1FJGJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1fjgJ00
2KL8A 3D3BJ 2VQEJ 4DV7J 5BR8J 1HR0J 4NEYA 3W1YC 2MTLA 4DR2J 5LMNJ 4JI4J 4B3RJ 5A2QU 2MQ8A 3D3CJ 1XNRJ 4RJVA 1HNWJ 1FJGJ 2UXCJ 3R2DJ 4B3MJ 2KVQE 4JI2J 2UXDJ 4X64J 4DR7J 1IBMJ 4DV1J 4V1Ak 4X62J 1N33J 2UXBJ 4YY3J 4JI0J 3J81U 3T1YJ 4JI6J 4LFAJ 4NXMJ 4NEZA 4LF4J 4JI7J 1IBKJ 2UUCJ 4LFCJ 2UUBJ 4KYZA 4YHHJ 2UUAJ 4HHUA 5LMUJ 4DV6J 5IWAJ 1N34J 2HHHJ 1I94J 4AQYJ 3T1HJ 4NXNJ 4DV4J 4GKKJ 1J5EJ 4JI1J 2F4VJ 4PWWA 4LFBJ 4GKJJ 4LF9J 4KHPJ 4JYAJ 4DV5J 5FLXU 4KY3A 4DR4J 1XMQJ 2VQFJ 4JV5J 2UU9J 4LF6J 4LF5J 4JI3J 4JI8J 1N36J 2E5LJ 3OTOJ 4X66J 4DR5J 4DUZJ 5IT9U 3J7AN 4B3SJ 4DUYJ 4DV2J 4LF7J 4LF8J 4DR3J 3R2CJ 1HNXJ 4DR1J 5LM7E 1IBLJ 4DV3J 4B3TJ 3JAMU 2ZM6J 4DV0J 5AJ3J 4JI5J 4OX9J 1HNZJ 3J80U 4DR6J 1N32J 3IMQJ 4X65J 1XMOJ 4K0KJ 2MEWA 1XNQJ
chains in the Genus database with same CATH superfamily
3RB0A 2BDPA 1FX2A 4HI2A 4MKAA 2RUGA 3HHLD 2YX4A 4TLQA 4ED6A 4I6YA 4EMDA 1GTHA 2RE1A 3H2VE 5KT2A 1B0VA 4PR6A 3IRXA 1H2TZ 4V19X 4YFUA 1RHMB 3I32A 3RYLA 5K14B 5K8OA 3QGHA 1T9YA 2I5JA 2KFZA 1J5EJ 4Y2CA 3VZIA 3G82B 2Y1JA 2HWTA 3DFEA 4ECSA 1E6VA 3CCWA 1LWFA 4CO1A 2GVZB 3J7YI 2HVIA 5GAGI 1SH3A 1JB0C 4LSNA 3A12A 1TL1A 4ITSA 1HFEL 2CQDA 4LRBA 4TU7A 4CO0A 1JLQA 3WBZA 3MUTP 3DLKA 1VQ9S 3POTA 1JNZB 1M1HA 1HYSB 2LA4A 1SJ3P 1YX2A 2XZDB 4KT0C 4HI1A 2HYIB 4ED1A 4BS2A 2R7SA 4DV1J 3D7SB 1S0MA 5LMNF 1BUXA 2YQ1A 2KN4A 5L9NA 2QA1A 1Y5IB 2IRUA 2O5DA 2MLXA 5J2QA 3JYTB 4R25A 3J81j 2AZ1A 2LXFA 3MEEA 4GC6A 2B5JA 5E3AA 4C8LA 1T03B 3E01B 1ZAVA 1RB0A 2UUBF 1WF2A 1BXNA 3Q8QB 1L3TA 5J2MB 1FVQA 2GMLA 5A8KA 1HLWA 4WFBQ 4ERDA 4CTAB 2QA2A 2HFZA 1TKTA 5GAHU 4DU8A 4H4KA 5JXSA 5D6GA 1S12A 5G4DA 2FVPA 4QWDA 3KTQA 3NNHA 4OZ5A 3MM7A 3ZZZA 3DC2A 1Q95G 4CLFA 4ES1A 1XNRJ 1V5IB 2XHWA 4XAKA 3K5PA 1I51B 2J6SA 3BSNA 1DFDA 4M5DB 2HQDA 1OS5A 3KUEA 3CB4A 2ZBRA 5CQGA 3ULHA 4IDKB 2XC9A 2DGQA 2B6AA 1BMQB 4PUOB 1RISA 1VQKS 2RSQA 1N5YB 1XERA 2MLYA 1AW0A 2B51A 2VG5B 4W92B 1MN7A 4WJBA 4K8RA 2P5VA 3BPDA 1ACMB 1YRUA 4M1KA 3RRGA 2BXJA 2OPQA 1P1LA 4QWAA 3SCLE 1WC6A 3CPWR 5CD4H 5JMNA 4PXCA 4FBTA 2CJQA 2PFFB 3EUNA 3NGDA 2HS0A 3I96A 5B0BA 4U9RA 3PYEA 4MK7A 2RB7A 4UOGA 5DETA 4H4OB 3EXCX 2BRLA 4O3NA 2BR0A 2PDAA 3IC1A 4PWUA 1Y10A 1YGYA 5E2QA 1IWGA 3HK2A 4RUBA 2MY7A 1RLCL 4ZVTB 1FERA 3B6BA 2XCPA 2V69A 3HHLA 1E6YA 3TZWA 2N82B 3ILIA 1X9WA 1VQLS 4CT9A 3MPUB 1J2VA 4F26A 2DY1A 2EI5A 4UQGA 4Q8FA 3RB3A 2F3JA 4KGKA 2KJVA 5K8MA 2DIVA 1VK3A 5ETOA 5EHHA 3C15A 3ZXWA 3MUMP 3KMQA 1YLXA 4L76A 5D0GA 4Y2MA 4RNOA 3RR7A 1F3VA 4QYZJ 3N5BA 4DR4J 4J9OA 3K5NA 1F9HA 4Q44A 3MM8B 2AF6A 3MAHA 4NA2A 4OV1A 2RJZA 1FKPB 5DQGA 1RT5B 2HAIA 8AT1B 3A8IA 3MM6A 4M5JA 4J9VA 4B9LA 4DR6J 4D3GA 1U24A 1X0PA 4LSLB 4UZCA 1KBRA 2UV8A 5KG0A 2J6TA 1PC5A 1J5EF 2DGTA 3QO9B 4JI4J 3DLEA 4OX9F 1GXUA 1VCTA 2H65B 2GVDA 3AT1B 5HANA 2CYYA 4FKYA 2PEBA 5DDPC 1RAGB 1M5KC 2IBKA 2D3UA 4R8UA 1R0AB 4WFNQ 5CA5A 4NI2B 1JXVA 3I82A 5E7OB 1VQPS 4PQUA 1HNVB 1Y0HA 1TV6B 3M6XA 2WTFA 2DHAA 1RSCA 5KOWA 4GKKJ 1JX4A 1H72C 5A8WB 2HHXA 4KV8B 1HBOA 2AV5A 4ED0A 4EI2A 3KK2B 5F8IA 4DV1F 4JI3J 3OTOJ 2VFRA 5IV3A 4ICLB 5D4OA 2YH0A 4ZLNA 1EQMA 1LK7A 3DRSB 1K47A 1NAQA 5F41A 2OIHA 1TZ0A 5I3UA 3D3BJ 1SV5A 2DBBA 5FIIA 2M70A 2VDIA 1WEXA 2WK4A 5KFTA 2VD3A 3TWZA 1Y00A 3D6TB 3UW1A 4ZP9A 3R2DJ 1T95A 2LDYA 3I5AA 4K4ZA 4RX6A 3MTJA 2XSJB 3P6YC 2FJDB 3BBFA 3W65A 2HFNA 1IBKJ 2Z58B 1XEZA 4B9SA 3LGHA 5DRKA 1VHIA 1GT8A 2AJ0A 2KYZA 3FEZA 1UVKA 1QY7A 1WHYA 3H0PA 1TUVA 4C11B 3WDOA 1LWCB 2B56A 3TEGA 2C3YA 2DPJA 2FLPA 2Q66A 3FGVA 4B3OB 1WKKA 4O3RA 2VPYB 1HL6A 2DY9A 2OLWA 1RT1B 2KFYA 3K7RA 2XY5A 1LFWA 4LF8F 1M0SA 3J7ZT 1IKVA 2VQEJ 2P2CB 3CIZA 4ECRA 3QNWB 1K73T 4JV2A 3G6YA 5LSRA 3UN2A 2P9GA 1VIOA 2VJUA 2N7YA 3CTRA 2EFQA 3IAS9 4X4OA 4XIUA 2FYXA 2VPXB 2XNQA 2BZ2A 3J80Y 1S6PB 2B4VA 3DLGB 1WNEA 5L9XA 3JSBA 1GMVA 4FF2A 1NUEA 3OVBA 2WONA 5F0WA 3CJTA 3OL9A 2Q6BA 1YHQS 3CDUA 2H4YB 4R0JA 5D78A 3D28A 1UFWA 4A8OA 4F4YA 3DOKA 3K8VA 2HS4A 2Y8WA 4DG1B 1M1KT 1HBNA 3LWLA 3F41A 4RNNA 4ZKAA 3DLLQ 3UCGA 2CXEA 3SSSA 1JLEB 2RU3A 3E2EA 2B8QA 4DOZA 3OXFA 1B7YB 4OJHA 4OZLA 4B08A 4J9NA 1FRMA 4KSEB 2HQIA 3CCTA 4DLGA 3KJVB 2HFSA 2K7JA 1XC9A 2CQ0A 2WSEC 2C3UA 1JLGA 1WEZA 1N0UA 3KHLA 4FXVA 2E9ZA 4ZOSA 3O5TB 1NSPA 5KG2A 4I2QB 5GAEI 3JQMA 2E1PA 4ED3A 4DR4F 4IG0B 3OHAA 4UOCA 5THWA 2R7RA 4RUHA 2HVEA 1VDHA 1AROP 1W25A 1VJQA 3C2PA 2OTJS 3DOLB 2KM8B 1JLFA 4I7FB 4I68A 4NXNJ 1NHVA 3DOMB 4JI4F 3C16B 3HVAA 1VQ5S 1FJEB 2D69A 2GV1A 1V3SA 3T1HF 3MR2A 2HZCA 3V6KA 1KVKA 3CMES 5B7WA 3IGVA 2XY6A 3A3OB 1KQKA 1B0TA 4GC7A 3V4IA 1U6BA 5C5JA 1D3WA 1M5HA 4X4QA 2ZH5A 4P6QA 1SVDA 2D9OA 2XYGB 2NQPA 2KT2A 3KG4A 2ZUAA 4PUOA 2MZTA 2QG9B 5A0YA 4JI3F 1UVJA 2OEKA 1QE1A 4MIAA 3W7BA 4NA1A 1VRTB 2CDQA 2ATCB 3HLUA 3UCZP 1CBKA 2R42A 2A2CA 1H3DA 2VH7A 3I6PA 4WXWA 3UO0A 5EUHA 4Y3CA 1RT6A 2KB2A 2RQKA 1PGZA 2RRBA 4LRDA 1NH7A 1EETB 3NOGA 1H7WA 3M30B 3D2WA 3R9LA 2OPPB 3FBFA 1O5JA 4J9RA 3ELHA 3DI6A 4OZNA 2M4MA 4H4OA 1RAIB 3LANA 2EFPA 2HQFA 2KM8C 3O8WA 4NZ0A 2LQ9A 3L3CA 1BQNA 3ZTQA 1IBKF 1IR2A 1HNXJ 2GMHA 2J9EA 1RK8A 3BO4A 4USHA 2Z2LA 3LQVA 2WOMB 4XTTA 2CJXB 1FRKA 5HBMA 3MM5B 4DCJB 3MEGB 2YNGA 3B8HA 4K4UA 1PBAA 2KDOA 3N6MA 4YR3A 2NXEA 4LQ9A 3A4TA 1T05A 3DMJB 4KRWA 1TL3B 2BJEA 4IO9Q 2KTQA 2CVEA 5IV4A 4Y2KA 4PXBA 3MM8A 1D9AA 1N34J 2ZJRQ 1XTZA 1JMTA 4U96A 1S10A 3DRRA 5F8JA 2GQQA 2PMWA 4AL6A 3R1LA 3HFVA 5EWEA 3LH2S 4PPZA 1TTHB 1X5PA 2W9CB 2GIRA 1HIYA 1CULB 1HWUA 4K59A 2IM2A 3QO9A 2AP6A 2A18A 1RWPB 1MMNA 1NSKL 3O3LA 4UUXA 1TVRA 3J80U 1RHUB 1RWWB 2F5GA 2YNIB 3I4HX 1R6VA 1WOPA 2R2UA 3DKDA 2DH8A 1SKRA 1FJGJ 3VAMA 2UXCJ 3ZTRA 1Q4RA 5KFXA 4CI0B 1HNVA 3KHHA 4NLUA 2F9JA 3UDVA 2HK2A 1U2FA 2RDIA 3QWUA 4O4GA 3DN9A 2W7AA 1SC1B 2LDIA 4MH8A 3RBDA 1V9OA 1WUUA 1RAOA 4DZDA 2F4VJ 4ZPBA 3MTKA 5C25B 5KT6A 4DV5J 2CVIA 1V3ZA 4RBVA 1FDNA 2BYCA 2AYMA 2E1AA 2NREA 4OHZA 2G0CA 4CO3A 1CJUB 4F50A 1BGXT 3DM2A 2X1AA 3K5LA 4KTQA 2XBPA 4FVMA 3R7NB 2RHQB 5KFFA 4OZ1A 3NEKA 1UVIA 1NPPA 1QTNB 1OY8A 1N6QB 2XMKA 1CEZA 4QIEA 5D0HA 1T9UA 2HIQA 3I31A 2GO9A 4NXNF 4CRJA 4J91A 2M2BA 4F4XA 2C3PA 3FRZA 4RW9A 2R7UA 2DR6A 2J8SA 3M1VB 4B9TA 1R0BG 4F3MA 5JJBA 4B3MJ 4C3MA 3K5OA 3VGVA 3PRVA 1N5VA 1S1WA 2N3LA 1VYAA 4FP9A 1WI6A 4CYUA 3P5TL 2ZZTA 2YKNB 1VRUB 2HMIA 5BYSA 1QVGR 2QLJB 2MKHA 4B3OA 1TL5A 1SL1A 4WE1B 3OV7A 3BSOA 2UP1A 2V2ZA 3HVTB 1Q5YA 1VGYA 4R0EA 1G1XA 2YKMB 2XI3A 1RABB 3MCOA 4ID8A 2H4WB 1S1UA 2CJ9A 4NLYA 3ETOA 5I3PA 2OPRA 4RU2A 4BDPA 1BQMB 1FDAA 1JLCB 3MPVA 2DKOB 1SL2A 4ZDNA 3TVZA 4QIWD 1OYEA 3BYPA 1U8SA 2OEJA 4WFAQ 4FBUA 4RW8A 3FBBA 4ZVGA 4ZVQB 2FB0A 1FD8A 2WBMA 4DUYF 3E51A 3W9HA 3IO1A 3R5AA 4C3LA 2ZE2A 2AHOB 5ITHA 3G8TA 3PNIA 3EE3A 3JAMY 2BQRA 4IO1A 2V8DA 1TP7A 1OMSA 4HTIA 5IM0B 1S5ZA 2CA9A 1IBMJ 4PPDA 4DR2F 4DSIA 3M8SA 4AUKA 1HNXF 3AODA 1NBEB 1S79A 2H5IB 4WYWA 1FRLA 2DHSA 1SC4B 1FWKA 3Q8SB 2DISA 4ED4A 1M5VC 2DHHA 3DCAA 3EVWA 2K1RB 2V9WA 3SZ2A 4AQYJ 4YY3F 4OX6A 3I0SB 3OR1B 3EMTA 3C66A 3IS9B 2GHVC 2UUWA 1ZBTA 3SYZA 5T7LA 4DQQA 1GX6A 4I6AA 1F5AA 1OY6A 1V5VA 2KZZA 2AJQA 2R3VA 3U1NA 4HVZA 1REGX 4DBQA 4NRUA 1QTMA 3BQ2A 2P9CA 1IBLJ 2WVEA 1TQLA 3HKWA 1WDDA 1J5OB 3RRKA 2AWZA 2HRTA 5D4LA 1AZSA 1KHWA 3DOLA 2J0QD 2ZD1B 2Z8QA 2VBYA 4EBEA 1RUSA 3WC2A 2YPYA 4YB5A 3QAEA 3C6TB 4A8QA 1N33J 3CMQA 4X2BA 2E5JA 2R4FA 2RU9A 4AL5A 2XG8A 5J1EB 3ZTPA 1EP4B 2O67A 5E3CA 4KPCA 1QAYA 1H38A 4IR9A 2MGZB 2IAJA 2FJAB 1JLBB 1KONA 2GGPB 2ALZA 3TW0A 3EWGA 2CAJA 1URNA 4C3KA 2UXCF 3K0JA 1IKWA 1OQ6A 2F63A 3BO3A 4ELTA 1SQFA 4E2FB 2HBYB 5H9FK 1FTRA 3AJ1A 5F8HA 3DRPB 4LUBA 2VG6B 1MROA 4ZJOA 2XTJP 5KFDA 1L3VA 1WC3A 5DM7Q 2UU9F 4N8OA 4R5PB 4GVBA 3PYDA 3EPIA 2CDRB 2VFTA 8RUCA 5BR8J 2OEMA 2F8EX 2ZITA 2B7CB 2QX0A 4ID5B 5A6PA 1KLMB 5F3ZA 3CCSS 1IJEB 3D3CJ 4U7UK 4CIOA 2CQHA 2QYGA 5MAOA 3NAHA 2EXUA 3HD1A 2O01C 3RRHA 2XGQA 1QSLA 3HHKA 4BC9A 3C14A 1OSCA 3OD2A 1FDBA 2YKOA 2JX2A 3GZ7A 3BN4A 3H98A 1RGVA 2J0SD 5C24A 1C0UA 1MG7A 1S6OA 4NXMF 4ALZA 3H25A 4KIAA 1U6FA 1W7WA 2XCAA 3MM9B 1ZM9A 2CQGA 2KXFA 3OTCA 1UETA 3M9NB 4Y2AA 4UT4A 2EG1A 4O0IA 5KFRA 1NK4A 3S7RA 2KFNA 3GCWP 4C4WA 1KKHA 2HGMA 2FHMA 2ZBQA 1CC8A 4Q2MA 2R8JA 5F0UA 3AH6A 3W63A 2HRYA 1HD0A 2VC1A 1LK5A 5KFHA 3DMJA 1F1BB 1KWMA 1YJTA 2ZH3A 5L39A 1M5PC 1YIJS 1LWEB 4A46A 3H8YA 5E3RA 1Q7LB 4RKUC 4YN3B 3MGJA 2CZ9A 1C0TB 3G8QA 3LPYA 4QWBA 1TL7A 3ZZUA 3TZYA 3MZIA 4W90B 2PGCA 3T41A 2RIJA 1SIWB 2HBRB 1RYRA 1KNZA 3IRWP 1FEHA 2P6TA 2OSQA 4ECVA 3G87A 3MPDA 3T1YF 2X7IA 3GMGA 2QN6B 5HI7A 2VDHA 4LIWA 1YBTA 2R8IA 1NH8A 5LMUF 2XULA 1HHTP 5L1JA 3UD5A 2QTWA 1EX8A 3DU6A 1GAOA 3AOBA 2BE7D 3FFIA 5KFUA 4ANDA 3GG1A 4CDIA 4CM2A 1T3NA 3KLIB 3JAMU 2XY7A 4LT6A 1BC6A 2BRKA 5AJ3J 1W2IA 1QSYA 4LF5F 1NEEA 5HMXA 1I3OB 3RJMB 3THTA 2UV8G 1HNIB 1VISA 4IYQA 4FF1A 4N76A 1NB2A 