1FJGJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1fjgJ00
4DR3J 5IWAJ 2UUAJ 4X64J 4GKJJ 1I94J 4DR4J 3IMQJ 4NXMJ 1N34J 4B3SJ 5LMNJ 2KVQE 1XMQJ 2UXCJ 4JI1J 4DR5J 4X66J 2ZM6J 4JI7J 2UXDJ 4DV6J 1N33J 4JI2J 4LF5J 4LF6J 4LF8J 4DR1J 2E5LJ 4LF4J 1HNXJ 3J7AN 3JAMU 5AJ3J 4NEZA 3J81U 3R2DJ 4LFCJ 4B3RJ 3D3CJ 4DV3J 4JV5J 4X65J 4NXNJ 4KY3A 2UUBJ 5LM7E 4GKKJ 4JI8J 4DV5J 4X62J 2VQFJ 3R2CJ 1HNZJ 2VQEJ 1HNWJ 1IBMJ 5BR8J 4PWWA 4LFBJ 5FLXU 4NEYA 4JI5J 4YHHJ 3W1YC 3T1YJ 2HHHJ 4B3MJ 4DV2J 4DV7J 4OX9J 4B3TJ 4DV1J 1XNQJ 4DUYJ 3D3BJ 1IBKJ 4JI0J 2KL8A 1HR0J 2MTLA 2MEWA 1J5EJ 1N32J 4JI6J 5IT9U 4DV4J 1XMOJ 2UXBJ 3OTOJ 3J80U 4LF7J 1FJGJ 3T1HJ 4K0KJ 4AQYJ 1N36J 4RJVA 2UUCJ 1XNRJ 5A2QU 4JI4J 1IBLJ 2UU9J 4V1Ak 4KHPJ 4DR2J 4HHUA 4DR6J 4LFAJ 4DUZJ 2MQ8A 4JYAJ 4DR7J 4LF9J 4JI3J 4DV0J 2F4VJ 5LMUJ 4YY3J 4KYZA
chains in the Genus database with same CATH superfamily
1F0XA 2DK2A 5CZXA 3BJYA 4AXIA 3FFIA 5IWAJ 2HGLA 2VG7B 5KG0A 1RBAA 4UTGA 3VZIA 3MUVP 4NA2A 4F4AA 2YKOA 3MM6B 4B3TF 3M6UA 1HKAA 1TL7A 2JEFA 3GR0A 3JTOA 2LECA 4B3OB 4GKKF 4GMKA 2A3JA 1HBOA 4B3SJ 4ECWA 2BBEA 2HWHA 2VUGA 3QSIA 2Y1RI 2CQCA 1U1MA 1SC6A 3IR6B 4C3KA 3HJVA 2LXIA 3S6EA 4USVA 3TEGA 2W4PA 4ZVRB 2E1CA 3J81j 3KHLA 2NREA 4BWMA 4DOZA 2OJ3A 2BJ7A 1SBRA 1FNMA 4ECTA 3M30A 1RI7A 2KDOA 4IRCA 3A8KA 2CQ1A 1UTAA 2MKHA 2YH1A 2IA6A 1TKZB 3DU5A 1IBKF 2XCAA 4NLWA 4K4ZA 3M8YA 5AJ3J 2VB6A 1G6BA 3H8YA 1GXUA 3RJMB 1NK7A 3OR1A 3H0PA 4ZCKA 2ZHAA 3K58A 4M5DA 3D3CJ 1NPPA 3HF5A 4JV5J 3JTNA 3LGHA 1FD8A 2Z2LA 1NK9A 2HGNA 4K2XA 5E3PA 3VAJA 3TX0A 2G0CA 3UN3A 1DRZA 1JLGA 1NJXA 2DRBA 2XNQA 2E5HA 3UFCX 4GKKJ 3G6XA 2LQ9A 1CJUA 2NUUG 3LAMA 3LP1B 3Q24A 1P8GA 1RTZA 1CPZA 3FRZA 4TYAA 1OWXA 4KAIA 2JX2A 4FYXB 1NKCA 2ZNYA 2JJ4D 2DGXA 4Y28C 1V5VA 2OO4A 2V4JA 2XSJA 4A8FA 5BR8J 3LOUA 4USIA 5FDLA 1F2HA 1V9OA 2MYFA 2R7WA 2I5JB 2KXHA 4LT6A 2M8DB 1AUDA 2VPWB 3R5AA 4RX6A 3VVTA 4AL7A 4NWBA 1S9GB 4WFXA 4A47A 2EFPA 1KD1T 3DOLA 4YHHJ 1RACB 2AMCB 3TI0A 5DRKA 5A8RA 2HIYA 2FVSA 1SH2A 2W2MP 4L73A 5A8WA 4J9KA 1W26A 2BXJA 3HHDA 4QIGA 2XGQA 1PAEX 2R7RA 1YI2S 4C8LA 2ZZTA 1TK8A 1XNQJ 1T95A 4H4KC 4O3SA 1CJKB 2P9EA 4HKQA 4WKRA 4NCBA 3NCRA 1VK8A 1SI9A 5FD1A 4RNHA 3ZFVA 3D5MA 1UPMB 2ROGA 4P2MA 4BWJA 3T5HA 2AW0A 5HQLA 3M1VB 4F4KA 1PYSB 2A6MA 5J2PA 2YWFA 3UR3C 2FLPA 1UJ5A 3NGUA 3CCTA 1FTRA 4ENOA 5L1KA 3ZZTA 2NLWA 2UXCF 2QL7B 3AD8C 3NL0A 4E8UA 4PG5A 2GZOA 5D77A 2POKA 3GMGA 2IVYA 4P7TA 3KMSA 4USHA 2EEYA 3HSGA 3I32A 4OMFG 4YB1P 2YXLA 1NK4A 5DLFA 3R97A 3VGVA 3NP5A 3CB4A 5E3CA 4C8KA 3O6QA 1IBLJ 3AT1B 3CMAS 2LEBA 1RLDA 4RW8B 5KG1A 1KHWA 1NBEB 3KJVB 2L3MA 1U1PA 1NJZA 4DR6J 1C1BA 2KT3A 2EFNA 5DQGA 4Z2XA 4DUZJ 1KVJA 1Q79A 3CDEA 3ET6B 5CYMB 3SQOP 4ANDA 2LEPA 4MK8A 3Q2TC 4YB7A 4FF2A 4Q8FA 2H1YA 2MQNA 4DWIA 1RWWB 1N0UA 3EWGA 4ICLB 2BM0A 1GFWB 4IG3B 4CO0A 4BC7A 2NS1B 5DDQC 2F63A 4PG6A 3RRGA 1QSSA 3LA0A 1DLOB 2FHJD 1H3DA 4DCOB 4OL8A 2K3IA 1NSPA 3BGFA 1WHXA 1HMVA 2YQ0A 4LRCA 4C8MA 1RLCL 5GAHI 3DXSX 1KTVA 3Q2SC 1I94J 2UXDF 1WI8A 3NCQA 1R8CA 4OX6A 2YNFB 3IMQJ 4USKA 5KTQA 5GMDA 3SV3A 2I1RA 1TAQA 1LWEA 3ZNUA 3NOGA 4B9LA 1RHKB 3QGGA 3WDOA 4X4SA 1B99A 1Z2ZA 3FQLA 3ZO7A 4JI1F 4N41A 2ZZNA 4F02A 3D67A 1KEKA 5L1IA 4JI1J 4DR5J 4LFAF 3MM7B 3DKDA 4KBIA 3E51A 1WOPA 5DQHA 4PAAA 4X4VA 2WK4A 2B6AB 3TQEA 3C16B 2CVIA 3IGNA 1WG4A 5L8RC 5DM7Q 4JI7J 4KR0B 4Z37A 2XO7A 3TR5A 2FLOA 4MK7A 5B08A 1FRMA 3IRXB 4OYMA 3CEDA 3Q83A 4OI3A 4ZVEA 3QT7A 2PSZA 3C16A 3CIZA 4ECVA 1L3TA 1WACA 2C2OB 1Q5VA 1Q1KA 2C1EB 4DUTA 2BW2A 4CCHA 1S79A 4IOCQ 2ZBCA 2FD2A 3KJNB 4YR3A 5DG9A 2CDQA 1XMOF 2VU5A 1S4FA 3DLGA 4JI8J 2MHNA 3PX0A 5E33A 4E0DA 1SH3A 1QAYA 4B9MA 4DHVA 3QT6A 1Q4RA 1HNZJ 2G0IA 4N8NA 5E41A 1QVGR 4QCLA 4IFVA 3DLKA 1KP6A 3PJWA 2AGOA 2HVEA 1BQMB 1S5ZA 5A0YB 4ZLNA 3QJPA 2ASJA 2Q1LA 2AYBA 2U1AA 2MXYA 4PR6A 3ITHB 4OZ1A 5LJ5Y 2FQQB 4YB6A 2QA4G 3TARA 4ELTA 2Q66A 3B6BA 1Y00A 1X4GA 4L3NA 5LXRA 1EZZB 4L6V3 1N52B 5MAOA 1HQEB 2VFSA 2Q6CA 1RT6A 4C48A 1GX5A 1N5SA 3FMBA 1FFSB 1Y7PA 5J2MB 2QT7A 3CCMS 4B3TJ 2DO0A 5I42A 2CFXA 3R7BB 1LK7A 2RQMA 3CWJA 4NLYA 2ZUAA 4F3QA 3CD5A 2XLIA 3BH7B 1T8EA 3QRPA 2RS2A 4DU7A 5C2GA 1T9VA 3KLVA 3PZPA 1S0VA 2W01A 1XK8A 2ZITA 3T1HF 3W64A 4B08A 4B9SA 2L08A 1J5EJ 5HVHA 2D69A 3W2WA 3R1HA 2GHWA 1M90T 1U2CA 4UOHA 2MZ1A 1V3ZA 3BF4A 3EZ5A 1FK9B 3JSMA 2R2UA 3PX6A 4I68A 4AL6A 3Q89A 1XTZA 2V2VA 3I4HX 1MMLA 2LDIA 2KU7A 5KT5A 1WWHA 1RQ0A 1FDDA 2VPYB 1RTIB 3BKUA 3HSJA 2UV8A 3NLCA 1W2BR 4QU7A 1SKRA 1RT2B 2Z4PA 4LBIA 4O0IA 4DF4A 4JI2F 3M6VA 3OLBA 2AQ4A 1RTDB 2LXUA 1TZ0A 2PEBA 2BX6A 3DCAA 3RUBL 2ADCA 1JWWA 4X4OA 5DGAA 2PA8D 1JLQB 2EG2A 5L38A 3RRHA 2J7UA 3CW2C 4IG3A 1F9HA 2GVZB 4IR9A 5LSOA 2GAGC 2HKEA 3IN5A 1UWBA 3KMQA 4NLDA 2ADBA 1WF2A 2EKYA 1ROFA 3DU6A 4QR2A 4GC6A 1SKUB 4NLVA 2HFNA 1WUUA 5A6WA 3UN2A 2RDJA 4YY3J 3W7BA 5HMYA 1K44A 2IYGA 4ZS6A 3ZZOA 4DR6F 1UWBB 2H5JB 3KUHA 3M8PA 3A8EA 5A0YA 2AU0A 1OMSA 2M88A 2KYZA 2LXFA 1OSDA 4WU2A 1ZAWA 4CNYA 1VQKS 3BREA 4TKTA 2VOPA 2HAIA 4U9RA 4U96A 4ZJLA 1UEVA 2JLEA 5HQ8A 1AROP 5KT3A 1Q16B 4KH1B 1FA0A 4DV0F 3ILLA 4M5MA 2YWEA 4J91A 3ZTOA 4O3NA 1Z1ZA 4JI5F 1N88A 2GMLA 1SH0A 3MFHA 1GNKA 2F8MA 4IG0B 3CC7S 3RBXA 5E3RA 1QTMA 5ITHA 3DGPA 5A2QY 2GQCA 1EAYC 1FE0A 2HBRB 1NPRA 3MEEB 3IWNC 2V9KA 3PRVA 4ZN1A 4LSLB 4DPOA 3QRRA 2PMHA 3KNGA 4O3OA 4U95A 4DN0A 4IO9Q 1X5PA 1R7IA 1SQFA 3O8WA 3RAQA 1SJFA 2ZWPA 3VAMA 3GFHA 2F4FA 3TA0A 4DLGA 1N36F 2R7OA 4WFBQ 3H4DA 5RUBA 5H1SV 2W2QP 3BS9A 3SQGB 2J0SD 3G71S 3KLEA 4X65J 1EARA 4P9SA 3M7VA 4A8XA 4DPXA 4ED8A 4WXWA 1I6JA 3PO4A 2FVRA 1N5TA 1IWGA 5HROB 4DV2F 5HP1B 2DR7A 1TFWA 2BACA 4RBUA 2RSQA 3FBFA 1X4BA 4Q0BB 3HHLD 1JB0C 2DTJA 2QIFA 5KFVA 1RHRB 2N4CA 3GV7B 3KK3A 3SCIE 2ZBIA 2DYAA 1TV6B 1HPZB 2XEXA 3MWBA 4O4GB 2B56A 3GFZA 3QAUA 4PYAA 5LT5A 3HP6A 3KJQB 1U25A 3M8PB 3POTA 2AKWB 2ZVIA 5D15A 2VDIA 3SBMA 4KH0B 3J7ZT 1HWKA 3IA0A 1G7CB 2XMMA 2GHVC 1D8YA 3EXYA 1AFJA 2YWGA 4LMZA 1NH7A 2YKMA 4ZPWR 4NLGA 2YKMB 1REVA 1DTTB 4HI2A 2KJWA 3GFXA 2DNNA 3O2IA 2FJAB 4I0WA 4DMZA 1OIAA 3J80Y 4ED0A 1X60A 1C1CB 1NDCA 2AEMA 3C6TB 3H90A 1DURA 5ETSA 2IVFB 3A3PB 3OL7A 2FHOB 4MFBA 2ACMA 2ZBRA 4QIFA 3EICA 3ZC4A 4EBDA 2AJFE 3Q0AA 2VF3A 2XYPB 4LR8A 3VWSA 4WFAQ 1VQ7S 3CJKA 1FVQA 2RHQB 4ZN3A 3MMAA 2P9GA 4UOCA 5KFKA 3PW2A 1WTFA 2OUGA 5IZHA 1M5KC 2G1HA 2J9EA 3OL9A 1C0UB 4LRFA 1RTJB 1YBTA 1FK9A 3JSMB 4B3MF 4CQ1A 5IT9U 1N32F 3MR3A 4YN3B 3KLEB 5KFUA 2J6TA 3CVKA 1X0FA 3C15B 3HULA 1YJRA 2OHDA 1F3VA 1WC3A 3QMQA 4KQZA 1QY7A 5CZVA 3T1HJ 4LF7J 2JEIA 1DHMA 3H20A 4Y2KA 3AH6A 1U0SA 4DR4F 1X4AA 3ILOA 4L76A 5KFPA 3DC2A 3DLLQ 2DEIA 1OQ6A 1A6LA 1HQ2A 3VZHA 1JLAB 1P6TA 1S1XB 2BJDA 2B43A 3CJ0A 3R7NB 3UCGA 2HZVA 3ENVA 1RTHB 1VCTA 1JLBB 3B54A 3TVKA 5KT6A 1VBYA 1YJNS 1OY6A 2H5IB 1F60B 1HBNB 1B0VA 3NS6A 3CJ5A 2SXLA 2IRYA 2UP1A 2Q6BA 2YPYA 1KONA 4GO5X 3I9ZA 2YBVA 3DLHA 2WZ1A 4Y2AA 5J1EA 1S9FA 4EO6A 2DGTA 3QPIA 4O4RA 2BM1A 3GG0A 1UFLA 3GTYX 2V50A 2QFJA 2MZSA 4UQGA 3BGRB 5D0EA 3Q23A 3PW7A 3WIVA 3MAQA 1S1WA 1T11A 2UUWA 5M2UA 1U09A 3BO3A 1KVIA 3CNQP 4S0MA 4RZRA 1VRTB 4X66F 5DG8A 1PG5B 2H5EA 1TKXB 4DR4J 3IG1B 2B4UA 1UP1A 5F8HA 1YRTA 2HZCA 1M5VC 4K4UA 2CZ4A 4R5PA 4WE1B 1WKKA 2RNEA 4J90A 3MM5B 4D3HA 5MLCV 3RW7A 3OTOF 4USJC 1YJWS 1HARA 1XR7A 3G6VA 4CWBA 2D9OA 4IQMA 2DNOA 3M32B 4JOUA 4EMDA 5L39A 4N77A 2ZM6F 2EC2A 4ILMA 3VF0B 3IS9A 3JSRA 3PFOA 4DV6J 2HMIA 2DY1A 4C0OC 4LF5J 3W5YA 4I6WA 4NRTA 2CQBA 1KQKA 4LF5F 3GYNA 2DR8A 3MUTP 2IFXA 5ETOA 3JAMU 2CZVC 3J81U 1Q7YT 3CJ2A 3A1YG 2BJ3A 3HVTB 1HR0F 1O6XA 3PNIA 4I64A 2VBYA 2JC0A 2NQPA 4L3KA 4OV1A 5D4PA 1V3SA 4IFYB 4M95A 3KJFB 5LM7E 1RJJA 1TUWA 1RAJA 4ED1A 2MY7A 3E01B 3BDPA 1F9EB 4M5GA 2N4DA 3GU0A 3PKYA 3EVMA 4ZLLA 1KFDA 3ICLA 4F25A 2MZJA 2RF2B 2BRLA 3FSXA 4UOFA 2EC0A 4AD6A 4PQAA 3US5A 5EWGA 4WCEQ 4M5LA 4CH1A 2KKHA 2BQUA 2QA4S 2VJVA 1T03A 1N0VC 5HJYA 5LMUF 4DS5A 4DR1F 1OY8A 2QMUB 1P9QC 4DUYF 4U7UD 4C7QA 1BC6A 2RH3A 2JRSA 2DHSA 3TZZA 1P1LA 3OUYB 1N33F 5IQQA 3PIOQ 2XSJB 3JSYA 5D4LA 1FRIA 2FZCB 2YKQA 4J9QA 1R6VA 4FBUA 1RWOB 4DSLA 3TJ9A 1JLCB 2ZNZA 2HHVA 1ZM3A 5KG4A 1DTTA 3SCJE 4TQSA 2HHHJ 4MYTA 1YGYA 5C42B 2JDJA 4NYZA 4DV2J 4F50A 1FEEA 4USWA 2EG1A 1ACMB 1W7WA 4YR0A 2EBEA 4I69A 2FC9A 4XO0A 4HR2A 3IC1A 2NR0A 3OVSA 2FVCA 4K59A 3PJ9A 1JNRB 4ZP7A 2WOMA 3D3BJ 3M9NB 4X2BA 2XS7A 2AHOB 1NO8A 1EX8A 3CMES 4KJIA 3HMJG 4QR0A 2DT9A 3NGDA 5AXLA 5IFMA 2XS5A 2FJEB 2OTLS 1SV5B 1TL1A 3BO4A 1R8HA 1DQ9A 3DDNA 2CQHA 4ZPTR 3LWMA 1S10A 2I2YA 2FHMA 1FXRA 3SQGA 1YKWA 3O44A 5B7WA 3TUJC 2F1FA 2GC8A 4L75A 1NAQA 4WP3A 3M6XA 1PO6A 1HD1A 4QR1A 1TL5A 1CBKA 3H5XA 3MEDB 1HD0A 1OPZA 1OO0B 1X4HA 3T41A 1Y0HA 3CD7A 2L9NA 3CJRA 4DCPB 3DHWC 3GR1A 2YNHB 4TYBA 4XPCA 5BR8F 1JXVA 2ZH8A 3OUYA 1RZMA 3OSNA 2RQKA 2BQRA 1M5OC 3LALA 1UJ4A 4RNMA 4ECQA 1K8AT 2KM8C 2OPRA 1RHMB 2QLXA 2B8QA 1H2VZ 4MKVA 4ID8A 3SSSA 2VIHA 3SV4A 3I82A 3V6DB 1SKWA 1B64A 2GFFA 1JX4A 2LA4A 2HNYB 2VL1A 4DLEA 1RP5A 4DL0C 3RB3A 2HIQA 1RCOB 3KLHA 5H9EK 5HLFB 1FKOB 1Q82T 2UVVA 5EN1A 3A8JA 1WF1A 1REVB 4DSKA 4NXMF 2V4RA 4HHJA 2P9CA 4FPRA 5AE2A 2RDDA 1ZH5A 2HW3A 2EW9A 5F8GA 4YEAA 3VAKA 2H54B 3CJ8A 4FVMA 1RT1B 2RKIB 3VAFA 3NRBA 3PVXA 3ZZ0A 1HNVA 3ULHA 1QVFR 3PO5A 5IC6B 3BGLA 2M0GB 3TA2A 3VALA 2XI2A 4CO1A 3I0RA 2CPHA 1HYSA 3KLGB 2GIQA 3AAWB 1RT4B 3FKBA 3KHRA 2PGCA 3C6UB 4C0BA 2WAQD 1FNOA 1KN6A 3UD4P 1NSAA 3DM2A 1BMQB 5KFCA 3Q8VA 4FVCA 1RHUB 4N5SA 3MMJA 5F8IA 1Q8LA 1NUEA 2GCFA 3T9NA 4ZCLA 1ZYQA 2OFGX 3OVAA 2OLWA 3AD7C 5DS7A 3B82A 3MCSA 4CLKA 3Q8RB 4C3LA 1FO1A 4N56A 3OL8A 1HNXJ 2HFOA 3UVJA 4LF4F 3SCKE 4J9MA 3KDNA 2DNRA 2ATCB 5KFIA 3MECB 3PW5A 4IRKA 1WC0A 4CO5A 4URGA 2B4PA 4PXBA 3FCHA 2FUG9 1LEOA 1X8DA 1ZAXA 2OH2A 5GAGI 2ZDOA 3DRYA 1EKRA 1OSCA 1TMJA 2M2BA 2J76E 1T94A 4X4QA 5KFEA 1GTEA 1S1UA 4DL6A 4YHHF 2KZZA 2J7WA 2XZTB 2FTRA 2YY3A 4G1PA 1U0HA 4A48A 2EFOA 2ZHBA 3J7YI 3DHXA 1DY3A 1RWKB 4JV0A 2CAJA 5CYJA 3RB6A 8RUCA 3ILIA 4QZVB 4ZMMA 1KOHA 2CQDA 4HTIA 2MLZA 3ZZRA 1TUGB 4A8WA 2HURA 4ELUA 3MPUB 1ZTWA 1IKYB 2AJQA 4HL9A 2JNJA 5DDRC 2CPZA 1Y3KA 3AJ2A 2W4DA 3AQPA 2C2RA 1RA6A 3G9CA 2R8HA 3TQ1A 3KTQA 2Q3PA 1VISA 2ZH5A 3WC2A 2Y8YA 2CYYA 2HEKA 1AXQA 3WZ0A 1S6PA 1HNVB 3BH6B 1Q86T 2FB0A 2AF6A 3HHEA 2R2RA 1C2PA 4I2QB 5K8MA 1Z4UA 2GJFA 4I2PB 4QW9A 4J9VA 3R9LA 4W92B 3GPAA 3HPOA 1G1XA 1QTNB 4N8OA 1FDAA 3AJDA 3HFVA 3JQJA 3CPWR 3DDIA 3K89A 2LCWA 1TP7A 4DL5A 2LQBA 5ETVA 3I56S 2V6AA 7AT1B 4UY85 1N5YA 1RWVB 3GQCA 3KK2B 2CQ0A 2QYGA 2IM0A 2GJ2A 4WXOA 4OHYA 3OR1B 1LKZA 3BB5A 