA 1NHIA 5A2QQ 4LF5E 3B82A 4ZVIA 4JI8E 3JAMC 1I94E 4DV7E 1N0VC 4X65E 1J5EI 4JI2E 1FJGE 4LFAE 3PYEA 1UEKA 4X64I 2UUBI 4KQVA 3T1YI 1IBME 4LFBI 4JI6E 1N32I 1HNZE 2UXDE 1N36E 3QT8A 4HYMA 3CWVA 1FKAE 2WW4A 2UXCI 3LPSA 4USKA 4DU8A 3ZZUA 1HNWE 2F4VI 1VISA 4DR7E 1IBLI 1RR9A 4DR1E 3ZKDA 1Z0GA 1D6TA 4PRVA 3GONA 4I3HA 4DV3E 1EA6A 2DEIA 3T1HE 2UXBI 4B3SE 4DUYE 4JI7I 2UUAE 4FWGA 5LMUI 2VQFI 1XMQI 1N36I 1K47A 3ZZ0A 3Q1QA 4WUDA 4JI4I 4MYTA 3ZZTA 4DXLA 1NHJA 2R42A 1IBMI 2OI2A 4DV5I 4LF9E 1FWKA 3WU4A 4DV3I 4FW9A 4OX9I 3OTOI 2E5LE 1EI1A 3OTOE 4JI3E 3H4LA 3PYGA 1Z59A 2ZM6I 4RPFA 1HR0E 5GMDA 4X62I 1HR0I 1N0UA 2V2VA 1FI4A 1ZXNA 4X66E 4DV1E 5IWAI 4DV2E 4LF6E 3J80Q 4HXZA 1KTVA 2AJ4A 4GKKE 4Z7YA 3WU5A 4DR3I 1B62A 4JI8I 2UXDI 4DV6I 4KHPE 5IWAE 1Z0WA 4DPXA 3ZKBA 1Z5AA 4FN5A 4LF9I 2VQFE 4K0KI 1PKPA 1ZM9A 3J80C 1NZ0A 3T1YE 4NXNI 1ZM3A 2E1RA 4B3TI 4LF4E 1H7UA 4P52A 2UUCI 3V2UC 4PRXA 3LTOA 3T1HI 4JYAE 2BM1A 4YY3E 3PYDA 1IBKI 4JI0I 4JI0E 4X65I 1J5EE 4DUZI 1I94I 1N34E 2HK2A 2A2DA 2F4VE 4FWHA 1Z0BA 4DR5E 4UT4A 4GKJI 4ED4A 4JI6I 1N32E 4YY3I 4B3SI 4AQYE 3HULA 4DV7I 1WUUA 2HHHI 2UXCE 1Z0EA 1N34I 2UU9I 1MG7A 2NPFA 1RREA 5IT9Q 4WUBA 1ZM4A 4LFCI 4B3RE 4K0KE 4DV1I 2V8PA 2LJPA 5FLXC 1KIJA 1MU5A 5GMEA 4JI7E 1KVKA 4JI3I 4JV5I 1XNQE 1PVGA 4DU7A 4HACB 1DARA 5LMUE 1XMQE 5LMNE 4B3MI 4X62E 4DR2I 1HNWI 4LF7E 5LL6R 4Z7CA 5L3JA 4B3ME 2EFGA 3D4JA 1FWLA 4JI5E 4LFCE 2E5LI 2V2ZA 4DUYI 5FLXQ 1N33E 2ZITA 4M1KA 2UUAI 4DR6I 1FNMA 3QT7A 3LNUA 4NXME 1MX0A 4NXMI 1S16A 1Z5BA 2VQEI 3B8HA 4JYAI 3B78A 4MYUA 4DV5E 4OX9E 1H73A 2BM0A 2R3VA 3M6AA 3ZM7A 3J7AM 1H72C 5BR8I 4HACA 1ZM2A 3PYFA 4B3RI 1IBLE 2DEJA 4DR6E 2HFSA 4DV0E 2UXBE 4DPYA 2XEXA 2ZM6E 4LF5I 4DV6E 4KHPI 5A2QC 4DUZE 4AQYI 4LF8I 4JV5E 1IBKE
chains in the Genus database with same CATH superfamily
5LMNI 2AE8A 4YHHE 3WU3A 2NN6A 2UUBE 5K36C 1HNXE 3P76A 2HHHE 1ELOA 3K17A 5BR8E 4DPWA 4GKKI 4USMA 4JI2I 4NXNE 1FJGI 1OJ4A 2V34A 1KKHA 4GKJE 3CDIA 2HFUA 1XMOE 2HKEA 2HKJA 4DV4I 4FW5A 4EMDA 3WU6A 3PS2A 3F0NA 4QNKA 3JAMQ 2VF3A 4JI1E 2O1VA 3PRYA 1HNXI 4OO1B 3Q6NA 4JI1I 4YHHI 1R6LA 2O1WA 2V2QA 4DR2E 2UUCE 5K36D 4DR7I 2J7KA 4JI5I 4UTGA 1OYPA 4P7AA 2GS8A 1Z0CA 2C38A 4DPTA 1N33I 3M85D 4AIDA 2BV3A 2JE6A 3PS3A 4JI4E 4URLA 4IZKA 2PNMA 3J81C 2NN6D 3J81Q 4DPUA 5DRPA 1YH8A 2PO0B 4DR3E 2IESA 4DR1I 2ZBKB 2HK3A 4HY1A 4DR5I 1XNRE 4LF8E 4IFDF 1B63A 4IFDD 1RHYA 1XNRI 4IFDC 2X7IA 1H74A 1H7SA 2CZ9A 4LFBE 1NHHA 4IFDE 4LFAI 4DV2I 4LF6I 2BA1D 2J65A 1Z5CA 4OO1C 3DD6A 3K1JA 2C39A 5C0XE 4B3TE 1XNQI 2Z5BA 4OO1A 4LCFA 4R1FA 2X36A 1E3PA 1XHKA 4WUCA 4ISAA 1U2RA 1A6FA 5IT9C 4LF7I 1BKNA 2BA0G 2C39B 1HNZI 2UU9E 4BA1A 2JEBA 5C0XB 3QT6A 1Z0TA 1ZXMA 2Q2EB 2VQEE 2BA0D 4X64E 2Z5CB 2BR2A 