2MJUA 3TUZC 1RTIA 3CGIA 1NJYA 4RW7A 2DGWA 1IVZA 1UKUA 1UCNA 3D0HE 3PJ9A 5CYQA 4OJ1A 4DL2A 2PFDA 3B4MA 3P4UB 2ZNZA 3D67A 3NL0A 5KFYA 3H20A 4AYBD 4M94A 3SDEB 4NA3A 5H9EK 2I2YA 1U25A 2HGNA 4ZVUB 1X60A 3HHEA 3SFUA 2CQBA 3MAAB 1N33F 1UEVA 3E8OA 4C6AA 4CO2A 3EDRB 3NOCA 2XS2A 1REVA 1Q82T 4IH6A 2ZZMA 1PCAA 1WF1A 2FY8A 3PW7A 5J2PA 1WC4A 4KO0A 5GAHI 5CHCB 2E5LF 5E41A 4DUZF 2G0JA 1U48A 4L3KA 1CJTA 1R8BA 2K2PA 4USVA 3KK1A 3BDEA 1ULRA 1X4DA 2HQCA 1HNZF 3IBWA 1ZM3A 5BYRA 2JOQA 4KAIA 2XLKA 5HMYA 1NHKL 4J9UE 4O3SA 2OPSB 1QM9A 3IWXA 3Q89A 2FY1A 4WE1A 4ZVOB 1JKHA 3FCHA 3HVWA 2ZHBA 4ED7A 2ACMA 1JIHA 3G6ES 3V4MA 1YITS 5BR8F 4OYIA 4LFAF 5IFMA 2OJ3A 3GFYA 3PM9A 3W64A 3OR2A 3BR9A 4KGVB 3M2VA 4ECUA 1KR4A 1RWXB 1QAXA 1UPPA 3DHXA 4WZMA 4LF9F 4LR9A 3EM1A 1S59A 4FKXA 1R31A 4ZIVA 3BH6B 3EX7B 3JSMB 5LJ5Y 3MEDB 3KLEB 5DS7A 2J9DA 3AOAA 1GTEA 3V6DB 4DR1F 4FVCA 5BJRA 2YWGA 5B08A 2DNHA 4P10A 2Z56B 3HHDA 3M2RB 4DL5A 4WIQA 3D6MB 4WKRA 2XS5A 4MKVA 2CPEA 1RA6A 4C7QA 3I0SA 4TY8B 3FKBA 2E5GA 5RUBA 1RTJA 2KXNB 4C8MA 4MJKA 3LALA 5IWAJ 4ZP8A 1OQ3A 4Q7AA 5J1NA 4I4BA 4RPFA 3KLVA 1FNMA 5H1SV 2E7VA 4DDFA 1VK8A 1Z4UA 1N36J 2ZC4A 2EC0A 3ISZA 4F2RA 2QA4S 4LF7J 4EO6A 3KWMA 4JYAF 4ZVSB 2KT5A 4QYRA 1VBXA 1HMVB 1T3OA 1S76D 4JV5F 2BANB 3GYNA 1KOOA 3DYAA 2V94A 1F5BA 4DV2F 2B0GA 2LQJA 2HHPA 2JLFA 1X5SA 3GSDA 1WG1A 2DGVA 1NZ8A 5ETSA 1HHSA 1XQIA 5BXIA 5J1EA 1GX5A 3PACA 2PT0A 3T5LA 3HDSA 4X64J 4PABA 1JLBA 3SCIE 1KTVA 2GGPA 4NX9A 1QLNA 4IUFA 2LXUA 2KZMA 5AJ3F 3AD8C 3D1QA 3AJDA 1HQUA 1KN6A 2VONA 2Z2MA 3CE8A 3W2WB 3RBEA 3W2VB 2AX0A 1FK9B 4DL7A 2G2OA 4YDXA 4NPOA 1P27B 4KHMA 3DRPA 3MMBA 2ZC3A 3BV8A 2OFGX 3I0RB 5J2NA 4NLQA 5DO2A 3TANA 3B4DA 4IQXA 4KR0B 4FXWA 1RTHB 2ZHAA 2YWKA 4HT5A 1EHWA 2AEJA 2DK2A 4JI8J 5KFKA 3TZZA 2PN6A 1DY3A 1WSVA 1ZYQA 5KT7A 4ID5A 3ENQA 3H4DA 3ZTSA 2RHSB 3SSQA 1TFYA 1X5TA 4P52A 2BJDA 4RLEA 3BPSP 3CJSA 4X66F 1G7CB 1U4BA 5CD4A 4K0KJ 2P8IA 2AU0A 1FNXH 3W1YC 4Q0BB 4PG7A 4Q45A 4NMLA 1S9GA 3AOCA 2BW2A 5KFCA 2QJ3A 1SJFA 2NYIA 2W2NP 1J27A 4TVAB 2BBEA 3IR6B 3DXSX 1CSJA 1RBOB 4YS2A 1IQZA 4YB1P 2A3JA 3BDPA 4G1PA 2DHXA 2UUCJ 3GR0A 4K5RA 2DNPA 2E29A 4IFVB 1CVJA 4U67Q 2JLEA 4DV6J 2MZJA 3VV2B 3PO4A 3AXKA 5ETLA 3RGIA 1RT7B 4MIBA 3PHTA 1L5UA 2C2NA 3ILOA 2VFVA 1CS4B 4QU7A 2JLGA 4P7VA 3V6HA 1R0CB 1HWJA 2UVRA 2RS2A 3BH7B 4DUTA 5C2GA 1FWLA 2ZBCA 1XMOJ 2GZOA 1C0TA 4Q2LA 3PZPA 3KYLA 1NXIA 4N7TA 2CNLB 5SZTA 2R8KA 3R7BB 2U2FA 4DU7A 1HQEB 2J8AA 4ZP7A 5A6WA 2OTLS 4X4TA 4N56A 1Q7YT 2B3TB 4QQBA 4CLKA 4RWXA 2AD9A 2IC3A 3M32B 3PRBA 1EARA 3KUHA 2NXUA 3GR1A 4I69A 3OQ2A 2DO0A 3LAKA 4Q43A 3VWSA 3HULA 3KLIA 4OIXA 2CG8A 4O44A 1S9EA 2CG4A 4DL6A 2YNHB 3J7AN 4LBPA 5DG7A 4LFBF 1F0XA 2RNEA 3F44A 4DV3J 2FJXA 3Q24A 2NUUG 1EKRA 1T9VA 3KLFB 1VQSA 4N77A 3Q8YA 3SBMA 5KFJA 1N4LA 5CCMA 2LECA 2KVQE 2DGUA 4MK9A 1K1SA 3TX8A 3QGPA 4K7QA 4DPTA 4Z2XA 3CC2S 3JB9k 4LFCJ 1YI2S 2RKIA 2L41A 2FC9A 5HVHA 5FJ4A 3B82A 2XMAA 1U8WA 5DGAA 4QR2A 4ZCLA 1YWXA 2R9LA 1M90T 1T94A 1JXLA 2BJ8A 4MFBB 2AYEA 3F0NA 2IMWP 4X64F 4KFBB 2HURA 2BJ1A 1C1CB 2VBXA 5IC4B 3BSAA 4BLGA 2KG0A 2CJBA 2YWWA 2NPIA 1G4CA 3NWRA 1X4HA 4L3NA 3HSGA 1HARA 2CADA 1S0OA 2DNKA 5DZ7A 2ERRA 3J7YU 5F8LA 3KJNB 5GAGU 1PC4A 5K9FA 1Q53A 2Y0BB 3LTOA 2Q3PA 1GFWB 1RWUA 3N0VA 3NWGA 1S72S 1M1GA 3LP0A 4K50A 2DVIA 1DQ9A 4JI8F 3SIPB 5L8RC 4EUVA 1OPIA 2XWXA 1VR6A 2WVBA 3SV3A 3MWBA 2LCWA 3OLBA 5A2QY 4QPTA 1S7HA 4DR7F 4K0KF 2KJWA 2RRNA 3MPWA 3K59A 1TK0A 4NCGA 1LW0B 4F67A 2C2DA 2MZQA 3QJPA 1VHFA 2X1GA 3JTPA 1PAEX 4HKQA 2HHHF 3PW2A 3G86A 3CDEA 4WYLA 2HHWA 2OMLA 1FRHA 3MEDA 3IAM9 2A2DA 1KQFB 3M8QB 3MMAA 2W2PP 2HNZB 1U1OA 3RR8A 3QZ7A 4A4JA 4URGA 3IGNA 3A3PB 4WU2A 1UTAA 4AL7A 4FS2A 4DV6F 2OP5A 2ZH7A 2FJWA 5HROB 1XNQJ 2ZOMA 3ZZTA 1SUQB 3DLHA 3H59A 3NBPB 2R2RA 4J90A 2EFNA 2YH1A 3A8KA 4F8RA 3S01A 4P75A 1RTZA 5FDLB 1TFWA 3H5SA 3MPYA 2VU5A 4RW6B 4OYZA 4LF4J 1RAJA 3UVJA 3CCJS 4LRCA 4TQSA 2NR0A 2F7VA 3CJ2A 3KK3A 3HO1A 3KLHA 4YMEA 4P74A 4BHQA 1JXEA 3H2LA 5KFEA 1DAXA 3ISNC 2KG1A 2LQ8A 4ZP6A 4K4YA 4JV1A 2FTRA 5ETQA 4AFFA 4C0BA 1PSDA 2XLIA 3I56S 4PWDB 3SQGB 3DDKA 3IR5B 2MQQA 2H51B 2EC2A 5H9FJ 4L73A 2NUHA 3K57A 1DJ0A 3RZAA 4OFZA 4C0OC 3MOJB 2G13A 2ZOFA 3KOAA 5GMDA 1I5OB 2NXJA 4DX7A 3R5CA 2M8DB 3M2UB 2M0GB 2WVCA 2FPHX 2P6SA 1S1XA 1HR0J 1FFWB 1H73A 4NOHA 2XYPB 2HNDB 1Q8LA 2MZ1A 2IMOA 1HNWJ 4QWEA 2YWEA 3PKYA 3W2VA 1YJ9S 4DSFA 5ETPA 1RWKB 2ZDPA 2NXNA 1X5OA 4DQPA 3I0RA 1NJWA 1RWVB 2IVFB 3PO5A 1RTHA 2DH7A 1S6QB 4G3IA 1U1QA 5M2PA 3C6UA 4A8KA 3PKMA 4FPRA 2JVRA 4FYXB 2AEMA 1NSQA 2V9KA 3OFFA 1H7XA 4OYWA 3VCDA 4KGMA 3W8GA 4DL4A 2WW8A 4H4MB 1VBKA 4B9VA 4ECXA 1DTTA 2N4DA 2I38A 1WACA 2R7WA 2QLWA 4DWIA 2JFDA 4LFCF 4UOFA 1WOSA 2DXEA 1WHWA 1RT2A 3M8ZA 4PG6A 4CLPA 1RCXB 2LFVA 2ALYB 1C1BB 4NCBA 4WCEQ 5IQ6A 1MMDA 1GEHA 1H98A 2E9TA 1VLYA 4WF9Q 5ETKA 1MSWD 3TAQA 1HW8A 4ECWA 1RZMA 3OUYA 1CJVB 3NP5A 2WBRA 3CNQP 3NS7B 2FUG9 1B7FA 3OFGA 1CQMA 3M9MB 2MMYA 1KRPA 3GJSB 4OV6A 3GFHA 5L46A 4JI6F 2DTJA 3Q8RB 1U49A 1IM4A 1SBRA 5KG1A 1RA7A 3R7SB 2RQCA 3PJXA 5JVHQ 5DLFA 4ZVEA 5I42A 2J0XA 2HZAA 5D15A 1I94F 1FD2A 3D6HB 1GXTA 1CLFA 5A8RA 4USMA 4KH0B 3AD9C 2J6UA 5HQLA 1HQEA 5E3PA 4CCHA 5MLCV 3MMCA 4DPUA 3M8PB 1ZPVA 1KLNA 2HAFA 2VG7A 5IT0A 3MECA 4RW4A 3CDWA 1UW9A 4F0KA 5A2QU 3AQOA 1PILA 4IG3B 2LXIA 1OWXA 1RWOB 3LO3A 4F4KA 5EGYA 1TK5A 2HFVA 3TJ9A 2MKJA 2DGXA 4V1Ak 2PC6A 3N6NA 4JI0J 1DQ8A 3Q22A 4M5MA 3NKYA 5G0RA 1A7GE 4OI6A 1S99A 2E9RX 2ZH4A 2V8PA 2YQ3A 3L4BC 5D3GA 1FKOA 2Q6CA 2YX1A 3WC0A 4M63A 3TNVA 2EBGA 2Y0SD 3G4SS 4EEYA 2RUSA 1B64A 3U1LA 5H9EJ 4KY3A 2MQOA 4CLTA 2VJVA 2N3OA 4N5SA 4CT8A 2Q1LA 1IQTA 3A13A 1GMWD 1Q86T 3VGSA 2W2QP 1NDCA 4LF4F 4KHPF 5LL6d 3R2CJ 5IT4A 3EICA 3QJLA 3LPEA 4ETXA 1IKYB 1LWXA 3A8JA 2WAQD 4O3QA 1Y11A 3N5FA 2JH3A 3M05A 4RUAA 2PO4A 4M5KA 2AJ1A 2DNMA 2FIUA 3VVUA 1X4AA 4KBIA 3MR5A 1YDLA 3FCVA 4X65F 1WTBA 4DN0A 1ZTTA 4G1QA 2QT7A 1B70B 4S0MA 2C3MA 4TYAA 3PFOA 2GCFA 3GLJA 3BGLA 2FQQB 4F0HA 1K0TA 1SXLA 3BKUA 2CPHA 3W3SA 3D9BA 2ZBPA 3R6GB 1HR0F 3RTVA 1EAYC 4B9UA 4GKJJ 1HQ2A 3PEJA 2YWHA 1FKAF 1RT4B 1X4CA 5CAAA 3BGRA 1S1TA 1EIYB 3UR3C 3VAFA 4QIVA 4A8MP 2JC1A 5LSLA 1ZM4A 2GAGC 3PW4A 4DCPB 2RF2A 1SB6A 2V63A 5KG3A 3T9NA 1HBUA 2WVFA 2E7XA 4FYVB 4L6V3 4Z7YA 1S1VB 1JWWA 3KLGB 2Y1RI 5DGBA 5GAEU 3BM7A 2J9DE 3BREA 3IWNC 3OBIA 2OD6A 3CD0A 2GHPA 3NCRA 1VQ8S 9ATCB 1XR6A 4KH1B 2L08A 4DEZA 3LP1A 2W7OA 2E5IA 4XPCA 3IG1B 2HNZA 4ATNA 1N56A 2R7QA 3BN7A 3TUJC 4WP9A 1L3KA 2QFJA 4ZVFA 4YUDA 1LEOA 2YKAA 4Y00A 1KFSA 3VZHA 2W8LA 2XI2A 4KPYA 4OHXA 2FJVA 1WJ9A 1X8DA 3AA8A 1SL0A 3DRYA 2HNYB 2GO8A 4O0NA 1XMQF 2F4FA 2YNFA 3S8SA 4UUWA 2VBWA 1JK9B 4DSKA 5AE1A 5FDLA 2O1PA 4B3RJ 4JI5F 2UVWA 1Q8BA 1U2RA 2MKKA 4WKYA 4IFYA 1RP5A 2BACA 4WBFA 5CH7B 3EGWB 4J9LA 4DF4A 4LRFA 2MB0B 1T9TA 1ZOTA 1O0PA 3BQ0A 1Y9OA 4X62J 2QLFB 2OKQA 1NSAA 4USJC 1S57A 3KG1A 5B0CA 4HHJA 5AXNA 1GQEA 3TVYA 2VB6A 5KFMA 3CWJA 4K2XA 3SXLA 2RQ4A 3QIPB 3CULA 2GA7A 2JEGA 1RT3A 3W5XA 3FEXB 2Y1LB 1A0OB 3S1TA 4JB8B 3AHPA 2VV5A 3QPIA 4KKOB 2IRYA 4U7CA 2GIFA 2YX7A 3KJQB 4ZLJA 3VAJA 4AXJA 1RQ0A 4JI0F 3DNCA 2MKSA 4W4MA 4U8VA 3QLHA 3MR6A 3GJRB 2H48B 5LXRA 3TQ1A 1HPZB 1GMWA 3KFWX 5IOLA 2QLBB 3CW2C 1DLOB 3BB5A 4USIA 2WRMA 3EVOA 2MTLA 5LSOA 3R6LB 1MU2A 1D9FA 4I67A 4FNHA 3JSYA 2UUTA 3DGPA 4P72A 5KFPA 2QL5B 5C42A 2VA3A 3HHNB 1IKXA 1RBAA 1VS3A 3NGUA 2W9BA 4ETZA 4EYIB 1Q16B 4M5LA 2VL1A 3R1HA 3H90A 4DLEA 4I2PB 4H4MA 1UWBB 4YR2A 4DPOA 1BE4A 3UNGC 1LW2A 1U2CA 4L75A 2FZKB 3QSYB 2GIQA 3HFKA 3M8WA 3U27A 3A3NB 3Q8UA 2HQ3A 2ZH9A 2V4JA 4WU3A 3SI8A 4CH1A 2LKZA 2QMUB 1F2HA 3I55S 2ASJA 1WC0A 1VQ6S 3N28A 3OJSA 3H5YA 1F60B 4ZLLA 1RHRB 2EWHA 1UAWA 4Q8EA 3WIUA 2LEAA 1TMJA 2FLOA 4O23A 7AT1B 2I5JB 4GKJF 4RO0A 4A8WA 4USWA 4MYTA 1NDKA 5F8GA 1BWEA 2HG4A 1CJKA 1E6VB 2UXDJ 3G6VA 2JEJA 3OHBA 1LWFB 4CM0A 4O3OA 2FHKA 2VICA 1XNRF 5KG6A 5ETMA 4LQ3A 2NSBA 4EBDA 4RNHA 4X4RA 1KS2A 4LSNB 1TL1B 2UUAJ 1DTQA 4DPYA 3D66A 2L3MA 3FMBA 3R3TA 3PEHA 3DLKB 1NJXA 5KFGA 4K4VA 2CQPA 5GADI 3VQTA 3KNGA 4X4VA 1GXLA 2IA0A 1KC8T 3CD7A 1LKZA 2QGFB 3K17A 1S6UA 3ENVA 4XDDA 2HBZB 5A76A 5DDQC 1DZ5A 2V8VA 3HJFA 2XMJA 5KFSA 4K4SA 2W01A 2QV6A 1AB8A 3UPFA 1P9YA 4DPWA 4IG3A 2MQPA 4NLTA 4LRAA 1RLDA 5J2QB 4DQIA 1UW4A 2DB1A 2K3IA 3NCPA 5K14A 3QFHA 3K58A 3MEEB 2B5JB 2M3DA 4OI4A 3D54A 2EKNA 3HZEA 4C9DA 4FYWB 1S48A 3G82A 4I0WA 3UWTA 3TUIC 5A8KB 4OYBA 2BEFA 1T8EA 2EKYA 3M8YA 3T3FA 2GVZA 3NGTA 2MJNA 1RACB 3RW7A 1TKTB 2W7PA 3N4WA 2X1BA 1WD6A 1N52B 3NY0A 3MI7X 2HKEA 4B3RF 3MM7B 4QU6A 1HYSA 1N54B 3NNAA 4ECZA 5D8HB 1APSA 1HHQA 3RBXA 2DCUB 2NZCA 4W98A 4DR5J 2VKZG 2ZZNA 2EVZA 2JVOA 4PYAA 2RMLA 3GPAA 3BSCA 3U02A 3HF5A 4TKTA 2B6AB 4KQZA 9RUBA 1NJZA 4NL5A 4OI1A 2FVCA 2HHQA 1PYSB 3JYTA 3I4PA 3GIIA 1IWAA 4WP3A 1N88A 1VQOS 4NEYA 1T03A 1PKUA 3E01A 2MQLA 2AYGA 