1Q7LB 2K1RB 3MM8A 1MMNA 3OFHA 4HI1A 3HK2A 3UD5A 2E29A 4P75A 4RJVA 5KFWA 4J9SA 2UUCJ 2XI3A 2RU3A 5DQIA 4EO8A 4J9RA 1D0EA 2BV3A 3H42A 4DFMA 2MQQA 1S7IA 3KOAA 1HNWJ 3VGTA 1RT7A 1VDHA 3DRSA 3QGIA 1QJHA 5EHHA 2WB4A 2ZE2B 3OFEA 4HHUA 1OJ4A 2EWHA 4KKOA 3IBCB 4CRJA 4K8RA 2MQ8A 3SMZA 2YKNB 4GVLA 5CYQB 1RT5B 2LQ5A 3PJXA 1C4AA 5C25B 1TL3B 2J8SA 5I3UB 2DNGA 3HI9A 3UW1A 5A8RB 3J7Z5 2CPEA 3DI6B 4IO1A 4IKAA 5LMUJ 4B9UA 1J2VA 4TU9A 2E9RX 2YWKA 3ZNJ1 2V2ZA 4MIBA 4DPTA 3CCZA 2PT0A 3GWCA 2G0JA 2AZ3A 2UUAF 4DSIA 3CMQA 2HWIA 3UDVA 2CVEA 2WB1D 5G4DA 4OYIA 1T3NA 3RBDA 2G2OA 4K5RA 2DIUA 2BMBA 1QLNA 1FERA 3BGRA 3ENAA 1TK5A 4Y2MA 4NXMJ 2KHDA 2BKPA 1WD6A 1JLCA 1NXIA 2I8EA 4KV8B 4KFBA 2VOOA 4IYQA 1WHWA 1PAUB 4KC5A 4TY9A 4K4XA 2YX7A 4ALZA 2IAJB 3VV2B 4QYZJ 4AE5A 1PCAA 5JXSA 2XY7A 1VHFA 3GP9A 2HHPA 3ADAC 4JYAF 4ZITA 5BJRA 1U49A 4F8RA 4JV2A 3AHPA 2ABYA 3BSAA 5F3ZA 3KK1A 2N82B 2EFGA 1T9XA 3IAS9 2J0XA 4HH0A 2DPJA 5JVHQ 2ZKTA 3BYPA 1SJRA 1G2EA 1TKZA 4PG8A 3RTVA 5ETTA 4UOGA 1HI0P 4B3RJ 2EBGA 3CJ4A 1NDKA 2QL9B 1IKWB 4OYXA 4ZJOA 3ZZZA 1NZAA 5FLXY 4DV3J 2CJXB 1JJCB 2AYMA 5ETLA 2M8HA 1S9EA 3GJRB 4ZJQA 4ITSA 2VQFF 3MECA 8AT1B 4IH5A 3C8YA 1S72S 1HNXF 3M6WA 2VQFJ 4ZDNA 3CCVS 3PHTA 4KO0B 4ANCA 2F3JA 2EXUA 4ECZA 2QLJB 3K57A 2GO9A 1VRUB 3MR5A 1X4EA 3GZ7A 1F5CA 3M8QA 2OGUA 4ECUA 2C2EA 3DOKB 1RGVA 1IKVB 1VBZA 3DN9A 4CLYA 1LFWA 2J5AA 2VG7A 1GXLA 3L7UA 4ER8A 4G3IA 3W3SA 4PWDB 3I5BA 2FIUA 3LQVA 4OZLA 1IXKA 3SFUA 3AOAA 5J2MA 3OLAA 2EK6A 1R31A 1RA7A 2CXEA 4ICLA 5A8WB 5K5MA 1UFKA 2R7SA 2I5JA 3J7A1 3MTKA 2CZ9A 2GQQA 1BQXA 1WORA 1WELA 4LVOP 2FGOA 3W63A 1NPKA 1S9GA 3V4MA 3HSDA 1U1OA 1X5TA 4LFBF 1K0VA 2HQIA 5F3TA 4ANEA 2OD6A 2BQ3A 5U47A 4M5HA 2E5GA 1JXEA 4C11B 3TAPA 3CGIA 2C3YA 2UUTA 4ZK7M 3KYLA 2UVWA 4DFPA 4YUDA 1LV5A 1NK6A 2MEWA 1SC4B 4R8UB 1KTQA 2XLKA 4M1KA 3MTJA 1FDNA 2D3OR 2DNMA 2H3EB 2OKQA 2B4OA 4WFYA 2C2ZB 5GAHU 4UQTA 4M5DB 3LF0A 8ATCB 1S7HA 2CJKA 1Q5YA 1UVNA 3WBZA 4FYWB 2VASA 3SEOA 1XIQA 1IJFB 5I4MA 4HYKA 3I87A 4WBFA 4K0KJ 1JIHA 4AQYJ 4Q8EA 1S12A 1RT7B 2N7CA 3V6KA 3LO3A 4ZIWA 1X7VA 1R89A 1DJ0A 1H74A 1EJ7L 1WSVA 4KKOB 3ZTSA 2KH9A 5IC4B 1FTCA 4D3GA 2KI2A 2JHEA 3AD9C 3KKFA 4ED6A 4C98A 4QWEA 4ID5B 5ETKA 5K14B 3ISZA 3TUZC 3BO2A 1BQNA 2YPZA 2IPOB 1FD2A 2AJ2A 2M9KA 3CXCR 5KT4A 4ZVOB 1RU2A 2HVHA 2FJDB 2PE8A 1HWUA 2ZD1B 4DR7J 2A18A 4DS4A 2VFVA 4DV0J 3M8RA 3GSIA 5ETQA 3SIPB 4CT9A 3VAIA 2L9WA 4DR3J 3Q8QB 3QGPA 3DDKA 1CJVA 3I0RB 2Y0SD 2ZVSA 3N5BA 1DARA 4P7VA 4N47A 2UUCF 3L3CA 2R7QA 1HA1A 2XWYA 3MPDA 3U02A 1KNZA 2LQJA 2V9WA 1RT1A 1PKUA 2RKIA 3C66A 4CTAB 3M2VB 2QEXS 1MNEA 1GMWD 3R6GB 4WTOB 4Q5VA 2DPIA 3UDEA 2VC0A 3TNVA 4FYDA 2OSRA 3FCVA 2NXEA 2X1GA 1WC1A 2R7TA 4LF7F 4HVZA 4I7FA 1HNIA 3HT0A 2IVMA 1YRXA 3BKFA 3GSDA 5KFMA 3SZ2A 1HNWF 3OHBA 1N5VA 2HFUA 5A6PA 4C8ZA 2XBPA 5ETNA 3JTPA 1RKJA 3GIKA 4FNHA 2PI4A 4UZCA 1NZ8A 3NNCA 4B02A 3MMBA 1M1GA 2ZC3A 5KT7A 4K7QA 2C42A 2MQLA 5LOQA 4ES1A 4K4WA 1ZA1B 1IVZA 6AT1B 1OS5A 4Y0FA 4BHQA 2ZOGA 3KWMA 1KQSR 4Q0BA 2W25A 4U8VA 5EDWA 1KLMB 1RDRA 1FRHA 3OTDA 3PDNA 4CH7A 2AEJA 1UW9A 4ZVTB 1BLUA 3VGSA 1HHTP 2FJBB 3MAAB 3MEDA 3WQPA 4FS2A 4ATNA 7FDRA 1S9EB 2QX0A 3V6HA 1BQNB 1H2TZ 2ZH2A 4B3RF 2HFZA 5A76A 2FJXA 4G1IA 5CXTA 1DBDA 3CJ3A 3UD3P 1VQYA 2HHWA 1APSA 1JLFB 2LQ8A 2NXUA 2WVBA 2CQGA 3G8TA 4K50A 1HBMA 1RT3B 1KR4A 1QD1A 3N01A 4NMXA 2RIJA 1XEZA 1NEEA 5C24B 2JOQA 2DITA 1MU2A 1H0HB 4DR5F 1YWXA 2W8KA 2BEFA 2C2KB 4LF2A 5C42A 3ISNC 5H9FJ 4LQ3A 4ZOSA 3D6HB 4DJBA 4B3MJ 1N54B 3D1QA 1VRTA 4H54A 5HQMA 3CDUA 1BWVA 1HBUA 1QUVA 2W1BA 2WW4A 2WRMA 2YTCA 3GCXP 2I6WA 2VC1A 4CTAA 1GMVA 4HHHA 3FSIA 2W7OA 2CWXA 3FBBA 2B9XA 3L9ZA 4XPEA 4LFCF 4MJKA 3M05A 2HS0A 1ZOTA 4LRBA 4C11A 3DRPB 5GAEU 1YJ9S 4ERDA 1F9FA 1HBUB 3IWLA 4ZVHA 3PRBA 4DSFA 3OXFA 1BY9A 1WOOA 1MLAA 3MCMA 4DU8A 2N3OA 1NRKA 1PC5A 2DIVA 5M2RA 4CLWA 1EETA 1KHVA 4JI8F 4C6AA 1BXNA 3A12A 2QMWA 1E6YB 2W9BB 2HNZB 2I38A 1VQ8S 2IRXA 2OPPB 3J80U 1PSDA 1Z2LA 4K4YA 4NOHA 4Q44A 1AA1B 1UAWA 3MI7X 3KXDA 5G0RB 4WZMA 2MLYA 3MD3A 1WG5A 2MJUA 3NWRA 1RT2A 3IM8A 3IRXA 1LWXA 3FEYB 4KPYA 1S4EA 1URRA 2DHHA 3W5XA 1NK0A 1L3VA 4XAKA 3RGIA 1JK9B 3CD0A 3M8WA 3QQCD 4M5JA 2VD3A 1RBOB 3JQMA 3MAHA 2V4QA 3FMWA 4K0KF 4LFAJ 2O66A 1IKXA 2M4MA 3H5SA 1FX2A 3QFHA 4DDFA 2DR9A 4DSJA 3RRKA 5IXUA 3TANA 2CJBA 1SJQA 3N79A 2AJ4A 5B0FA 3H59A 1HWJA 3TJAA 4DX6A 1EIYB 2HHHF 2XMAA 2ASYA 3A3NB 1S0NA 3PEJA 2KYXA 4QWAA 2V8PA 4X4NA 4A46A 2LKZA 2FZGB 2QC3A 2D3UA 4ZVFA 4ZVPB 2GJIA 4J9UE 3W9IA 4DQRA 2AD9A 3CJSA 4I6YA 4YB5A 1NM2A 1UVIA 2A2CA 1AYEA 3T5KA 1TKXA 3A8IA 3V81B 3C6TA 2ZHOA 1U6ZA 4OX7A 1DLOA 3AOCA 1SUQB 1RT6B 2X1BA 3L7PA 1S1WB 1U2RA 3C6UA 1FRXA 2GMJA 2HNDA 4OYPA 1YQHA 4OZ0A 3EM1A 5CABA 4RNFA 3BSOA 1M5SA 4Q43A 1N48A 2RQCA 1R8AA 2EFQA 1TVRB 3HFZB 4KFBB 3K5NA 3KLIB 1S97A 4PQUA 3MXHP 1FJGF 3KG0A 5H9FK 3CT9A 4KTQA 5IV3A 4HACB 3CD6S 5KFHA 3K5PA 4AYBD 1I94F 2UXDJ 3HFKA 2DGWA 4JI2J 4YQWA 1YJUA 4JI7F 4LF6J 3PXGa 1WKJA 1R0AB 1UL3A 2M3DA 4LF6F 5EX0A 4WPAA 2B9EA 1NLKL 2X3GA 4LBHA 1N6QA 1JLAA 1S1XA 2CJAA 2BJ1A 2CPFA 3E01A 1VLYA 3CCJS 3P8BB 1Y5NB 2HYIB 4IUFA 5T41A 4G1QA 2Z0GA 5KFOA 1U6BA 3FZ2A 4UY8T 3E2EA 5KFTA 1S0OA 3UCUP 1HFEL 1TQLA 1NU4A 3HVTA 3N0VA 4J9PA 2BUNA 3M2RA 3IO1A 3W65A 1WNEA 1RSCA 4Q2LA 1BD6A 2YNHA 4ID5A 4PWUA 1VFJA 4RUAA 3BKTA 3LPYA 1YZ7A 1FI4A 1CJTB 1RISA 1SIZA 2BKNA 2DHXA 3C14B 3DRSB 4OI6A 1IBMJ 4NZ0A 1SQGA 4MYUA 2CNLB 3IM9A 1T9YA 2HHSA 2AJ0A 2NPIA 4TVAB 2IJFA 3HKWA 2CDRB 2OAUA 5KG3A 2HVZA 1VYAA 4XIUA 3A13A 3N5FA 1UCNA 2RRAA 1UMJA 5C2CA 3DOLB 1ZBTA 1X4DA 4KV8A 3H2UB 4JUZA 4WK1A 4K4TA 1R6YA 4ZPAA 4OI2A 2C3OA 1GH8A 1RT4A 2HZAA 3BBBA 3D68A 3KHHA 2FPHX 3ZZPA 1X31C 3F73A 3ZXWA 1XMQF 3DMJB 3HX9A 3VAHA 4B3SF 3NNHA 2R4FA 3FVYA 4JI0J 2V2KA 4F3OA 1SL1A 4X64F 1T7PA 5AE1A 3KUEA 4PQUB 2V67A 3HCXA 4IQXA 5JVGQ 2ZEJA 2XB2D 2FVPA 3TA1A 2JLGA 1R27B 1R0CB 1RAHB 2KXFA 3CDWA 3OR2B 5EWFA 1JKHA 1RHJB 4YOEA 4IDKA 4H4OA 3LP0B 4O3QA 1FVSA 4U7CA 2VBZA 2CQ2A 2DNYA 2RUSA 1JJHA 1LW0A 1P9YA 5HP1A 2CA9A 4DL4A 2AZ1A 3ENWA 1CVJA 3P49B 4RW8A 3LW5C 4NLPA 4KB7A 4DQIA 3F56A 1KKHA 4OYWA 4P2XA 3G4SS 5E7OB 1RTHA 3CCRS 2GMHA 5IT4A 4DV6F 4DL3A 1VBKA 4V1Ak 4ZLPA 2UVRA 3HDSA 4RBTA 1IWAA 1RWMB 1VJQA 3GIRA 4B3OA 2Z8QA 4PG4A 3M2RB 1O5JA 1DTQA 4IFYA 3HHNB 1Y4ZB 3LPEA 4CDIA 3FZBA 3MAAA 1D1UA 2ZOMA 3DOMA 4KGXB 3CCUS 3QJJA 2DISA 1JXLA 3D6TB 2R9LA 1FEHA 2QA1A 3KUGA 4RW4A 2XULA 3W62A 1RUSA 1H73A 4JI3J 4FXDA 4Y6IA 5DM6Q 2R7UA 1UETA 4OZNA 3L7OA 3T9ZA 1ZTTA 1LW2A 2PIIA 4URQU 4NMLA 1VC6A 2HFVA 2MMYA 3OW2R 3AA9A 4ZPBA 1UVMA 4QYRA 3VQTA 2XS2A 1C1CA 1NHUA 1DQ8A 1UZDA 1YG0A 2NXNA 2WW8A 4RL1A 4CNZA 3MFIA 1WTBA 4ECXA 3KLIA 1S6OA 1R0BG 4X84A 5LJ3Y 2PDAA 1FT8A 2ZWOA 2XYGB 2CQ3A 4EEYA 5EX3A 2HNDB 4KHRA 3OQ2A 5CD4A 3GCWP 2OIHA 9ATCB 2ATLA 1SUQA 3MR7A 4ETXA 3M2VA 4A4JA 3L09A 2WSCC 2JVRA 3DRPA 2ZH6A 3RR7A 2AX0A 4A8QA 4FF4A 1RAGB 2CNKB 2GA7A 1DAXA 1Q8IA 3CE8A 3K7RA 4OQJA 3BQ2A 2W4CA 2UU9F 1VLOA 2JZ5A 1RWNB 2V8HA 2BOAA 1FXDA 1XN9A 2XHWA 3D66A 4RW6A 3THPA 2E5LJ 3J7AN 5IT9Y 4GVBA 3U27A 3FBCA 4TLQA 4YFUA 4AL5A 4QPTA 1KVKA 1RAFB 3SDEA 2LU2A 4NCAA 5D4OA 1T05B 4NXNJ 5GADI 2MSSA 3VQSA 2Z2ZA 3QBCA 4DX7A 5KG7A 3G6ES 1NJWA 4NXNF 1HYSB 4USMA 4Y65A 2D41A 4PPDA 2VHGA 1U47A 4E2FB 5HROA 1WEXA 2CQIA 3JQKA 4X62J 2QL5B 3HZGA 1EQ0A 3W8GA 2ILZA 3VR1A 4ECRA 1OPIA 2J0QD 3MGJA 3EJMA 1DTQB 1FFGB 1IKXB 4Y2CA 2OEJA 3KG4A 2K06A 3M2UA 1VIOA 3SSQA 3UQSA 3QZ8A 1R8BA 2CPXA 1B4SA 2FDNA 3OFFA 3R5GA 5IOLA 1SJ3P 1A7GE 1JQGA 4XDCA 1DQAA 5HL7Q 4PYDA 4RNNA 2ZH3A 2VV5A 2ZJPQ 4JB8B 4OJGA 2HVDA 5KFGA 1SC1B 3OL6A 3BPSP 4F67A 4IRDA 6FD1A 4F4WA 2FLNA 2XGPA 2VA2A 2WTFA 3MHYA 4OHXA 1YX2A 3KLGA 4WE1A 2P2CB 4J5OA 1KRPA 2E5JA 2B7CB 2ASDA 3MD1A 3UN5A 4DR3F 1HIYA 3MDFA 1FRLA 5ETRA 3GILA 1TAUA 4FKYA 4FN5A 2D9PA 4TQRA 1TU0B 5KFLA 4Z7CA 1FWPA 2VQEF 3DMJA 4DF8A 4F26A 2O3DA 2ZBQA 3K5OA 3N6NA 1VIXA 5AT1B 4BC9A 1EP4A 2YQ1A 4K4SA 1NNDA 2K2PA 3MEKA 2X3DA 4DQSA 4QBUA 2RRNA 2FY1A 1SB6A 1VGYA 1B3TA 3OXLA 1WHVA 2GS8A 3VCDA 2OMOA 1RTDA 2QJ3A 4I6AA 3OTEA 2DNQA 3S8SA 2B9WA 1S6QA 3MEGA 3NAHA 4CO3A 4A8YA 1O51A 4LBPA 4CO2A 2KFYA 3PM9A 4CIOA 4ZLJA 4F4ZA 1VRUA 2G13A 4OJ3A 2GAHC 2KJVA 2BRKA 3OD2A 2VKRA 3U1MA 4BCAA 3HVRA 5E3AA 3R5JB 3GG1A 1QAIA 3PKMA 3UR0A 5B0EA 3QNWB 1EHWA 1N4LA 2GW8A 2ZD1A 4KGMA 5I3QA 2Y3YA 4DZ6A 3NBPB 2DR6A 1LWCA 2H4YB 4PABA 1OYDA 2M52A 1I5OB 2QO3A 4YR2A 3TVYA 3BSNA 1VQSA 2Y0BB 3BDEA 1NHVA 3MM6A 2DGQA 4C8YA 4XK8C 4V19J 3ILJA 1U1RA 2E9TA 2GVDA 3K8VA 5AJ3F 2O01C 1CJKA 2KG0A 3EGWB 3MOZA 1SCJB 2MGZA 2ZJQQ 1PJ6A 1QSYA 2BJ9A 3LH2S 1TKDA 2AYGA 3DLEA 1U1NA 5C7PA 5ETMA 1HQEA 2B7BB 4HT7A 2OP5A 4I7FB 1VQ6S 2F4VF 2IMOA 1FHTA 3J7YU 3I55S 4Y2IA 2NXCA 3KG1A 1R43A 2HHXA 4ES3A 1VC0A 1YBUA 2PD1A 3I6PA 2RB7A 2PO4A 4NX9A 2QLWA 5KOXA 4DV3F 4OHWA 5L9XA 4PPZA 4R5PB 2BZ2A 1MMDA 2D3O1 3R5CA 1MSWD 3QYYA 3RB4A 1J5EF 1N33J 1RWXB 5B0GA 1WEZA 2GIRA 2XHCA 2J6UA 4MIWA 3TX8A 1WSRA 4DR2F 3MMCA 3WX8A 4WIIA 1CULA 1FESA 2E1PA 2HBYB 5KFFA 4UF4A 1QAXA 2N3LA 3OXGA 2HRUA 3FQKA 1U24A 2YKPA 4M94A 4OX9F 1WHYA 4ZVQB 4GRSA 4DCJB 1JJ4A 2R7XA 2KFZA 1UPPA 2LEAA 3HO1A 4OIXA 1VJWA 4KPCA 4N7TA 2DH9A 5JJBA 1U45A 2RDIA 1HBMB 1RT3A 4NLOA 3R5DA 2CPJA 3B4DA 4ZP9A 1FNXH 1ZM4A 3EXCX 5KT2A 1TMMA 1VBXA 1S48A 3EVWA 4PCQA 2KRRA 5BYQA 4TN2A 3RB0A 3M2UB 3X3UA 3W66A 3NCPA 4PWWA 2R2SA 3B78A 1YLXA 1IR1A 3DOMB 1AZSA 3EGNA 1S1TB 5L9NA 4U6PA 3TAMB 3NNAA 3KNAA 3TZWA 4E98A 2ROEA 4C9DA 1LWCB 2CJYB 2IYIA 1VQ9S 3EMTA 3W1YC 3I31A 1RWPB 4QW8A 1MG7A 3JSBA 3HHLC 2CNNB 3R27A 1PYTA 3O5TB 4OX9J 4X4PA 1UVLA 2Y9HA 1XERA 4CM2A 3IWXA 3EPIA 4DUYJ 1HMVB 3IG1A 3FRYA 1IBLF 1GAOA 4G65A 2DNZA 2E1AA 3OTCA 4MTPA 4WZQA 3BV8A 2R8JA 1U6FA 3LP0A 4A8SA 2BOPA 4ED3A 4QQBA 1ELOA 4JI6J 4HEA9 3DRRB 3EYZA 2XC9A 3L4BC 4J9OA 4OFZA 4ZIVA 1KQFB 7FD1A 3CUNA 2IHR1 3DRRA 5J2QA 4QWBA 2MZRA 4ETZA 3PIPQ 3HHLA 2UZAA 3GONA 2ZH9A 3R1LA 1FJGJ 5JUMA 1N36J 4Y00A 1PC4A 4DQPA 5F9LA 5DJBA 4RU9A 3CO9A 2WONB 4RO0A 2QE5A 3TAQA 2VODA 2BE7D 4FF1A 4M5NA 2RT3A 2X1FA 5A8KB 4KO0A 4URSA 1X9SA 1NKEA 4MKAA 4DPUA 1VHIA 4EUVA 4OLPA 4PXDA 4CLTA 1RTIA 2BW7A 4JP8A 2YWWA 3TVZA 3V2UC 1KFSA 2P6TA 1AFIA 1M1HA 4YS2A 2IJRA 3SI8A 5C25A 2ALZA 1F5AA 3IRWP 2E7WA 3SFGA 2D3ZA 3T1YF 4DFJA 3QT5A 3EDQB 3IP0A 4K2JA 4LVNP 4CLSA 3OJSA 4QOTA 2QMXA 2FC8A 5K14A 1NMEB 2XQCA 1SIWB 3OTBA 3AODA 3NGKA 1TUVA 3GIIA 4OI0A 4KE5A 1KQGB 5KFAA 4AFFA 5F8LA 3H7HB 1GXTA 1HBOB 2MKYA 3I4PA 3N6LA 2BE2A 2DGVA 2E7XA 5ETPA 2BANA 2FYXA 4NLSA 3I5CA 5L1JA 