4DR4E 4DR4I 1Y4UA 5K36E 4XTJA 1S4EA 3QT5A 2C37B 4MU4A 4LF4I 1YHCA 1Z0VA 4FWDA 1QZRA 1PIEA 1XMOI 4DV0I 4PU9A 3J7AG 2O1UA 5DRQA 4JG4A 1Y5YA 2A2CA 4DV4E 4X66I 3V5RA 3L7ZB 1NHIA 5A2QQ 4LF5E 2C38B 3B82A 5C0XF 4ZVIA 2O1TA 4JI8E 3JAMC 1I94E 2WP8A 4DV7E 1N0VC 2PO1A 4X65E 1J5EI 1E3HA 4JI2E 1FJGE 4LFAE 3PYEA 1UEKA 4X64I 4OZEA 2IOPA 2UUBI 2PNZA 4KQVA 3T1YI 1IBME 4LFBI 4NBQA 4OO1F 5DROA 4OO1D 4MU3A 4JI6E 1N32I 1HNZE 2UXDE 1N36E 3QT8A 5K36B 4HYMA 5JEAB 3CWVA 1FKAE 2WW4A 2UXCI 3NZKA 3LPSA 4USKA 4DU8A 3ZZUA 1HNWE 2F4VI 1VISA 4DR7E 1RR9A 4DR1E 1IBLI 3ZKDA 1Z0GA 4FW4A 4PRVA 1D6TA 4GQUA 2NN6B 3GONA 3U1YA 4I3HA 3L7ZA 4DV3E 1EA6A 2JE6B 2Z5CA 2DEIA 3T1HE 2UXBI 4B3SE 4J3DA 4DUYE 4JI7I 4IFDB 2UUAE 4FWGA 5LMUI 2VQFI 1XMQI 1HK7A 1N36I 1K47A 3ZZ0A 3Q1QA 4BA2B 4WUDA 4JI4I 4MYTA 4AM3A 2GQ0A 1USVA 3ZZTA 4DXLA 4QNJA 2GO3A 1NHJA 2R42A 1USUA 1IBMI 2OI2A 4DV5I 4LF9E 5C0XA 2JEBB 1FWKA 3WU4A 4DV3I 4FW9A 4OX9I 3OTOI 3P3CA 2E5LE 1EI1A 3OTOE 4MQYA 4JI3E 3H4LA 3PYGA 1Z59A 1Y4SA 1UDQA 3PS1A 2ZM6I 4RPFA 4IS9A 4N3OA 5GMDA 4X62I 1HR0I 1HR0E 1R6MA 1UDOA 1N0UA 3P3EA 2V2VA 1FI4A 1ZXNA 4OKGA 4X66E 5IWAI 4DV1E 4IZJD 2NN6F 5K36A 4DV2E 4LF6E 3J80Q 4HXZA 1KTVA 4FW7A 2AJ4A 4IZKB 4GKKE 2BR2B 4OO1E 2PNLA 4Z7YA 3WU5A 2WNRB 4DR3I 1B62A 4BA1B 4IZJA 4JI8I 2UXDI 2PO2A 4DV6I 4KHPE 1Y6ZA 1Z0WA 4DPXA 3ZKBA 5JEAC 5IWAE 1Z5AA 4FN5A 4LF9I 2VQFE 1OYSA 1PKPA 4FW6A 4K0KI 1ZM9A 2O3ZA 3J80C 3M7NG 1NZ0A 3T1YE 4NXNI 1ZM3A 2E1RA 3H1CA 4B3TI 4LF4E 1H7UA 4P52A 2UUCI 3V2UC 5JEAD 4PRXA 2JEAB 3LTOA 5DNLA 3T1HI 2VESA 4JYAE 2PO0A 2BM1A 1OYRA 4YY3E 5DNXA 3M7ND 3PYDA 1IBKI 4JI0I 4JI0E 5FWKA 4X65I 1J5EE 2WNRA 4DUZI 2HK2A 1N34E 1I94I 2A2DA 2F4VE 2GO4A 4FWHA 2C37A 1Z0BA 4DR5E 3B4TA 4UT4A 3Q6MA 4GKJI 4ED4A 3KRNA 5ELWA 1Y60A 2IOQA 4JI6I 1N32E 2IERA 4LOMA 2WP8B 4YY3I 4B3SI 4LPFA 4AQYE 3HULA 4DV7I 5EKWA 1WUUA 4LCHA 3U1KA 2HHHI 2Z5BB 2Z5EA 4U3BA 2UXCE 1Z0EA 1N34I 2UU9I 4IFDA 1MG7A 2NPFA 1RREA 5IT9Q 1UDNA 3GCMA 4WUBA 1ZM4A 5JEAA 4LFCI 4MU1A 4B3RE 4K0KE 5DRRA 4DV1I 2V8PA 3P3GA 2LJPA 2JT2A 5FLXC 1KIJA 1MU5A 5GMEA 2F1DA 4JI7E 4LCGA 4IZJB 1KVKA 4JI3I 4JV5I 1XNQE 2BA1G 2CG9A 2NN6E 1PVGA 4DU7A 4HACB 1DARA 5LMUE 1P42A 1XMQE 5LMNE 4B3MI 4X62E 4DR2I 5C0XC 1HNWI 4LF7E 5LL6R 4Z7CA 5L3JA 4B3ME 5K36F 2EFGA 3D4JA 3HKMA 1FWLA 4U3DA 4AIMA 5EL9A 2PO2B 4JI5E 4LFCE 2CGEA 2E5LI 2V2ZA 4DUYI 2CVEA 5FLXQ 1N33E 3HJCA 3GMEA 2ZITA 3UHMA 3P06A 4M1KA 2UUAI 4MDTA 4DR6I 1FNMA 2PO1B 3QT7A 3LNUA 4NXME 1MX0A 4NXMI 1S16A 1Z5BA 2JEAA 2VQEI 3B8HA 1VI7A 4JYAI 3B78A 2PNZB 2NN6C 4MYUA 4DV5E 4OX9E 1H73A 2BM0A 2R3VA 1XXEA 3GLLA 3M6AA 3ZM7A 3J7AM 1H72C 5BR8I 3M85G 4HACA 3CDJA 1ZM2A 3K85A 3PYFA 5C0XD 4B3RI 1IBLE 2DEJA 5JEAE 4DR6E 2HFSA 4DV0E 4MU0A 4BA2A 2UXBE 4DPYA 2XEXA 2ZM6E 4LF5I 4DV6E 4KHPI 5A2QC 4FW3A 1UDSA 4DUZE 4AQYI 4LF8I 4JV5E 5JEAF 1IBKE