3D0IE 1AXQA 2OPQB 2FHOB 5J2MA 2KXHA 4DR6F 1RAAB 2RQMA 3QGIA 4FYYB 4OL8A 2DNNA 3TX0A 2B9EA 3N9UC 5HMZA 4CTAA 4QIGA 4BC7A 5K20B 4E98A 3RUBL 2LEBA 5AXMA 4RNFA 1FXDA 4OYAA 1RT4A 2DT9A 1B3TA 3FJ2A 1WOOA 2R2SA 1U0HB 4UY85 4YQWA 2DNOA 1N48A 1WC1A 4M5DA 4C48A 2VPZB 4TLRA 2QMWA 2ZJQQ 1X9MA 3HHLB 2U1AA 1E6YB 4E0DA 3P8BB 4IDKA 2MZRA 4IOCQ 4GKKF 3M9OB 4I6WA 5ETVA 2B9XA 1ITPA 3CDBA 5D77A 1N5YA 3UI3A 2V68A 2VG5A 3OTOF 4CLWA 3C15B 3W5YA 3FRYA 1PO6A 4I64A 2NZ4A 5LMNJ 3ADAC 4Q5VA 3THPA 3CCRS 3FQKA 1FFGB 1QVFR 3M6VA 4F4WA 2KU7A 4JBCA 1I6JA 3O1LA 3V2UC 3IG1A 4QIFA 4GO5X 4PZVA 2RDJA 2X1FA 2ASDA 4OYXA 3EVMA 2KKHA 3GJQB 3T5HA 2UUBJ 4N8NA 2R7VA 3MM6B 3W8PA 4ZPAA 2PMZD 2BQ3A 2EFGA 3DLEB 4OZJA 1AYEA 2CWKA 2YKQA 1RXOB 3M7VA 2X3GA 1LFPA 3CJRA 4GMKA 2UXDF 4ZPWR 2VIHA 2ATLA 2GVDB 4IRCA 2RILA 2WHOA 4DR3J 5U47A 3V81B 3QT5A 4R8UB 3GIKA 3UE2A 1UVLA 2ZM6J 2V4QA 1X0FA 4PQUB 4ED8A 1UJ6A 4NZ7A 1OPZA 2ZWPA 2XGPA 3HHLC 3FCWA 3FZ2A 3GCXP 1HBOB 2LQBA 3MDFA 3QZ8A 3ZZPA 2VQEF 3US5A 4M95A 4DL0C 3TYTA 1UFLA 1FKPA 3D5MA 3IBFB 4ANEA 1PBUA 2HHSA 2CQIA 4J5OA 1RT5A 2MY8A 4CLYA 4QWCA 2Y3YA 1IUJA 2C42A 4QZVB 4LSLA 3ZO7A 1WTFA 1RHKB 4FF3A 5I3UB 5EX0A 1Y4ZB 1SV5B 2R7TA 3OXLA 2ADBA 2V8GA 2V2VA 4DX5A 2AGOA 1HPZA 1H2VZ 5I3QA 5KFQA 3EGZA 4JV0A 1S0NA 4NCAA 2QL7B 2K7KA 5LJ3Y 2HW3A 3CJQA 3T5JA 2MPUA 1VJWA 2BX6A 3WHIA 5IZHA 4EZ6A 1R0AA 3LGMA 4NI2A 2AGPA 3ETMA 1ZAWA 5FLXY 3KKFA 2HHTA 4WFXA 1ZZNA 4EZ9A 1TV6A 4HLBA 3WZ0A 2EW9A 5A8WA 2BQUA 4AE5A 4KV8A 1QUPA 2PI4A 1Q79A 3KK2A 4ZCIA 3JQKA 1SC3B 2XMUA 4ICLA 4PYDA 4OJGA 5ETTA 3BKTA 4A8YA 2CPXA 3P5BP 2O66A 3DRSA 4ZLPA 1NKEA 3PIOQ 1RAFB 2DIUA 3PIPQ 2BUNA 2DNLA 1VI7A 1IKVB 3PY8A 4HT7A 3UDCA 1NK8A 4CLZA 3LW5C 2DGOA 2WSCC 4EBCA 2IM0A 1DARA 3OTDA 2VFUA 3UD4P 2XSJA 4YB7A 1HWIA 3JTNA 3H7HB 4FN5A 1VIXA 3BQ1A 4ZN1A 5KG4A 2ZJPQ 2WONB 3MF5A 4OX9J 5KOXA 3ENAA 4BWMA 2YVSA 4L74A 4C11A 2M52A 3DOKB 1LWCA 3BGFA 2G1HA 2ZVIA 3JXOA 4DPXA 2ZHOA 3TUPA 1HBNB 1RAHB 2NPFA 1ZTWA 2R8GA 5F8MA 4USUA 2VC0A 1Q1KA 3CMAS 1G6BA 2GS8A 5FD1A 4IOAQ 5AE2A 4JI2J 4EO8A 2VHGA 3NG8A 5E33A 3VAIA 3T5KA 2L9WA 2YXLA 1WC5A 1PG5B 3AB2B 1TKZB 2DPIA 4QJVA 1SKWA 1RT1A 2DXDA 5DJBA 3OFEA 1JJ4A 1GK8A 3I9ZA 3DLBA 3HSZA 1JLGB 3MUVP 1IM6A 3GJTB 3TA2A 2MHNA 2GC8A 1S9FA 3CXCR 3P45B 1GMUA 2BMBA 1CPZA 1RU1A 2V6AA 4QPXA 2BVZA 2DHGA 2AIRB 4Y65A 2K06A 3PX4A 1S6PA 3DLGA 1M5SA 3C19A 4ILRA 3F56A 2EEYA 1JLFB 1NKBA 2N7CA 1NM2A 2CQ2A 4DSLA 3Q2SC 4KC5A 2R2TA 4DG1A 1NO8A 3UR0A 4BWJA 4ED5A 2FVQA 1UMJA 1C4AA 4C8NA 1S7IA 1PYTA 2K8GA 3TJAA 1AUDA 5LXYA 4WK1A 1JLEA 2VBZA 5IS2A 1I1GA 3BO2A 4PG4A 2JFKA 2RRAA 1R3NA 4DR3F 2VODA 3OL8A 4LMZA 3OJUA 2ZM6F 1SJRA 3KJVA 1G3OA 3IM8A 3V4IB 3EGVA 4TU9A 3MFIA 3QT6A 4X4NA 2YQ0A 4I2QA 4WK3A 2MQNA 2Y8YA 4IG0A 2G4BA 5A0YB 3TAPA 1N34F 1R8PA 1HI0P 1WF0A 1P8GA 1LQ9A 1QE1B 2CQCA 5IT9U 5KFWA 4LF8J 4DZ6A 4PG8A 3RU0A 3CC7S 4WPAA 4WWSA 5LM7E 3OLAA 5KFLA 5KG5A 2ILYA 5B0FA 3CJKB 3VAKA 1KHVA 3G8SA 1RT6B 4OHWA 1UP1A 3MMJA 1TAUA 1K44A 2AJFE 4I7FA 4DI6A 2NSCA 3DOMA 2F65A 3FVYA 3AD7C 3C16A 1L3SA 5C2CA 1C4CA 1ICEB 4F36A 1HI1A 1TAQA 3JSRA 2VFSA 1AT1B 2IBOA 3DI6B 4LR8A 2XO7A 3GQCA 3W62A 3BKFA 1TU0B 1WKLA 2M88A 1RDRA 1D1UA 3EZ5A 4ZA1A 3HXMA 3TARA 1BQNB 4TYBA 4B02A 3OSPA 5F8NA 1N8RT 1U0HA 1FJGF 5KFBA 5JVGQ 5C7PA 3NXZA 5DDRC 3FUYA 1UVNA 5HBMB 5B09A 3GV5B 5L38A 1U45A 2YNGB 2B4UA 4CWBA 3AQPA 5FLXU 1UL3A 2NYHA 3P96A 5HP1B 3CJ5A 2KRRA 3ILLA 5ETRA 2WCXA 1VRTA 2KVIA 2DNZA 2HQGA 2F4VF 1T05B 2A10A 3GE9A 4RWWA 3CD5A 4DV5F 2P9EA 2W2MP 2FC8A 3HZGA 4A48A 2UVUA 4Y2IA 4ECYA 3N6LA 2R7OA 1EETA 3VQSA 5AE3A 3M30A 3KHRA 3DRRB 2OPPA 2WW4A 4OI3A 1IBCB 1SIZA 1LNQA 5D0EA 4CLSA 4ZN3A 1VQ4S 1U0SA 3ZC4A 4G1IA 1LOUA 4NLWA 1H2UX 2A0FB 1FF2A 3TVKA 2V5HG 3NMAA 2WOMA 4B3MF 4FYDA 1HBMB 1TVRB 4HHUA 1RADB 1ROFA 1WG4A 4ZVRB 3T1HJ 3MM5A 3LA0A 3SCJE 3LUYA 2GQCA 3MEGA 3WX4A 2V0NA 5HATA 4JI1J 3V81A 2KHDA 3AY0A 4Z37A 1QJHA 4UY8T 4CH0S 1FE4A 2KI2A 4JI2F 3W61A 4DFPA 3A8EA 1XJWB 1WG5A 2V8HA 2LQ5A 2VOOA 1OSDA 3JTOA 1TL3A 3Q8PB 4N41A 1RKJA 6FD1A 1YTYA 4O4GB 1YK9A 3OSNA 3O44A 2OMOA 2E1CA 2Q43A 4DHVA 4DV7J 2VKRA 2XMTA 1F3FA 5I4MA 2NXCA 1X4GA 4RU9A 2VZ9A 4RJVA 3CJ0A 4LVNP 4NYOA 1FTCA 3PYFA 3ZZYA 3HFZB 2W9CA 2OI2A 1CULA 2VPWB 3DM2B 1G2EA 5L1IA 1RJJA 4CLUA 1UWAA 4HYKA 3AB4B 2VOPA 3HSDA 1IBMF 4J7CA 2YPZA 1NZAA 2ZDOA 2YNIA 2EPIA 1P1TA 4RW9B 1O6XA 3RAQA 4CNZA 4J37A 4ZITA 2BKPA 3GFZA 4AQYF 3U1MA 5D4NA 3NMRA 2E1MC 5ETNA 1T9XA 1S1WB 1XWLA 4ZVHA 3HX9A 4EYHB 4CYUB 2D3O1 4B17A 1QUVA 4PRFA 2HMIB 4A47A 1NDPA 3GWCA 4NE9C 4RNMA 3RAXA 3QYYA 1T11A 3LP2B 3GU0A 4Z7CA 1IBLF 4YP3A 5C25A 2F40A 3TZXA 1S1UB 4OZ2A 3MXHP 1FDDA 2OPRB 1CJUA 4HH1A 3Q0AA 1HW9A 1BLUA 3W9JA 3Q8VA 4ES3A 3NS5A 2MSTA 2CPYA 1N6QA 5HL7Q 2Z2ZA 4NRTA 4RW8B 5HQMA 4DF8A 4IOBA 4NYZA 2FLLA 1R6YA 1Q5VA 1NNDA 2FHJD 1T0TV 3U7JA 1U02A 5E0OA 3BS9A 2ZE2B 5D0RA 2YY3A 3M1VA 6AT1B 2YTCA 3KHGA 3QAUA 2APOA 1V6HA 2OGUA 1TKDA 2JZ5A 2CUYA 3AAWB 1Q81T 5CYMB 4P9SA 3UCUP 2OUGA 2YKNA 2GFFA 5HVGA 1VRUA 2BABA 5D4PA 3I5CA 3GYGA 1KSPA 1NPKA 2BJ7A 2ZBIA 4WFYA 3IWLA 3QGGA 5L1LA 2R7XA 2ZVSA 4ZCMA 4F02A 2JEFA 2AEFA 2WSFC 3BYRA 3HVTA 3L95X 5DM6Q 2YKMA 1W26A 1TKZA 1UA1A 5LT5A 1XR5A 2LYVA 2XMVA 2Y1IA 1P6TA 5T7LB 1KEKA 4M5NA 3E3XA 1YJVA 1BQMA 3IFEA 1JLCA 1O8BA 2PMHA 4FXDA 2BJ9A 4OHYA 2ZNYA 4X4UA 2ZKUA 2ROEA 2QLXA 2KHCA 3H40A 4KYZA 5HSPA 1DRZA 3LAMA 1JQGA 1VRQC 4LF1A 3JS9A 1HWLA 2CPJA 3IXQA 3MD3A 1AZSB 1FT8A 4NMXA 2WVDA 4C8KA 1IR0A 5B0EA 2QFIA 5IM0A 5JUMA 5HQ8A 2LEPA 1YJUA 5CCLA 4URSA 3OW2R 3TJ8A 2Z2YB 1QAIA 4OX7A 2DJWA 4CQ1A 3EZUA 2DD8S 2K1RA 1H6KX 2IAJB 2G0IA 4V19J 4JI1F 3OR1A 4PG5A 1H0HB 3PDNA 3IS9A 1VOMA 3LOUA 5B0AA 1SJQA 1RE1B 3SMZA 4USTA 1IKWB 3CC4S 2W2OP 3FQLA 3L09A 2MYFA 3WQPA 2QA4G 1WEYA 1MROB 4J9KA 1FA0A 1JJ2R 1J5OA 4K2JA 1SI9A 1KDNA 4GVBB 3QRPA 1N5SA 4DV7F 3GIRA 2VA2A 4DCOB 2WZ1A 4P2FA 5HMWA 2E1RA 1ZS6A 2HVDA 1RYSA 2OELA 1XR7A 3DLJA 3QIDA 3GYXB 3CJKA 2ZD1A 1B99A 4EWTA 3MAQA 3PXGa 3R27A 3EJMA 3C6TA 1VQMS 3C14B 1OIAA 4DUYJ 2IM3A 4LIRA 2W9AA 2CPDA 4ZIWA 2V50A 1EP4A 3OPKA 3NGSA 2MGZA 1BWVA 5C24B 1C0UB 3H42A 4I1TA 1S49A 4CP5A 3AJ2A 3CJ4A 4DR2J 2EK1A 1X31C 7FD1A 2QRRA 1SH0A 4AXIA 1NRKA 2D1CA 1YRTA 4ZJLA 1SJ1A 2VG6A 1FE0A 4YY3J 1JJCB 1YSJA 4DN9A 3QWPA 4NLGA 2G9OA 1R43A 1KD1T 3TA1A 4TQRA 2BOAA 3CF5Q 2H1YA 4R5PA 3G2XA 5HP1A 1MWZA 1KFDA 3PRDA 2CZVC 3VVTA 1OJ4A 2L9DA 3M4XA 1SCJB 1KLMA 2FHJA 2HZVA 1FO1A 2QIFA 4FZVA 1AA1B 5DZ6A 1O51A 3AA9A 5KFZA 5AXKA 1LV5A 1X4EA 4USKA 1R27B 1NPRA 2E7WA 3VAHA 3FSXA 1TL7B 4ZJQA 2XSFA 3CCUS 3MCNA 1YKWA 1XMBA 4OJ3A 4Y28C 1N32J 4TNOA 1D8ZA 4UTGA 1Q0NA 3SCKE 1GNKA 1DHMA 3C3LA 3MM9A 2JJ4D 1P9QC 2LLZA 2M7SA 3D1HA 4U7UD 2DR7A 1FRJA 1YZ7A 1HBMA 3BBCA 2D41A 3CVKA 4OI0A 4NWBA 1FXLA 3FFIB 3OVSA 3GSIA 2CQ3A 3HVRA 4IH7A 1KQGB 1WHXA 3OTEA 2DR5A 1XBWA 1TMMA 1LWEA 2KRBA 2C2KB 2JC0A 1D8YA 1RTIB 4RW7B 2UU9J 2LU1A 1AUSL 4B3SJ 4GRSA 5DLGA 2Q79A 4TN2A 1RU2A 3G9CA 5CYQB 4ZCKA 5EN1A 5SUHA 1T9WA 2NS1B 2W4DA 1N5QA 2CNKB 2CRLA 3KDNA 3T19A 1SPBP 2ROGA 3K2YA 3HI9A 1U47A 2AMCB 1FESA 2QZ8A 1U1PA 1U1MA 2X3DA 4X84A 4HR2A 1U1LA 2B7BB 2DITA 1YRXA 4MK8A 4ZS6A 3O2IA 4AT1B 4X4SA 1TELA 3NGRA 4NXMJ 1SJ4P 1PAUB 5KT3A 1REVB 2GW8A 3UN3A 4HL9A 3B54A 2FGOA 3FBCA 5J2PB 4KO0B 2OD4A 4OQJA 4FNIA 2PIIA 3QMQA 1CJTB 2N4CA 1HNIA 2CQ1A 4RL1A 3KK1B 1Q8IA 3N01A 4DMZA 4XK8C 2A6MA 4RBTA 5IWAF 3TO8A 1S0VA 2ZEJA 4L72B 1Z2ZA 3KXDA 1S4EA 2BE9B 4XDCA 3LP2A 1C2PA 3MCSA 3TQEA 3R5DA 1F6TA 4QR1A 4QCLA 3DDNA 4DFJA 2IA6A 2I9SA 1JKHB 5HN0A 3UD3P 1DQAA 1N36F 1UJ5A 1LXJA 3IMQJ 4LF7F 3I9V9 3KJFB 5L1KA 3SDEA 4UQTA 3CCMS 2IJFA 2ZUGA 2G1DA 3OR2B 1PIEA 3MAAA 1WI8A 3M2VB 2BKOA 3OFHA 3QSIA 2D3ZA 2IIHA 1FJ7A 4P7TA 3VR1A 3T1YJ 1FRXA 3ZFVA 3H4BA 3T9ZA 3R5GA 5DQHA 5EWGA 3DU5A 3CO9A 5LMUJ 3KG0A 3EYZA 2PA8D 3T6BA 1S97A 2FLNA 5CYMA 3MURP 3Q23A 4ZHRB 3CO0P 3K5MA 1FRIA 2RD5C 4M5HA 1VBYA 2JL9A 2Z4PA 4LF5J 2OPSA 3C8YA 4LF2A 5T14A 2PSZA 5LOQA 4B9NA 1R89A 3GILA 1X4FA 3MR7A 5CZVA 1EB0A 2IVMA 1RTJB 2CQ4A 3VGUA 3X3UA 3NRBA 1ZH5A 2LP4A 4NLPA 3DXBA 4J9PA 3MOZA 2PI5A 1U1KA 4C8OA 4DX8H 2JHEA 5KFOA 2ZH2A 3UFCX 5EDWA 1UVMA 1SKUB 2D7SA 3F73A 3M6UA 2L9NA 2XHCA 3CCES 3ZZRA 4BBYA 3KMSA 4F2SA 2PD1A 2QSFA 4HEA9 1KVJA 1YJWS 3NGKA 2AGQA 3VTIA 3JSMA 1N32F 3DYAB 4MTPA 3KLEA 2BM1A 2JWNA 1Y7PA 4P2XA 1KVIA 2CKWA 3V6DA 1UZHA 3CD6S 5HJXA 1B0PA 3THVA 2UUCF 4PWWA 3HKZD 3ICLA 4I56A 3WIVA 3M2RA 5F9LA 5GMEA 3D4JA 1N5TA 3KDOA 2DYAA 4M5IA 2E5LJ 3UQSA 4DUZJ 3HMJG 3BZQA 2DGSA 4TY8A 4OLOA 1RHJB 1JLAB 2XLJA 1JNRB 1HQUB 2FGCA 1SH2A 3NCQA 4YR0A 1HNZJ 5DQIA 2OAUA 4NLDA 1F9EB 1WDTA 3MMBB 2W1BA 4MAKA 5J2NB 4F7VA 2QL9B 2CJYB 4OI2A 4UW2A 4EU0A 2GJFA 4CZCA 2EFOA 1FX4A 1XMOF 1UFKA 4MIWA 3MFHA 4B3SF 2FJBB 4IR1A 4ZPTR 4IH5A 4CO5A 1V3RA 4LFAJ 1TKXB 4NEZA 2JEIA 2XYHB 2DRAA 3SFGA 3FC9A 2MZSA 1HMVA 2MKIA 1NJIT 