4A8MP 4WJBA 2R8GA 2DH8A 2Z58B 4OI4A 4FXWA 4TY8A 4DG1A 4ES2A 3FFIB 5KG2A 3M32A 4DL2A 2B8PA 2NYHA 1RADB 3AB2B 3DGPB 3Q86A 4F0HA 3DM2B 2CJ9A 4Q7AA 2KVQE 2IM1A 3MUMP 5LMNJ 2BR0A 1SJ1A 1JJ2R 1M5PC 1MWZA 1HNIB 2IM2A 1H7XA 3MM5A 1EP4B 4EU0A 3QWPA 1UW4A 2W2OP 3PYDA 4JV5F 4PKDB 4P2SA 3C3LA 3C2PA 4P6QA 4WIQA 1T3OA 4PG7A 3U1NA 2PFDA 2AGPA 1U26A 3HD2A 4FPIA 3G8SA 3LWLA 1BUXA 9RUBA 5KOWA 3FK4A 2LVWA 4ED2A 2W2PP 4CI0B 3D9BA 4LIWA 1RKIA 4DFKA 2HQDA 4LR7A 5CAAA 5IV4A 2MJNA 2DNKA 2OD4A 1LWFA 4TNOA 3CDBA 1S0MA 1GQEA 5J1NA 1EKSA 1B7FA 3ONQA 2WBMA 2MDAA 2N7YA 1CJUB 3IAM9 3K59A 2PN6A 1Q8BA 1HQUB 3TEHB 5DG7A 2JEGA 1JLGB 4EYIB 1HBNA 1PILA 1XBWA 2IBOA 3QSYB 3CDAA 4I1TA 2Y1IA 1F2GA 2XMUA 1PJ5A 2NZ4A 1S59A 2HRYA 2ZE2A 1UVKA 3PR4A 3I5AA 4EBEA 2CQ4A 1U4BA 1X9WA 2HHUA 2HHQA 4HT5A 1VQMS 4LFBJ 4BDPA 1D3WA 1VS3A 4DXLA 4ECYA 3VVUA 4O44B 1LNQA 4X4UA 4NEYA 2AT1B 3MCNA 3N4WA 1RAOA 5B0DA 3GLJA 4IOAQ 2OEMA 2CIMA 1FWLA 1KDNA 4KT0C 4OHZA 2HHTA 3K17A 4CP5A 4I56A 4FYYB 5K9FA 5HMWA 3M9MB 5HVGA 3EZOA 1PJ7A 1AT1B 2APOA 4U8YA 3CCES 1A9NB 2AP6A 2YNFA 3OPKA 3TOQA 3DLJA 3H5UA 3TP2A 4F7VA 1ZM2A 4I2QA 2EI5A 2KL8A 4LRDA 4QIWD 1HWLA 1OY9A 2HG4A 1S6PB 1K47A 2E5IA 4MFBB 2L41A 2IAJA 2M5YA 1PGZA 3WIUA 3HVAA 2XCPA 1EETB 2DRDA 1I3OB 3NEKA 4KSEB 5FJ4A 1K1QA 1LWFB 4JBCA 3UE2A 3F41A 4RWWA 4MAKA 2V2QA 2W7AA 2DXDA 4M5IA 3GIMA 1TL4A 3E3XA 1JMTA 3UNYA 1J5OB 1XNRF 5K8PA 5DDPC 3THVA 2JEJA 4WWSA 2IM3A 4C3MA 3GIJA 3HM9A 1XNRJ 2RU9A 4FYVB 4JI4J 5HBMA 1IN0A 3FEZA 4WYLA 2YWHA 3W9HA 3CJQA 4O4GA 1BQMA 1YJ7A 3BN7A 2B0GA 1XNQF 2LP4A 1C4CA 1NDPA 1G4CA 3NXZA 3CCLS 4JYAJ 2BABA 2B4VA 2LDYA 3RW6A 2DGSA 5D4NA 2MKKA 2C22A 1HLWA 1YJTA 1XC9A 2OPRB 2VFRA 2A10A 3M4XA 1JNZB 4KHPF 5E0OA 3OJUA 1I51B 1Q81T 4RU2A 5KFRA 1R3NA 3NAIA 3D0HE 1AUSL 3NBPA 1XMBA 4MK9A 3MF5A 1S1VB 4GO7X 2OFHX 1JLEA 4LREA 4O3PA 3DYAA 1CQNA 4H4MA 3TUIC 4CLZA 5F8NA 3H5YA 2VG5B 2UUAJ 4NI2B 1ZA2B 2JSXA 5HAOA 4EWTA 4X64J 2KB2A 1Y9OA 4Z7YA 2XZDB 1S1VA 4I4BA 3F0NA 5CD4H 2RD5C 3NMRA 2QSWA 1V6HA 5HK4A 2YQ3A 1VQLS 3CC4S 2FHJA 2CPDA 2ERRA 2E1MC 1TL7B 1HWIA 3GB0A 2V34A 2HBQB 1TFYA 1RAIB 4RBVA 1GTHA 2COLA 1KC8T 2ZM6J 3N9UC 1F5BA 1K73T 4I2PA 1N6QB 5CQGA 2I0XA 4N76A 1LXJA 1NB7A 4ZPVR 2C2MB 4WP8A 1S77D 3QRQA 3PY8A 4U67Q 1T0TV 3P45B 5FIIA 4NCGA 1U48A 3HZEA 5HBMB 2GNKA 3NKYA 1LQ9A 2F8EX 3HXMA 2IC3B 4LFCJ 2HQCA 3TUPA 4WK3A 3AOBA 2B51A 2K7KA 1IBMF 2V5HG 3H98A 2IIHA 2LFVA 4R25A 2RILA 1VR6A 4NYOA 3VTIA 4QWDA 3WX4A 3JYTB 1S99A 4Y34A 1W25A 2AIRB 3PG9A 3CCSS 3MZIA 2J7KA 1NK8A 4UZBA 1N8RT 1FJEB 4O3RA 2YNIB 3HT3A 1SKSA 5IWAF 3R2CJ 1U02A 2HWTA 3AJ1A 5ADZA 4RLEA 3HLUA 4WP9A 3Q8PB 2P8IA 3EPGA 2X51A 4OJHA 4F2RA 3HJFA 1CJTA 2DXEA 2HS4A 1PYOB 1S1UB 2FJWA 2G1DA 3BQ1A 3BM7A 4W4MA 3WHIA 2VDHA 4TU8A 2DB1A 3ENQA 2XM3A 4AQYF 2KHCA 4LR9A 5CHCB 3ZTQA 1NB2A 2EFVA 3T5JA 2NZCA 3CSKA 2UV8G 2CUYA 4O44A 1NHKL 2HS3A 3SXLA 3TAMA 4KHMA 2GX8A 4HLBA 1NKBA 1M1KT 3D7SB 3CULA 3NGRA 5HSPA 2IA0A 1BGXT 1TK0A 4B17A 2Z30B 2Y1JA 4YP3A 4B9NA 2VFTA 2DGOA 2DH7A 2U2FA 2PMZD 2M70A 2E1RA 3R7SB 4TU7A 2DEJA 4RNOA 1L3UA 3Q8SB 2NXJA 4DL7A 1D9FA 1NSQA 4ZPDA 1RE1B 6FDRA 3KK1B 4KIAA 1HNZF 4DN9A 2ZBPA 4UW2A 1P1TA 2QLBB 3UNGC 1RYRA 1P27B 1RYSA 3EGVA 3GYXB 2HK2A 1TVRA 2WCXA 4DV4J 4UT4A 2P6SA 3SSRA 4HDHA 3IR5B 4ZVGA 2UXBJ 4DV4F 5D3GB 3MPWA 2YVSA 2GQ2A 2KRBA 2AEFA 2GIFA 2Q43A 4NLQA 4BLGA 1UEKA 4M5KA 1VRQC 3BYRA 4OYOA 2LMIA 2DGUA 5A2QU 2FHKA 2Q79A 1O8BA 3GJQB 2NCKL 1Y3JA 2XMKA 3CO0P 4RW9B 5LSRA 3KK3B 3DGVA 1NH8A 2K8GA 3W60A 5J1EB 5CCLA 2XWXA 2VZ9A 5DETA 1SJ4P 1X5SA 3OVBA 5F8JA 2QN6B 1RK8A 2V8VA 3Q22A 4PWDA 3DLGB 2RF2A 4L72B 1UJ6A 1LW2B 4IH7A 5C5JA 2OTJS 2C2DA 1YBAA 1GT8A 2HQFA 5KFBA 2D7SA 4DPYA 4OI1A 4OYAA 2NUHA 1LK5A 4RW4B 2CPIA 2MGZB 1YTYA 4PUOB 2GVDB 4B9TA 2XNRA 2UXBF 4ED5A 2JFKA 1GMWA 1H38A 3BR9A 5F0UA 2GGPB 1RABB 1U8SA 1TKTA 4WF9Q 4GKJF 5IM0B 1VQNS 2OEKA 4ZHRA 3F44A 2BE2B 1D9AA 4GKJJ 4PUOA 3J81Y 3CC2S 1RWUA 4ZCIA 4ILRA 4LIRA 2VA3A 1E6VB 1N34J 2ILYA 2L48A 3JXOA 2KN4A 3MM7A 3V4IA 1SL0A 2KT5A 3AQOA 4LF1A 4NA3A 4RUCA 3D6FB 5HMXA 1RB0A 4LSNB 3MURP 1RTJA 3P5BP 2OELA 1NJYA 3H2VE 1PIEA 2FLLA 5DZ7A 1Y5LB 1QM9A 3HHKA 2F7VA 3AXKA 1Q95G 3H2LA 4GVBB 4NLXA 2V94A 3FCWA 5SZTA 1FJ7A 2WOMB 1JKHB 3O1LA 4LF8J 2EPIA 1S6QB 4DR1J 1S76D 3UDCA 3SYZA 3OBIA 3R8YA 4EZ6A 4YY3F 3DXBA 2DNLA 1CULB 2E9ZA 5D0GA 2C2NA 3RZAA 4CLFA 3KFWX 3MPYA 4C8NA 5M2PA 3PW0A 1FFWB 3RBZA 3PHEA 3TO8A 3KLFB 1YRUA 4EYHB 1UA1A 5D3GA 2B9YA 1C0TB 1GEHA 2L9DA 2LYVA 4O23A 3OT9A 2HPUA 1EQMA 3IR7B 4GC7A 1U8WA 3FJ2A 3KLHB 3UDLA 1HHSA 2CRLA 5D78A 4OZ5A 3HVWA 5HLFA 2ROPA 4OZ2A 1CEZA 4HTJA 4OJ1A 2DJWA 3KJVA 3M9OB 2R7VA 1Q8KA 1U1LA 3POTB 1EB0A 1MN7A 3MM9B 4B9VA 1YDLA 3NY0A 4ZP6A 5E3QA 1V5IB 1T9UA 3M8QB 5KFYA 2KFNA 2CG8A 3IGVA 4ELVA 4NE9C 1Y11A 2GV1A 4L74A 2HQGA 5CYQA 1HI8A 1WOSA 3C14A 3NWGA 4J9NA 1UVJA 2P5VA 3K0JA 4FNIA 1UA0A 2A2DA 1S1TA 3BPDA 2XMVA 1HL6A 1TTHB 2VH7A 5GMKa 3T1YJ 1ZZNA 3P4UB 4J7CA 2C28A 3C46A 4NZ6A 1XWLA 2RVJA 3LTOA 1DZ5A 2VJUA 5T7LA 4X65F 2D1CA 3DNCA 5HN0A 3M1VA 2PMWA 5K20B 1VK3A 2B3TB 1MROA 1Y5IB 3SCLE 5CCMA 5IM0A 2MKIA 4QWCA 1B0PA 2H51B 3IS9B 3VHQA 3BSCA 2BE9B 2RHSB 2MQOA 5I42B 2KG1A 5F0WA 4CZCA 3CJKB 1Q78A 3QIDA 3KK2A 3M8SA 3QT8A 4IG0A 1FCAA 1GX6A 3IXQA 1N5YB 3NS5A 2AX1A 2WVCA 3H4BA 3H25A 1N32J 4IDKB 1YIJS 1H7WA 3QAEA 4BS2A 4FF3A 1FXLA 3G86A 2YX1A 1WC4A 3OFGA 3KLFA 2EVZA 4HACA 2Z2MA 1MW7A 2WBRA 3S7RA 3W5ZA 3PACA 1NJIT 3QJLA 2G2YA 4ED7A 4RW9A 3TYTA 1L3SA 3EGZA 1Q0NA 1IQTA 3HD1A 3E8OA 4YMEA 2J9CA 1H72C 4NCGB 3WC0A 2BDPA 4OZ3A 1HPZA 3K5MA 3QO9A 2XMJA 4IFVB 2Z57B 2UU9J 4C4WA 2BVZA 5E5NA 5T14A 5IS2A 2KXNB 1CS4A 2X1AA 3MR2A 1VQ4S 2CWKA 3FEXB 3G82B 2QZ8A 5H9EJ 1U7LA 1IUJA 2DBBA 1FWKA 2C3UA 2HFSA 1WF0A 2WSEC 2XTJP 3DI6A 2IDLA 4Y3CA 5EUHA 5JMNA 1IKYA 1YHQS 5KFDA 2ZFHA 1XR6A 2XMTA 3NS7B 1X4CA 1LOUA 4DPWA 1Q53A 4RUBA 1OQ3A 1QSLA 2OI2A 2YKNA 4LRAA 1VQOS 1V3RA 1U0HB 3V6JA 3BR8A 1BWEA 1H98A 3EDRB 3CJTA 5GVQA 3RYLA 5D0HA 1IJEB 2VKZG 2MKCA 3LANA 2XMWA 3DYAB 3MCOA 1QE1B 2A1BA 1IM6A 1L5UA 2BA9A 4RR5A 2QYCA 1G3OA 2MKSA 1X5OA 4IH6A 1KSPA 3EZUA 2MQMA 1IQZA 2ACYA 2DNHA 3I96A 2RRBA 1AW0A 2XY6A 1C0UA 3GFYA 1FX4A 2W9CA 1IBCB 3LP2A 3UWTA 2Z2YB 3IBFB 3MR6A 4DQQA 4DR7F 3KDOA 3NG8A 2JL9A 4AUKA 1KWMA 2OPPA 2JVOA 4YDDB 2V69A 1FDBA 1IR2A 1E6YA 2HAFA 2W9BA 3PYFA 2GHPA 1ZAVA 5LSLA 4A8KA 1R0AA 4AXJA 3PV8A 1CG2A 1TELA 3G2XA 3EE3A 4RWXA 4C97A 3MMCB 5HO4A 2MLXA 4RW6B 5BXIA 3R2DJ 1YJVA 2LU1A 4FDFA 1T9TA 2R42A 4NPOA 2QSFA 2YX4A 5BYRA 3RG6A 1WDTA 2YNGB 1N5QA 4UUXA 2DRAA 1M0SA 2JWNA 4JI3F 3HHLB 2KZMA 1RXOB 3QLHA 4J37A 1I1GA 2GVZA 3ZZUA 5AXNA 5CYMA 2V8GA 1AB8A 4FXVA 1JLQA 2DY9A 2KVIA 3CIMA 5KFSA 1FKPA 2F9DA 3GJTB 5K8OA 5K8NA 1SL2A 3T6JA 3IFEA 3QIPA 3D4JA 2R3VA 3W8PA 4NZ7A 2FJVA 4NLTA 3LAKA 3T6BA 1IKVA 2EK1A 1TV6A 3TWZA 4H4KA 2R8IA 2W2NP 1JLBA 2G4BA 1CJVB 4JI4F 4PZVA 4MKYA 2F65A 3HSZA 1U2FA 1CC7A 3U7JA 4WTYA 1U1QA 2O5DA 3PYGA 4RKUC 2EKNA 4M63A 3EVOA 4DEZA 4USUA 1K0TA 1PBUA 4DSEA 3ZTRA 3JB9k 1JLFA 3G96A 3B8HA 2F40A 2A0FB 2OSQA 3NGSA 1IR0A 1WC6A 2RS8A 2X7IA 3D0IE 1YSJA 2W9CB 4FKXA 4KGZB 2DR5A 1D9DA 1YITS 4P71A 1YVFA 5GMEA 1J27A 1TKTB 1VQ5S 2R8KA 4NI2A 2F5GA 2IY5B 1RAAB 2CPYA 4LSLA 3W61A 5DLGA 1UFWA 1IBKJ 3R3TA 3MMAB 2MTLA 4P74A 5D6GA 4EZ9A 1L3KA 5HMZA 2I9SA 3JAMY 3PTWA 3RR8A 5KFQA 2ZKUA 2HNZA 3BBCA 4FBTA 4LF9F 2ZUGA 1RCXB 3CCWA 4KGVB 4OYBA 4TXSA 4MH8A 3OV7A 3ISND 2XSFA 4ZVUB 2FVQA 1SPBP 4DX5A 2FZKB 2J8AA 1H2UX 1YZ6A 2QFIA 3QGHA 4LUBA 4EK2A 4AT1B 1T05A 1NK5A 2AV5A 3THTA 3SDEB 3BGOP 2NSCA 1B0TA 1K1SA 4BBYA 2J6SA 1CS4B 1VI7A 2VONA 3C19A 2XLJA 3VAGA 4P2FA 3QO9B 1WI6A 1VMBA 4KGKA 4DR2J 1J5OA 4W90B 2R2TA 1HW9A 4C0HA 2CG4A 3ELHA 4Q2MA 2MKJA 3D6MB 2OPQA 3O3LA 1D8ZA 4J9LA 4NLRA 3GJSB 1RT5A 1NCLA 3FDSA 2DCLA 1R8PA 4OZJA 2F4VJ 3TJ8A 2C3PA 3V6DA 5LMNF 4LJMA 2XO6A 3QZ7A 2HBZB 1S49A 1X9MA 4FZVA 2DCUB 1VC5A 4NRUA 4OLOA 3DOKA 4IOBA 2IMWP 2BANB 3Q8UA 3PFEA 3OSPA 1OYEA 1KS2A 1JLEB 2RE1A 2ZDPA 5LL6d 5B0CA 5L46A 2DVIA 4NASA 4ZA1A 3LP2B 4HH1A 4MMOA 4F04B 1WG1A 2O67A 2RAQA 2XZWA 4ZHRB 3OHAA 4PXEA 2K7JA 3FGVA 2D74B 3MEEA 3N6MA 2B5JA 3AB4B 3QWUA 1LWEB 2WVDA 3NMAA 2ALYB 5KFXA 2UXCJ 2B5JB 5DO2A 5I3PA 2PFFB 2KO1A 3HKZD 3MPVA 4X66J 4DI6A 5LXYA 4CLLA 2HGMA 3ZTPA 4QIEA 2AJ1A 3MMBB 1X4FA 2VPXB 4P52A 4PEOA 3G8QA 5EWEA 4USTA 4LF4J 4QPXA 1LW0B 2DKOB 4FP9A 4R8UA 2WVFA 2VBXA 2HRTA 2V8DA 2FY8A 1UZHA 4NEZA 3W9JA 5DDOC 3MEGB 1ICEB 3LGNA 1LXNA 3OR2A 4F4XA 4P73A 2IRUA 2DO4A 2MY8A 3P5TL 4UUWA 1QAJA 4IR1A 2UUBJ 3ET6A 3P3DA 4JI6F 3RBEA 1MN9A 2OPQB 1URNA 1C1BB 2QTWA 3QATA 2E7VA 2E5LF 2Z56B 1ZM9A 4WKYA 3P6YC 2VPZB 2FGCA 2BJEA 2V4JB 3AFGA 2WHOA 3T19A 3T1AA 2VQEJ 3EUNA 2MB0B 4XTTA 5IT0A 3GE9A 4WFNQ 4C8OA 2VBWA 4NL5A 5BYSA 2RMLA 2YH0A 4X62F 2UVUA 2WSFC 4OX8A 3V4IB 5KG5A 2Y8WA 1HW8A 3AXMA 3LUYA 4P10A 2F9JA 4X4RA 2IBKA 3GV5B 3P96A 5HVFA 5F9NA 1S6UA 3TZXA 4CM0A 2JLFA 4DV1J 3KHGA 2UUBF 1SXLA 5B0AA 1FRKA 2GGPA 1GMUA 2NSBA 2VG5A 1E6VA 3TRGA 3W2WB 3FUYA 2DHGA 2OMLA 5F41A 4F4YA 4O0NA 3M30B 1O0PA 1XR5A 2J9DE 3LGMA 5T7LB 4G6VB 3QFWA 1HI1A 4DX8H 1HR0J 1KBRA 2CNOB 2CQPA 4RW7B 3G6YA 2KM8B 4RUHA 1CQMA 2JC1A 3U1LA 2HMIB 4ILLA 3L95X 2K1RA 3MM8B 1A0OB 1YK9A 2E44A 3D28A 3BBFA 2ZH7A 1ZETA 5G0RA 5D8HB 1XMOJ 2YKAA 2F8HA 3BEGB 1VOMA 2QG9B 3A3OB 5SUHA 4EI2A 4ED4A 2M7SA 4H4OB 3RAMA 1FF2A 4G1QB 2XYHB 2IDEA 2CJQA 3FNNA 3DRXA 4NYPA 3G87A 3JS9A 5HANA 4ZKAA 2IC3A 5KFJA 4FS1A 2A6OA 1UEUA 1KLNA 4F2SA 4JI0F 3QIPB 4OYZA 1Y10A 3DLKB 3PYEA 3H40A 3DFEA 5J2NA 1T02A 2LA6A 5KAKA 1FKOA 1X0PA 2OPSB 4LF9J 5B09A 3LP1A 2HNYA 1UKUA 3PCOB 2HLTA 2QGFB 2VG6A 4TLRA 3IBWA 5E2QA 4CO4A 1U1KA 2MQPA 5AXKA 1SQEA 3UCZP 4PRFA 5KFNA 4NLUA 1MWYA 3ETOA 4QU6A 4KYZA 1K9MT 1W2IA 3D1OA 4QIVA 1WDDA 1T03B 3D0GE 3Q8YA 4F0MA 2ZZMA 4K4VA 3V81A 2JH3A 2BKOA 2W9AA 4JV1A 4M8LA 1FKAF 4WU3A 4R0EA 3DLBA 2DNPA 3MOJB 1CSJA 1MROB 4CLPA 4H4MB 1F1BB 2WVEA 3K5LA 2O1PA 3PR5B 2B6AA 1XMQJ 3M8ZA 3PX4A 4CYUB 3GV8B 1S57A 3B4MA 2DHAA 3TW0A 5CA5A 5THWA 3I0SB 2DXFA 2G2ZA 1HHQA 2V0NA 1UWAA 4QJVA 2QA2A 5D0RA 1FE4A 3UVJB 4X4TA 1PBAA 3S01A 2CADA 1ZZFA 4HDGA 1MWQA 3UPFA 2MHEA 1GK8A 2V63A 2WONA 4V19X 3RU0A 4C2MA 3CF5Q 4DBQA 2PA3A 1CC8A 1HQUA 2AYEA 2H9ZA 5DZ6A 1DFDA 4DV7F 1FKPB 4ZCMA 5J2QB 5L1LA 2YNIA 4WYWA 4KY3A 4F36A 1WJ9A 4EBCA 2VFUA 2ZH1A 3R6LB 3QLHB 4LSZB 4F3MA 1C0TA 4DV5J 4QYZK 3JYTA 2KTQA 3K2YA 4NA1A 4I67A 4DV5F 2YNGA 5HATA 5FDLB 1IM4A 2HLUA 2VICA 4DUZF 3X1LB 4F0KA 3G82A 5AXMA 3FSYA 5F8MA 3CCQS 1RU1A 2H4WB 3ETMA 4ZP8A 1ZS6A 3W2VA 2V68A 2C3MA 1SVDA 1T9WA 2RQ4A 2Y1LB 5GAGU 2W8LA 2J0WA 1XJWB 1ZPVA 2CKWA 2IJNA 3T3FA 3PRDA 2NYIA 5FLXU 4KRWA 5I3UA 3S1TA 3BZQA 3NGTA 3FC9A 2W7PA 4ZVSB 2BYCA 1TL3A 1FRJA 4ECSA 5DGBA 4JI5J 5C24A 4U7UK 1ULRA 3FBEA 3BGUA 5GAEI 1H6KX 3VGUA 3N28A 2XG8A 4LQ9A 1WC5A 4TY8B 2ZC4A 1AZSB 4LSNA 4DG1B 3PW4A 2NPFA 4DV7J 1B70B 2PC6A 4MT1A 1MU2B 2XY5A 1LFPA 2QRRA 1M5HA 2QLFB 3DLEB 4RW7A 3UO0A 2MZTA 1QDUB 3ZZYA 2PI5A 4P72A 4LF8F 5J2PB 3NOCA 5AE3A 2W24A 1QE1A 1N56A 1WEYA 2RUGA 2LLZA 2G9OA 5KG6A 3EX7B 4MIAA 1RHQB 1B7YB 5GADU 2H48B 4EFAC 2HSEB 1KOOA 3T5LA 3I9V9 3I0SA 4MKBA 3D1HA 2PEHA 2KT2A 4A8OA 4R0JA 4Q45A 3K8WA 3R5BA 4DV1F 4CYUA 2HK3A 1XQIA 2ZOFA 4ZPCA 1F3FA 2AWZA 1ZPWX 3AA8A 3C15A 3D54A 5CH7B 1IKWA 2MPUA 4CT8A 5B0BA 2J9DA 4PXCA 3OTOJ 1SC3B 2ASLA 3AY0A 3PEHA 1RAEB 1SV5A 1TL1B 2HQ3A 4WFZA 3UI3A 5IQ6A 3D2WA 4CLUA 3CTRA 2QV6A 1KLMA 5A8KA 3GYGA 5EGYA 2GO8A 2MSTA 3BN4A 4YDXA 3V5RA 4W98A 1F6TA 2JFDA 3A4TA 4XDDA 2AGQA 5KFZA 2ZH4A 1QUPA 2K3KA 3MM9A 1NSKL 2MZQA 4KHPJ 1TR0A 3BQ0A 2DD8S 4EGLA 3W2VB 5J1PA 2ZJRQ 2VG6B 3RAXA 3TZYA 1VQPS 4OHVA 1WKLA 2OPSA 3ITHA 2BJ8A 1D09B 1REGX 1BHNA 5HJXA 5J2NB 4DZDA 2H65B 2E66A 4RPFA 5HI7A 1N34F 1ITPA 1FJCA 4OV6A 1CLFA 4K5SA 1RBLA 1NDLA 2RJZA 4CH0S 1BE4A 2HVIA