chains in the Genus database with same CATH topology
5LMNI 4YHHE 3WU3A 2UUBE 1HNXE 2HHHE 1ELOA 3K17A 5BR8E 4DPWA 4GKKI 4USMA 4JI2I 4NXNE 1FJGI 1OJ4A 2V34A 1KKHA 4GKJE 2HFUA 1XMOE 2HKEA 2HKJA 4DV4I 4EMDA 3WU6A 3F0NA 3JAMQ 2VF3A 4JI1E 2O1VA 3PRYA 1HNXI 3Q6NA 4JI1I 4YHHI 2O1WA 2V2QA 4DR2E 2UUCE 4DR7I 2J7KA 4JI5I 4UTGA 4P7AA 2GS8A 1Z0CA 4DPTA 1N33I 2BV3A 4JI4E 4URLA 4IZKA 2PNMA 3J81C 3J81Q 4DPUA 4DR3E 4DR1I 2ZBKB 2HK3A 4HY1A 4DR5I 1XNRE 4LF8E 1B63A 1XNRI 2X7IA 1H74A 1H7SA 2CZ9A 4LFBE 1NHHA 4LFAI 4DV2I 4LF6I 1Z5CA 3K1JA 4B3TE 1XNQI 2Z5BA 4R1FA 2X36A 1XHKA 4WUCA 1U2RA 1A6FA 5IT9C 4LF7I 1BKNA 1HNZI 2UU9E 3QT6A 1Z0TA 1ZXMA 2Q2EB 2VQEE 4X64E 2Z5CB 4DR4E 4DR4I 1Y4UA 4XTJA 1S4EA 3QT5A 4LF4I 1Z0VA 4FWDA 1QZRA 1PIEA 1XMOI 4DV0I 4PU9A 3J7AG 2O1UA 4JG4A 2A2CA 4DV4E 4X66I 3V5RA 1NHIA 5A2QQ 4LF5E 3B82A 4ZVIA 2O1TA 4JI8E 3JAMC 1I94E 4DV7E 1N0VC 4X65E 1J5EI 4JI2E 1FJGE 4LFAE 3PYEA 1UEKA 4X64I 2IOPA 2UUBI 4KQVA 3T1YI 1IBME 4LFBI 4JI6E 1N32I 1HNZE 2UXDE 1N36E 3QT8A 4HYMA 3CWVA 1FKAE 2WW4A 2UXCI 3LPSA 4USKA 4DU8A 3ZZUA 1HNWE 2F4VI 1VISA 4DR7E 1IBLI 1RR9A 4DR1E 3ZKDA 1Z0GA 1D6TA 4PRVA 3GONA 4I3HA 4DV3E 1EA6A 2Z5CA 2DEIA 3T1HE 2UXBI 4B3SE 4DUYE 4JI7I 2UUAE 4FWGA 1XMQI 2VQFI 5LMUI 1HK7A 1N36I 1K47A 3ZZ0A 3Q1QA 4WUDA 4JI4I 4MYTA 2GQ0A 1USVA 3ZZTA 4DXLA 1NHJA 2R42A 1USUA 1IBMI 2OI2A 4DV5I 4LF9E 1FWKA 3WU4A 4DV3I 4FW9A 4OX9I 3OTOI 2E5LE 1EI1A 3OTOE 4JI3E 3H4LA 3PYGA 1Z59A 1Y4SA 2ZM6I 4RPFA 4N3OA 5GMDA 4X62I 1HR0I 1HR0E 1N0UA 2V2VA 1FI4A 1ZXNA 4X66E 4DV1E 5IWAI 4IZJD 4DV2E 4LF6E 3J80Q 4HXZA 1KTVA 2AJ4A 4IZKB 4GKKE 2PNLA 4Z7YA 3WU5A 4DR3I 1B62A 4IZJA 4JI8I 2UXDI 4DV6I 4KHPE 1Y6ZA 1Z0WA 4DPXA 3ZKBA 5IWAE 1Z5AA 4FN5A 4LF9I 2VQFE 4K0KI 1PKPA 1ZM9A 3J80C 1NZ0A 3T1YE 4NXNI 1ZM3A 2E1RA 4B3TI 4LF4E 1H7UA 4P52A 2UUCI 3V2UC 4PRXA 3LTOA 3T1HI 4JYAE 2BM1A 4YY3E 3PYDA 1IBKI 4JI0I 4JI0E 5FWKA 4X65I 1J5EE 4DUZI 1I94I 1N34E 2HK2A 2A2DA 2F4VE 4FWHA 1Z0BA 4DR5E 4UT4A 3Q6MA 4GKJI 4ED4A 2IOQA 4JI6I 1N32E 4YY3I 4B3SI 4AQYE 3HULA 4DV7I 1WUUA 2HHHI 2Z5BB 2Z5EA 2UXCE 1Z0EA 1N34I 2UU9I 1MG7A 2NPFA 1RREA 5IT9Q 4WUBA 1ZM4A 4LFCI 4B3RE 4K0KE 4DV1I 2V8PA 2LJPA 5FLXC 1KIJA 1MU5A 5GMEA 4JI7E 4IZJB 1KVKA 4JI3I 4JV5I 1XNQE 2CG9A 1PVGA 4DU7A 4HACB 1DARA 5LMUE 1XMQE 5LMNE 4B3MI 4X62E 4DR2I 1HNWI 4LF7E 5LL6R 4Z7CA 5L3JA 4B3ME 2EFGA 3D4JA 1FWLA 4JI5E 4LFCE 2CGEA 2E5LI 2V2ZA 4DUYI 5FLXQ 1N33E 3HJCA 2ZITA 3P06A 4M1KA 2UUAI 4DR6I 1FNMA 3QT7A 3LNUA 4NXME 1MX0A 4NXMI 1S16A 1Z5BA 2VQEI 3B8HA 4JYAI 3B78A 4MYUA 4DV5E 4OX9E 1H73A 2BM0A 2R3VA 3M6AA 3ZM7A 3J7AM 1H72C 5BR8I 4HACA 1ZM2A 3K85A 3PYFA 4B3RI 1IBLE 