2BANA 4DFKA 3HJVA 2I6WA 3ET6B 1NMEB 3CEDA 2ASLA 4OZ0A 1TL4A 3TA0A 4LF9J 1S9GB 1UEKA 2QMXA 8ATCB 2F9DA 1HI8A 1CQNA 4ED2A 3LWMA 2F8MA 2HSEB 1W2BR 4DR1J 2QSWA 4RR5A 2WB1D 3W2WA 4LR7A 1UZDA 1FK9A 3RB6A 3PJWA 1YVFA 1TUWA 4ZPCA 1R8HA 3UDLA 4DV3F 2B4PA 2MQ8A 2CPFA 5GMKa 3EGNA 4K4XA 1VQ7S 1RHQB 2GQ2A 2YKPA 4QBUA 5DG9A 4MMOA 3WX8A 4BCAA 1U1RA 4LVOP 1SKSA 3BF4A 4F3QA 1WKJA 2UXBJ 3R5JB 2MLZA 1FNOA 1XIQA 3HT3A 2GNKA 1SQGA 3FBEA 4F3OA 3IM9A 2MDAA 1RI7A 3NNCA 4WTYA 1ZM2A 1VC0A 4Q0BA 1NHUA 4JYAJ 2J7UA 1U26A 3ISND 2XZWA 4JV5J 2J9CA 4HTJA 3OL6A 5CABA 3CDAA 4ES2A 4NLSA 4DV2J 1CC7A 4WTOB 2HRUA 1U09A 2DEIA 2DXFA 4B3TJ 2IC3B 1EKSA 4FS1A 1URRA 3R5BA 4IFVA 3RW6A 1QAJA 4QW9A 3IBCB 1K0VA 1L3UA 2BM0A 2OSRA 3NLCA 3EPGA 1WSRA 1RT7A 3TAMB 4AD6A 3CJ8A 2PE8A 2IPOB 4O44B 1S9EB 5E5NA 1CS4A 3D6FB 5BYQA 1YJNS 2XNRA 2RT3A 4QW8A 2ZH6A 4ELVA 4PCQA 4LBIA 4JP8A 1OYDA 2DRBA 2G2ZA 2GX8A 4C0HA 3W60A 4KGZB 2QEXS 5B0DA 1Z1ZA 3T6JA 1R8AA 3MR3A 3UNYA 1NK9A 2IJRA 1F2GA 4ZVPB 1HWKA 2DEJA 2IRXA 2W25A 2DNYA 2GMJA 4X66J 1QDUB 2K3KA 1FXRA 3ENWA 3Q2TC 1FHTA 3GB0A 2IYIA 2AJ2A 4TXSA 3M32A 2RKIB 2JDJA 1Y3JA 1YBUA 3AFGA 3M6WA 4KE5A 3SQOP 2KL8A 3IR7B 1X4BA 2XZTB 4H54A 5HLFB 3PX6A 3X1LB 2ZWOA 3RBZA 2NLWA 3W66A 4B9MA 2H3EB 2HPUA 2C22A 1U6ZA 2BV3A 1VC6A 2YNHA 1XNQF 2ZFHA 4C8YA 2IDLA 4WXOA 5EX3A 2SXLA 2I0XA 4ANCA 5B0GA 4NLRA 2IY5B 5AT1B 1Y5NB 4PQAA 2DNQA 2MKYA 3OT9A 2MXYA 2B9WA 3KLFA 2C2RA 1CG2A 4DV4J 3J81Y 4U6PA 3I87A 1U1NA 2RAQA 4K4WA 3BGUA 3J7A1 1MN9A 2ACYA 3LP0B 3VHQA 3QATA 4NLOA 5GADU 1K1QA 1RBLA 3GV8B 1T7PA 1WWHA 3GIMA 1EQ0A 3L7PA 2LA6A 4RZRA 1T02A 2BE2B 4ECQA 2JNJA 3PG9A 4NCGB 3ITHB 4MFBA 4TY9A 1NLKL 3KNAA 2GAHC 4WFZA 3PR5B 4KFBA 4NASA 4A8SA 2DR9A 3EXYA 1Y3KA 5CYJA 1C1CA 2H54B 3BR8A 3MMAB 4O4RA 1HNWF 5HO4A 3FMWA 3OXGA 4ZHRA 2J7KA 3K89A 2Z0GA 4U8YA 2M9KA 2MSSA 2ILZA 3H5UA 2G2YA 2D3OR 2H9ZA 4PAAA 4LFBJ 2LU2A 1JJHA 3B78A 4Y6IA 4NZ6A 2UXBF 2C28A 2RDDA 2HLTA 2FZGB 1XK8A 5K8PA 2HIYA 3TP2A 5KFAA 1PJ7A 1DURA 2FD2A 3NAIA 3UVJB 4F4ZA 3ZZ0A 3G6XA 3LGNA 2IDEA 3KK3B 3KLHB 3IN5A 1VFJA 2QC3A 2ABYA 1LW0A 4DQSA 2F8HA 3ILJA 1VLOA 3Q86A 3TR5A 5CXTA 4M5GA 3N79A 4LSZB 3ZTOA 4EGLA 1MLAA 3M8QA 2DCLA 3AXMA 2AKWB 4KHRA 1NU4A 3MCMA 4M8LA 1UJ4A 3TRGA 4GVLA 2ZH1A 4YDDB 4B3TF 4E8UA 4F04B 1OY9A 4FF4A 3MD1A 2E44A 2IHR1 4YHHJ 2HK3A 3K8WA 3CCLS 1EJ7L 2DO4A 2PEHA 3OVAA 5HROA 4QOTA 3QT8A 4HH0A 1SUQA 3FEYB 3BGOP 1S1XB 3NBPA 1JLAA 4QYZK 4EFAC 3QRQA 5IQQA 2CJAA 4LBHA 4LF6J 3PW5A 2HFOA 2HBQB 2IYGA 1A9NB 2MHEA 1NCLA 1PJ5A 3PFEA 4J9QA 3KUGA 5F9NA 1MMLA 4RW6A 2ADCA 4FDFA 2D74B 2X51A 3OL7A 2AX1A 2HLUA 1FFSB 1RWMB 3HT0A 4A8XA 2C2ZB 1Q8KA 3PV8A 4ECTA 3LF0A 3C6UB 4WP8A 1TKXA 2PA3A 3O6QA 3GIJA 3P3DA 4C98A 2BOPA 4Y0FA 5KFVA 3GTYX 5E3QA 2AZ3A 3ET6A 1ELOA 2DNGA 4J9SA 4PWDA 3SQGA 4DR7J 1VMBA 4ILMA 4DL3A 1X9SA 1DTTB 4LREA 3OTBA 4HDGA 5KG7A 3PTWA 4CLLA 4K4TA 2W4CA 1ZA1B 1ZPWX 4ELUA 1RT2B 1ZZFA 2MQMA 3M2UA 2HHHJ 1RTDB 4D3HA 2V34A 3QT7A 4DSJA 3HSJA 2J76E 2GHWA 3H5XA 2HNDA 1ZAXA 1BY9A 2W24A 3EZOA 1WELA 3IA0A 4DS4A 4IKAA 2D9PA 2CWXA 1F9FA 2A1BA 1KQSR 1HD1A 3L7OA 1HKAA 2MKCA 3OUYB 5K8NA 3SEOA 2HWHA 2OFHX 3I5BA 3HPOA 3UDEA 1FEEA 3CJ3A 4EK2A 2E5HA 2CPZA 1S77D 2HVZA 4HACB 5K5MA 1GH8A 1S6QA 3V6JA 3C46A 2CIMA 2MEWA 4MT1A 3VAGA 2HEKA 4DV4F 2DR8A 4ZPVR 2VF3A 1YZ6A 1U7LA 4C97A 4JUZA 1QD1A 5I42B 3PW0A 4UF4A 5M2RA 4K5SA 3HCXA 2A6OA 2M8HA 3DRXA 1VQNS 1YG0A 3J81U 5A8RB 2POKA 1NK7A 2L48A 2I1RA 4F25A 3HM9A 3FNNA 1S4FA 4DJBA 3JQJA 3MMCB 4RUCA 5KTQA 4URQU 3A1YG 3IRXB 3QRRA 2VG7B 4PEOA 1YJ7A 3MECB 1C1BA 4NLXA 4RW4B 1AFIA 1BD6A 4ENOA 3ONQA 2AW0A 1RKIA 2EFVA 5GVQA 2ZOGA 2XWYA 4LJMA 4FPIA 4WIIA 3MEKA 2AQ4A 3TAMA 1CJVA 5G0RB 3CCVS 3GONA 4OX8A 2Z30B 2GJIA 3ZNJ1 3DHWC 5M2UA 1PYOB 4DQRA 4OYOA 2C2MB 5D3GB 1FKOB 2RH3A 3ZNUA 4GO7X 2EBEA 3VALA 4C2MA 4DSEA 4MKYA 1BQXA 4IRKA 1AFJA 1R7IA 1D0EA 2HGLA 2J5AA 2C1EB 7FDRA 4YEAA 1JLQB 1KTQA 4NLVA 3EDQB 1FI4A 3POTB 3VF0B 1BHNA 4ZMMA 1XN9A 2YWFA 3RAMA 2RS8A 2J0WA 3GP9A 3DGVA 4U95A 2COLA 2B43A 3RG6A 2C2OB 3M8PA 3BEGB 1HA1A 2KT3A 1D9DA 3GFXA 1MWYA 3PHEA 5HVFA 1UA0A 2KH9A 2HWIA 2IVYA 2O3DA 2C3OA 2VQFJ 1FWPA 4G1QB 4OYMA 4DS5A 1F5CA 2W4PA 5HLFA 4UZBA 4OLPA 2GJ2A 5F3TA 1N0VC 3GG0A 4DV0J 3DDIA 4YHHF 4CNYA 2IM1A 5HAOA 2XB2D 5T41A 4TU8A 3TEHB 4HDHA 4KB7A 2XS7A 3QQCD 4G65A 4OMFG 5IXUA 3GV7B 2YBVA 1PJ6A 2KYXA 3CT9A 1KP6A 2V4RA 1Y5LB 1OO0B 4LF6F 1X7VA 2CJKA 5ADZA 2I8EA 2VASA 3QFWA 1NK0A 3BGRB 4JI6J 1S1TB 3IP0A 4JI7J 2WB4A 4MKBA 3FK4A 1IKYA 1R8CA 1NDLA 4X62F 1NKCA 1VBZA 3W5ZA 1I94J 3UN5A 2RF2B 3PVXA 1HBUB 1FVSA 2Z57B 4P2SA 3H2UB 5EWFA 2V2KA 2IJNA 2BE2A 3MHYA 3T1AA 3CCQS 4P2MA 3CCZA 2UZAA 3ITHA 4PKDB 1RAEB 3FDSA 1M5OC 2XO6A 1Q78A 3ZZOA 2W8KA 3SSRA 2HS3A 2JSXA 1ZETA 1ZA2B 2BA9A 2EG2A 3LP1B 4ILLA 3D68A 1MWQA 1VQYA 1A6LA 2XMWA 4IQMA 5DG8A 3PCOB 1YQHA 4DFMA 2H5JB 2CFXA 3QBCA 4XPEA 5KFNA 2QO3A 4A8FA 2J7WA 2V67A 2CNOB 1QSSA 5AXLA 3BJYA 5KFIA 4DX6A 2KO1A 2Y9HA 4PXEA 2LMIA 3SV4A 4Y34A 1YBAA 2YNFB 1NK5A 4H4KC 2HVHA 2FZCB 3FZBA 4OYPA 2C2EA 1UPMB 3S6EA 2FVRA 4KHPJ 4PXDA 4JOUA 4G6VB 4IFYB 5KT4A 1S1VA 3KLGA 3QJJA 2E66A 2EK6A 2BW7A 2XM3A 3CUNA 2OHDA 2B8PA 1KOHA 3L9ZA 6FDRA 1NK6A 3R8YA 1FCAA 4X65J 4DXLA 2B4OA 1YJRA 3L7UA 2JRSA 2HHVA 1RT3B 1Z2LA 3PR4A 2XMMA 2XEXA 1WHVA 2CZ4A 1B4SA 3FSYA 4RBUA 3V5RA 3HP6A 1TR0A 4NYPA 1IN0A 2ZKTA 4X4PA 1SC6A 3HD2A 3TOQA 4ZK7M 3W9IA 1MW7A 2BKNA 2QE5A 2XQCA 1IJFB 3QLHB 2CPIA 2AT1B 2HNYA 3G71S 3G96A 1SQEA 1TUGB 2UVVA 5IC6B 4OZ3A 3P49B 4KGXB 3CSKA 2ASYA 2OH2A 2B9YA 1IXKA 2BJ3A 2UUAF 4ER8A 2M5YA 1MU2B 3R97A 4CH7A 2FDNA 1VC5A 4YB6A 4KJIA 5IT9Y 3DGPB 4MYUA 1IR1A 5DDOC 4XO0A 5CZXA 4F4AA 5C42B 1EZZB 1H74A 1IKXB 1LXNA 3PYGA 2W9BB 1DBDA 1MNEA 3TI0A 2FJEB 2V2QA 2DH9A 2AYBA 5KT5A 2HHUA 4N47A 3J7Z5 3QIPA 4CO4A 3PX0A 1UEUA 4YOEA 4WZQA 4J9MA 2NCKL 2OO4A 1K9MT 2R8HA 4KKOA 1NB7A 2VQFF 3CIMA 1LW2B 3NS6A 2DNRA 3D0GE 3FSIA 1RTDA 4ZPDA 3Q83A 2RVJA 2V4JB 4DV0F 2FVSA 2HFUA 4F0MA 1DLOA 2ROPA 3BBBA 4P73A 1RWNB 3RB4A 1RCOB 3VGTA 5HJYA 2F1FA 5J1PA 1TK8A 3M8RA 5HK4A 1WORA 2VUGA 2DRDA 1XMQJ 4HACA 2IFXA 1CJKB 2QYCA 1K8AT 2H5EA 4QR0A 3D1OA 2ZH8A 1FJCA 2AJ4A 4P71A 2LVWA 4JI7F 4IRDA 2CNNB 4JI5J 4OHVA 4O3PA 4C8ZA 4UOHA 4DR5F 4I2PA 5KAKA 1DTQB 1UWBA 1D09B 4HHHA
chains in the Genus database with same CATH topology
2KL8A 3D3BJ 2VQEJ 4DV7J 5BR8J 1HR0J 4NEYA 3W1YC 2MTLA 4DR2J 5LMNJ 4JI4J 4B3RJ 5A2QU 2MQ8A 3D3CJ 1XNRJ 4RJVA 1HNWJ 1FJGJ 2UXCJ 3R2DJ 4B3MJ 2KVQE 4JI2J 2UXDJ 4X64J 4DR7J 1IBMJ 4DV1J 4V1Ak 4X62J 1N33J 2UXBJ 4YY3J 4JI0J 3J81U 3T1YJ 4JI6J 4LFAJ 4NXMJ 4NEZA 4LF4J 4JI7J 1IBKJ 2UUCJ 4LFCJ 2UUBJ 4KYZA 4YHHJ 2UUAJ 4HHUA 5LMUJ 4DV6J 5IWAJ 1N34J 2HHHJ 1I94J 4AQYJ 3T1HJ 4NXNJ 4DV4J 4GKKJ 1J5EJ 4JI1J 2F4VJ 4PWWA 4LFBJ 4GKJJ 4LF9J 4KHPJ 4JYAJ 4DV5J 5FLXU 4KY3A 4DR4J 1XMQJ 2VQFJ 4JV5J 2UU9J 4LF6J 4LF5J 4JI3J 4JI8J 1N36J 2E5LJ 3OTOJ 4X66J 4DR5J 4DUZJ 5IT9U 3J7AN 4B3SJ 4DUYJ 4DV2J 4LF7J 4LF8J 4DR3J 3R2CJ 1HNXJ 4DR1J 5LM7E 1IBLJ 4DV3J 4B3TJ 3JAMU 2ZM6J 4DV0J 5AJ3J 4JI5J 4OX9J 1HNZJ 3J80U 4DR6J 1N32J 3IMQJ 4X65J 1XMOJ 4K0KJ 2MEWA 1XNQJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KL8 A;  3D3B J;  2VQE J;  4DV7 J;  5BR8 J;  1HR0 J;  4NEY A;  3W1Y C;  2MTL A;  4DR2 J;  5LMN J;  4JI4 J;  4B3R J;  5A2Q U;  2MQ8 A;  3D3C J;  1XNR J;  4RJV A;  1HNW J;  1FJG J;  2UXC J;  3R2D J;  4B3M J;  2KVQ E;  4JI2 J;  2UXD J;  4X64 J;  4DR7 J;  1IBM J;  4DV1 J;  4V1A k;  4X62 J;  1N33 J;  2UXB J;  4YY3 J;  4JI0 J;  3J81 U;  3T1Y J;  4JI6 J;  4LFA J;  4NXM J;  4NEZ A;  4LF4 J;  4JI7 J;  1IBK J;  2UUC J;  4LFC J;  2UUB J;  4KYZ A;  4YHH J;  2UUA J;  4HHU A;  5LMU J;  4DV6 J;  5IWA J;  1N34 J;  2HHH J;  1I94 J;  4AQY J;  3T1H J;  4NXN J;  4DV4 J;  4GKK J;  1J5E J;  4JI1 J;  2F4V J;  4PWW A;  4LFB J;  4GKJ J;  4LF9 J;  4KHP J;  4JYA J;  4DV5 J;  5FLX U;  4KY3 A;  4DR4 J;  1XMQ J;  2VQF J;  4JV5 J;  2UU9 J;  4LF6 J;  4LF5 J;  4JI3 J;  4JI8 J;  1N36 J;  2E5L J;  3OTO J;  4X66 J;  4DR5 J;  4DUZ J;  5IT9 U;  3J7A N;  4B3S J;  4DUY J;  4DV2 J;  4LF7 J;  4LF8 J;  4DR3 J;  3R2C J;  1HNX J;  4DR1 J;  5LM7 E;  1IBL J;  4DV3 J;  4B3T J;  3JAM U;  2ZM6 J;  4DV0 J;  5AJ3 J;  4JI5 J;  4OX9 J;  1HNZ J;  3J80 U;  4DR6 J;  1N32 J;  3IMQ J;  4X65 J;  1XMO J;  4K0K J;  2MEW A;  1XNQ J; 
#chains in the Genus database with same CATH topology