chains in the Genus database with same CATH topology
4DR3J 5IWAJ 2UUAJ 4X64J 4GKJJ 1I94J 4DR4J 3IMQJ 4NXMJ 1N34J 4B3SJ 5LMNJ 2KVQE 1XMQJ 2UXCJ 4JI1J 4DR5J 4X66J 2ZM6J 4JI7J 2UXDJ 4DV6J 1N33J 4JI2J 4LF5J 4LF6J 4LF8J 4DR1J 2E5LJ 4LF4J 1HNXJ 3J7AN 3JAMU 5AJ3J 4NEZA 3J81U 3R2DJ 4LFCJ 4B3RJ 3D3CJ 4DV3J 4JV5J 4X65J 4NXNJ 4KY3A 2UUBJ 5LM7E 4GKKJ 4JI8J 4DV5J 4X62J 2VQFJ 3R2CJ 1HNZJ 2VQEJ 1HNWJ 1IBMJ 5BR8J 4PWWA 4LFBJ 5FLXU 4NEYA 4JI5J 4YHHJ 3W1YC 3T1YJ 2HHHJ 4B3MJ 4DV2J 4DV7J 4OX9J 4B3TJ 4DV1J 1XNQJ 4DUYJ 3D3BJ 1IBKJ 4JI0J 2KL8A 1HR0J 2MTLA 2MEWA 1J5EJ 1N32J 4JI6J 5IT9U 4DV4J 1XMOJ 2UXBJ 3OTOJ 3J80U 4LF7J 1FJGJ 3T1HJ 4K0KJ 4AQYJ 1N36J 4RJVA 2UUCJ 1XNRJ 5A2QU 4JI4J 1IBLJ 2UU9J 4V1Ak 4KHPJ 4DR2J 4HHUA 4DR6J 4LFAJ 4DUZJ 2MQ8A 4JYAJ 4DR7J 4LF9J 4JI3J 4DV0J 2F4VJ 5LMUJ 4YY3J 4KYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 J;  5IWA J;  2UUA J;  4X64 J;  4GKJ J;  1I94 J;  4DR4 J;  3IMQ J;  4NXM J;  1N34 J;  4B3S J;  5LMN J;  2KVQ E;  1XMQ J;  2UXC J;  4JI1 J;  4DR5 J;  4X66 J;  2ZM6 J;  4JI7 J;  2UXD J;  4DV6 J;  1N33 J;  4JI2 J;  4LF5 J;  4LF6 J;  4LF8 J;  4DR1 J;  2E5L J;  4LF4 J;  1HNX J;  3J7A N;  3JAM U;  5AJ3 J;  4NEZ A;  3J81 U;  3R2D J;  4LFC J;  4B3R J;  3D3C J;  4DV3 J;  4JV5 J;  4X65 J;  4NXN J;  4KY3 A;  2UUB J;  5LM7 E;  4GKK J;  4JI8 J;  4DV5 J;  4X62 J;  2VQF J;  3R2C J;  1HNZ J;  2VQE J;  1HNW J;  1IBM J;  5BR8 J;  4PWW A;  4LFB J;  5FLX U;  4NEY A;  4JI5 J;  4YHH J;  3W1Y C;  3T1Y J;  2HHH J;  4B3M J;  4DV2 J;  4DV7 J;  4OX9 J;  4B3T J;  4DV1 J;  1XNQ J;  4DUY J;  3D3B J;  1IBK J;  4JI0 J;  2KL8 A;  1HR0 J;  2MTL A;  2MEW A;  1J5E J;  1N32 J;  4JI6 J;  5IT9 U;  4DV4 J;  1XMO J;  2UXB J;  3OTO J;  3J80 U;  4LF7 J;  1FJG J;  3T1H J;  4K0K J;  4AQY J;  1N36 J;  4RJV A;  2UUC J;  1XNR J;  5A2Q U;  4JI4 J;  1IBL J;  2UU9 J;  4V1A k;  4KHP J;  4DR2 J;  4HHU A;  4DR6 J;  4LFA J;  4DUZ J;  2MQ8 A;  4JYA J;  4DR7 J;  4LF9 J;  4JI3 J;  4DV0 J;  2F4V J;  5LMU J;  4YY3 J;  4KYZ A; 
#chains in the Genus database with same CATH topology
 1F0X A;  2DK2 A;  5CZX A;  3BJY A;  4AXI A;  3FFI A;  5IWA J;  2HGL A;  2VG7 B;  5KG0 A;  1RBA A;  4UTG A;  3VZI A;  3MUV P;  4NA2 A;  4F4A A;  2YKO A;  3MM6 B;  4B3T F;  3M6U A;  1HKA A;  1TL7 A;  2JEF A;  3GR0 A;  3JTO A;  2LEC A;  4B3O B;  4GKK F;  4GMK A;  2A3J A;  1HBO A;  4B3S J;  4ECW A;  2BBE A;  2HWH A;  2VUG A;  3QSI A;  2Y1R I;  2CQC A;  1U1M A;  1SC6 A;  3IR6 B;  4C3K A;  3HJV A;  2LXI A;  3S6E A;  4USV A;  3TEG A;  2W4P A;  4ZVR B;  2E1C A;  3J81 j;  3KHL A;  2NRE A;  4BWM A;  4DOZ A;  2OJ3 A;  2BJ7 A;  1SBR A;  1FNM A;  4ECT A;  3M30 A;  1RI7 A;  2KDO A;  4IRC A;  3A8K A;  2CQ1 A;  1UTA A;  2MKH A;  2YH1 A;  2IA6 A;  1TKZ B;  3DU5 A;  1IBK F;  2XCA A;  4NLW A;  4K4Z A;  3M8Y A;  5AJ3 J;  2VB6 A;  1G6B A;  3H8Y A;  1GXU A;  3RJM B;  1NK7 A;  3OR1 A;  3H0P A;  4ZCK A;  2ZHA A;  3K58 A;  4M5D A;  3D3C J;  1NPP A;  3HF5 A;  4JV5 J;  3JTN A;  3LGH A;  1FD8 A;  2Z2L A;  1NK9 A;  2HGN A;  4K2X A;  5E3P A;  3VAJ A;  3TX0 A;  2G0C A;  3UN3 A;  1DRZ A;  1JLG A;  1NJX A;  2DRB A;  2XNQ A;  2E5H A;  3UFC X;  4GKK J;  3G6X A;  2LQ9 A;  1CJU A;  2NUU G;  3LAM A;  3LP1 B;  3Q24 A;  1P8G A;  1RTZ A;  1CPZ A;  3FRZ A;  4TYA A;  1OWX A;  4KAI A;  2JX2 A;  4FYX B;  1NKC A;  2ZNY A;  2JJ4 D;  2DGX A;  4Y28 C;  1V5V A;  2OO4 A;  2V4J A;  2XSJ A;  4A8F A;  5BR8 J;  3LOU A;  4USI A;  5FDL A;  1F2H A;  1V9O A;  2MYF A;  2R7W A;  2I5J B;  2KXH A;  4LT6 A;  2M8D B;  1AUD A;  2VPW B;  3R5A A;  4RX6 A;  3VVT A;  4AL7 A;  4NWB A;  1S9G B;  4WFX A;  4A47 A;  2EFP A;  1KD1 T;  3DOL A;  4YHH J;  1RAC B;  2AMC B;  3TI0 A;  5DRK A;  5A8R A;  2HIY A;  2FVS A;  1SH2 A;  2W2M P;  4L73 A;  5A8W A;  4J9K A;  1W26 A;  2BXJ A;  3HHD A;  4QIG A;  2XGQ A;  1PAE X;  2R7R A;  1YI2 S;  4C8L A;  2ZZT A;  1TK8 A;  1XNQ J;  1T95 A;  4H4K C;  4O3S A;  1CJK B;  2P9E A;  4HKQ A;  4WKR A;  4NCB A;  3NCR A;  1VK8 A;  1SI9 A;  5FD1 A;  4RNH A;  3ZFV A;  3D5M A;  1UPM B;  2ROG A;  4P2M A;  4BWJ A;  3T5H A;  2AW0 A;  5HQL A;  3M1V B;  4F4K A;  1PYS B;  2A6M A;  5J2P A;  2YWF A;  3UR3 C;  2FLP A;  1UJ5 A;  3NGU A;  3CCT A;  1FTR A;  4ENO A;  5L1K A;  3ZZT A;  2NLW A;  2UXC F;  2QL7 B;  3AD8 C;  3NL0 A;  4E8U A;  4PG5 A;  2GZO A;  5D77 A;  2POK A;  3GMG A;  2IVY A;  4P7T A;  3KMS A;  4USH A;  2EEY A;  3HSG A;  3I32 A;  4OMF G;  4YB1 P;  2YXL A;  1NK4 A;  5DLF A;  3R97 A;  3VGV A;  3NP5 A;  3CB4 A;  5E3C A;  4C8K A;  3O6Q A;  1IBL J;  3AT1 B;  3CMA S;  2LEB A;  1RLD A;  4RW8 B;  5KG1 A;  1KHW A;  1NBE B;  3KJV B;  2L3M A;  1U1P A;  1NJZ A;  4DR6 J;  1C1B A;  2KT3 A;  2EFN A;  5DQG A;  4Z2X A;  4DUZ J;  1KVJ A;  1Q79 A;  3CDE A;  3ET6 B;  5CYM B;  3SQO P;  4AND A;  2LEP A;  4MK8 A;  3Q2T C;  4YB7 A;  4FF2 A;  4Q8F A;  2H1Y A;  2MQN A;  4DWI A;  1RWW B;  1N0U A;  3EWG A;  4ICL B;  2BM0 A;  1GFW B;  4IG3 B;  4CO0 A;  4BC7 A;  2NS1 B;  5DDQ C;  2F63 A;  4PG6 A;  3RRG A;  1QSS A;  3LA0 A;  1DLO B;  2FHJ D;  1H3D A;  4DCO B;  4OL8 A;  2K3I A;  1NSP A;  3BGF A;  1WHX A;  1HMV A;  2YQ0 A;  4LRC A;  4C8M A;  1RLC L;  5GAH I;  3DXS X;  1KTV A;  3Q2S C;  1I94 J;  2UXD F;  1WI8 A;  3NCQ A;  1R8C A;  4OX6 A;  2YNF B;  3IMQ J;  4USK A;  5KTQ A;  5GMD A;  3SV3 A;  2I1R A;  1TAQ A;  1LWE A;  3ZNU A;  3NOG A;  4B9L A;  1RHK B;  3QGG A;  3WDO A;  4X4S A;  1B99 A;  1Z2Z A;  3FQL A;  3ZO7 A;  4JI1 F;  4N41 A;  2ZZN A;  4F02 A;  3D67 A;  1KEK A;  5L1I A;  4JI1 J;  4DR5 J;  4LFA F;  3MM7 B;  3DKD A;  4KBI A;  3E51 A;  1WOP A;  5DQH A;  4PAA A;  4X4V A;  2WK4 A;  2B6A B;  3TQE A;  3C16 B;  2CVI A;  3IGN A;  1WG4 A;  5L8R C;  5DM7 Q;  4JI7 J;  4KR0 B;  4Z37 A;  2XO7 A;  3TR5 A;  2FLO A;  4MK7 A;  5B08 A;  1FRM A;  3IRX B;  4OYM A;  3CED A;  3Q83 A;  4OI3 A;  4ZVE A;  3QT7 A;  2PSZ A;  3C16 A;  3CIZ A;  4ECV A;  1L3T A;  1WAC A;  2C2O B;  1Q5V A;  1Q1K A;  2C1E B;  4DUT A;  2BW2 A;  4CCH A;  1S79 A;  4IOC Q;  2ZBC A;  2FD2 A;  3KJN B;  4YR3 A;  5DG9 A;  2CDQ A;  1XMO F;  2VU5 A;  1S4F A;  3DLG A;  4JI8 J;  2MHN A;  3PX0 A;  5E33 A;  4E0D A;  1SH3 A;  1QAY A;  4B9M A;  4DHV A;  3QT6 A;  1Q4R A;  1HNZ J;  2G0I A;  4N8N A;  5E41 A;  1QVG R;  4QCL A;  4IFV A;  3DLK A;  1KP6 A;  3PJW A;  2AGO A;  2HVE A;  1BQM B;  1S5Z A;  5A0Y B;  4ZLN A;  3QJP A;  2ASJ A;  2Q1L A;  2AYB A;  2U1A A;  2MXY A;  4PR6 A;  3ITH B;  4OZ1 A;  5LJ5 Y;  2FQQ B;  4YB6 A;  2QA4 G;  3TAR A;  4ELT A;  2Q66 A;  3B6B A;  1Y00 A;  1X4G A;  4L3N A;  5LXR A;  1EZZ B;  4L6V 3;  1N52 B;  5MAO A;  1HQE B;  2VFS A;  2Q6C A;  1RT6 A;  4C48 A;  1GX5 A;  1N5S A;  3FMB A;  1FFS B;  1Y7P A;  5J2M B;  2QT7 A;  3CCM S;  4B3T J;  2DO0 A;  5I42 A;  2CFX A;  3R7B B;  1LK7 A;  2RQM A;  3CWJ A;  4NLY A;  2ZUA A;  4F3Q A;  3CD5 A;  2XLI A;  3BH7 B;  1T8E A;  3QRP A;  2RS2 A;  4DU7 A;  5C2G A;  1T9V A;  3KLV A;  3PZP A;  1S0V A;  2W01 A;  1XK8 A;  2ZIT A;  3T1H F;  3W64 A;  4B08 A;  4B9S A;  2L08 A;  1J5E J;  5HVH A;  2D69 A;  3W2W A;  3R1H A;  2GHW A;  1M90 T;  1U2C A;  4UOH A;  2MZ1 A;  1V3Z A;  3BF4 A;  3EZ5 A;  1FK9 B;  3JSM A;  2R2U A;  3PX6 A;  4I68 A;  4AL6 A;  3Q89 A;  1XTZ A;  2V2V A;  3I4H X;  1MML A;  2LDI A;  2KU7 A;  5KT5 A;  1WWH A;  1RQ0 A;  1FDD A;  2VPY B;  1RTI B;  3BKU A;  3HSJ A;  2UV8 A;  3NLC A;  1W2B R;  4QU7 A;  1SKR A;  1RT2 B;  2Z4P A;  4LBI A;  4O0I A;  4DF4 A;  4JI2 F;  3M6V A;  3OLB A;  2AQ4 A;  1RTD B;  2LXU A;  1TZ0 A;  2PEB A;  2BX6 A;  3DCA A;  3RUB L;  2ADC A;  1JWW A;  4X4O A;  5DGA A;  2PA8 D;  1JLQ B;  2EG2 A;  5L38 A;  3RRH A;  2J7U A;  3CW2 C;  4IG3 A;  1F9H A;  2GVZ B;  4IR9 A;  5LSO A;  2GAG C;  2HKE A;  3IN5 A;  1UWB A;  3KMQ A;  4NLD A;  2ADB A;  1WF2 A;  2EKY A;  1ROF A;  3DU6 A;  4QR2 A;  4GC6 A;  1SKU B;  4NLV A;  2HFN A;  1WUU A;  5A6W A;  3UN2 A;  2RDJ A;  4YY3 J;  3W7B A;  5HMY A;  1K44 A;  2IYG A;  4ZS6 A;  3ZZO A;  4DR6 F;  1UWB B;  2H5J B;  3KUH A;  3M8P A;  3A8E A;  5A0Y A;  2AU0 A;  1OMS A;  2M88 A;  2KYZ A;  2LXF A;  1OSD A;  4WU2 A;  1ZAW A;  4CNY A;  1VQK S;  3BRE A;  4TKT A;  2VOP A;  2HAI A;  4U9R A;  4U96 A;  4ZJL A;  1UEV A;  2JLE A;  5HQ8 A;  1ARO P;  5KT3 A;  1Q16 B;  4KH1 B;  1FA0 A;  4DV0 F;  3ILL A;  4M5M A;  2YWE A;  4J91 A;  3ZTO A;  4O3N A;  1Z1Z A;  4JI5 F;  1N88 A;  2GML A;  1SH0 A;  3MFH A;  1GNK A;  2F8M A;  4IG0 B;  3CC7 S;  3RBX A;  5E3R A;  1QTM A;  5ITH A;  3DGP A;  5A2Q Y;  2GQC A;  1EAY C;  1FE0 A;  2HBR B;  1NPR A;  3MEE B;  3IWN C;  2V9K A;  3PRV A;  4ZN1 A;  4LSL B;  4DPO A;  3QRR A;  2PMH A;  3KNG A;  4O3O A;  4U95 A;  4DN0 A;  4IO9 Q;  1X5P A;  1R7I A;  1SQF A;  3O8W A;  3RAQ A;  1SJF A;  2ZWP A;  3VAM A;  3GFH A;  2F4F A;  3TA0 A;  4DLG A;  1N36 F;  2R7O A;  4WFB Q;  3H4D A;  5RUB A;  5H1S V;  2W2Q P;  3BS9 A;  3SQG B;  2J0S D;  3G71 S;  3KLE A;  4X65 J;  1EAR A;  4P9S A;  3M7V A;  4A8X A;  4DPX A;  4ED8 A;  4WXW A;  1I6J A;  3PO4 A;  2FVR A;  1N5T A;  1IWG A;  5HRO B;  4DV2 F;  5HP1 B;  2DR7 A;  1TFW A;  2BAC A;  4RBU A;  2RSQ A;  