2DEJA 4DR6E 2HFSA 4DV0E 2UXBE 4DPYA 2XEXA 2ZM6E 4LF5I 4DV6E 4KHPI 5A2QC 4DUZE 4AQYI 4LF8I 4JV5E 1IBKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN I;  4YHH E;  3WU3 A;  2UUB E;  1HNX E;  2HHH E;  1ELO A;  3K17 A;  5BR8 E;  4DPW A;  4GKK I;  4USM A;  4JI2 I;  4NXN E;  1FJG I;  1OJ4 A;  2V34 A;  1KKH A;  4GKJ E;  2HFU A;  1XMO E;  2HKE A;  2HKJ A;  4DV4 I;  4EMD A;  3WU6 A;  3F0N A;  3JAM Q;  2VF3 A;  4JI1 E;  1HNX I;  4JI1 I;  4YHH I;  2V2Q A;  4DR2 E;  2UUC E;  4DR7 I;  2J7K A;  4JI5 I;  4UTG A;  4P7A A;  2GS8 A;  1Z0C A;  4DPT A;  1N33 I;  2BV3 A;  4JI4 E;  4URL A;  3J81 C;  3J81 Q;  4DPU A;  4DR3 E;  4DR1 I;  2ZBK B;  2HK3 A;  4HY1 A;  4DR5 I;  1XNR E;  4LF8 E;  1B63 A;  1XNR I;  2X7I A;  1H74 A;  1H7S A;  2CZ9 A;  4LFB E;  1NHH A;  4LFA I;  4DV2 I;  4LF6 I;  1Z5C A;  3K1J A;  4B3T E;  1XNQ I;  4R1F A;  2X36 A;  1XHK A;  4WUC A;  1U2R A;  1A6F A;  5IT9 C;  4LF7 I;  1BKN A;  1HNZ I;  2UU9 E;  3QT6 A;  1Z0T A;  1ZXM A;  2Q2E B;  2VQE E;  4X64 E;  4DR4 E;  4DR4 I;  4XTJ A;  1S4E A;  3QT5 A;  4LF4 I;  1Z0V A;  4FWD A;  1QZR A;  1PIE A;  1XMO I;  4DV0 I;  4PU9 A;  3J7A G;  4JG4 A;  2A2C A;  4DV4 E;  4X66 I;  3V5R A;  1NHI A;  5A2Q Q;  4LF5 E;  3B82 A;  4ZVI A;  4JI8 E;  3JAM C;  1I94 E;  4DV7 E;  1N0V C;  4X65 E;  1J5E I;  4JI2 E;  1FJG E;  4LFA E;  3PYE A;  1UEK A;  4X64 I;  2UUB I;  4KQV A;  3T1Y I;  1IBM E;  4LFB I;  4JI6 E;  1N32 I;  1HNZ E;  2UXD E;  1N36 E;  3QT8 A;  4HYM A;  3CWV A;  1FKA E;  2WW4 A;  2UXC I;  3LPS A;  4USK A;  4DU8 A;  3ZZU A;  1HNW E;  2F4V I;  1VIS A;  4DR7 E;  1IBL I;  1RR9 A;  4DR1 E;  3ZKD A;  1Z0G A;  1D6T A;  4PRV A;  3GON A;  4I3H A;  4DV3 E;  1EA6 A;  2DEI A;  3T1H E;  2UXB I;  4B3S E;  4DUY E;  4JI7 I;  2UUA E;  4FWG A;  5LMU I;  2VQF I;  1XMQ I;  1N36 I;  1K47 A;  3ZZ0 A;  3Q1Q A;  4WUD A;  4JI4 I;  4MYT A;  3ZZT A;  4DXL A;  1NHJ A;  2R42 A;  1IBM I;  2OI2 A;  4DV5 I;  4LF9 E;  1FWK A;  3WU4 A;  4DV3 I;  4FW9 A;  4OX9 I;  3OTO I;  2E5L E;  1EI1 A;  3OTO E;  4JI3 E;  3H4L A;  3PYG A;  1Z59 A;  2ZM6 I;  4RPF A;  1HR0 E;  5GMD A;  4X62 I;  1HR0 I;  1N0U A;  2V2V A;  1FI4 A;  1ZXN A;  4X66 E;  4DV1 E;  5IWA I;  4DV2 E;  4LF6 E;  3J80 Q;  4HXZ A;  1KTV A;  2AJ4 A;  4GKK E;  4Z7Y A;  3WU5 A;  4DR3 I;  1B62 A;  4JI8 I;  2UXD I;  4DV6 I;  4KHP E;  5IWA E;  1Z0W A;  4DPX A;  3ZKB A;  1Z5A A;  4FN5 A;  4LF9 I;  2VQF E;  4K0K I;  1PKP A;  1ZM9 A;  3J80 C;  1NZ0 A;  3T1Y E;  4NXN I;  1ZM3 A;  2E1R A;  4B3T I;  4LF4 E;  1H7U A;  4P52 A;  2UUC I;  3V2U C;  4PRX A;  3LTO A;  3T1H I;  4JYA E;  2BM1 A;  4YY3 E;  3PYD A;  1IBK I;  4JI0 I;  4JI0 E;  4X65 I;  1J5E E;  4DUZ I;  1I94 I;  1N34 E;  2HK2 A;  2A2D A;  2F4V E;  4FWH A;  1Z0B A;  4DR5 E;  4UT4 A;  4GKJ I;  4ED4 A;  4JI6 I;  1N32 E;  4YY3 I;  4B3S I;  4AQY E;  3HUL A;  4DV7 I;  1WUU A;  2HHH I;  2UXC E;  1Z0E A;  1N34 I;  2UU9 I;  1MG7 A;  2NPF A;  1RRE A;  5IT9 Q;  4WUB A;  1ZM4 A;  4LFC I;  4B3R E;  4K0K E;  4DV1 I;  2V8P A;  2LJP A;  5FLX C;  1KIJ A;  1MU5 A;  5GME A;  4JI7 E;  1KVK A;  4JI3 I;  4JV5 I;  1XNQ E;  1PVG A;  4DU7 A;  4HAC B;  1DAR A;  5LMU E;  1XMQ E;  5LMN E;  4B3M I;  4X62 E;  4DR2 I;  1HNW I;  4LF7 E;  5LL6 R;  4Z7C A;  5L3J A;  4B3M E;  2EFG A;  3D4J A;  1FWL A;  4JI5 E;  4LFC E;  2E5L I;  2V2Z A;  4DUY I;  5FLX Q;  1N33 E;  2ZIT A;  4M1K A;  2UUA I;  4DR6 I;  1FNM A;  3QT7 A;  3LNU A;  4NXM E;  1MX0 A;  4NXM I;  1S16 A;  1Z5B A;  2VQE I;  3B8H A;  4JYA I;  3B78 A;  4MYU A;  4DV5 E;  4OX9 E;  1H73 A;  2BM0 A;  2R3V A;  3M6A A;  3ZM7 A;  3J7A M;  1H72 C;  5BR8 I;  4HAC A;  1ZM2 A;  3PYF A;  4B3R I;  1IBL E;  2DEJ A;  4DR6 E;  2HFS A;  4DV0 E;  2UXB E;  4DPY A;  2XEX A;  2ZM6 E;  4LF5 I;  4DV6 E;  4KHP I;  5A2Q C;  4DUZ E;  4AQY I;  4LF8 I;  4JV5 E;  1IBK E; 
#chains in the Genus database with same CATH topology
 5LMN I;  2AE8 A;  4YHH E;  3WU3 A;  2NN6 A;  2UUB E;  5K36 C;  1HNX E;  3P76 A;  2HHH E;  1ELO A;  3K17 A;  5BR8 E;  4DPW A;  4GKK I;  4USM A;  4JI2 I;  4NXN E;  1FJG I;  1OJ4 A;  2V34 A;  1KKH A;  4GKJ E;  3CDI A;  2HFU A;  1XMO E;  2HKE A;  2HKJ A;  4DV4 I;  4FW5 A;  4EMD A;  3WU6 A;  3PS2 A;  3F0N A;  4QNK A;  3JAM Q;  2VF3 A;  4JI1 E;  2O1V A;  3PRY A;  1HNX I;  4OO1 B;  3Q6N A;  4JI1 I;  4YHH I;  1R6L A;  2O1W A;  2V2Q A;  4DR2 E;  2UUC E;  5K36 D;  4DR7 I;  2J7K A;  4JI5 I;  4UTG A;  1OYP A;  4P7A A;  2GS8 A;  1Z0C A;  2C38 A;  4DPT A;  1N33 I;  3M85 D;  4AID A;  2BV3 A;  2JE6 A;  3PS3 A;  4JI4 E;  4URL A;  4IZK A;  2PNM A;  3J81 C;  2NN6 D;  3J81 Q;  4DPU A;  5DRP A;  1YH8 A;  2PO0 B;  4DR3 E;  2IES A;  4DR1 I;  2ZBK B;  2HK3 A;  4HY1 A;  4DR5 I;  1XNR E;  4LF8 E;  4IFD F;  1B63 A;  4IFD D;  1RHY A;  1XNR I;  4IFD C;  2X7I A;  1H74 A;  1H7S A;  2CZ9 A;  4LFB E;  1NHH A;  4IFD E;  4LFA I;  4DV2 I;  4LF6 I;  2BA1 D;  2J65 A;  1Z5C A;  4OO1 C;  3DD6 A;  3K1J A;  2C39 A;  5C0X E;  4B3T E;  1XNQ I;  2Z5B A;  4OO1 A;  4LCF A;  4R1F A;  2X36 A;  1E3P A;  1XHK A;  4WUC A;  4ISA A;  1U2R A;  1A6F A;  5IT9 C;  4LF7 I;  1BKN A;  2BA0 G;  2C39 B;  1HNZ I;  2UU9 E;  4BA1 A;  2JEB A;  5C0X B;  3QT6 A;  1Z0T A;  1ZXM A;  2Q2E B;  2VQE E;  2BA0 D;  4X64 E;  2Z5C B;  2BR2 A;  4DR4 E;  4DR4 I;  1Y4U A;  5K36 E;  4XTJ A;  1S4E A;  3QT5 A;  2C37 B;  4MU4 A;  4LF4 I;  1YHC A;  1Z0V A;  4FWD A;  1QZR A;  1PIE A;  1XMO I;  4DV0 I;  4PU9 A;  3J7A G;  2O1U