 3RB0 A;  2BDP A;  1FX2 A;  4HI2 A;  4MKA A;  2RUG A;  3HHL D;  2YX4 A;  4TLQ A;  4ED6 A;  4I6Y A;  4EMD A;  1GTH A;  2RE1 A;  3H2V E;  5KT2 A;  1B0V A;  4PR6 A;  3IRX A;  1H2T Z;  4V19 X;  4YFU A;  1RHM B;  3I32 A;  3RYL A;  5K14 B;  5K8O A;  3QGH A;  1T9Y A;  2I5J A;  2KFZ A;  1J5E J;  4Y2C A;  3VZI A;  3G82 B;  2Y1J A;  2HWT A;  3DFE A;  4ECS A;  1E6V A;  3CCW A;  1LWF A;  4CO1 A;  2GVZ B;  3J7Y I;  2HVI A;  5GAG I;  1SH3 A;  1JB0 C;  4LSN A;  3A12 A;  1TL1 A;  4ITS A;  1HFE L;  2CQD A;  4LRB A;  4TU7 A;  4CO0 A;  1JLQ A;  3WBZ A;  3MUT P;  3DLK A;  1VQ9 S;  3POT A;  1JNZ B;  1M1H A;  1HYS B;  2LA4 A;  1SJ3 P;  1YX2 A;  2XZD B;  4KT0 C;  4HI1 A;  2HYI B;  4ED1 A;  4BS2 A;  2R7S A;  4DV1 J;  3D7S B;  1S0M A;  5LMN F;  1BUX A;  2YQ1 A;  2KN4 A;  5L9N A;  2QA1 A;  1Y5I B;  2IRU A;  2O5D A;  2MLX A;  5J2Q A;  3JYT B;  4R25 A;  3J81 j;  2AZ1 A;  2LXF A;  3MEE A;  4GC6 A;  2B5J A;  5E3A A;  4C8L A;  1T03 B;  3E01 B;  1ZAV A;  1RB0 A;  2UUB F;  1WF2 A;  1BXN A;  3Q8Q B;  1L3T A;  5J2M B;  1FVQ A;  2GML A;  5A8K A;  1HLW A;  4WFB Q;  4ERD A;  4CTA B;  2QA2 A;  2HFZ A;  1TKT A;  5GAH U;  4DU8 A;  4H4K A;  5JXS A;  5D6G A;  1S12 A;  5G4D A;  2FVP A;  4QWD A;  3KTQ A;  3NNH A;  4OZ5 A;  3MM7 A;  3ZZZ A;  3DC2 A;  1Q95 G;  4CLF A;  4ES1 A;  1XNR J;  1V5I B;  2XHW A;  4XAK A;  3K5P A;  1I51 B;  2J6S A;  3BSN A;  1DFD A;  4M5D B;  2HQD A;  1OS5 A;  3KUE A;  3CB4 A;  2ZBR A;  5CQG A;  3ULH A;  4IDK B;  2XC9 A;  2DGQ A;  2B6A A;  1BMQ B;  4PUO B;  1RIS A;  1VQK S;  2RSQ A;  1N5Y B;  1XER A;  2MLY A;  1AW0 A;  2B51 A;  2VG5 B;  4W92 B;  1MN7 A;  4WJB A;  4K8R A;  2P5V A;  3BPD A;  1ACM B;  1YRU A;  4M1K A;  3RRG A;  2BXJ A;  2OPQ A;  1P1L A;  4QWA A;  3SCL E;  1WC6 A;  3CPW R;  5CD4 H;  5JMN A;  4PXC A;  4FBT A;  2CJQ A;  2PFF B;  3EUN A;  3NGD A;  2HS0 A;  3I96 A;  5B0B A;  4U9R A;  3PYE A;  4MK7 A;  2RB7 A;  4UOG A;  5DET A;  4H4O B;  3EXC X;  2BRL A;  4O3N A;  2BR0 A;  2PDA A;  3IC1 A;  4PWU A;  1Y10 A;  1YGY A;  5E2Q A;  1IWG A;  3HK2 A;  4RUB A;  2MY7 A;  1RLC L;  4ZVT B;  1FER A;  3B6B A;  2XCP A;  2V69 A;  3HHL A;  1E6Y A;  3TZW A;  2N82 B;  3ILI A;  1X9W A;  1VQL S;  4CT9 A;  3MPU B;  1J2V A;  4F26 A;  2DY1 A;  2EI5 A;  4UQG A;  4Q8F A;  3RB3 A;  2F3J A;  4KGK A;  2KJV A;  5K8M A;  2DIV A;  1VK3 A;  5ETO A;  5EHH A;  3C15 A;  3ZXW A;  3MUM P;  3KMQ A;  1YLX A;  4L76 A;  5D0G A;  4Y2M A;  4RNO A;  3RR7 A;  1F3V A;  4QYZ J;  3N5B A;  4DR4 J;  4J9O A;  3K5N A;  1F9H A;  4Q44 A;  3MM8 B;  2AF6 A;  3MAH A;  4NA2 A;  4OV1 A;  2RJZ A;  1FKP B;  5DQG A;  1RT5 B;  2HAI A;  8AT1 B;  3A8I A;  3MM6 A;  4M5J A;  4J9V A;  4B9L A;  4DR6 J;  4D3G A;  1U24 A;  1X0P A;  4LSL B;  4UZC A;  1KBR A;  2UV8 A;  5KG0 A;  2J6T A;  1PC5 A;  1J5E F;  2DGT A;  3QO9 B;  4JI4 J;  3DLE A;  4OX9 F;  1GXU A;  1VCT A;  2H65 B;  2GVD A;  3AT1 B;  5HAN A;  2CYY A;  4FKY A;  2PEB A;  5DDP C;  1RAG B;  1M5K C;  2IBK A;  2D3U A;  4R8U A;  1R0A B;  4WFN Q;  5CA5 A;  4NI2 B;  1JXV A;  3I82 A;  5E7O B;  1VQP S;  4PQU A;  1HNV B;  1Y0H A;  1TV6 B;  3M6X A;  2WTF A;  2DHA A;  1RSC A;  5KOW A;  4GKK J;  1JX4 A;  1H72 C;  5A8W B;  2HHX A;  4KV8 B;  1HBO A;  2AV5 A;  4ED0 A;  4EI2 A;  3KK2 B;  5F8I A;  4DV1 F;  4JI3 J;  3OTO J;  2VFR A;  5IV3 A;  4ICL B;  5D4O A;  2YH0 A;  4ZLN A;  1EQM A;  1LK7 A;  3DRS B;  1K47 A;  1NAQ A;  5F41 A;  2OIH A;  1TZ0 A;  5I3U A;  3D3B J;  1SV5 A;  2DBB A;  5FII A;  2M70 A;  2VDI A;  1WEX A;  2WK4 A;  5KFT A;  2VD3 A;  3TWZ A;  1Y00 A;  3D6T B;  3UW1 A;  4ZP9 A;  3R2D J;  1T95 A;  2LDY A;  3I5A A;  4K4Z A;  4RX6 A;  3MTJ A;  2XSJ B;  3P6Y C;  2FJD B;  3BBF A;  3W65 A;  2HFN A;  1IBK J;  2Z58 B;  1XEZ A;  4B9S A;  3LGH A;  5DRK A;  1VHI A;  1GT8 A;  2AJ0 A;  2KYZ A;  3FEZ A;  1UVK A;  1QY7 A;  1WHY A;  3H0P A;  1TUV A;  4C11 B;  3WDO A;  1LWC B;  2B56 A;  3TEG A;  2C3Y A;  2DPJ A;  2FLP A;  2Q66 A;  3FGV A;  4B3O B;  1WKK A;  4O3R A;  2VPY B;  1HL6 A;  2DY9 A;  2OLW A;  1RT1 B;  2KFY A;  3K7R A;  2XY5 A;  1LFW A;  4LF8 F;  1M0S A;  3J7Z T;  1IKV A;  2VQE J;  2P2C B;  3CIZ A;  4ECR A;  3QNW B;  1K73 T;  4JV2 A;  3G6Y A;  5LSR A;  3UN2 A;  2P9G A;  1VIO A;  2VJU A;  2N7Y A;  3CTR A;  2EFQ A;  3IAS 9;  4X4O A;  4XIU A;  2FYX A;  2VPX B;  2XNQ A;  2BZ2 A;  3J80 Y;  1S6P B;  2B4V A;  3DLG B;  1WNE A;  5L9X A;  3JSB A;  1GMV A;  4FF2 A;  1NUE A;  3OVB A;  2WON A;  5F0W A;  3CJT A;  3OL9 A;  2Q6B A;  1YHQ S;  3CDU A;  2H4Y B;  4R0J A;  5D78 A;  3D28 A;  1UFW A;  4A8O A;  4F4Y A;  3DOK A;  3K8V A;  2HS4 A;  2Y8W A;  4DG1 B;  1M1K T;  1HBN A;  3LWL A;  3F41 A;  4RNN A;  4ZKA A;  3DLL Q;  3UCG A;  2CXE A;  3SSS A;  1JLE B;  2RU3 A;  3E2E A;  2B8Q A;  4DOZ A;  3OXF A;  1B7Y B;  4OJH A;  4OZL A;  4B08 A;  4J9N A;  1FRM A;  4KSE B;  2HQI A;  3CCT A;  4DLG A;  3KJV B;  2HFS A;  2K7J A;  1XC9 A;  2CQ0 A;  2WSE C;  2C3U A;  1JLG A;  1WEZ A;  1N0U A;  3KHL A;  4FXV A;  2E9Z A;  4ZOS A;  3O5T B;  1NSP A;  5KG2 A;  4I2Q B;  5GAE I;  3JQM A;  2E1P A;  4ED3 A;  4DR4 F;  4IG0 B;  3OHA A;  4UOC A;  5THW A;  2R7R A;  4RUH A;  2HVE A;  1VDH A;  1ARO P;  1W25 A;  1VJQ A;  3C2P A;  2OTJ S;  3DOL B;  2KM8 B;  1JLF A;  4I7F B;  4I68 A;  4NXN J;  1NHV A;  3DOM B;  4JI4 F;  3C16 B;  3HVA A;  1VQ5 S;  1FJE B;  2D69 A;  2GV1 A;  1V3S A;  3T1H F;  3MR2 A;  2HZC A;  3V6K A;  1KVK A;  3CME S;  5B7W A;  3IGV A;  2XY6 A;  3A3O B;  1KQK A;  1B0T A;  4GC7 A;  3V4I A;  1U6B A;  5C5J A;  1D3W A;  1M5H A;  4X4Q A;  2ZH5 A;  4P6Q A;  1SVD A;  2D9O A;  2XYG B;  2NQP A;  2KT2 A;  3KG4 A;  2ZUA A;  4PUO A;  2MZT A;  2QG9 B;  5A0Y A;  4JI3 F;  1UVJ A;  2OEK A;  1QE1 A;  4MIA A;  3W7B A;  4NA1 A;  1VRT B;  2CDQ A;  2ATC B;  3HLU A;  3UCZ P;  1CBK A;  2R42 A;  2A2C A;  1H3D A;  2VH7 A;  3I6P A;  4WXW A;  3UO0 A;  5EUH A;  4Y3C A;  1RT6 A;  2KB2 A;  2RQK A;  1PGZ A;  2RRB A;  4LRD A;  1NH7 A;  1EET B;  3NOG A;  1H7W A;  3M30 B;  3D2W A;  3R9L A;  2OPP B;  3FBF A;  1O5J A;  4J9R A;  3ELH A;  3DI6 A;  4OZN A;  2M4M A;  4H4O A;  1RAI B;  3LAN A;  2EFP A;  2HQF A;  2KM8 C;  3O8W A;  4NZ0 A;  2LQ9 A;  3L3C A;  1BQN A;  3ZTQ A;  1IBK F;  1IR2 A;  1HNX J;  2GMH A;  2J9E A;  1RK8 A;  3BO4 A;  4USH A;  2Z2L A;  3LQV A;  2WOM B;  4XTT A;  2CJX B;  1FRK A;  5HBM A;  3MM5 B;  4DCJ B;  3MEG B;  2YNG A;  3B8H A;  4K4U A;  1PBA A;  2KDO A;  3N6M A;  4YR3 A;  2NXE A;  4LQ9 A;  3A4T A;  1T05 A;  3DMJ B;  4KRW A;  1TL3 B;  2BJE A;  4IO9 Q;  2KTQ A;  2CVE A;  5IV4 A;  4Y2K A;  4PXB A;  3MM8 A;  1D9A A;  1N34 J;  2ZJR Q;  1XTZ A;  1JMT A;  4U96 A;  1S10 A;  3DRR A;  5F8J A;  2GQQ A;  2PMW A;  4AL6 A;  3R1L A;  3HFV A;  5EWE A;  3LH2 S;  4PPZ A;  1TTH B;  1X5P A;  2W9C B;  2GIR A;  1HIY A;  1CUL B;  1HWU A;  4K59 A;  2IM2 A;  3QO9 A;  2AP6 A;  2A18 A;  1RWP B;  1MMN A;  1NSK L;  3O3L A;  4UUX A;  1TVR A;  3J80 U;  1RHU B;  1RWW B;  2F5G A;  2YNI B;  3I4H X;  1R6V A;  1WOP A;  2R2U A;  3DKD A;  2DH8 A;  1SKR A;  1FJG J;  3VAM A;  2UXC J;  3ZTR A;  1Q4R A;  5KFX A;  4CI0 B;  1HNV A;  3KHH A;  4NLU A;  2F9J A;  3UDV A;  2HK2 A;  1U2F A;  2RDI A;  3QWU A;  4O4G A;  3DN9 A;  2W7A A;  1SC1 B;  2LDI A;  4MH8 A;  3RBD A;  1V9O A;  1WUU A;  1RAO A;  4DZD A;  2F4V J;  4ZPB A;  3MTK A;  5C25 B;  5KT6 A;  4DV5 J;  2CVI A;  1V3Z A;  4RBV A;  1FDN A;  2BYC A;  2AYM A;  2E1A A;  2NRE A;  4OHZ A;  2G0C A;  4CO3 A;  1CJU B;  4F50 A;  1BGX T;  3DM2 A;  2X1A A;  3K5L A;  4KTQ A;  2XBP A;  4FVM A;  3R7N B;  2RHQ B;  5KFF A;  4OZ1 A;  3NEK A;  1UVI A;  1NPP A;  1QTN B;  1OY8 A;  1N6Q B;  2XMK A;  1CEZ A;  4QIE A;  5D0H A;  1T9U A;  2HIQ A;  3I31 A;  2GO9 A;  4NXN F;  4CRJ A;  4J91 A;  2M2B A;  4F4X A;  2C3P A;  3FRZ A;  4RW9 A;  2R7U A;  2DR6 A;  2J8S A;  3M1V B;  4B9T A;  1R0B G;  4F3M A;  5JJB A;  4B3M J;  4C3M A;  3K5O A;  3VGV A;  3PRV A;  1N5V A;  1S1W A;  2N3L A;  1VYA A;  4FP9 A;  1WI6 A;  4CYU A;  3P5T L;  2ZZT A;  2YKN B;  1VRU B;  2HMI A;  5BYS A;  1QVG R;  2QLJ B;  2MKH A;  4B3O A;  1TL5 A;  1SL1 A;  4WE1 B;  3OV7 A;  3BSO A;  2UP1 A;  2V2Z A;  3HVT B;  1Q5Y A;  1VGY A;  4R0E A;  1G1X A;  2YKM B;  2XI3 A;  1RAB B;  3MCO A;  4ID8 A;  2H4W B;  1S1U A;  2CJ9 A;  4NLY A;  3ETO A;  5I3P A;  2OPR A;  4RU2 A;  4BDP A;  1BQM B;  1FDA A;  1JLC B;  3MPV A;  2DKO B;  1SL2 A;  4ZDN A;  3TVZ A;  4QIW D;  1OYE A;  3BYP A;  1U8S A;  2OEJ A;  4WFA Q;  4FBU A;  4RW8 A;  3FBB A;  4ZVG A;  4ZVQ B;  2FB0 A;  1FD8 A;  2WBM A;  4DUY F;  3E51 A;  3W9H A;  3IO1 A;  3R5A A;  4C3L A;  2ZE2 A;  2AHO B;  5ITH A;  3G8T A;  3PNI A;  3EE3 A;  3JAM Y;  2BQR A;  4IO1 A;  2V8D A;  1TP7 A;  1OMS A;  4HTI A;  5IM0 B;  1S5Z A;  2CA9 A;  1IBM J;  4PPD A;  4DR2 F;  4DSI A;  3M8S A;  4AUK A;  1HNX F;  3AOD A;  1NBE B;  1S79 A;  2H5I B;  4WYW A;  1FRL A;  2DHS A;  1SC4 B;  1FWK A;  3Q8S B;  2DIS A;  4ED4 A;  1M5V C;  2DHH A;  3DCA A;  3EVW A;  2K1R B;  2V9W A;  3SZ2 A;  4AQY J;  4YY3 F;  4OX6 A;  3I0S B;  3OR1 B;  3EMT A;  3C66 A;  3IS9 B;  2GHV C;  2UUW A;  1ZBT A;  3SYZ A;  5T7L A;  4DQQ A;  1GX6 A;  4I6A A;  1F5A A;  1OY6 A;  1V5V A;  2KZZ A;  2AJQ A;  2R3V A;  3U1N A;  4HVZ A;  1REG X;  4DBQ A;  4NRU A;  1QTM A;  3BQ2 A;  2P9C A;  1IBL J;  2WVE A;  1TQL A;  3HKW A;  1WDD A;  1J5O B;  3RRK A;  2AWZ A;  2HRT A;  5D4L A;  1AZS A;  1KHW A;  3DOL A;  2J0Q D;  2ZD1 B;  2Z8Q A;  2VBY A;  4EBE A;  1RUS A;  3WC2 A;  2YPY A;  4YB5 A;  3QAE A;  3C6T B;  4A8Q A;  1N33 J;  3CMQ A;  4X2B A;  2E5J A;  2R4F A;  2RU9 A;  4AL5 A;  2XG8 A;  5J1E B;  3ZTP A;  1EP4 B;  2O67 A;  5E3C A;  4KPC A;  1QAY A;  1H38 A;  4IR9 A;  2MGZ B;  2IAJ A;  2FJA B;  1JLB B;  1KON A;  2GGP B;  2ALZ A;  3TW0 A;  3EWG A;  2CAJ A;  1URN A;  4C3K A;  2UXC F;  3K0J A;  1IKW A;  1OQ6 A;  2F63 A;  3BO3 A;  4ELT A;  1SQF A;  4E2F B;  2HBY B;  5H9F K;  1FTR A;  3AJ1 A;  5F8H A;  3DRP B;  4LUB A;  2VG6 B;  1MRO A;  4ZJO A;  2XTJ P;  5KFD A;  1L3V A;  1WC3 A;  5DM7 Q;  2UU9 F;  4N8O A;  4R5P B;  4GVB A;  3PYD A;  3EPI A;  2CDR B;  2VFT A;  8RUC A;  5BR8 J;  2OEM A;  2F8E X;  2ZIT A;  2B7C B;  2QX0 A;  4ID5 B;  5A6P A;  1KLM B;  5F3Z A;  3CCS S;  1IJE B;  3D3C J;  4U7U K;  4CIO A;  2CQH A;  2QYG A;  5MAO A;  3NAH A;  2EXU A;  3HD1 A;  2O01 C;  3RRH A;  2XGQ A;  1QSL A;  3HHK A;  4BC9 A;  3C14 A;  1OSC A;  3OD2 A;  1FDB A;  2YKO A;  2JX2 A;  3GZ7 A;  3BN4 A;  3H98 A;  1RGV A;  2J0S D;  5C24 A;  1C0U A;  1MG7 A;  1S6O A;  4NXM F;  4ALZ A;  3H25 A;  4KIA A;  1U6F A;  1W7W A;  2XCA A;  3MM9 B;  1ZM9 A;  2CQG A;  2KXF A;  3OTC A;  1UET A;  3M9N B;  4Y2A A;  4UT4 A;  2EG1 A;  4O0I A;  5KFR A;  1NK4 A;  3S7R A;  2KFN A;  3GCW P;  4C4W A;  1KKH A;  2HGM A;  2FHM A;  2ZBQ A;  1CC8 A;  4Q2M A;  2R8J A;  5F0U A;  3AH6 A;  3W63 A;  2HRY A;  1HD0 A;  2VC1 A;  1LK5 A;  5KFH A;  3DMJ A;  1F1B B;  1KWM A;  1YJT A;  2ZH3 A;  5L39 A;  1M5P C;  1YIJ S;  1LWE B;  4A46 A;  3H8Y A;  5E3R A;  1Q7L B;  4RKU C;  4YN3 B;  3MGJ A;  2CZ9 A;  1C0T B;  3G8Q A;  3LPY A;  4QWB A;  1TL7 A;  3ZZU A;  3TZY A;  3MZI A;  4W90 B;  2PGC A;  3T41 A;  2RIJ A;  1SIW B;  2HBR B;  1RYR A;  1KNZ A;  3IRW P;  1FEH A;  2P6T A;  2OSQ A;  4ECV A;  3G87 A;  3MPD A;  3T1Y F;  2X7I A;  3GMG A;  2QN6 B;  5HI7 A;  2VDH A;  4LIW A;  1YBT A;  2R8I A;  1NH8 A;  5LMU F;  2XUL A;  1HHT P;  5L1J A;  3UD5 A;  2QTW A;  1EX8 A;  3DU6 A;  1GAO A;  3AOB A;  2BE7 D;  3FFI A;  5KFU A;  4AND A;  3GG1 A;  4CDI A;  4CM2 A;  1T3N A;  3KLI B;  3JAM U;  2XY7 A;  4LT6 A;  1BC6 A;  2BRK A;  5AJ3 J;  1W2I A;  1QSY A;  4LF5 F;  1NEE A;  5HMX A;  1I3O B;  3RJM B;  3THT A;  2UV8 G;  1HNI B;  1VIS A;  4IYQ A;  4FF1 A;  4N76 A;  1NB2 A;  2MJU A;  3TUZ C;  1RTI A;  3CGI A;  1NJY A;  4RW7 A;  2DGW A;  1IVZ A;  1UKU A;  1UCN A;  3D0H E;  3PJ9 A;  5CYQ A;  4OJ1 A;  4DL2 A;  2PFD A;  3B4M A;  3P4U B;  2ZNZ A;  3D67 A;  3NL0 A;  5KFY A;  3H20 A;  4AYB D;  4M94 A;  3SDE B;  4NA3 A;  5H9E K;  2I2Y A;  1U25 A;  2HGN A;  4ZVU B;  1X60 A;  3HHE A;  3SFU A;  2CQB A;  3MAA B;  1N33 F;  1UEV A;  3E8O A;  4C6A A;  4CO2 A;  3EDR B;  3NOC A;  2XS2 A;  1REV A;  1Q82 T;  4IH6 A;  2ZZM A;  1PCA A;  1WF1 A;  2FY8 A;  3PW7 A;  5J2P A;  1WC4 A;  4KO0 A;  5GAH I;  5CHC B;  2E5L F;  5E41 A;  4DUZ F;  2G0J A;  1U48 A;  4L3K A;  1CJT A;  1R8B A;  2K2P A;  4USV A;  3KK1 A;  3BDE A;  1ULR A;  1X4D A;  2HQC A;  1HNZ F;  3IBW A;  1ZM3 A;  5BYR A;  2JOQ A;  4KAI A;  2XLK A;  5HMY A;  1NHK L;  4J9U E;  4O3S A;  2OPS B;  1QM9 A;  3IWX A;  3Q89 A;  2FY1 A;  4WE1 A;  4ZVO B;  1JKH A;  3FCH A;  3HVW A;  2ZHB A;  4ED7 A;  2ACM A;  1JIH A;  3G6E S;  3V4M A;  1YIT S;  5BR8 F;  4OYI A;  4LFA F;  5IFM A;  2OJ3 A;  3GFY A;  3PM9 A;  3W64 A;  3OR2 A;  3BR9 A;  4KGV B;  3M2V A;  4ECU A;  1KR4 A;  1RWX B;  1QAX A;  1UPP A;  3DHX A;  4WZM A;  4LF9 F;  4LR9 A;  3EM1 A;  1S59 A;  4FKX A;  1R31 A;  4ZIV A;  3BH6 B;  3EX7 B;  3JSM B;  5LJ5 Y;  3MED B;  3KLE B;  5DS7 A;  2J9D A;  3AOA A;  1GTE A;  3V6D B;  4DR1 F;  4FVC A;  5BJR A;  2YWG A;  5B08 A;  2DNH A;  4P10 A;  2Z56 B;  3HHD A;  3M2R B;  4DL5 A;  4WIQ A;  3D6M B;  4WKR A;  2XS5 A;  4MKV A;  2CPE A;  1RA6 A;  4C7Q A;  3I0S A;  4TY8 B;  3FKB A;  2E5G A;  5RUB A;  1RTJ A;  2KXN B;  4C8M A;  4MJK A;  3LAL A;  5IWA J;  4ZP8 A;  1OQ3 A;  4Q7A A;  5J1N A;  4I4B A;  4RPF A;  3KLV A;  1FNM A;  5H1S V;  2E7V A;  4DDF A;  1VK8 A;  1Z4U A;  1N36 J;  2ZC4 A;  2EC0 A;  3ISZ A;  4F2R A;  2QA4 S;  4LF7 J;  4EO6 A;  3KWM A;  4JYA F;  4ZVS B;  2KT5 A;  4QYR A;  1VBX A;  1HMV B;  1T3O A;  1S76 D;  4JV5 F;  2BAN B;  3GYN A;  1KOO A;  3DYA A;  2V94 A;  1F5B A;  4DV2 F;  2B0G A;  2LQJ A;  2HHP A;  2JLF A;  1X5S A;  3GSD A;  1WG1 A;  2DGV A;  1NZ8 A;  5ETS A;  1HHS A;  1XQI A;  5BXI A;  5J1E A;  1GX5 A;  3PAC A;  2PT0 A;  3T5L A;  3HDS A;  4X64 J;  4PAB A;  1JLB A;  3SCI E;  1KTV A;  2GGP A;  4NX9 A;  1QLN A;  4IUF A;  2LXU A;  2KZM A;  5AJ3 F;  3AD8 C;  3D1Q A;  3AJD A;  1HQU A;  1KN6 A;  2VON A;  2Z2M A;  3CE8 A;  3W2W B;  3RBE A;  3W2V B;  2AX0 A;  1FK9 B;  4DL7 A;  2G2O A;  4YDX A;  4NPO A;  1P27 B;  4KHM A;  3DRP A;  3MMB A;  2ZC3 A;  3BV8 A;  2OFG X;  3I0R B;  5J2N A;  4NLQ A;  5DO2 A;  3TAN A;  3B4D A;  4IQX A;  4KR0 B;  4FXW A;  1RTH B;  2ZHA A;  2YWK A;  4HT5 A;  1EHW A;  2AEJ A;  2DK2 A;  4JI8 J;  5KFK A;  3TZZ A;  2PN6 A;  1DY3 A;  1WSV A;  1ZYQ A;  5KT7 A;  4ID5 A;  3ENQ A;  3H4D A;  3ZTS A;  2RHS B;  3SSQ A;  1TFY A;  1X5T A;  4P52 A;  2BJD A;  4RLE A;  3BPS P;  3CJS A;  4X66 F;  1G7C B;  1U4B A;  5CD4 A;  4K0K J;  2P8I A;  2AU0 A;  1FNX H;  3W1Y C;  4Q0B B;  4PG7 A;  4Q45 A;  4NML A;  1S9G A;  3AOC A;  2BW2 A;  5KFC A;  2QJ3 A;  1SJF A;  2NYI A;  2W2N P;  1J27 A;  4TVA B;  2BBE A;  3IR6 B;  3DXS X;  1CSJ A;  1RBO B;  4YS2 A;  1IQZ A;  4YB1 P;  2A3J A;  3BDP A;  4G1P A;  2DHX A;  2UUC J;  3GR0 A;  4K5R A;  2DNP A;  2E29 A;  4IFV B;  1CVJ A;  4U67 Q;  2JLE A;  4DV6 J;  2MZJ A;  3VV2 B;  3PO4 A;  3AXK A;  5ETL A;  3RGI A;  1RT7 B;  4MIB A;  3PHT A;  1L5U A;  2C2N A;  3ILO A;  2VFV A;  1CS4 B;  4QU7 A;  2JLG A;  4P7V A;  3V6H A;  1R0C B;  1HWJ A;  2UVR A;  2RS2 A;  3BH7 B;  4DUT A;  5C2G A;  1FWL A;  2ZBC A;  1XMO J;  2GZO A;  1C0T A;  4Q2L A;  3PZP A;  3KYL A;  1NXI A;  4N7T A;  2CNL B;  5SZT A;  2R8K A;  3R7B B;  2U2F A;  4DU7 A;  1HQE B;  2J8A A;  4ZP7 A;  5A6W A;  2OTL S;  4X4T A;  4N56 A;  1Q7Y T;  2B3T B;  4QQB A;  4CLK A;  4RWX A;  2AD9 A;  2IC3 A;  3M32 B;  3PRB A;  1EAR A;  3KUH A;  2NXU A;  3GR1 A;  4I69 A;  3OQ2 A;  2DO0 A;  3LAK A;  4Q43 A;  3VWS A;  3HUL A;  3KLI A;  4OIX A;  2CG8 A;  4O44 A;  1S9E A;  2CG4 A;  4DL6 A;  2YNH B;  3J7A N;  4LBP A;  5DG7 A;  4LFB F;  1F0X A;  2RNE A;  3F44 A;  4DV3 J;  2FJX A;  3Q24 A;  2NUU G;  1EKR A;  1T9V A;  3KLF B;  1VQS A;  4N77 A;  3Q8Y A;  3SBM A;  5KFJ A;  1N4L A;  5CCM A;  2LEC A;  2KVQ E;  2DGU A;  4MK9 A;  1K1S A;  3TX8 A;  3QGP A;  4K7Q A;  4DPT A;  4Z2X A;  3CC2 S;  3JB9 k;  4LFC J;  1YI2 S;  2RKI A;  2L41 A;  2FC9 A;  5HVH A;  5FJ4 A;  3B82 A;  2XMA A;  1U8W A;  5DGA A;  4QR2 A;  4ZCL A;  1YWX A;  2R9L A;  1M90 T;  1T94 A;  1JXL A;  2BJ8 A;  4MFB B;  2AYE A;  3F0N A;  2IMW P;  4X64 F;  4KFB B;  2HUR A;  2BJ1 A;  1C1C B;  2VBX A;  5IC4 B;  3BSA A;  4BLG A;  2KG0 A;  2CJB A;  2YWW A;  2NPI A;  1G4C A;  3NWR A;  1X4H A;  4L3N A;  3HSG A;  1HAR A;  2CAD A;  1S0O A;  2DNK A;  5DZ7 A;  2ERR A;  3J7Y U;  5F8L A;  3KJN B;  5GAG U;  1PC4 A;  5K9F A;  1Q53 A;  2Y0B B;  3LTO A;  2Q3P A;  1GFW B;  1RWU A;  3N0V A;  3NWG A;  1S72 S;  1M1G A;  3LP0 A;  4K50 A;  2DVI A;  1DQ9 A;  4JI8 F;  3SIP B;  5L8R C;  4EUV A;  1OPI A;  2XWX A;  1VR6 A;  2WVB A;  3SV3 A;  3MWB A;  2LCW A;  3OLB A;  5A2Q Y;  4QPT A;  1S7H A;  4DR7 F;  4K0K F;  2KJW A;  2RRN A;  3MPW A;  3K59 A;  1TK0 A;  4NCG A;  1LW0 B;  4F67 A;  2C2D A;  2MZQ A;  3QJP A;  1VHF A;  2X1G A;  3JTP A;  1PAE X;  4HKQ A;  2HHH F;  3PW2 A;  3G86 A;  3CDE A;  4WYL A;  2HHW A;  2OML A;  1FRH A;  3MED A;  3IAM 9;  2A2D A;  1KQF B;  3M8Q B;  3MMA A;  2W2P P;  2HNZ B;  1U1O A;  3RR8 A;  3QZ7 A;  4A4J A;  4URG A;  3IGN A;  3A3P B;  4WU2 A;  1UTA A;  4AL7 A;  4FS2 A;  4DV6 F;  2OP5 A;  2ZH7 A;  2FJW A;  5HRO B;  1XNQ J;  2ZOM A;  3ZZT A;  1SUQ B;  3DLH A;  3H59 A;  3NBP B;  2R2R A;  4J90 A;  2EFN A;  2YH1 A;  3A8K A;  4F8R A;  3S01 A;  4P75 A;  1RTZ A;  5FDL B;  1TFW A;  3H5S A;  3MPY A;  2VU5 A;  4RW6 B;  4OYZ A;  4LF4 J;  1RAJ A;  3UVJ A;  3CCJ S;  4LRC A;  4TQS A;  2NR0 A;  2F7V A;  3CJ2 A;  3KK3 A;  3HO1 A;  3KLH A;  4YME A;  4P74 A;  4BHQ A;  1JXE A;  3H2L A;  5KFE A;  1DAX A;  3ISN C;  2KG1 A;  2LQ8 A;  4ZP6 A;  4K4Y A;  4JV1 A;  2FTR A;  5ETQ A;  4AFF A;  4C0B A;  1PSD A;  2XLI A;  3I56 S;  4PWD B;  3SQG B;  3DDK A;  3IR5 B;  2MQQ A;  2H51 B;  2EC2 A;  5H9F