3FBF A;  1X4B A;  4Q0B B;  3HHL D;  1JB0 C;  2DTJ A;  2QIF A;  5KFV A;  1RHR B;  2N4C A;  3GV7 B;  3KK3 A;  3SCI E;  2ZBI A;  2DYA A;  1TV6 B;  1HPZ B;  2XEX A;  3MWB A;  4O4G B;  2B56 A;  3GFZ A;  3QAU A;  4PYA A;  5LT5 A;  3HP6 A;  3KJQ B;  1U25 A;  3M8P B;  3POT A;  2AKW B;  2ZVI A;  5D15 A;  2VDI A;  3SBM A;  4KH0 B;  3J7Z T;  1HWK A;  3IA0 A;  1G7C B;  2XMM A;  2GHV C;  1D8Y A;  3EXY A;  1AFJ A;  2YWG A;  4LMZ A;  1NH7 A;  2YKM A;  4ZPW R;  4NLG A;  2YKM B;  1REV A;  1DTT B;  4HI2 A;  2KJW A;  3GFX A;  2DNN A;  3O2I A;  2FJA B;  4I0W A;  4DMZ A;  1OIA A;  3J80 Y;  4ED0 A;  1X60 A;  1C1C B;  1NDC A;  2AEM A;  3C6T B;  3H90 A;  1DUR A;  5ETS A;  2IVF B;  3A3P B;  3OL7 A;  2FHO B;  4MFB A;  2ACM A;  2ZBR A;  4QIF A;  3EIC A;  3ZC4 A;  4EBD A;  2AJF E;  3Q0A A;  2VF3 A;  2XYP B;  4LR8 A;  3VWS A;  4WFA Q;  1VQ7 S;  3CJK A;  1FVQ A;  2RHQ B;  4ZN3 A;  3MMA A;  2P9G A;  4UOC A;  5KFK A;  3PW2 A;  1WTF A;  2OUG A;  5IZH A;  1M5K C;  2G1H A;  2J9E A;  3OL9 A;  1C0U B;  4LRF A;  1RTJ B;  1YBT A;  1FK9 A;  3JSM B;  4B3M F;  4CQ1 A;  5IT9 U;  1N32 F;  3MR3 A;  4YN3 B;  3KLE B;  5KFU A;  2J6T A;  3CVK A;  1X0F A;  3C15 B;  3HUL A;  1YJR A;  2OHD A;  1F3V A;  1WC3 A;  3QMQ A;  4KQZ A;  1QY7 A;  5CZV A;  3T1H J;  4LF7 J;  2JEI A;  1DHM A;  3H20 A;  4Y2K A;  3AH6 A;  1U0S A;  4DR4 F;  1X4A A;  3ILO A;  4L76 A;  5KFP A;  3DC2 A;  3DLL Q;  2DEI A;  1OQ6 A;  1A6L A;  1HQ2 A;  3VZH A;  1JLA B;  1P6T A;  1S1X B;  2BJD A;  2B43 A;  3CJ0 A;  3R7N B;  3UCG A;  2HZV A;  3ENV A;  1RTH B;  1VCT A;  1JLB B;  3B54 A;  3TVK A;  5KT6 A;  1VBY A;  1YJN S;  1OY6 A;  2H5I B;  1F60 B;  1HBN B;  1B0V A;  3NS6 A;  3CJ5 A;  2SXL A;  2IRY A;  2UP1 A;  2Q6B A;  2YPY A;  1KON A;  4GO5 X;  3I9Z A;  2YBV A;  3DLH A;  2WZ1 A;  4Y2A A;  5J1E A;  1S9F A;  4EO6 A;  2DGT A;  3QPI A;  4O4R A;  2BM1 A;  3GG0 A;  1UFL A;  3GTY X;  2V50 A;  2QFJ A;  2MZS A;  4UQG A;  3BGR B;  5D0E A;  3Q23 A;  3PW7 A;  3WIV A;  3MAQ A;  1S1W A;  1T11 A;  2UUW A;  5M2U A;  1U09 A;  3BO3 A;  1KVI A;  3CNQ P;  4S0M A;  4RZR A;  1VRT B;  4X66 F;  5DG8 A;  1PG5 B;  2H5E A;  1TKX B;  4DR4 J;  3IG1 B;  2B4U A;  1UP1 A;  5F8H A;  1YRT A;  2HZC A;  1M5V C;  4K4U A;  2CZ4 A;  4R5P A;  4WE1 B;  1WKK A;  2RNE A;  4J90 A;  3MM5 B;  4D3H A;  5MLC V;  3RW7 A;  3OTO F;  4USJ C;  1YJW S;  1HAR A;  1XR7 A;  3G6V A;  4CWB A;  2D9O A;  4IQM A;  2DNO A;  3M32 B;  4JOU A;  4EMD A;  5L39 A;  4N77 A;  2ZM6 F;  2EC2 A;  4ILM A;  3VF0 B;  3IS9 A;  3JSR A;  3PFO A;  4DV6 J;  2HMI A;  2DY1 A;  4C0O C;  4LF5 J;  3W5Y A;  4I6W A;  4NRT A;  2CQB A;  1KQK A;  4LF5 F;  3GYN A;  2DR8 A;  3MUT P;  2IFX A;  5ETO A;  3JAM U;  2CZV C;  3J81 U;  1Q7Y T;  3CJ2 A;  3A1Y G;  2BJ3 A;  3HVT B;  1HR0 F;  1O6X A;  3PNI A;  4I64 A;  2VBY A;  2JC0 A;  2NQP A;  4L3K A;  4OV1 A;  5D4P A;  1V3S A;  4IFY B;  4M95 A;  3KJF B;  5LM7 E;  1RJJ A;  1TUW A;  1RAJ A;  4ED1 A;  2MY7 A;  3E01 B;  3BDP A;  1F9E B;  4M5G A;  2N4D A;  3GU0 A;  3PKY A;  3EVM A;  4ZLL A;  1KFD A;  3ICL A;  4F25 A;  2MZJ A;  2RF2 B;  2BRL A;  3FSX A;  4UOF A;  2EC0 A;  4AD6 A;  4PQA A;  3US5 A;  5EWG A;  4WCE Q;  4M5L A;  4CH1 A;  2KKH A;  2BQU A;  2QA4 S;  2VJV A;  1T03 A;  1N0V C;  5HJY A;  5LMU F;  4DS5 A;  4DR1 F;  1OY8 A;  2QMU B;  1P9Q C;  4DUY F;  4U7U D;  4C7Q A;  1BC6 A;  2RH3 A;  2JRS A;  2DHS A;  3TZZ A;  1P1L A;  3OUY B;  1N33 F;  5IQQ A;  3PIO Q;  2XSJ B;  3JSY A;  5D4L A;  1FRI A;  2FZC B;  2YKQ A;  4J9Q A;  1R6V A;  4FBU A;  1RWO B;  4DSL A;  3TJ9 A;  1JLC B;  2ZNZ A;  2HHV A;  1ZM3 A;  5KG4 A;  1DTT A;  3SCJ E;  4TQS A;  2HHH J;  4MYT A;  1YGY A;  5C42 B;  2JDJ A;  4NYZ A;  4DV2 J;  4F50 A;  1FEE A;  4USW A;  2EG1 A;  1ACM B;  1W7W A;  4YR0 A;  2EBE A;  4I69 A;  2FC9 A;  4XO0 A;  4HR2 A;  3IC1 A;  2NR0 A;  3OVS A;  2FVC A;  4K59 A;  3PJ9 A;  1JNR B;  4ZP7 A;  2WOM A;  3D3B J;  3M9N B;  4X2B A;  2XS7 A;  2AHO B;  1NO8 A;  1EX8 A;  3CME S;  4KJI A;  3HMJ G;  4QR0 A;  2DT9 A;  3NGD A;  5AXL A;  5IFM A;  2XS5 A;  2FJE B;  2OTL S;  1SV5 B;  1TL1 A;  3BO4 A;  1R8H A;  1DQ9 A;  3DDN A;  2CQH A;  4ZPT R;  3LWM A;  1S10 A;  2I2Y A;  2FHM A;  1FXR A;  3SQG A;  1YKW A;  3O44 A;  5B7W A;  3TUJ C;  2F1F A;  2GC8 A;  4L75 A;  1NAQ A;  4WP3 A;  3M6X A;  1PO6 A;  1HD1 A;  4QR1 A;  1TL5 A;  1CBK A;  3H5X A;  3MED B;  1HD0 A;  1OPZ A;  1OO0 B;  1X4H A;  3T41 A;  1Y0H A;  3CD7 A;  2L9N A;  3CJR A;  4DCP B;  3DHW C;  3GR1 A;  2YNH B;  4TYB A;  4XPC A;  5BR8 F;  1JXV A;  2ZH8 A;  3OUY A;  1RZM A;  3OSN A;  2RQK A;  2BQR A;  1M5O C;  3LAL A;  1UJ4 A;  4RNM A;  4ECQ A;  1K8A T;  2KM8 C;  2OPR A;  1RHM B;  2QLX A;  2B8Q A;  1H2V Z;  4MKV A;  4ID8 A;  3SSS A;  2VIH A;  3SV4 A;  3I82 A;  3V6D B;  1SKW A;  1B64 A;  2GFF A;  1JX4 A;  2LA4 A;  2HNY B;  2VL1 A;  4DLE A;  1RP5 A;  4DL0 C;  3RB3 A;  2HIQ A;  1RCO B;  3KLH A;  5H9E K;  5HLF B;  1FKO B;  1Q82 T;  2UVV A;  5EN1 A;  3A8J A;  1WF1 A;  1REV B;  4DSK A;  4NXM F;  2V4R A;  4HHJ A;  2P9C A;  4FPR A;  5AE2 A;  2RDD A;  1ZH5 A;  2HW3 A;  2EW9 A;  5F8G A;  4YEA A;  3VAK A;  2H54 B;  3CJ8 A;  4FVM A;  1RT1 B;  2RKI B;  3VAF A;  3NRB A;  3PVX A;  3ZZ0 A;  1HNV A;  3ULH A;  1QVF R;  3PO5 A;  5IC6 B;  3BGL A;  2M0G B;  3TA2 A;  3VAL A;  2XI2 A;  4CO1 A;  3I0R A;  2CPH A;  1HYS A;  3KLG B;  2GIQ A;  3AAW B;  1RT4 B;  3FKB A;  3KHR A;  2PGC A;  3C6U B;  4C0B A;  2WAQ D;  1FNO A;  1KN6 A;  3UD4 P;  1NSA A;  3DM2 A;  1BMQ B;  5KFC A;  3Q8V A;  4FVC A;  1RHU B;  4N5S A;  3MMJ A;  5F8I A;  1Q8L A;  1NUE A;  2GCF A;  3T9N A;  4ZCL A;  1ZYQ A;  2OFG X;  3OVA A;  2OLW A;  3AD7 C;  5DS7 A;  3B82 A;  3MCS A;  4CLK A;  3Q8R B;  4C3L A;  1FO1 A;  4N56 A;  3OL8 A;  1HNX J;  2HFO A;  3UVJ A;  4LF4 F;  3SCK E;  4J9M A;  3KDN A;  2DNR A;  2ATC B;  5KFI A;  3MEC B;  3PW5 A;  4IRK A;  1WC0 A;  4CO5 A;  4URG A;  2B4P A;  4PXB A;  3FCH A;  2FUG 9;  1LEO A;  1X8D A;  1ZAX A;  2OH2 A;  5GAG I;  2ZDO A;  3DRY A;  1EKR A;  1OSC A;  1TMJ A;  2M2B A;  2J76 E;  1T94 A;  4X4Q A;  5KFE A;  1GTE A;  1S1U A;  4DL6 A;  4YHH F;  2KZZ A;  2J7W A;  2XZT B;  2FTR A;  2YY3 A;  4G1P A;  1U0H A;  4A48 A;  2EFO A;  2ZHB A;  3J7Y I;  3DHX A;  1DY3 A;  1RWK B;  4JV0 A;  2CAJ A;  5CYJ A;  3RB6 A;  8RUC A;  3ILI A;  4QZV B;  4ZMM A;  1KOH A;  2CQD A;  4HTI A;  2MLZ A;  3ZZR A;  1TUG B;  4A8W A;  2HUR A;  4ELU A;  3MPU B;  1ZTW A;  1IKY B;  2AJQ A;  4HL9 A;  2JNJ A;  5DDR C;  2CPZ A;  1Y3K A;  3AJ2 A;  2W4D A;  3AQP A;  2C2R A;  1RA6 A;  3G9C A;  2R8H A;  3TQ1 A;  3KTQ A;  2Q3P A;  1VIS A;  2ZH5 A;  3WC2 A;  2Y8Y A;  2CYY A;  2HEK A;  1AXQ A;  3WZ0 A;  1S6P A;  1HNV B;  3BH6 B;  1Q86 T;  2FB0 A;  2AF6 A;  3HHE A;  2R2R A;  1C2P A;  4I2Q B;  5K8M A;  1Z4U A;  2GJF A;  4I2P B;  4QW9 A;  4J9V A;  3R9L A;  4W92 B;  3GPA A;  3HPO A;  1G1X A;  1QTN B;  4N8O A;  1FDA A;  3AJD A;  3HFV A;  3JQJ A;  3CPW R;  3DDI A;  3K89 A;  2LCW A;  1TP7 A;  4DL5 A;  2LQB A;  5ETV A;  3I56 S;  2V6A A;  7AT1 B;  4UY8 5;  1N5Y A;  1RWV B;  3GQC A;  3KK2 B;  2CQ0 A;  2QYG A;  2IM0 A;  2GJ2 A;  4WXO A;  4OHY A;  3OR1 B;  1LKZ A;  3BB5 A;  1Q7L B;  2K1R B;  3MM8 A;  1MMN A;  3OFH A;  4HI1 A;  3HK2 A;  3UD5 A;  2E29 A;  4P75 A;  4RJV A;  5KFW A;  4J9S A;  2UUC J;  2XI3 A;  2RU3 A;  5DQI A;  4EO8 A;  4J9R A;  1D0E A;  2BV3 A;  3H42 A;  4DFM A;  2MQQ A;  1S7I A;  3KOA A;  1HNW J;  3VGT A;  1RT7 A;  1VDH A;  3DRS A;  3QGI A;  1QJH A;  5EHH A;  2WB4 A;  2ZE2 B;  3OFE A;  4HHU A;  1OJ4 A;  2EWH A;  4KKO A;  3IBC B;  4CRJ A;  4K8R A;  2MQ8 A;  3SMZ A;  2YKN B;  4GVL A;  5CYQ B;  1RT5 B;  2LQ5 A;  3PJX A;  1C4A A;  5C25 B;  1TL3 B;  2J8S A;  5I3U B;  2DNG A;  3HI9 A;  3UW1 A;  5A8R B;  3J7Z 5;  2CPE A;  3DI6 B;  4IO1 A;  4IKA A;  5LMU J;  4B9U A;  1J2V A;  4TU9 A;  2E9R X;  2YWK A;  3ZNJ 1;  2V2Z A;  4MIB A;  4DPT A;  3CCZ A;  2PT0 A;  3GWC A;  2G0J A;  2AZ3 A;  2UUA F;  4DSI A;  3CMQ A;  2HWI A;  3UDV A;  2CVE A;  2WB1 D;  5G4D A;  4OYI A;  1T3N A;  3RBD A;  2G2O A;  4K5R A;  2DIU A;  2BMB A;  1QLN A;  1FER A;  3BGR A;  3ENA A;  1TK5 A;  4Y2M A;  4NXM J;  2KHD A;  2BKP A;  1WD6 A;  1JLC A;  1NXI A;  2I8E A;  4KV8 B;  4KFB A;  2VOO A;  4IYQ A;  1WHW A;  1PAU B;  4KC5 A;  4TY9 A;  4K4X A;  2YX7 A;  4ALZ A;  2IAJ B;  3VV2 B;  4QYZ J;  4AE5 A;  1PCA A;  5JXS A;  2XY7 A;  1VHF A;  3GP9 A;  2HHP A;  3ADA C;  4JYA F;  4ZIT A;  5BJR A;  1U49 A;  4F8R A;  4JV2 A;  3AHP A;  2ABY A;  3BSA A;  5F3Z A;  3KK1 A;  2N82 B;  2EFG A;  1T9X A;  3IAS 9;  2J0X A;  4HH0 A;  2DPJ A;  5JVH Q;  2ZKT A;  3BYP A;  1SJR A;  1G2E A;  1TKZ A;  4PG8 A;  3RTV A;  5ETT A;  4UOG A;  1HI0 P;  4B3R J;  2EBG A;  3CJ4 A;  1NDK A;  2QL9 B;  1IKW B;  4OYX A;  4ZJO A;  3ZZZ A;  1NZA A;  5FLX Y;  4DV3 J;  2CJX B;  1JJC B;  2AYM A;  5ETL A;  2M8H A;  1S9E A;  3GJR B;  4ZJQ A;  4ITS A;  2VQF F;  3MEC A;  8AT1 B;  4IH5 A;  3C8Y A;  1S72 S;  1HNX F;  3M6W A;  2VQF J;  4ZDN A;  3CCV S;  3PHT A;  4KO0 B;  4ANC A;  2F3J A;  2EXU A;  4ECZ A;  2QLJ B;  3K57 A;  2GO9 A;  1VRU B;  3MR5 A;  1X4E A;  3GZ7 A;  1F5C A;  3M8Q A;  2OGU A;  4ECU A;  2C2E A;  3DOK B;  1RGV A;  1IKV B;  1VBZ A;  3DN9 A;  4CLY A;  1LFW A;  2J5A A;  2VG7 A;  1GXL A;  3L7U A;  4ER8 A;  4G3I A;  3W3S A;  4PWD B;  3I5B A;  2FIU A;  3LQV A;  4OZL A;  1IXK A;  3SFU A;  3AOA A;  5J2M A;  3OLA A;  2EK6 A;  1R31 A;  1RA7 A;  2CXE A;  4ICL A;  5A8W B;  5K5M A;  1UFK A;  2R7S A;  2I5J A;  3J7A 1;  3MTK A;  2CZ9 A;  2GQQ A;  1BQX A;  1WOR A;  1WEL A;  4LVO P;  2FGO A;  3W63 A;  1NPK A;  1S9G A;  3V4M A;  3HSD A;  1U1O A;  1X5T A;  4LFB F;  1K0V A;  2HQI A;  5F3T A;  4ANE A;  2OD6 A;  2BQ3 A;  5U47 A;  4M5H A;  2E5G A;  1JXE A;  4C11 B;  3TAP A;  3CGI A;  2C3Y A;  2UUT A;  4ZK7 M;  3KYL A;  2UVW A;  4DFP A;  4YUD A;  1LV5 A;  1NK6 A;  2MEW A;  1SC4 B;  4R8U B;  1KTQ A;  2XLK A;  4M1K A;  3MTJ A;  1FDN A;  2D3O R;  2DNM A;  2H3E B;  2OKQ A;  2B4O A;  4WFY A;  2C2Z B;  5GAH U;  4UQT A;  4M5D B;  3LF0 A;  8ATC B;  1S7H A;  2CJK A;  1Q5Y A;  1UVN A;  3WBZ A;  4FYW B;  2VAS A;  3SEO A;  1XIQ A;  1IJF B;  5I4M A;  4HYK A;  3I87 A;  4WBF A;  4K0K J;  1JIH A;  4AQY J;  4Q8E A;  1S12 A;  1RT7 B;  2N7C A;  3V6K A;  3LO3 A;  4ZIW A;  1X7V A;  1R89 A;  1DJ0 A;  1H74 A;  1EJ7 L;  1WSV A;  