A;  5DRQ A;  4JG4 A;  1Y5Y A;  2A2C A;  4DV4 E;  4X66 I;  3V5R A;  3L7Z B;  1NHI A;  5A2Q Q;  4LF5 E;  2C38 B;  3B82 A;  5C0X F;  4ZVI A;  2O1T A;  4JI8 E;  3JAM C;  1I94 E;  2WP8 A;  4DV7 E;  1N0V C;  2PO1 A;  4X65 E;  1J5E I;  1E3H A;  4JI2 E;  1FJG E;  4LFA E;  3PYE A;  1UEK A;  4X64 I;  4OZE A;  2IOP A;  2UUB I;  2PNZ A;  4KQV A;  3T1Y I;  1IBM E;  4LFB I;  4NBQ A;  4OO1 F;  5DRO A;  4OO1 D;  4MU3 A;  4JI6 E;  1N32 I;  1HNZ E;  2UXD E;  1N36 E;  3QT8 A;  5K36 B;  4HYM A;  5JEA B;  3CWV A;  1FKA E;  2WW4 A;  2UXC I;  3NZK A;  3LPS A;  4USK A;  4DU8 A;  3ZZU A;  1HNW E;  2F4V I;  1VIS A;  4DR7 E;  1RR9 A;  4DR1 E;  1IBL I;  3ZKD A;  1Z0G A;  4FW4 A;  4PRV A;  1D6T A;  4GQU A;  2NN6 B;  3GON A;  3U1Y A;  4I3H A;  3L7Z A;  4DV3 E;  1EA6 A;  2JE6 B;  2Z5C A;  2DEI A;  3T1H E;  2UXB I;  4B3S E;  4J3D A;  4DUY E;  4JI7 I;  4IFD B;  2UUA E;  4FWG A;  5LMU I;  2VQF I;  1XMQ I;  1HK7 A;  1N36 I;  1K47 A;  3ZZ0 A;  3Q1Q A;  4BA2 B;  4WUD A;  4JI4 I;  4MYT A;  4AM3 A;  2GQ0 A;  1USV A;  3ZZT A;  4DXL A;  4QNJ A;  2GO3 A;  1NHJ A;  2R42 A;  1USU A;  1IBM I;  2OI2 A;  4DV5 I;  4LF9 E;  5C0X A;  2JEB B;  1FWK A;  3WU4 A;  4DV3 I;  4FW9 A;  4OX9 I;  3OTO I;  3P3C A;  2E5L E;  1EI1 A;  3OTO E;  4MQY A;  4JI3 E;  3H4L A;  3PYG A;  1Z59 A;  1Y4S A;  1UDQ A;  3PS1 A;  2ZM6 I;  4RPF A;  4IS9 A;  4N3O A;  5GMD A;  4X62 I;  1HR0 I;  1HR0 E;  1R6M A;  1UDO A;  1N0U A;  3P3E A;  2V2V A;  1FI4 A;  1ZXN A;  4OKG A;  4X66 E;  5IWA I;  4DV1 E;  4IZJ D;  2NN6 F;  5K36 A;  4DV2 E;  4LF6 E;  3J80 Q;  4HXZ A;  1KTV A;  4FW7 A;  2AJ4 A;  4IZK B;  4GKK E;  2BR2 B;  4OO1 E;  2PNL A;  4Z7Y A;  3WU5 A;  2WNR B;  4DR3 I;  1B62 A;  4BA1 B;  4IZJ A;  4JI8 I;  2UXD I;  2PO2 A;  4DV6 I;  4KHP E;  1Y6Z A;  1Z0W A;  4DPX A;  3ZKB A;  5JEA C;  5IWA E;  1Z5A A;  4FN5 A;  4LF9 I;  2VQF E;  1OYS A;  1PKP A;  4FW6 A;  4K0K I;  1ZM9 A;  2O3Z A;  3J80 C;  3M7N G;  1NZ0 A;  3T1Y E;  4NXN I;  1ZM3 A;  2E1R A;  3H1C A;  4B3T I;  4LF4 E;  1H7U A;  4P52 A;  2UUC I;  3V2U C;  5JEA D;  4PRX A;  2JEA B;  3LTO A;  5DNL A;  3T1H I;  2VES A;  4JYA E;  2PO0 A;  2BM1 A;  1OYR A;  4YY3 E;  5DNX A;  3M7N D;  3PYD A;  1IBK I;  4JI0 I;  4JI0 E;  5FWK A;  4X65 I;  1J5E E;  2WNR A;  4DUZ I;  2HK2 A;  1N34 E;  1I94 I;  2A2D A;  2F4V E;  2GO4 A;  4FWH A;  2C37 A;  1Z0B A;  4DR5 E;  3B4T A;  4UT4 A;  3Q6M A;  4GKJ I;  4ED4 A;  3KRN A;  5ELW A;  1Y60 A;  2IOQ A;  4JI6 I;  1N32 E;  2IER A;  4LOM A;  2WP8 B;  4YY3 I;  4B3S I;  4LPF A;  4AQY E;  3HUL A;  4DV7 I;  5EKW A;  1WUU A;  4LCH A;  3U1K A;  2HHH I;  2Z5B B;  2Z5E A;  4U3B A;  2UXC E;  1Z0E A;  1N34 I;  2UU9 I;  4IFD A;  1MG7 A;  2NPF A;  1RRE