J;  4L73 A;  2NUH A;  3K57 A;  1DJ0 A;  3RZA A;  4OFZ A;  4C0O C;  3MOJ B;  2G13 A;  2ZOF A;  3KOA A;  5GMD A;  1I5O B;  2NXJ A;  4DX7 A;  3R5C A;  2M8D B;  3M2U B;  2M0G B;  2WVC A;  2FPH X;  2P6S A;  1S1X A;  1HR0 J;  1FFW B;  1H73 A;  4NOH A;  2XYP B;  2HND B;  1Q8L A;  2MZ1 A;  2IMO A;  1HNW J;  4QWE A;  2YWE A;  3PKY A;  3W2V A;  1YJ9 S;  4DSF A;  5ETP A;  1RWK B;  2ZDP A;  2NXN A;  1X5O A;  4DQP A;  3I0R A;  1NJW A;  1RWV B;  2IVF B;  3PO5 A;  1RTH A;  2DH7 A;  1S6Q B;  4G3I A;  1U1Q A;  5M2P A;  3C6U A;  4A8K A;  3PKM A;  4FPR A;  2JVR A;  4FYX B;  2AEM A;  1NSQ A;  2V9K A;  3OFF A;  1H7X A;  4OYW A;  3VCD A;  4KGM A;  3W8G A;  4DL4 A;  2WW8 A;  4H4M B;  1VBK A;  4B9V A;  4ECX A;  1DTT A;  2N4D A;  2I38 A;  1WAC A;  2R7W A;  2QLW A;  4DWI A;  2JFD A;  4LFC F;  4UOF A;  1WOS A;  2DXE A;  1WHW A;  1RT2 A;  3M8Z A;  4PG6 A;  4CLP A;  1RCX B;  2LFV A;  2ALY B;  1C1B B;  4NCB A;  4WCE Q;  5IQ6 A;  1MMD A;  1GEH A;  1H98 A;  2E9T A;  1VLY A;  4WF9 Q;  5ETK A;  1MSW D;  3TAQ A;  1HW8 A;  4ECW A;  1RZM A;  3OUY A;  1CJV B;  3NP5 A;  2WBR A;  3CNQ P;  3NS7 B;  2FUG 9;  1B7F A;  3OFG A;  1CQM A;  3M9M B;  2MMY A;  1KRP A;  3GJS B;  4OV6 A;  3GFH A;  5L46 A;  4JI6 F;  2DTJ A;  3Q8R B;  1U49 A;  1IM4 A;  1SBR A;  5KG1 A;  1RA7 A;  3R7S B;  2RQC A;  3PJX A;  5JVH Q;  5DLF A;  4ZVE A;  5I42 A;  2J0X A;  2HZA A;  5D15 A;  1I94 F;  1FD2 A;  3D6H B;  1GXT A;  1CLF A;  5A8R A;  4USM A;  4KH0 B;  3AD9 C;  2J6U A;  5HQL A;  1HQE A;  5E3P A;  4CCH A;  5MLC V;  3MMC A;  4DPU A;  3M8P B;  1ZPV A;  1KLN A;  2HAF A;  2VG7 A;  5IT0 A;  3MEC A;  4RW4 A;  3CDW A;  1UW9 A;  4F0K A;  5A2Q U;  3AQO A;  1PIL A;  4IG3 B;  2LXI A;  1OWX A;  1RWO B;  3LO3 A;  4F4K A;  5EGY A;  1TK5 A;  2HFV A;  3TJ9 A;  2MKJ A;  2DGX A;  4V1A k;  2PC6 A;  3N6N A;  4JI0 J;  1DQ8 A;  3Q22 A;  4M5M A;  3NKY A;  5G0R A;  1A7G E;  4OI6 A;  1S99 A;  2E9R X;  2ZH4 A;  2V8P A;  2YQ3 A;  3L4B C;  5D3G A;  1FKO A;  2Q6C A;  2YX1 A;  3WC0 A;  4M63 A;  3TNV A;  2EBG A;  2Y0S D;  3G4S S;  4EEY A;  2RUS A;  1B64 A;  3U1L A;  5H9E J;  4KY3 A;  2MQO A;  4CLT A;  2VJV A;  2N3O A;  4N5S A;  4CT8 A;  2Q1L A;  1IQT A;  3A13 A;  1GMW D;  1Q86 T;  3VGS A;  2W2Q P;  1NDC A;  4LF4 F;  4KHP F;  5LL6 d;  3R2C J;  5IT4 A;  3EIC A;  3QJL A;  3LPE A;  4ETX A;  1IKY B;  1LWX A;  3A8J A;  2WAQ D;  4O3Q A;  1Y11 A;  3N5F A;  2JH3 A;  3M05 A;  4RUA A;  2PO4 A;  4M5K A;  2AJ1 A;  2DNM A;  2FIU A;  3VVU A;  1X4A A;  4KBI A;  3MR5 A;  1YDL A;  3FCV A;  4X65 F;  1WTB A;  4DN0 A;  1ZTT A;  4G1Q A;  2QT7 A;  1B70 B;  4S0M A;  2C3M A;  4TYA A;  3PFO A;  2GCF A;  3GLJ A;  3BGL A;  2FQQ B;  4F0H A;  1K0T A;  1SXL A;  3BKU A;  2CPH A;  3W3S A;  3D9B A;  2ZBP A;  3R6G B;  1HR0 F;  3RTV A;  1EAY C;  4B9U A;  4GKJ J;  1HQ2 A;  3PEJ A;  2YWH A;  1FKA F;  1RT4 B;  1X4C A;  5CAA A;  3BGR A;  1S1T A;  1EIY B;  3UR3 C;  3VAF A;  4QIV A;  4A8M P;  2JC1 A;  5LSL A;  1ZM4 A;  2GAG C;  3PW4 A;  4DCP B;  2RF2 A;  1SB6 A;  2V63 A;  5KG3 A;  3T9N A;  1HBU A;  2WVF A;  2E7X A;  4FYV B;  4L6V 3;  4Z7Y A;  1S1V B;  1JWW A;  3KLG B;  2Y1R I;  5DGB A;  5GAE U;  3BM7 A;  2J9D E;  3BRE A;  3IWN C;  3OBI A;  2OD6 A;  3CD0 A;  2GHP A;  3NCR A;  1VQ8 S;  9ATC B;  1XR6 A;  4KH1 B;  2L08 A;  4DEZ A;  3LP1 A;  2W7O A;  2E5I A;  4XPC A;  3IG1 B;  2HNZ A;  4ATN A;  1N56 A;  2R7Q A;  3BN7 A;  3TUJ C;  4WP9 A;  1L3K A;  2QFJ A;  4ZVF A;  4YUD A;  1LEO A;  2YKA A;  4Y00 A;  1KFS A;  3VZH A;  2W8L A;  2XI2 A;  4KPY A;  4OHX A;  2FJV A;  1WJ9 A;  1X8D A;  3AA8 A;  1SL0 A;  3DRY A;  2HNY B;  2GO8 A;  4O0N A;  1XMQ F;  2F4F A;  2YNF A;  3S8S A;  4UUW A;  2VBW A;  1JK9 B;  4DSK A;  5AE1 A;  5FDL A;  2O1P A;  4B3R J;  4JI5 F;  2UVW A;  1Q8B A;  1U2R A;  2MKK A;  4WKY A;  4IFY A;  1RP5 A;  2BAC A;  4WBF A;  5CH7 B;  3EGW B;  4J9L A;  4DF4 A;  4LRF A;  2MB0 B;  1T9T A;  1ZOT A;  1O0P A;  3BQ0 A;  1Y9O A;  4X62 J;  2QLF B;  2OKQ A;  1NSA A;  4USJ C;  1S57 A;  3KG1 A;  5B0C A;  4HHJ A;  5AXN A;  1GQE A;  3TVY A;  2VB6 A;  5KFM A;  3CWJ A;  4K2X A;  3SXL A;  2RQ4 A;  3QIP B;  3CUL A;  2GA7 A;  2JEG A;  1RT3 A;  3W5X A;  3FEX B;  2Y1L B;  1A0O B;  3S1T A;  4JB8 B;  3AHP A;  2VV5 A;  3QPI A;  4KKO B;  2IRY A;  4U7C A;  2GIF A;  2YX7 A;  3KJQ B;  4ZLJ A;  3VAJ A;  4AXJ A;  1RQ0 A;  4JI0 F;  3DNC A;  2MKS A;  4W4M A;  4U8V A;  3QLH A;  3MR6 A;  3GJR B;  2H48 B;  5LXR A;  3TQ1 A;  1HPZ B;  1GMW A;  3KFW X;  5IOL A;  2QLB B;  3CW2 C;  1DLO B;  3BB5 A;  4USI A;  2WRM A;  3EVO A;  2MTL A;  5LSO A;  3R6L B;  1MU2 A;  1D9F A;  4I67 A;  4FNH A;  3JSY A;  2UUT A;  3DGP A;  4P72 A;  5KFP A;  2QL5 B;  5C42 A;  2VA3 A;  3HHN B;  1IKX A;  1RBA A;  1VS3 A;  3NGU A;  2W9B A;  4ETZ A;  4EYI B;  1Q16 B;  4M5L A;  2VL1 A;  3R1H A;  3H90 A;  4DLE A;  4I2P B;  4H4M A;  1UWB B;  4YR2 A;  4DPO A;  1BE4 A;  3UNG C;  1LW2 A;  1U2C A;  4L75 A;  2FZK B;  3QSY B;  2GIQ A;  3HFK A;  3M8W A;  3U27 A;  3A3N B;  3Q8U A;  2HQ3 A;  2ZH9 A;  2V4J A;  4WU3 A;  3SI8 A;  4CH1 A;  2LKZ A;  2QMU B;  1F2H A;  3I55 S;  2ASJ A;  1WC0 A;  1VQ6 S;  3N28 A;  3OJS A;  3H5Y A;  1F60 B;  4ZLL A;  1RHR B;  2EWH A;  1UAW A;  4Q8E A;  3WIU A;  2LEA A;  1TMJ A;  2FLO A;  4O23 A;  7AT1 B;  2I5J B;  4GKJ F;  4RO0 A;  4A8W A;  4USW A;  4MYT A;  1NDK A;  5F8G A;  1BWE A;  2HG4 A;  1CJK A;  1E6V B;  2UXD J;  3G6V A;  2JEJ A;  3OHB A;  1LWF B;  4CM0 A;  4O3O A;  2FHK A;  2VIC A;  1XNR F;  5KG6 A;  5ETM A;  4LQ3 A;  2NSB A;  4EBD A;  4RNH A;  4X4R A;  1KS2 A;  4LSN B;  1TL1 B;  2UUA J;  1DTQ A;  4DPY A;  3D66 A;  2L3M A;  3FMB A;  3R3T A;  3PEH A;  3DLK B;  1NJX A;  5KFG A;  4K4V A;  2CQP A;  5GAD I;  3VQT A;  3KNG A;  4X4V A;  1GXL A;  2IA0 A;  1KC8 T;  3CD7 A;  1LKZ A;  2QGF B;  3K17 A;  1S6U A;  3ENV A;  4XDD A;  2HBZ B;  5A76 A;  5DDQ C;  1DZ5 A;  2V8V A;  3HJF A;  2XMJ A;  5KFS A;  4K4S A;  2W01 A;  2QV6 A;  1AB8 A;  3UPF A;  1P9Y A;  4DPW A;  4IG3 A;  2MQP A;  4NLT A;  4LRA A;  1RLD A;  5J2Q B;  4DQI A;  1UW4 A;  2DB1 A;  2K3I A;  3NCP A;  5K14 A;  3QFH A;  3K58 A;  3MEE B;  2B5J B;  2M3D A;  4OI4 A;  3D54 A;  2EKN A;  3HZE A;  4C9D A;  4FYW B;  1S48 A;  3G82 A;  4I0W A;  3UWT A;  3TUI C;  5A8K B;  4OYB A;  2BEF A;  1T8E A;  2EKY A;  3M8Y A;  3T3F A;  2GVZ A;  3NGT A;  2MJN A;  1RAC B;  3RW7 A;  1TKT B;  2W7P A;  3N4W A;  2X1B A;  1WD6 A;  1N52 B;  3NY0 A;  3MI7 X;  2HKE A;  4B3R F;  3MM7 B;  4QU6 A;  1HYS A;  1N54 B;  3NNA A;  4ECZ A;  5D8H B;  1APS A;  1HHQ A;  3RBX A;  2DCU B;  2NZC A;  4W98 A;  4DR5 J;  2VKZ G;  2ZZN A;  2EVZ A;  2JVO A;  4PYA A;  2RML A;  3GPA A;  3BSC A;  3U02 A;  3HF5 A;  4TKT A;  2B6A B;  4KQZ A;  9RUB A;  1NJZ A;  4NL5 A;  4OI1 A;  2FVC A;  2HHQ A;  1PYS B;  3JYT A;  3I4P A;  3GII A;  1IWA A;  4WP3 A;  1N88 A;  1VQO S;  4NEY A;  1T03 A;  1PKU A;  3E01 A;  2MQL A;  2AYG A;  3D0I E;  1AXQ A;  2OPQ B;  2FHO B;  5J2M A;  2KXH A;  4DR6 F;  1RAA B;  2RQM A;  3QGI A;  4FYY B;  4OL8 A;  2DNN A;  3TX0 A;  2B9E A;  3N9U C;  5HMZ A;  4CTA A;  4QIG A;  4BC7 A;  5K20 B;  4E98 A;  3RUB L;  2LEB A;  5AXM A;  4RNF A;  1FXD A;  4OYA A;  1RT4 A;  2DT9 A;  1B3T A;  3FJ2 A;  1WOO A;  2R2S A;  1U0H B;  4UY8 5;  4YQW A;  2DNO A;  1N48 A;  1WC1 A;  4M5D A;  4C48 A;  2VPZ B;  4TLR A;  2QMW A;  2ZJQ Q;  1X9M A;  3HHL B;  2U1A A;  1E6Y B;  4E0D A;  3P8B B;  4IDK A;  2MZR A;  4IOC Q;  4GKK F;  3M9O B;  4I6W A;  5ETV A;  2B9X A;  1ITP A;  3CDB A;  5D77 A;  1N5Y A;  3UI3 A;  2V68 A;  2VG5 A;  3OTO F;  4CLW A;  3C15 B;  3W5Y A;  3FRY A;  1PO6 A;  4I64 A;  2NZ4 A;  5LMN J;  3ADA C;  4Q5V A;  3THP A;  3CCR S;  3FQK A;  1FFG B;  1QVF R;  3M6V A;  4F4W A;  2KU7 A;  4JBC A;  1I6J A;  3O1L A;  3V2U C;  3IG1 A;  4QIF A;  4GO5 X;  4PZV A;  2RDJ A;  2X1F A;  2ASD A;  4OYX A;  3EVM A;  2KKH A;  3GJQ B;  3T5H A;  2UUB J;  4N8N A;  2R7V A;  3MM6 B;  3W8P A;  4ZPA A;  2PMZ D;  2BQ3 A;  2EFG A;  3DLE B;  4OZJ A;  1AYE A;  2CWK A;  2YKQ A;  1RXO B;  3M7V A;  2X3G A;  1LFP A;  3CJR A;  4GMK A;  2UXD F;  4ZPW R;  2VIH A;  2ATL A;  2GVD B;  4IRC A;  2RIL A;  2WHO A;  4DR3 J;  5U47 A;  3V81 B;  3QT5 A;  4R8U B;  3GIK A;  3UE2 A;  1UVL A;  2ZM6 J;  2V4Q A;  1X0F A;  4PQU B;  4ED8 A;  1UJ6 A;  4NZ7 A;  1OPZ A;  2ZWP A;  2XGP A;  3HHL C;  3FCW A;  3FZ2 A;  3GCX P;  1HBO B;  2LQB A;  3MDF A;  3QZ8 A;  3ZZP A;  2VQE F;  3US5 A;  4M95 A;  4DL0 C;  3TYT A;  1UFL A;  1FKP A;  3D5M A;  3IBF B;  4ANE A;  1PBU A;  2HHS A;  2CQI A;  4J5O A;  1RT5 A;  2MY8 A;  4CLY A;  4QWC A;  2Y3Y A;  1IUJ A;  2C42 A;  4QZV B;  4LSL A;  3ZO7 A;  1WTF A;  1RHK B;  4FF3 A;  5I3U B;  5EX0 A;  1Y4Z B;  1SV5 B;  2R7T A;  