4KKO B;  3ZTS A;  2KH9 A;  5IC4 B;  1FTC A;  4D3G A;  2KI2 A;  2JHE A;  3AD9 C;  3KKF A;  4ED6 A;  4C98 A;  4QWE A;  4ID5 B;  5ETK A;  5K14 B;  3ISZ A;  3TUZ C;  3BO2 A;  1BQN A;  2YPZ A;  2IPO B;  1FD2 A;  2AJ2 A;  2M9K A;  3CXC R;  5KT4 A;  4ZVO B;  1RU2 A;  2HVH A;  2FJD B;  2PE8 A;  1HWU A;  2ZD1 B;  4DR7 J;  2A18 A;  4DS4 A;  2VFV A;  4DV0 J;  3M8R A;  3GSI A;  5ETQ A;  3SIP B;  4CT9 A;  3VAI A;  2L9W A;  4DR3 J;  3Q8Q B;  3QGP A;  3DDK A;  1CJV A;  3I0R B;  2Y0S D;  2ZVS A;  3N5B A;  1DAR A;  4P7V A;  4N47 A;  2UUC F;  3L3C A;  2R7Q A;  1HA1 A;  2XWY A;  3MPD A;  3U02 A;  1KNZ A;  2LQJ A;  2V9W A;  1RT1 A;  1PKU A;  2RKI A;  3C66 A;  4CTA B;  3M2V B;  2QEX S;  1MNE A;  1GMW D;  3R6G B;  4WTO B;  4Q5V A;  2DPI A;  3UDE A;  2VC0 A;  3TNV A;  4FYD A;  2OSR A;  3FCV A;  2NXE A;  2X1G A;  1WC1 A;  2R7T A;  4LF7 F;  4HVZ A;  4I7F A;  1HNI A;  3HT0 A;  2IVM A;  1YRX A;  3BKF A;  3GSD A;  5KFM A;  3SZ2 A;  1HNW F;  3OHB A;  1N5V A;  2HFU A;  5A6P A;  4C8Z A;  2XBP A;  5ETN A;  3JTP A;  1RKJ A;  3GIK A;  4FNH A;  2PI4 A;  4UZC A;  1NZ8 A;  3NNC A;  4B02 A;  3MMB A;  1M1G A;  2ZC3 A;  5KT7 A;  4K7Q A;  2C42 A;  2MQL A;  5LOQ A;  4ES1 A;  4K4W A;  1ZA1 B;  1IVZ A;  6AT1 B;  1OS5 A;  4Y0F A;  4BHQ A;  2ZOG A;  3KWM A;  1KQS R;  4Q0B A;  2W25 A;  4U8V A;  5EDW A;  1KLM B;  1RDR A;  1FRH A;  3OTD A;  3PDN A;  4CH7 A;  2AEJ A;  1UW9 A;  4ZVT B;  1BLU A;  3VGS A;  1HHT P;  2FJB B;  3MAA B;  3MED A;  3WQP A;  4FS2 A;  4ATN A;  7FDR A;  1S9E B;  2QX0 A;  3V6H A;  1BQN B;  1H2T Z;  2ZH2 A;  4B3R F;  2HFZ A;  5A76 A;  2FJX A;  4G1I A;  5CXT A;  1DBD A;  3CJ3 A;  3UD3 P;  1VQY A;  2HHW A;  1APS A;  1JLF B;  2LQ8 A;  2NXU A;  2WVB A;  2CQG A;  3G8T A;  4K50 A;  1HBM A;  1RT3 B;  1KR4 A;  1QD1 A;  3N01 A;  4NMX A;  2RIJ A;  1XEZ A;  1NEE A;  5C24 B;  2JOQ A;  2DIT A;  1MU2 A;  1H0H B;  4DR5 F;  1YWX A;  2W8K A;  2BEF A;  2C2K B;  4LF2 A;  5C42 A;  3ISN C;  5H9F J;  4LQ3 A;  4ZOS A;  3D6H B;  4DJB A;  4B3M J;  1N54 B;  3D1Q A;  1VRT A;  4H54 A;  5HQM A;  3CDU A;  1BWV A;  1HBU A;  1QUV A;  2W1B A;  2WW4 A;  2WRM A;  2YTC A;  3GCX P;  2I6W A;  2VC1 A;  4CTA A;  1GMV A;  4HHH A;  3FSI A;  2W7O A;  2CWX A;  3FBB A;  2B9X A;  3L9Z A;  4XPE A;  4LFC F;  4MJK A;  3M05 A;  2HS0 A;  1ZOT A;  4LRB A;  4C11 A;  3DRP B;  5GAE U;  1YJ9 S;  4ERD A;  1F9F A;  1HBU B;  3IWL A;  4ZVH A;  3PRB A;  4DSF A;  3OXF A;  1BY9 A;  1WOO A;  1MLA A;  3MCM A;  4DU8 A;  2N3O A;  1NRK A;  1PC5 A;  2DIV A;  5M2R A;  4CLW A;  1EET A;  1KHV A;  4JI8 F;  4C6A A;  1BXN A;  3A12 A;  2QMW A;  1E6Y B;  2W9B B;  2HNZ B;  2I38 A;  1VQ8 S;  2IRX A;  2OPP B;  3J80 U;  1PSD A;  1Z2L A;  4K4Y A;  4NOH A;  4Q44 A;  1AA1 B;  1UAW A;  3MI7 X;  3KXD A;  5G0R B;  4WZM A;  2MLY A;  3MD3 A;  1WG5 A;  2MJU A;  3NWR A;  1RT2 A;  3IM8 A;  3IRX A;  1LWX A;  3FEY B;  4KPY A;  1S4E A;  1URR A;  2DHH A;  3W5X A;  1NK0 A;  1L3V A;  4XAK A;  3RGI A;  1JK9 B;  3CD0 A;  3M8W A;  3QQC D;  4M5J A;  2VD3 A;  1RBO B;  3JQM A;  3MAH A;  2V4Q A;  3FMW A;  4K0K F;  4LFA J;  2O66 A;  1IKX A;  2M4M A;  3H5S A;  1FX2 A;  3QFH A;  4DDF A;  2DR9 A;  4DSJ A;  3RRK A;  5IXU A;  3TAN A;  2CJB A;  1SJQ A;  3N79 A;  2AJ4 A;  5B0F A;  3H59 A;  1HWJ A;  3TJA A;  4DX6 A;  1EIY B;  2HHH F;  2XMA A;  2ASY A;  3A3N B;  1S0N A;  3PEJ A;  2KYX A;  4QWA A;  2V8P A;  4X4N A;  4A46 A;  2LKZ A;  2FZG B;  2QC3 A;  2D3U A;  4ZVF A;  4ZVP B;  2GJI A;  4J9U E;  3W9I A;  4DQR A;  2AD9 A;  3CJS A;  4I6Y A;  4YB5 A;  1NM2 A;  1UVI A;  2A2C A;  1AYE A;  3T5K A;  1TKX A;  3A8I A;  3V81 B;  3C6T A;  2ZHO A;  1U6Z A;  4OX7 A;  1DLO A;  3AOC A;  1SUQ B;  1RT6 B;  2X1B A;  3L7P A;  1S1W B;  1U2R A;  3C6U A;  1FRX A;  2GMJ A;  2HND A;  4OYP A;  1YQH A;  4OZ0 A;  3EM1 A;  5CAB A;  4RNF A;  3BSO A;  1M5S A;  4Q43 A;  1N48 A;  2RQC A;  1R8A A;  2EFQ A;  1TVR B;  3HFZ B;  4KFB B;  3K5N A;  3KLI B;  1S97 A;  4PQU A;  3MXH P;  1FJG F;  3KG0 A;  5H9F K;  3CT9 A;  4KTQ A;  5IV3 A;  4HAC B;  3CD6 S;  5KFH A;  3K5P A;  4AYB D;  1I94 F;  2UXD J;  3HFK A;  2DGW A;  4JI2 J;  4YQW A;  1YJU A;  4JI7 F;  4LF6 J;  3PXG a;  1WKJ A;  1R0A B;  1UL3 A;  2M3D A;  4LF6 F;  5EX0 A;  4WPA A;  2B9E A;  1NLK L;  2X3G A;  4LBH A;  1N6Q A;  1JLA A;  1S1X A;  2CJA A;  2BJ1 A;  2CPF A;  3E01 A;  1VLY A;  3CCJ S;  3P8B B;  1Y5N B;  2HYI B;  4IUF A;  5T41 A;  4G1Q A;  2Z0G A;  5KFO A;  1U6B A;  3FZ2 A;  4UY8 T;  3E2E A;  5KFT A;  1S0O A;  3UCU P;  1HFE L;  1TQL A;  1NU4 A;  3HVT A;  3N0V A;  4J9P A;  2BUN A;  3M2R A;  3IO1 A;  3W65 A;  1WNE A;  1RSC A;  4Q2L A;  1BD6 A;  2YNH A;  4ID5 A;  4PWU A;  1VFJ A;  4RUA A;  3BKT A;  3LPY A;  1YZ7 A;  1FI4 A;  1CJT B;  1RIS A;  1SIZ A;  2BKN A;  2DHX A;  3C14 B;  3DRS B;  4OI6 A;  1IBM J;  4NZ0 A;  1SQG A;  4MYU A;  2CNL B;  3IM9 A;  1T9Y A;  2HHS A;  2AJ0 A;  2NPI A;  4TVA B;  2IJF A;  3HKW A;  2CDR B;  2OAU A;  5KG3 A;  2HVZ A;  1VYA A;  4XIU A;  3A13 A;  3N5F A;  1UCN A;  2RRA A;  1UMJ A;  5C2C A;  3DOL B;  1ZBT A;  1X4D A;  4KV8 A;  3H2U B;  4JUZ A;  4WK1 A;  4K4T A;  1R6Y A;  4ZPA A;  4OI2 A;  2C3O A;  1GH8 A;  1RT4 A;  2HZA A;  3BBB A;  3D68 A;  3KHH A;  2FPH X;  3ZZP A;  1X31 C;  3F73 A;  3ZXW A;  1XMQ F;  3DMJ B;  3HX9 A;  3VAH A;  4B3S F;  3NNH A;  2R4F A;  3FVY A;  4JI0 J;  2V2K A;  4F3O A;  1SL1 A;  4X64 F;  1T7P A;  5AE1 A;  3KUE A;  4PQU B;  2V67 A;  3HCX A;  4IQX A;  5JVG Q;  2ZEJ A;  2XB2 D;  2FVP A;  3TA1 A;  2JLG A;  1R27 B;  1R0C B;  1RAH B;  2KXF A;  3CDW A;  3OR2 B;  5EWF A;  1JKH A;  1RHJ B;  4YOE A;  4IDK A;  4H4O A;  3LP0 B;  4O3Q A;  1FVS A;  4U7C A;  2VBZ A;  2CQ2 A;  2DNY A;  2RUS A;  1JJH A;  1LW0 A;  1P9Y A;  5HP1 A;  2CA9 A;  4DL4 A;  2AZ1 A;  3ENW A;  1CVJ A;  3P49 B;  4RW8 A;  3LW5 C;  4NLP A;  4KB7 A;  4DQI A;  3F56 A;  1KKH A;  4OYW A;  4P2X A;  3G4S S;  5E7O B;  1RTH A;  3CCR S;  2GMH A;  5IT4 A;  4DV6 F;  4DL3 A;  1VBK A;  4V1A k;  4ZLP A;  2UVR A;  3HDS A;  4RBT A;  1IWA A;  1RWM B;  1VJQ A;  3GIR A;  4B3O A;  2Z8Q A;  4PG4 A;  3M2R B;  1O5J A;  1DTQ A;  4IFY A;  3HHN B;  1Y4Z B;  3LPE A;  4CDI A;  3FZB A;  3MAA A;  1D1U A;  2ZOM A;  3DOM A;  4KGX B;  3CCU S;  3QJJ A;  2DIS A;  1JXL A;  3D6T B;  2R9L A;  1FEH A;  2QA1 A;  3KUG A;  4RW4 A;  2XUL A;  3W62 A;  1RUS A;  1H73 A;  4JI3 J;  4FXD A;  4Y6I A;  5DM6 Q;  2R7U A;  1UET A;  4OZN A;  3L7O A;  3T9Z A;  1ZTT A;  1LW2 A;  2PII A;  4URQ U;  4NML A;  1VC6 A;  2HFV A;  2MMY A;  3OW2 R;  3AA9 A;  4ZPB A;  1UVM A;  4QYR A;  3VQT A;  2XS2 A;  1C1C A;  1NHU A;  1DQ8 A;  1UZD A;  1YG0 A;  2NXN A;  2WW8 A;  4RL1 A;  4CNZ A;  3MFI A;  1WTB A;  4ECX A;  3KLI A;  1S6O A;  1R0B G;  4X84 A;  5LJ3 Y;  2PDA A;  1FT8 A;  2ZWO A;  2XYG B;  2CQ3 A;  4EEY A;  5EX3 A;  2HND B;  4KHR A;  3OQ2 A;  5CD4 A;  3GCW P;  2OIH A;  9ATC B;  2ATL A;  1SUQ A;  3MR7 A;  4ETX A;  3M2V A;  4A4J A;  3L09 A;  2WSC C;  2JVR A;  3DRP A;  2ZH6 A;  3RR7 A;  2AX0 A;  4A8Q A;  4FF4 A;  1RAG B;  2CNK B;  2GA7 A;  1DAX A;  1Q8I A;  3CE8 A;  3K7R A;  4OQJ A;  3BQ2 A;  2W4C A;  2UU9 F;  1VLO A;  2JZ5 A;  1RWN B;  2V8H A;  2BOA A;  1FXD A;  1XN9 A;  2XHW A;  3D66 A;  4RW6 A;  3THP A;  2E5L J;  3J7A N;  5IT9 Y;  4GVB A;  3U27 A;  3FBC A;  4TLQ A;  4YFU A;  4AL5 A;  4QPT A;  1KVK A;  1RAF B;  3SDE A;  2LU2 A;  4NCA A;  5D4O A;  1T05 B;  4NXN J;  5GAD I;  2MSS A;  3VQS A;  2Z2Z A;  3QBC A;  4DX7 A;  5KG7 A;  3G6E S;  1NJW A;  4NXN F;  1HYS B;  4USM A;  4Y65 A;  2D41 A;  4PPD A;  2VHG A;  1U47 A;  4E2F B;  5HRO A;  1WEX A;  2CQI A;  3JQK A;  4X62 J;  2QL5 B;  3HZG A;  1EQ0 A;  3W8G A;  2ILZ A;  3VR1 A;  4ECR A;  1OPI A;  2J0Q D;  3MGJ A;  3EJM A;  1DTQ B;  1FFG B;  1IKX B;  4Y2C A;  2OEJ A;  3KG4 A;  2K06 A;  3M2U A;  1VIO A;  3SSQ A;  3UQS A;  3QZ8 A;  1R8B A;  2CPX A;  1B4S A;  2FDN A;  3OFF A;  3R5G A;  5IOL A;  1SJ3 P;  1A7G E;  1JQG A;  4XDC A;  1DQA A;  5HL7 Q;  4PYD A;  4RNN A;  2ZH3 A;  2VV5 A;  2ZJP Q;  4JB8 B;  4OJG A;  2HVD A;  5KFG A;  1SC1 B;  3OL6 A;  3BPS P;  4F67 A;  4IRD A;  6FD1 A;  4F4W A;  2FLN A;  2XGP A;  2VA2 A;  2WTF A;  3MHY A;  4OHX A;  1YX2 A;  3KLG A;  4WE1 A;  2P2C B;  4J5O A;  1KRP A;  2E5J A;  2B7C B;  2ASD A;  3MD1 A;  3UN5 A;  4DR3 F;  1HIY A;  3MDF A;  1FRL A;  5ETR A;  3GIL A;  1TAU A;  4FKY A;  4FN5 A;  2D9P A;  4TQR A;  1TU0 B;  5KFL A;  4Z7C A;  1FWP A;  2VQE F;  3DMJ A;  4DF8 A;  4F26 A;  2O3D A;  2ZBQ A;  3K5O A;  3N6N A;  1VIX A;  5AT1 B;  4BC9 A;  1EP4 A;  2YQ1 A;  4K4S A;  1NND A;  2K2P A;  3MEK A;  2X3D A;  4DQS A;  4QBU A;  2RRN A;  2FY1 A;  1SB6 A;  1VGY A;  1B3T A;  3OXL A;  1WHV A;  2GS8 A;  3VCD A;  2OMO A;  1RTD A;  2QJ3 A;  4I6A A;  3OTE A;  2DNQ A;  3S8S A;  2B9W A;  1S6Q A;  3MEG A;  3NAH A;  4CO3 A;  4A8Y A;  1O51 A;  4LBP A;  4CO2 A;  2KFY A;  3PM9 A;  4CIO A;  4ZLJ A;  4F4Z A;  1VRU A;  2G13 A;  4OJ3 A;  2GAH C;  2KJV A;  2BRK A;  3OD2 A;  2VKR A;  3U1M A;  4BCA A;  3HVR A;  5E3A A;  3R5J B;  3GG1 A;  1QAI A;  3PKM A;  3UR0 A;  5B0E A;  3QNW B;  1EHW A;  1N4L A;  2GW8 A;  2ZD1 A;  4KGM A;  5I3Q A;  2Y3Y A;  4DZ6 A;  3NBP B;  2DR6 A;  1LWC A;  2H4Y B;  4PAB A;  1OYD A;  2M52 A;  1I5O B;  2QO3 A;  4YR2 A;  3TVY A;  3BSN A;  1VQS A;  2Y0B B;  3BDE A;  1NHV A;  3MM6 A;  2DGQ A;  4C8Y A;  4XK8 C;  4V19 J;  3ILJ A;  1U1R A;  2E9T A;  2GVD A;  3K8V A;  5AJ3 F;  2O01 C;  1CJK A;  2KG0 A;  3EGW B;  3MOZ A;  1SCJ B;  2MGZ A;  2ZJQ Q;  1PJ6 A;  1QSY A;  2BJ9 A;  3LH2 S;  1TKD A;  2AYG A;  3DLE A;  1U1N A;  5C7P A;  5ETM A;  1HQE A;  2B7B B;  4HT7 A;  2OP5 A;  4I7F B;  1VQ6 S;  2F4V F;  2IMO A;  1FHT A;  3J7Y U;  3I55 S;  4Y2I A;  2NXC A;  3KG1 A;  1R43 A;  2HHX A;  4ES3 A;  1VC0 A;  1YBU A;  2PD1 A;  3I6P A;  2RB7 A;  2PO4 A;  4NX9 A;  2QLW A;  5KOX A;  4DV3 F;  4OHW A;  5L9X A;  4PPZ A;  4R5P B;  2BZ2 A;  1MMD A;  2D3O 1;  3R5C A;  1MSW D;  3QYY A;  3RB4 A;  1J5E F;  1N33 J;  1RWX B;  5B0G A;  1WEZ A;  2GIR A;  2XHC A;  2J6U A;  4MIW A;  3TX8 A;  1WSR A;  4DR2 F;  3MMC A;  3WX8 A;  4WII A;  1CUL A;  1FES A;  2E1P A;  2HBY B;  5KFF A;  4UF4 A;  1QAX A;  2N3L A;  3OXG A;  2HRU A;  3FQK A;  1U24 A;  2YKP A;  4M94 A;  4OX9 F;  1WHY A;  4ZVQ B;  4GRS A;  4DCJ B;  1JJ4 A;  2R7X A;  2KFZ A;  1UPP A;  2LEA A;  3HO1 A;  4OIX A;  1VJW