A;  5IT9 Q;  1UDN A;  3GCM A;  4WUB A;  1ZM4 A;  5JEA A;  4LFC I;  4MU1 A;  4B3R E;  4K0K E;  5DRR A;  4DV1 I;  2V8P A;  3P3G A;  2LJP A;  2JT2 A;  5FLX C;  1KIJ A;  1MU5 A;  5GME A;  2F1D A;  4JI7 E;  4LCG A;  4IZJ B;  1KVK A;  4JI3 I;  4JV5 I;  1XNQ E;  2BA1 G;  2CG9 A;  2NN6 E;  1PVG A;  4DU7 A;  4HAC B;  1DAR A;  5LMU E;  1P42 A;  1XMQ E;  5LMN E;  4B3M I;  4X62 E;  4DR2 I;  5C0X C;  1HNW I;  4LF7 E;  5LL6 R;  4Z7C A;  5L3J A;  4B3M E;  5K36 F;  2EFG A;  3D4J A;  3HKM A;  1FWL A;  4U3D A;  4AIM A;  5EL9 A;  2PO2 B;  4JI5 E;  4LFC E;  2CGE A;  2E5L I;  2V2Z A;  4DUY I;  2CVE A;  5FLX Q;  1N33 E;  3HJC A;  3GME A;  2ZIT A;  3UHM A;  3P06 A;  4M1K A;  2UUA I;  4MDT A;  4DR6 I;  1FNM A;  2PO1 B;  3QT7 A;  3LNU A;  4NXM E;  1MX0 A;  4NXM I;  1S16 A;  1Z5B A;  2JEA A;  2VQE I;  3B8H A;  1VI7 A;  4JYA I;  3B78 A;  2PNZ B;  2NN6 C;  4MYU A;  4DV5 E;  4OX9 E;  1H73 A;  2BM0 A;  2R3V A;  1XXE A;  3GLL A;  3M6A A;  3ZM7 A;  3J7A M;  1H72 C;  5BR8 I;  3M85 G;  4HAC A;  3CDJ A;  1ZM2 A;  3K85 A;  3PYF A;  5C0X D;  4B3R I;  1IBL E;  2DEJ A;  5JEA E;  4DR6 E;  2HFS A;  4DV0 E;  4MU0 A;  4BA2 A;  2UXB E;  4DPY A;  2XEX A;  2ZM6 E;  4LF5 I;  4DV6 E;  4KHP I;  5A2Q C;  4FW3 A;  1UDS A;  4DUZ E;  4AQY I;  4LF8 I;  4JV5 E;  5JEA F;  1IBK E; 
#chains in the Genus database with same CATH homology
 5LMN I;  4YHH E;  3WU3 A;  2UUB E;  1HNX E;  2HHH E;  1ELO A;  3K17 A;  5BR8 E;  4DPW A;  4GKK I;  4USM A;  4JI2 I;  4NXN E;  1FJG I;  1OJ4 A;  2V34 A;  1KKH A;  4GKJ E;  2HFU A;  1XMO E;  2HKE A;  2HKJ A;  4DV4 I;  4EMD A;  3WU6 A;  3F0N A;  3JAM Q;  2VF3 A;  4JI1 E;  2O1V A;  3PRY A;  1HNX I;  3Q6N A;  4JI1 I;  4YHH I;  2O1W A;  2V2Q A;  4DR2 E;  2UUC E;  4DR7 I;  2J7K A;  4JI5 I;  4UTG A;  4P7A A;  2GS8 A;  1Z0C A;  4DPT A;  1N33 I;  2BV3 A;  4JI4 E;  4URL A;  4IZK A;  2PNM A;  3J81 C;  3J81 Q;  4DPU A;  4DR3 E;  4DR1 I;  2ZBK B;  2HK3 A;  4HY1 A;  4DR5 I;  1XNR E;  4LF8 E;  1B63 A;  1XNR I;  2X7I A;  1H74 A;  1H7S A;  2CZ9 A;  4LFB E;  1NHH A;  4LFA I;  4DV2 I;  4LF6 I;  1Z5C A;  3K1J A;  4B3T E;  1XNQ I;  2Z5B A;  4R1F A;  2X36 A;  1XHK A;  4WUC A;  1U2R A;  1A6F A;  5IT9 C;  4LF7 I;  1BKN A;  1HNZ I;  2UU9 E;  3QT6 A;  1Z0T A;  1ZXM A;  2Q2E B;  2VQE E;  4X64 E;  2Z5C B;  4DR4 E;  4DR4 I;  1Y4U A;  4XTJ A;  1S4E A;  3QT5 A;  4LF4 I;  1Z0V A;  4FWD A;  1QZR A;  1PIE A;  1XMO I;  4DV0 I;  4PU9 A;  3J7A G;  2O1U A;  4JG4 A;  2A2C A;  4DV4 E;  4X66 I;  3V5R A;  1NHI A;  5A2Q Q;  4LF5 E;  3B82 A;  4ZVI A;  2O1T A;  4JI8 E;  3JAM C;  1I94 E;  4DV7 E;  1N0V C;  4X65 E;  1J5E I;  4JI2 E;  1FJG E;  4LFA E;  3PYE A;  1UEK A;  4X64 I;  2IOP A;  2UUB I;  