A;  4KPC A;  4N7T A;  2DH9 A;  5JJB A;  1U45 A;  2RDI A;  1HBM B;  1RT3 A;  4NLO A;  3R5D A;  2CPJ A;  3B4D A;  4ZP9 A;  1FNX H;  1ZM4 A;  3EXC X;  5KT2 A;  1TMM A;  1VBX A;  1S48 A;  3EVW A;  4PCQ A;  2KRR A;  5BYQ A;  4TN2 A;  3RB0 A;  3M2U B;  3X3U A;  3W66 A;  3NCP A;  4PWW A;  2R2S A;  3B78 A;  1YLX A;  1IR1 A;  3DOM B;  1AZS A;  3EGN A;  1S1T B;  5L9N A;  4U6P A;  3TAM B;  3NNA A;  3KNA A;  3TZW A;  4E98 A;  2ROE A;  4C9D A;  1LWC B;  2CJY B;  2IYI A;  1VQ9 S;  3EMT A;  3W1Y C;  3I31 A;  1RWP B;  4QW8 A;  1MG7 A;  3JSB A;  3HHL C;  2CNN B;  3R27 A;  1PYT A;  3O5T B;  4OX9 J;  4X4P A;  1UVL A;  2Y9H A;  1XER A;  4CM2 A;  3IWX A;  3EPI A;  4DUY J;  1HMV B;  3IG1 A;  3FRY A;  1IBL F;  1GAO A;  4G65 A;  2DNZ A;  2E1A A;  3OTC A;  4MTP A;  4WZQ A;  3BV8 A;  2R8J A;  1U6F A;  3LP0 A;  4A8S A;  2BOP A;  4ED3 A;  4QQB A;  1ELO A;  4JI6 J;  4HEA 9;  3DRR B;  3EYZ A;  2XC9 A;  3L4B C;  4J9O A;  4OFZ A;  4ZIV A;  1KQF B;  7FD1 A;  3CUN A;  2IHR 1;  3DRR A;  5J2Q A;  4QWB A;  2MZR A;  4ETZ A;  3PIP Q;  3HHL A;  2UZA A;  3GON A;  2ZH9 A;  3R1L A;  1FJG J;  5JUM A;  1N36 J;  4Y00 A;  1PC4 A;  4DQP A;  5F9L A;  5DJB A;  4RU9 A;  3CO9 A;  2WON B;  4RO0 A;  2QE5 A;  3TAQ A;  2VOD A;  2BE7 D;  4FF1 A;  4M5N A;  2RT3 A;  2X1F A;  5A8K B;  4KO0 A;  4URS A;  1X9S A;  1NKE A;  4MKA A;  4DPU A;  1VHI A;  4EUV A;  4OLP A;  4PXD A;  4CLT A;  1RTI A;  2BW7 A;  4JP8 A;  2YWW A;  3TVZ A;  3V2U C;  1KFS A;  2P6T A;  1AFI A;  1M1H A;  4YS2 A;  2IJR A;  3SI8 A;  5C25 A;  2ALZ A;  1F5A A;  3IRW P;  2E7W A;  3SFG A;  2D3Z A;  3T1Y F;  4DFJ A;  3QT5 A;  3EDQ B;  3IP0 A;  4K2J A;  4LVN P;  4CLS A;  3OJS A;  4QOT A;  2QMX A;  2FC8 A;  5K14 A;  1NME B;  2XQC A;  1SIW B;  3OTB A;  3AOD A;  3NGK A;  1TUV A;  3GII A;  4OI0 A;  4KE5 A;  1KQG B;  5KFA A;  4AFF A;  5F8L A;  3H7H B;  1GXT A;  1HBO B;  2MKY A;  3I4P A;  3N6L A;  2BE2 A;  2DGV A;  2E7X A;  5ETP A;  2BAN A;  2FYX A;  4NLS A;  3I5C A;  5L1J A;  4A8M P;  4WJB A;  2R8G A;  2DH8 A;  2Z58 B;  4OI4 A;  4FXW A;  4TY8 A;  4DG1 A;  4ES2 A;  3FFI B;  5KG2 A;  3M32 A;  4DL2 A;  2B8P A;  2NYH A;  1RAD B;  3AB2 B;  3DGP B;  3Q86 A;  4F0H A;  3DM2 B;  2CJ9 A;  4Q7A A;  2KVQ E;  2IM1 A;  3MUM P;  5LMN J;  2BR0 A;  1SJ1 A;  1JJ2 R;  1M5P C;  1MWZ A;  1HNI B;  2IM2 A;  1H7X A;  3MM5 A;  1EP4 B;  4EU0 A;  3QWP A;  1UW4 A;  2W2O P;  3PYD A;  4JV5 F;  4PKD B;  4P2S A;  3C3L A;  3C2P A;  4P6Q A;  4WIQ A;  1T3O A;  4PG7 A;  3U1N A;  2PFD A;  2AGP A;  1U26 A;  3HD2 A;  4FPI A;  3G8S A;  3LWL A;  1BUX A;  9RUB A;  5KOW A;  3FK4 A;  2LVW A;  4ED2 A;  2W2P P;  4CI0 B;  3D9B A;  4LIW A;  1RKI A;  4DFK A;  2HQD A;  4LR7 A;  5CAA A;  5IV4 A;  2MJN A;  2DNK A;  2OD4 A;  1LWF A;  4TNO A;  3CDB A;  1S0M A;  1GQE A;  5J1N A;  1EKS A;  1B7F A;  3ONQ A;  2WBM A;  2MDA A;  2N7Y A;  1CJU B;  3IAM 9;  3K59 A;  2PN6 A;  1Q8B A;  1HQU B;  3TEH B;  5DG7 A;  2JEG A;  1JLG B;  4EYI B;  1HBN A;  1PIL A;  1XBW A;  2IBO A;  3QSY B;  3CDA A;  4I1T A;  2Y1I A;  1F2G A;  2XMU A;  1PJ5 A;  2NZ4 A;  1S59 A;  2HRY A;  2ZE2 A;  1UVK A;  3PR4 A;  3I5A A;  4EBE A;  2CQ4 A;  1U4B A;  1X9W A;  2HHU A;  2HHQ A;  4HT5 A;  1VQM S;  4LFB J;  4BDP A;  1D3W A;  1VS3 A;  4DXL A;  4ECY A;  3VVU A;  4O44 B;  1LNQ A;  4X4U A;  4NEY A;  2AT1 B;  3MCN A;  3N4W A;  1RAO A;  5B0D A;  3GLJ A;  4IOA Q;  2OEM A;  2CIM A;  1FWL A;  1KDN A;  4KT0 C;  4OHZ A;  2HHT A;  3K17 A;  4CP5 A;  4I56 A;  4FYY B;  5K9F A;  5HMW A;  3M9M B;  5HVG A;  3EZO A;  1PJ7 A;  1AT1 B;  2APO A;  4U8Y A;  3CCE S;  1A9N B;  2AP6 A;  2YNF A;  3OPK A;  3TOQ A;  3DLJ A;  3H5U A;  3TP2 A;  4F7V A;  1ZM2 A;  4I2Q A;  2EI5 A;  2KL8 A;  4LRD A;  4QIW D;  1HWL A;  1OY9 A;  2HG4 A;  1S6P B;  1K47 A;  2E5I A;  4MFB B;  2L41 A;  2IAJ A;  2M5Y A;  1PGZ A;  3WIU A;  3HVA A;  2XCP A;  1EET B;  2DRD A;  1I3O B;  3NEK A;  4KSE B;  5FJ4 A;  1K1Q A;  1LWF B;  4JBC A;  3UE2 A;  3F41 A;  4RWW A;  4MAK A;  2V2Q A;  2W7A A;  2DXD A;  4M5I A;  3GIM A;  1TL4 A;  3E3X A;  1JMT A;  3UNY A;  1J5O B;  1XNR F;  5K8P A;  5DDP C;  3THV A;  2JEJ A;  4WWS A;  2IM3 A;  4C3M A;  3GIJ A;  3HM9 A;  1XNR J;  2RU9 A;  4FYV B;  4JI4 J;  5HBM A;  1IN0 A;  3FEZ A;  4WYL A;  2YWH A;  3W9H A;  3CJQ A;  4O4G A;  1BQM A;  1YJ7 A;  3BN7 A;  2B0G A;  1XNQ F;  2LP4 A;  1C4C A;  1NDP A;  1G4C A;  3NXZ A;  3CCL S;  4JYA J;  2BAB A;  2B4V A;  2LDY A;  3RW6 A;  2DGS A;  5D4N A;  2MKK A;  2C22 A;  1HLW A;  1YJT A;  1XC9 A;  2OPR B;  2VFR A;  2A10 A;  3M4X A;  1JNZ B;  4KHP F;  5E0O A;  3OJU A;  1I51 B;  1Q81 T;  4RU2 A;  5KFR A;  1R3N A;  3NAI A;  3D0H E;  1AUS L;  3NBP A;  1XMB A;  4MK9 A;  3MF5 A;  1S1V B;  4GO7 X;  2OFH X;  1JLE A;  4LRE A;  4O3P A;  3DYA A;  1CQN A;  4H4M A;  3TUI C;  4CLZ A;  5F8N A;  3H5Y A;  2VG5 B;  2UUA J;  4NI2 B;  1ZA2 B;  2JSX A;  5HAO A;  4EWT A;  4X64 J;  2KB2 A;  1Y9O A;  4Z7Y A;  2XZD B;  1S1V A;  4I4B A;  3F0N A;  5CD4 H;  2RD5 C;  3NMR A;  2QSW A;  1V6H A;  5HK4 A;  2YQ3 A;  1VQL S;  3CC4 S;  2FHJ A;  2CPD A;  2ERR A;  2E1M C;  1TL7 B;  1HWI A;  3GB0 A;  2V34 A;  2HBQ B;  1TFY A;  1RAI B;  4RBV A;  1GTH A;  2COL A;  1KC8 T;  2ZM6 J;  3N9U C;  1F5B A;  1K73 T;  4I2P A;  1N6Q B;  5CQG A;  2I0X A;  4N76 A;  1LXJ A;  1NB7 A;  4ZPV R;  2C2M B;  4WP8 A;  1S77 D;  3QRQ A;  3PY8 A;  4U67 Q;  1T0T V;  3P45 B;  5FII A;  4NCG A;  1U48 A;  3HZE A;  5HBM B;  2GNK A;  3NKY A;  1LQ9 A;  2F8E X;  3HXM A;  2IC3 B;  4LFC J;  2HQC A;  3TUP A;  4WK3 A;  3AOB A;  2B51 A;  2K7K A;  1IBM F;  2V5H G;  3H98 A;  2IIH A;  2LFV A;  4R25 A;  2RIL A;  1VR6 A;  4NYO A;  3VTI A;  4QWD A;  3WX4 A;  3JYT B;  1S99 A;  4Y34 A;  1W25 A;  2AIR B;  3PG9 A;  3CCS S;  3MZI A;  2J7K A;  1NK8 A;  4UZB A;  1N8R T;  1FJE B;  4O3R A;  2YNI B;  3HT3 A;  1SKS A;  5IWA F;  3R2C J;  1U02 A;  2HWT A;  3AJ1 A;  5ADZ A;  4RLE A;  3HLU A;  4WP9 A;  3Q8P B;  2P8I A;  3EPG A;  2X51 A;  4OJH A;  4F2R A;  3HJF A;  1CJT A;  2DXE A;  2HS4 A;  1PYO B;  1S1U B;  2FJW A;  2G1D A;  3BQ1 A;  3BM7 A;  4W4M A;  3WHI A;  2VDH A;  4TU8 A;  2DB1 A;  3ENQ A;  2XM3 A;  4AQY F;  2KHC A;  4LR9 A;  5CHC B;  3ZTQ A;  1NB2 A;  2EFV A;  3T5J A;  2NZC A;  3CSK A;  2UV8 G;  2CUY A;  4O44 A;  1NHK L;  2HS3 A;  3SXL A;  3TAM A;  4KHM A;  2GX8 A;  4HLB A;  1NKB A;  1M1K T;  3D7S B;  3CUL A;  3NGR A;  5HSP A;  2IA0 A;  1BGX T;  1TK0 A;  4B17 A;  2Z30 B;  2Y1J A;  4YP3 A;  4B9N A;  2VFT A;  2DGO A;  2DH7 A;  2U2F A;  2PMZ D;  2M70 A;  2E1R A;  3R7S B;  4TU7 A;  2DEJ A;  4RNO A;  1L3U A;  3Q8S B;  2NXJ A;  4DL7 A;  1D9F A;  1NSQ A;  4ZPD A;  1RE1 B;  6FDR A;  3KK1 B;  4KIA A;  1HNZ F;  4DN9 A;  2ZBP A;  4UW2 A;  1P1T A;  2QLB B;  3UNG C;  1RYR A;  1P27 B;  1RYS A;  3EGV A;  3GYX B;  2HK2 A;  1TVR A;  2WCX A;  4DV4 J;  4UT4 A;  2P6S A;  3SSR A;  4HDH A;  3IR5 B;  4ZVG A;  2UXB J;  4DV4 F;  5D3G B;  3MPW A;  2YVS A;  2GQ2 A;  2KRB A;  2AEF A;  2GIF A;  2Q43 A;  4NLQ A;  4BLG A;  1UEK A;  4M5K A;  1VRQ C;  3BYR A;  4OYO A;  2LMI A;  2DGU A;  5A2Q U;  2FHK A;  2Q79 A;  1O8B A;  3GJQ B;  2NCK L;  1Y3J A;  2XMK A;  3CO0 P;  4RW9 B;  5LSR A;  3KK3 B;  3DGV A;  1NH8 A;  2K8G A;  3W60 A;  5J1E B;  5CCL A;  2XWX A;  2VZ9 A;  5DET A;  1SJ4 P;  1X5S A;  3OVB A;  5F8J A;  2QN6 B;  1RK8 A;  2V8V A;  3Q22 A;  4PWD A;  3DLG B;  2RF2 A;  4L72 B;  1UJ6 A;  1LW2 B;  4IH7 A;  5C5J A;  2OTJ S;  2C2D A;  1YBA A;  1GT8 A;  2HQF A;  5KFB A;  2D7S A;  4DPY A;  4OI1 A;  4OYA A;  2NUH A;  1LK5 A;  4RW4 B;  2CPI A;  2MGZ B;  1YTY A;  4PUO B;  2GVD B;  4B9T A;  2XNR A;  2UXB F;  4ED5 A;  2JFK A;  1GMW A;  1H38 A;  3BR9 A;  5F0U A;  2GGP B;  1RAB B;  1U8S A;  1TKT A;  4WF9 Q;  4GKJ F;  5IM0 B;  1VQN S;  2OEK A;  4ZHR A;  3F44 A;  2BE2 B;  1D9A A;  4GKJ J;  4PUO A;  3J81 Y;  3CC2 S;  1RWU A;  4ZCI A;  4ILR A;  4LIR A;  2VA3 A;  1E6V B;  1N34 J;  2ILY A;  2L48 A;  3JXO A;  2KN4 A;  3MM7 A;  3V4I A;  1SL0 A;  2KT5 A;  3AQO A;  4LF1 A;  4NA3 A;  4RUC A;  3D6F B;  5HMX A;  1RB0 A;  4LSN B;  3MUR P;  1RTJ A;  3P5B P;  2OEL A;  1NJY A;  3H2V E;  1PIE A;  2FLL A;  5DZ7 A;  1Y5L B;  1QM9 A;  3HHK A;  2F7V A;  3AXK A;  1Q95 G;  3H2L A;  4GVB B;  4NLX A;  2V94 A;  3FCW A;  5SZT A;  1FJ7 A;  2WOM B;  1JKH B;  3O1L A;  4LF8 J;  2EPI A;  1S6Q B;  4DR1 J;  1S76 D;  3UDC A;  3SYZ A;  3OBI A;  3R8Y A;  4EZ6 A;  4YY3 F;  3DXB A;  2DNL A;  1CUL B;  2E9Z A;  5D0G A;  2C2N A;  3RZA A;  4CLF A;  3KFW X;  3MPY A;  4C8N A;  5M2P A;  3PW0 A;  1FFW B;  3RBZ A;  3PHE A;  3TO8 A;  3KLF B;  1YRU A;  4EYH B;  1UA1 A;  5D3G A;  2B9Y A;  1C0T B;  1GEH A;  2L9D A;  2LYV A;  4O23 A;  3OT9 A;  2HPU A;  1EQM A;  3IR7 B;  4GC7 A;  1U8W A;  3FJ2 A;  3KLH B;  3UDL A;  1HHS A;  2CRL A;  5D78 A;  4OZ5 A;  3HVW A;  5HLF A;  2ROP A;  4OZ2 A;  1CEZ A;  4HTJ A;  4OJ1 A;  2DJW A;  3KJV A;  3M9O B;  2R7V A;  1Q8K A;  1U1L A;  3POT B;  1EB0 A;  1MN7 A;  3MM9 B;  4B9V A;  1YDL A;  3NY0 A;  4ZP6 A;  5E3Q A;  1V5I B;  1T9U A;  3M8Q B;  5KFY A;  2KFN A;  2CG8 A;  3IGV A;  4ELV A;  4NE9 C;  1Y11 A;  2GV1 A;  4L74 A;  2HQG A;  5CYQ A;  1HI8 A;  1WOS A;  3C14 A;  3NWG A;  4J9N A;  1UVJ A;  2P5V A;  3K0J A;  4FNI A;  1UA0 A;  2A2D A;  1S1T A;  3BPD A;  2XMV A;  1HL6 A;  1TTH B;  2VH7 A;  5GMK a;  3T1Y J;  1ZZN A;  3P4U B;  4J7C A;  2C28 A;  3C46 A;  4NZ6 A;  1XWL A;  2RVJ A;  3LTO A;  1DZ5 A;  2VJU A;  5T7L A;  4X65 F;  2D1C A;  3DNC A;  5HN0 A;  3M1V A;  2PMW A;  5K20 B;  1VK3 A;  2B3T B;  1MRO A;  1Y5I B;  3SCL E;  5CCM A;  5IM0 A;  2MKI A;  4QWC A;  1B0P A;  2H51 B;  3IS9 B;  3VHQ A;  3BSC A;  2BE9 B;  2RHS B;  2MQO A;  5I42 B;  2KG1 A;  5F0W A;  4CZC A;  3CJK B;  1Q78 A;  3QID A;  3KK2 A;  3M8S A;  3QT8 A;  4IG0 A;  1FCA A;  1GX6 A;  3IXQ A;  1N5Y B;  3NS5 A;  2AX1 A;  2WVC A;  3H4B A;  3H25 A;  1N32 J;  4IDK B;  1YIJ S;  1H7W A;  3QAE A;  4BS2 A;  4FF3 A;  1FXL A;  3G86 A;  2YX1 A;  1WC4 A;  3OFG A;  3KLF A;  2EVZ A;  4HAC A;  2Z2M A;  1MW7 A;  2WBR A;  3S7R A;  3W5Z A;  3PAC A;  1NJI T;  3QJL A;  2G2Y A;  4ED7 A;  4RW9 A;  3TYT A;  1L3S A;  3EGZ A;  1Q0N A;  1IQT A;  3HD1 A;  3E8O A;  4YME A;  2J9C A;  1H72 C;  4NCG B;  3WC0 A;  2BDP A;  4OZ3 A;  1HPZ A;  3K5M A;  3QO9 A;  2XMJ A;  4IFV B;  2Z57 B;  2UU9 J;  4C4W A;  2BVZ A;  5E5N A;  5T14 A;  5IS2 