4KQV A;  3T1Y I;  1IBM E;  4LFB I;  4JI6 E;  1N32 I;  1HNZ E;  2UXD E;  1N36 E;  3QT8 A;  4HYM A;  3CWV A;  1FKA E;  2WW4 A;  2UXC I;  3LPS A;  4USK A;  4DU8 A;  3ZZU A;  1HNW E;  2F4V I;  1VIS A;  4DR7 E;  1IBL I;  1RR9 A;  4DR1 E;  3ZKD A;  1Z0G A;  1D6T A;  4PRV A;  3GON A;  4I3H A;  4DV3 E;  1EA6 A;  2Z5C A;  2DEI A;  3T1H E;  2UXB I;  4B3S E;  4DUY E;  4JI7 I;  2UUA E;  4FWG A;  1XMQ I;  2VQF I;  5LMU I;  1HK7 A;  1N36 I;  1K47 A;  3ZZ0 A;  3Q1Q A;  4WUD A;  4JI4 I;  4MYT A;  2GQ0 A;  1USV A;  3ZZT A;  4DXL A;  1NHJ A;  2R42 A;  1USU A;  1IBM I;  2OI2 A;  4DV5 I;  4LF9 E;  1FWK A;  3WU4 A;  4DV3 I;  4FW9 A;  4OX9 I;  3OTO I;  2E5L E;  1EI1 A;  3OTO E;  4JI3 E;  3H4L A;  3PYG A;  1Z59 A;  1Y4S A;  2ZM6 I;  4RPF A;  4N3O A;  5GMD A;  4X62 I;  1HR0 I;  1HR0 E;  1N0U A;  2V2V A;  1FI4 A;  1ZXN A;  4X66 E;  4DV1 E;  5IWA I;  4IZJ D;  4DV2 E;  4LF6 E;  3J80 Q;  4HXZ A;  1KTV A;  2AJ4 A;  4IZK B;  4GKK E;  2PNL A;  4Z7Y A;  3WU5 A;  4DR3 I;  1B62 A;  4IZJ A;  4JI8 I;  2UXD I;  4DV6 I;  4KHP E;  1Y6Z A;  1Z0W A;  4DPX A;  3ZKB A;  5IWA E;  1Z5A A;  4FN5 A;  4LF9 I;  2VQF E;  4K0K I;  1PKP A;  1ZM9 A;  3J80 C;  1NZ0 A;  3T1Y E;  4NXN I;  1ZM3 A;  2E1R A;  4B3T I;  4LF4 E;  1H7U A;  4P52 A;  2UUC I;  3V2U C;  4PRX A;  3LTO A;  3T1H I;  4JYA E;  2BM1 A;  4YY3 E;  3PYD A;  1IBK I;  4JI0 I;  4JI0 E;  5FWK A;  4X65 I;  1J5E E;  4DUZ I;  1I94 I;  1N34 E;  2HK2 A;  2A2D A;  2F4V E;  4FWH A;  1Z0B A;  4DR5 E;  4UT4 A;  3Q6M A;  4GKJ I;  4ED4 A;  2IOQ A;  4JI6 I;  1N32 E;  4YY3 I;  4B3S I;  4AQY E;  3HUL A;  4DV7 I;  1WUU A;  2HHH I;  2Z5B B;  2Z5E A;  2UXC E;  1Z0E A;  1N34 I;  2UU9 I;  1MG7 A;  2NPF A;  1RRE A;  5IT9 Q;  4WUB A;  1ZM4 A;  4LFC I;  4B3R E;  4K0K E;  4DV1 I;  2V8P A;  2LJP A;  5FLX C;  1KIJ A;  1MU5 A;  5GME A;  4JI7 E;  4IZJ B;  1KVK A;  4JI3 I;  4JV5 I;  1XNQ E;  2CG9 A;  1PVG A;  4DU7 A;  4HAC B;  1DAR A;  5LMU E;  1XMQ E;  5LMN E;  4B3M I;  4X62 E;  4DR2 I;  1HNW I;  4LF7 E;  5LL6 R;  4Z7C A;  5L3J A;  4B3M E;  2EFG A;  3D4J A;  1FWL A;  4JI5 E;  4LFC E;  2CGE A;  2E5L I;  2V2Z A;  4DUY I;  5FLX Q;  1N33 E;  3HJC A;  2ZIT A;  3P06 A;  4M1K A;  2UUA I;  4DR6 I;  1FNM A;  3QT7 A;  3LNU A;  4NXM E;  1MX0 A;  4NXM I;  1S16 A;  1Z5B A;  2VQE I;  3B8H A;  4JYA I;  3B78 A;  4MYU A;  4DV5 E;  4OX9 E;  1H73 A;  2BM0 A;  2R3V A;  3M6A A;  3ZM7 A;  3J7A M;  1H72 C;  5BR8 I;  4HAC A;  1ZM2 A;  3K85 A;  3PYF A;  4B3R I;  1IBL E;  2DEJ A;  4DR6 E;  2HFS A;  4DV0 E;  2UXB E;  4DPY A;  2XEX A;  2ZM6 E;  4LF5 I;  4DV6 E;  4KHP I;  5A2Q C;  4DUZ E;  4AQY I;  4LF8 I;  4JV5 E;  1IBK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...