A;  2KXN B;  1CS4 A;  2X1A A;  3MR2 A;  1VQ4 S;  2CWK A;  3FEX B;  3G82 B;  2QZ8 A;  5H9E J;  1U7L A;  1IUJ A;  2DBB A;  1FWK A;  2C3U A;  2HFS A;  1WF0 A;  2WSE C;  2XTJ P;  3DI6 A;  2IDL A;  4Y3C A;  5EUH A;  5JMN A;  1IKY A;  1YHQ S;  5KFD A;  2ZFH A;  1XR6 A;  2XMT A;  3NS7 B;  1X4C A;  1LOU A;  4DPW A;  1Q53 A;  4RUB A;  1OQ3 A;  1QSL A;  2OI2 A;  2YKN A;  4LRA A;  1VQO S;  1V3R A;  1U0H B;  3V6J A;  3BR8 A;  1BWE A;  1H98 A;  3EDR B;  3CJT A;  5GVQ A;  3RYL A;  5D0H A;  1IJE B;  2VKZ G;  2MKC A;  3LAN A;  2XMW A;  3DYA B;  3MCO A;  1QE1 B;  2A1B A;  1IM6 A;  1L5U A;  2BA9 A;  4RR5 A;  2QYC A;  1G3O A;  2MKS A;  1X5O A;  4IH6 A;  1KSP A;  3EZU A;  2MQM A;  1IQZ A;  2ACY A;  2DNH A;  3I96 A;  2RRB A;  1AW0 A;  2XY6 A;  1C0U A;  3GFY A;  1FX4 A;  2W9C A;  1IBC B;  3LP2 A;  3UWT A;  2Z2Y B;  3IBF B;  3MR6 A;  4DQQ A;  4DR7 F;  3KDO A;  3NG8 A;  2JL9 A;  4AUK A;  1KWM A;  2OPP A;  2JVO A;  4YDD B;  2V69 A;  1FDB A;  1IR2 A;  1E6Y A;  2HAF A;  2W9B A;  3PYF A;  2GHP A;  1ZAV A;  5LSL A;  4A8K A;  1R0A A;  4AXJ A;  3PV8 A;  1CG2 A;  1TEL A;  3G2X A;  3EE3 A;  4RWX A;  4C97 A;  3MMC B;  5HO4 A;  2MLX A;  4RW6 B;  5BXI A;  3R2D J;  1YJV A;  2LU1 A;  4FDF A;  1T9T A;  2R42 A;  4NPO A;  2QSF A;  2YX4 A;  5BYR A;  3RG6 A;  1WDT A;  2YNG B;  1N5Q A;  4UUX A;  2DRA A;  1M0S A;  2JWN A;  4JI3 F;  3HHL B;  2KZM A;  1RXO B;  3QLH A;  4J37 A;  1I1G A;  2GVZ A;  3ZZU A;  5AXN A;  5CYM A;  2V8G A;  1AB8 A;  4FXV A;  1JLQ A;  2DY9 A;  2KVI A;  3CIM A;  5KFS A;  1FKP A;  2F9D A;  3GJT B;  5K8O A;  5K8N A;  1SL2 A;  3T6J A;  3IFE A;  3QIP A;  3D4J A;  2R3V A;  3W8P A;  4NZ7 A;  2FJV A;  4NLT A;  3LAK A;  3T6B A;  1IKV A;  2EK1 A;  1TV6 A;  3TWZ A;  4H4K A;  2R8I A;  2W2N P;  1JLB A;  2G4B A;  1CJV B;  4JI4 F;  4PZV A;  4MKY A;  2F65 A;  3HSZ A;  1U2F A;  1CC7 A;  3U7J A;  4WTY A;  1U1Q A;  2O5D A;  3PYG A;  4RKU C;  2EKN A;  4M63 A;  3EVO A;  4DEZ A;  4USU A;  1K0T A;  1PBU A;  4DSE A;  3ZTR A;  3JB9 k;  1JLF A;  3G96 A;  3B8H A;  2F40 A;  2A0F B;  2OSQ A;  3NGS A;  1IR0 A;  1WC6 A;  2RS8 A;  2X7I A;  3D0I E;  1YSJ A;  2W9C B;  4FKX A;  4KGZ B;  2DR5 A;  1D9D A;  1YIT S;  4P71 A;  1YVF A;  5GME A;  1J27 A;  1TKT B;  1VQ5 S;  2R8K A;  4NI2 A;  2F5G A;  2IY5 B;  1RAA B;  2CPY A;  4LSL A;  3W61 A;  5DLG A;  1UFW A;  1IBK J;  3R3T A;  3MMA B;  2MTL A;  4P74 A;  5D6G A;  4EZ9 A;  1L3K A;  5HMZ A;  2I9S A;  3JAM Y;  3PTW A;  3RR8 A;  5KFQ A;  2ZKU A;  2HNZ A;  3BBC A;  4FBT A;  4LF9 F;  2ZUG A;  1RCX B;  3CCW A;  4KGV B;  4OYB A;  4TXS A;  4MH8 A;  3OV7 A;  3ISN D;  2XSF A;  4ZVU B;  2FVQ A;  1SPB P;  4DX5 A;  2FZK B;  2J8A A;  1H2U X;  1YZ6 A;  2QFI A;  3QGH A;  4LUB A;  4EK2 A;  4AT1 B;  1T05 A;  1NK5 A;  2AV5 A;  3THT A;  3SDE B;  3BGO P;  2NSC A;  1B0T A;  1K1S A;  4BBY A;  2J6S A;  1CS4 B;  1VI7 A;  2VON A;  3C19 A;  2XLJ A;  3VAG A;  4P2F A;  3QO9 B;  1WI6 A;  1VMB A;  4KGK A;  4DR2 J;  1J5O A;  4W90 B;  2R2T A;  1HW9 A;  4C0H A;  2CG4 A;  3ELH A;  4Q2M A;  2MKJ A;  3D6M B;  2OPQ A;  3O3L A;  1D8Z A;  4J9L A;  4NLR A;  3GJS B;  1RT5 A;  1NCL A;  3FDS A;  2DCL A;  1R8P A;  4OZJ A;  2F4V J;  3TJ8 A;  2C3P A;  3V6D A;  5LMN F;  4LJM A;  2XO6 A;  3QZ7 A;  2HBZ B;  1S49 A;  1X9M A;  4FZV A;  2DCU B;  1VC5 A;  4NRU A;  4OLO A;  3DOK A;  4IOB A;  2IMW P;  2BAN B;  3Q8U A;  3PFE A;  3OSP A;  1OYE A;  1KS2 A;  1JLE B;  2RE1 A;  2ZDP A;  5LL6 d;  5B0C A;  5L46 A;  2DVI A;  4NAS A;  4ZA1 A;  3LP2 B;  4HH1 A;  4MMO A;  4F04 B;  1WG1 A;  2O67 A;  2RAQ A;  2XZW A;  4ZHR B;  3OHA A;  4PXE A;  2K7J A;  3FGV A;  2D74 B;  3MEE A;  3N6M A;  2B5J A;  3AB4 B;  3QWU A;  1LWE B;  2WVD A;  3NMA A;  2ALY B;  5KFX A;  2UXC J;  2B5J B;  5DO2 A;  5I3P A;  2PFF B;  2KO1 A;  3HKZ D;  3MPV A;  4X66 J;  4DI6 A;  5LXY A;  4CLL A;  2HGM A;  3ZTP A;  4QIE A;  2AJ1 A;  3MMB B;  1X4F A;  2VPX B;  4P52 A;  4PEO A;  3G8Q A;  5EWE A;  4UST A;  4LF4 J;  4QPX A;  1LW0 B;  2DKO B;  4FP9 A;  4R8U A;  2WVF A;  2VBX A;  2HRT A;  2V8D A;  2FY8 A;  1UZH A;  4NEZ A;  3W9J A;  5DDO C;  3MEG B;  1ICE B;  3LGN A;  1LXN A;  3OR2 A;  4F4X A;  4P73 A;  2IRU A;  2DO4 A;  2MY8 A;  3P5T L;  4UUW A;  1QAJ A;  4IR1 A;  2UUB J;  3ET6 A;  3P3D A;  4JI6 F;  3RBE A;  1MN9 A;  2OPQ B;  1URN A;  1C1B B;  2QTW A;  3QAT A;  2E7V A;  2E5L F;  2Z56 B;  1ZM9 A;  4WKY A;  3P6Y C;  2VPZ B;  2FGC A;  2BJE A;  2V4J B;  3AFG A;  2WHO A;  3T19 A;  3T1A A;  2VQE J;  3EUN A;  2MB0 B;  4XTT A;  5IT0 A;  3GE9 A;  4WFN Q;  4C8O A;  2VBW A;  4NL5 A;  5BYS A;  2RML A;  2YH0 A;  4X62 F;  2UVU A;  2WSF C;  4OX8 A;  3V4I B;  5KG5 A;  2Y8W A;  1HW8 A;  3AXM A;  3LUY A;  4P10 A;  2F9J A;  4X4R A;  2IBK A;  3GV5 B;  3P96 A;  5HVF A;  5F9N A;  1S6U A;  3TZX A;  4CM0 A;  2JLF A;  4DV1 J;  3KHG A;  2UUB F;  1SXL A;  5B0A A;  1FRK A;  2GGP A;  1GMU A;  2NSB A;  2VG5 A;  1E6V A;  3TRG A;  3W2W B;  3FUY A;  2DHG A;  2OML A;  5F41 A;  4F4Y A;  4O0N A;  3M30 B;  1O0P A;  1XR5 A;  2J9D E;  3LGM A;  5T7L B;  4G6V B;  3QFW A;  1HI1 A;  4DX8 H;  1HR0 J;  1KBR A;  2CNO B;  2CQP A;  4RW7 B;  3G6Y A;  2KM8 B;  4RUH A;  1CQM A;  2JC1 A;  3U1L A;  2HMI B;  4ILL A;  3L95 X;  2K1R A;  3MM8 B;  1A0O B;  1YK9 A;  2E44 A;  3D28 A;  3BBF A;  2ZH7 A;  1ZET A;  5G0R A;  5D8H B;  1XMO J;  2YKA A;  2F8H A;  3BEG B;  1VOM A;  2QG9 B;  3A3O B;  5SUH A;  4EI2 A;  4ED4 A;  2M7S A;  4H4O B;  3RAM A;  1FF2 A;  4G1Q B;  2XYH B;  2IDE A;  2CJQ A;  3FNN A;  3DRX A;  4NYP A;  3G87 A;  3JS9 A;  5HAN A;  4ZKA A;  2IC3 A;  5KFJ A;  4FS1 A;  2A6O A;  1UEU A;  1KLN A;  4F2S A;  4JI0 F;  3QIP B;  4OYZ A;  1Y10 A;  3DLK B;  3PYE A;  3H40 A;  3DFE A;  5J2N A;  1T02 A;  2LA6 A;  5KAK A;  1FKO A;  1X0P A;  2OPS B;  4LF9 J;  5B09 A;  3LP1 A;  2HNY A;  1UKU A;  3PCO B;  2HLT A;  2QGF B;  2VG6 A;  4TLR A;  3IBW A;  5E2Q A;  4CO4 A;  1U1K A;  2MQP A;  5AXK A;  1SQE A;  3UCZ P;  4PRF A;  5KFN A;  4NLU A;  1MWY A;  3ETO A;  4QU6 A;  4KYZ A;  1K9M T;  1W2I A;  3D1O A;  4QIV A;  1WDD A;  1T03 B;  3D0G E;  3Q8Y A;  4F0M A;  2ZZM A;  4K4V A;  3V81 A;  2JH3 A;  2BKO A;  2W9A A;  4JV1 A;  4M8L A;  1FKA F;  4WU3 A;  4R0E A;  3DLB A;  2DNP A;  3MOJ B;  1CSJ A;  1MRO B;  4CLP A;  4H4M B;  1F1B B;  2WVE A;  3K5L A;  2O1P A;  3PR5 B;  2B6A A;  1XMQ J;  3M8Z A;  3PX4 A;  4CYU B;  3GV8 B;  1S57 A;  3B4M A;  2DHA A;  3TW0 A;  5CA5 A;  5THW A;  3I0S B;  2DXF A;  2G2Z A;  1HHQ A;  2V0N A;  1UWA A;  4QJV A;  2QA2 A;  5D0R A;  1FE4 A;  3UVJ B;  4X4T A;  1PBA A;  3S01 A;  2CAD A;  1ZZF A;  4HDG A;  1MWQ A;  3UPF A;  2MHE A;  1GK8 A;  2V63 A;  2WON A;  4V19 X;  3RU0 A;  4C2M A;  3CF5 Q;  4DBQ A;  2PA3 A;  1CC8 A;  1HQU A;  2AYE A;  2H9Z A;  5DZ6 A;  1DFD A;  4DV7 F;  1FKP B;  4ZCM A;  5J2Q B;  5L1L A;  2YNI A;  4WYW A;  4KY3 A;  4F36 A;  1WJ9 A;  4EBC A;  2VFU A;  2ZH1 A;  3R6L B;  3QLH B;  4LSZ B;  4F3M A;  1C0T A;  4DV5 J;  4QYZ K;  3JYT A;  2KTQ A;  3K2Y A;  4NA1 A;  4I67 A;  4DV5 F;  2YNG A;  5HAT A;  5FDL B;  1IM4 A;  2HLU A;  2VIC A;  4DUZ F;  3X1L B;  4F0K A;  3G82 A;  5AXM A;  3FSY A;  5F8M A;  3CCQ S;  1RU1 A;  2H4W B;  3ETM A;  4ZP8 A;  1ZS6 A;  3W2V A;  2V68 A;  2C3M A;  1SVD A;  1T9W A;  2RQ4 A;  2Y1L B;  5GAG U;  2W8L A;  2J0W A;  1XJW B;  1ZPV A;  2CKW A;  2IJN A;  3T3F A;  3PRD A;  2NYI A;  5FLX U;  4KRW A;  5I3U A;  3S1T A;  3BZQ A;  3NGT A;  3FC9 A;  2W7P A;  4ZVS B;  2BYC A;  1TL3 A;  1FRJ A;  4ECS A;  5DGB A;  4JI5 J;  5C24 A;  4U7U K;  1ULR A;  3FBE A;  3BGU A;  5GAE I;  1H6K X;  3VGU A;  3N28 A;  2XG8 A;  4LQ9 A;  1WC5 A;  4TY8 B;  2ZC4 A;  1AZS B;  4LSN A;  4DG1 B;  3PW4 A;  2NPF A;  4DV7 J;  1B70 B;  2PC6 A;  4MT1 A;  1MU2 B;  2XY5 A;  1LFP A;  2QRR A;  1M5H A;  2QLF B;  3DLE B;  4RW7 A;  3UO0 A;  2MZT A;  1QDU B;  3ZZY A;  2PI5 A;  4P72 A;  4LF8 F;  5J2P B;  3NOC A;  5AE3 A;  2W24 A;  1QE1 A;  1N56 A;  1WEY A;  2RUG A;  2LLZ A;  2G9O A;  5KG6 A;  3EX7 B;  4MIA A;  1RHQ B;  1B7Y B;  5GAD U;  2H48 B;  4EFA C;  2HSE B;  1KOO A;  3T5L A;  3I9V 9;  3I0S A;  4MKB A;  3D1H A;  2PEH A;  2KT2 A;  4A8O A;  4R0J A;  4Q45 A;  3K8W A;  3R5B A;  4DV1 F;  4CYU A;  2HK3 A;  1XQI A;  2ZOF A;  4ZPC A;  1F3F A;  2AWZ A;  1ZPW X;  3AA8 A;  3C15 A;  3D54 A;  5CH7 B;  1IKW A;  2MPU A;  4CT8 A;  5B0B A;  2J9D A;  4PXC A;  3OTO J;  1SC3 B;  2ASL A;  3AY0 A;  3PEH A;  1RAE B;  1SV5 A;  1TL1 B;  2HQ3 A;  4WFZ A;  3UI3 A;  5IQ6 A;  3D2W A;  4CLU A;  3CTR A;  2QV6 A;  1KLM A;  5A8K A;  3GYG A;  5EGY A;  2GO8 A;  2MST A;  3BN4 A;  4YDX A;  3V5R A;  4W98 A;  1F6T A;  2JFD A;  3A4T A;  4XDD A;  2AGQ A;  5KFZ A;  2ZH4 A;  1QUP A;  2K3K A;  3MM9 A;  1NSK L;  2MZQ A;  4KHP J;  1TR0 A;  3BQ0 A;  2DD8 S;  4EGL A;  3W2V B;  5J1P A;  2ZJR Q;  2VG6 B;  3RAX A;  3TZY A;  1VQP S;  4OHV A;  1WKL A;  2OPS A;  3ITH A;  2BJ8 A;  1D09 B;  1REG X;  1BHN A;  5HJX A;  5J2N B;  4DZD A;  2H65 B;  2E66 A;  4RPF A;  5HI7 A;  1N34 F;  1ITP A;  1FJC A;  4OV6 A;  1CLF A;  4K5S A;  1RBL A;  1NDL A;  2RJZ A;  4CH0 S;  1BE4 A;  2HVI A; 
#chains in the Genus database with same CATH homology
 4DR3 J;  5IWA J;  2UUA J;  4X64 J;  4GKJ J;  1I94 J;  4DR4 J;  3IMQ J;  4NXM J;  1N34 J;  4B3S J;  5LMN J;  2KVQ E;  1XMQ J;  2UXC J;  4JI1 J;  4DR5 J;  4X66 J;  2ZM6 J;  4JI7 J;  2UXD J;  4DV6 J;  1N33 J;  4JI2 J;  4LF5 J;  4LF6 J;  4LF8 J;  4DR1 J;  2E5L J;  4LF4 J;  1HNX J;  3J7A N;  3JAM U;  5AJ3 J;  4NEZ A;  3J81 U;  3R2D J;  4LFC J;  4B3R J;  3D3C J;  4DV3 J;  4JV5 J;  4X65 J;  4NXN J;  4KY3 A;  2UUB J;  5LM7 E;  4GKK J;  4JI8 J;  4DV5 J;  4X62 J;  2VQF J;  3R2C J;  1HNZ J;  2VQE J;  1HNW J;  1IBM J;  5BR8 J;  4PWW A;  4LFB J;  5FLX U;  4NEY A;  4JI5 J;  4YHH J;  3W1Y C;  3T1Y J;  2HHH J;  4B3M J;  4DV2 J;  4DV7 J;  4OX9 J;  4B3T J;  4DV1 J;  1XNQ J;  4DUY J;  3D3B J;  1IBK J;  4JI0 J;  2KL8 A;  1HR0 J;  2MTL A;  2MEW A;  1J5E J;  1N32 J;  4JI6 J;  5IT9 U;  4DV4 J;  1XMO J;  2UXB J;  3OTO J;  3J80 U;  4LF7 J;  1FJG J;  3T1H J;  4K0K J;  4AQY J;  1N36 J;  4RJV A;  2UUC J;  1XNR J;  5A2Q U;  4JI4 J;  1IBL J;  2UU9 J;  4V1A k;  4KHP J;  4DR2 J;  4HHU A;  4DR6 J;  4LFA J;  4DUZ J;  2MQ8 A;  4JYA J;  4DR7 J;  4LF9 J;  4JI3 J;  4DV0 J;  2F4V J;  5LMU J;  4YY3 J;  4KYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...