3OXL A;  2ADB A;  2V8G A;  2V2V A;  4DX5 A;  2AGO A;  1HPZ A;  1H2V Z;  5I3Q A;  5KFQ A;  3EGZ A;  4JV0 A;  1S0N A;  4NCA A;  2QL7 B;  2K7K A;  5LJ3 Y;  2HW3 A;  3CJQ A;  3T5J A;  2MPU A;  1VJW A;  2BX6 A;  3WHI A;  5IZH A;  4EZ6 A;  1R0A A;  3LGM A;  4NI2 A;  2AGP A;  3ETM A;  1ZAW A;  5FLX Y;  3KKF A;  2HHT A;  4WFX A;  1ZZN A;  4EZ9 A;  1TV6 A;  4HLB A;  3WZ0 A;  2EW9 A;  5A8W A;  2BQU A;  4AE5 A;  4KV8 A;  1QUP A;  2PI4 A;  1Q79 A;  3KK2 A;  4ZCI A;  3JQK A;  1SC3 B;  2XMU A;  4ICL A;  4PYD A;  4OJG A;  5ETT A;  3BKT A;  4A8Y A;  2CPX A;  3P5B P;  2O66 A;  3DRS A;  4ZLP A;  1NKE A;  3PIO Q;  1RAF B;  2DIU A;  3PIP Q;  2BUN A;  2DNL A;  1VI7 A;  1IKV B;  3PY8 A;  4HT7 A;  3UDC A;  1NK8 A;  4CLZ A;  3LW5 C;  2DGO A;  2WSC C;  4EBC A;  2IM0 A;  1DAR A;  3OTD A;  2VFU A;  3UD4 P;  2XSJ A;  4YB7 A;  1HWI A;  3JTN A;  3H7H B;  4FN5 A;  1VIX A;  3BQ1 A;  4ZN1 A;  5KG4 A;  2ZJP Q;  2WON B;  3MF5 A;  4OX9 J;  5KOX A;  3ENA A;  4BWM A;  2YVS A;  4L74 A;  4C11 A;  2M52 A;  3DOK B;  1LWC A;  3BGF A;  2G1H A;  2ZVI A;  3JXO A;  4DPX A;  2ZHO A;  3TUP A;  1HBN B;  1RAH B;  2NPF A;  1ZTW A;  2R8G A;  5F8M A;  4USU A;  2VC0 A;  1Q1K A;  3CMA S;  1G6B A;  2GS8 A;  5FD1 A;  4IOA Q;  5AE2 A;  4JI2 J;  4EO8 A;  2VHG A;  3NG8 A;  5E33 A;  3VAI A;  3T5K A;  2L9W A;  2YXL A;  1WC5 A;  1PG5 B;  3AB2 B;  1TKZ B;  2DPI A;  4QJV A;  1SKW A;  1RT1 A;  2DXD A;  5DJB A;  3OFE A;  1JJ4 A;  1GK8 A;  3I9Z A;  3DLB A;  3HSZ A;  1JLG B;  3MUV P;  1IM6 A;  3GJT B;  3TA2 A;  2MHN A;  2GC8 A;  1S9F A;  3CXC R;  3P45 B;  1GMU A;  2BMB A;  1CPZ A;  1RU1 A;  2V6A A;  4QPX A;  2BVZ A;  2DHG A;  2AIR B;  4Y65 A;  2K06 A;  3PX4 A;  1S6P A;  3DLG A;  1M5S A;  3C19 A;  4ILR A;  3F56 A;  2EEY A;  1JLF B;  1NKB A;  2N7C A;  1NM2 A;  2CQ2 A;  4DSL A;  3Q2S C;  4KC5 A;  2R2T A;  4DG1 A;  1NO8 A;  3UR0 A;  4BWJ A;  4ED5 A;  2FVQ A;  1UMJ A;  1C4A A;  4C8N A;  1S7I A;  1PYT A;  2K8G A;  3TJA A;  1AUD A;  5LXY A;  4WK1 A;  1JLE A;  2VBZ A;  5IS2 A;  1I1G A;  3BO2 A;  4PG4 A;  2JFK A;  2RRA A;  1R3N A;  4DR3 F;  2VOD A;  3OL8 A;  4LMZ A;  3OJU A;  2ZM6 F;  1SJR A;  3KJV A;  1G3O A;  3IM8 A;  3V4I B;  3EGV A;  4TU9 A;  3MFI A;  3QT6 A;  4X4N A;  2YQ0 A;  4I2Q A;  4WK3 A;  2MQN A;  2Y8Y A;  4IG0 A;  2G4B A;  5A0Y B;  3TAP A;  1N34 F;  1R8P A;  1HI0 P;  1WF0 A;  1P8G A;  1LQ9 A;  1QE1 B;  2CQC A;  5IT9 U;  5KFW A;  4LF8 J;  4DZ6 A;  4PG8 A;  3RU0 A;  3CC7 S;  4WPA A;  4WWS A;  5LM7 E;  3OLA A;  5KFL A;  5KG5 A;  2ILY A;  5B0F A;  3CJK B;  3VAK A;  1KHV A;  3G8S A;  1RT6 B;  4OHW A;  1UP1 A;  3MMJ A;  1TAU A;  1K44 A;  2AJF E;  4I7F A;  4DI6 A;  2NSC A;  3DOM A;  2F65 A;  3FVY A;  3AD7 C;  3C16 A;  1L3S A;  5C2C A;  1C4C A;  1ICE B;  4F36 A;  1HI1 A;  1TAQ A;  3JSR A;  2VFS A;  1AT1 B;  2IBO A;  3DI6 B;  4LR8 A;  2XO7 A;  3GQC A;  3W62 A;  3BKF A;  1TU0 B;  1WKL A;  2M88 A;  1RDR A;  1D1U A;  3EZ5 A;  4ZA1 A;  3HXM A;  3TAR A;  1BQN B;  4TYB A;  4B02 A;  3OSP A;  5F8N A;  1N8R T;  1U0H A;  1FJG F;  5KFB A;  5JVG Q;  5C7P A;  3NXZ A;  5DDR C;  3FUY A;  1UVN A;  5HBM B;  5B09 A;  3GV5 B;  5L38 A;  1U45 A;  2YNG B;  2B4U A;  4CWB A;  3AQP A;  5FLX U;  1UL3 A;  2NYH A;  3P96 A;  5HP1 B;  3CJ5 A;  2KRR A;  3ILL A;  5ETR A;  2WCX A;  1VRT A;  2KVI A;  2DNZ A;  2HQG A;  2F4V F;  1T05 B;  2A10 A;  3GE9 A;  4RWW A;  3CD5 A;  4DV5 F;  2P9E A;  2W2M P;  2FC8 A;  3HZG A;  4A48 A;  2UVU A;  4Y2I A;  4ECY A;  3N6L A;  2R7O A;  1EET A;  3VQS A;  5AE3 A;  3M30 A;  3KHR A;  3DRR B;  2OPP A;  2WW4 A;  4OI3 A;  1IBC B;  1SIZ A;  1LNQ A;  5D0E A;  4CLS A;  4ZN3 A;  1VQ4 S;  1U0S A;  3ZC4 A;  4G1I A;  1LOU A;  4NLW A;  1H2U X;  2A0F B;  1FF2 A;  3TVK A;  2V5H G;  3NMA A;  2WOM A;  4B3M F;  4FYD A;  1HBM B;  1TVR B;  4HHU A;  1RAD B;  1ROF A;  1WG4 A;  4ZVR B;  3T1H J;  3MM5 A;  3LA0 A;  3SCJ E;  3LUY A;  2GQC A;  3MEG A;  3WX4 A;  2V0N A;  5HAT A;  4JI1 J;  3V81 A;  2KHD A;  3AY0 A;  4Z37 A;  1QJH A;  4UY8 T;  4CH0 S;  1FE4 A;  2KI2 A;  4JI2 F;  3W61 A;  4DFP A;  3A8E A;  1XJW B;  1WG5 A;  2V8H A;  2LQ5 A;  2VOO A;  1OSD A;  3JTO A;  1TL3 A;  3Q8P B;  4N41 A;  1RKJ A;  6FD1 A;  1YTY A;  4O4G B;  1YK9 A;  3OSN A;  3O44 A;  2OMO A;  2E1C A;  2Q43 A;  4DHV A;  4DV7 J;  2VKR A;  2XMT A;  1F3F A;  5I4M A;  2NXC A;  1X4G A;  4RU9 A;  2VZ9 A;  4RJV A;  3CJ0 A;  4LVN P;  4NYO A;  1FTC A;  3PYF A;  3ZZY A;  3HFZ B;  2W9C A;  2OI2 A;  1CUL A;  2VPW B;  3DM2 B;  1G2E A;  5L1I A;  1RJJ A;  4CLU A;  1UWA A;  4HYK A;  3AB4 B;  2VOP A;  3HSD A;  1IBM F;  4J7C A;  2YPZ A;  1NZA A;  2ZDO A;  2YNI A;  2EPI A;  1P1T A;  4RW9 B;  1O6X A;  3RAQ A;  4CNZ A;  4J37 A;  4ZIT A;  2BKP A;  3GFZ A;  4AQY F;  3U1M A;  5D4N A;  3NMR A;  2E1M C;  5ETN A;  1T9X A;  1S1W B;  1XWL A;  4ZVH A;  3HX9 A;  4EYH B;  4CYU B;  2D3O 1;  4B17 A;  1QUV A;  4PRF A;  2HMI B;  4A47 A;  1NDP A;  3GWC A;  4NE9 C;  4RNM A;  3RAX A;  3QYY A;  1T11 A;  3LP2 B;  3GU0 A;  4Z7C A;  1IBL F;  4YP3 A;  5C25 A;  2F40 A;  3TZX A;  1S1U B;  4OZ2 A;  3MXH P;  1FDD A;  2OPR B;  1CJU A;  4HH1 A;  3Q0A A;  1HW9 A;  1BLU A;  3W9J A;  3Q8V A;  4ES3 A;  3NS5 A;  2MST A;  2CPY A;  1N6Q A;  5HL7 Q;  2Z2Z A;  4NRT A;  4RW8 B;  5HQM A;  4DF8 A;  4IOB A;  4NYZ A;  2FLL A;  1R6Y A;  1Q5V A;  1NND A;  2FHJ D;  1T0T V;  3U7J A;  1U02 A;  5E0O A;  3BS9 A;  2ZE2 B;  5D0R A;  2YY3 A;  3M1V A;  6AT1 B;  2YTC A;  3KHG A;  3QAU A;  2APO A;  1V6H A;  2OGU A;  1TKD A;  2JZ5 A;  2CUY A;  3AAW B;  1Q81 T;  5CYM B;  4P9S A;  3UCU P;  2OUG A;  2YKN A;  2GFF A;  5HVG A;  1VRU A;  2BAB A;  5D4P A;  3I5C A;  3GYG A;  1KSP A;  1NPK A;  2BJ7 A;  2ZBI A;  4WFY A;  3IWL A;  3QGG A;  5L1L A;  2R7X A;  2ZVS A;  4ZCM A;  4F02 A;  2JEF A;  2AEF A;  2WSF C;  3BYR A;  3HVT A;  3L95 X;  5DM6 Q;  2YKM A;  1W26 A;  1TKZ A;  1UA1 A;  5LT5 A;  1XR5 A;  2LYV A;  2XMV A;  2Y1I A;  1P6T A;  5T7L B;  1KEK A;  4M5N A;  3E3X A;  1YJV A;  1BQM A;  3IFE A;  1JLC A;  1O8B A;  2PMH A;  4FXD A;  2BJ9 A;  4OHY A;  2ZNY A;  4X4U A;  2ZKU A;  2ROE A;  2QLX A;  2KHC A;  3H40 A;  4KYZ A;  5HSP A;  1DRZ A;  3LAM A;  1JQG A;  1VRQ C;  4LF1 A;  3JS9 A;  1HWL A;  2CPJ A;  3IXQ A;  3MD3 A;  1AZS B;  1FT8 A;  4NMX A;  2WVD A;  4C8K A;  1IR0 A;  5B0E A;  2QFI A;  5IM0 A;  5JUM A;  5HQ8 A;  2LEP A;  1YJU A;  5CCL A;  4URS A;  3OW2 R;  3TJ8 A;  2Z2Y B;  1QAI A;  4OX7 A;  2DJW A;  4CQ1 A;  3EZU A;  2DD8 S;  2K1R A;  1H6K X;  2IAJ B;  2G0I A;  4V19 J;  4JI1 F;  3OR1 A;  4PG5 A;  1H0H B;  3PDN A;  3IS9 A;  1VOM A;  3LOU A;  5B0A A;  1SJQ A;  1RE1 B;  3SMZ A;  4UST A;  1IKW B;  3CC4 S;  2W2O P;  3FQL A;  3L09 A;  2MYF A;  3WQP A;  2QA4 G;  1WEY A;  1MRO B;  4J9K A;  1FA0 A;  1JJ2 R;  1J5O A;  4K2J A;  1SI9 A;  1KDN A;  4GVB B;  3QRP A;  1N5S A;  4DV7 F;  3GIR A;  2VA2 A;  4DCO B;  2WZ1 A;  4P2F A;  5HMW A;  2E1R A;  1ZS6 A;  2HVD A;  1RYS A;  2OEL A;  1XR7 A;  3DLJ A;  3QID A;  3GYX B;  3CJK A;  2ZD1 A;  1B99 A;  4EWT A;  3MAQ A;  3PXG a;  3R27 A;  3EJM A;  3C6T A;  1VQM S;  3C14 B;  1OIA A;  4DUY J;  2IM3 A;  4LIR A;  2W9A A;  2CPD A;  4ZIW A;  2V50 A;  1EP4 A;  3OPK A;  3NGS A;  2MGZ A;  1BWV A;  5C24 B;  1C0U B;  3H42 A;  4I1T A;  1S49 A;  4CP5 A;  3AJ2 A;  3CJ4 A;  4DR2 J;  2EK1 A;  1X31 C;  7FD1 A;  2QRR A;  1SH0 A;  4AXI A;  1NRK A;  2D1C A;  1YRT A;  4ZJL A;  1SJ1 A;  2VG6 A;  1FE0 A;  4YY3 J;  1JJC B;  1YSJ A;  4DN9 A;  3QWP A;  4NLG A;  2G9O A;  1R43 A;  1KD1 T;  3TA1 A;  4TQR A;  2BOA A;  3CF5 Q;  2H1Y A;  4R5P A;  3G2X A;  5HP1 A;  1MWZ A;  1KFD A;  3PRD A;  2CZV C;  3VVT A;  1OJ4 A;  2L9D A;  3M4X A;  1SCJ B;  1KLM A;  2FHJ A;  2HZV A;  1FO1 A;  2QIF A;  4FZV A;  1AA1 B;  5DZ6 A;  1O51 A;  3AA9 A;  5KFZ A;  5AXK A;  1LV5 A;  1X4E A;  4USK A;  1R27 B;  1NPR A;  2E7W A;  3VAH A;  3FSX A;  1TL7 B;  4ZJQ A;  2XSF A;  3CCU S;  3MCN A;  1YKW A;  1XMB A;  4OJ3 A;  4Y28 C;  1N32 J;  4TNO A;  1D8Z A;  4UTG A;  1Q0N A;  3SCK E;  1GNK A;  1DHM A;  3C3L A;  3MM9 A;  2JJ4 D;  1P9Q C;  2LLZ A;  2M7S A;  3D1H A;  4U7U D;  2DR7 A;  1FRJ A;  1YZ7 A;  1HBM A;  3BBC A;  2D41 A;  3CVK A;  4OI0 A;  4NWB A;  1FXL A;  3FFI B;  3OVS A;  3GSI A;  2CQ3 A;  3HVR A;  4IH7 A;  1KQG B;  1WHX A;  3OTE A;  2DR5 A;  1XBW A;  1TMM A;  1LWE A;  2KRB A;  2C2K B;  2JC0 A;  1D8Y A;  1RTI B;  4RW7 B;  2UU9 J;  2LU1 A;  1AUS L;  4B3S J;  4GRS A;  5DLG A;  2Q79 A;  4TN2 A;  1RU2 A;  3G9C A;  5CYQ B;  4ZCK A;  5EN1 A;  5SUH A;  1T9W A;  2NS1 B;  2W4D A;  1N5Q A;  2CNK B;  2CRL A;  3KDN A;  3T19 A;  1SPB P;  2ROG A;  3K2Y A;  3HI9 A;  1U47 A;  2AMC B;  1FES A;  2QZ8 A;  1U1P A;  1U1M A;  2X3D A;  4X84 A;  4HR2 A;  1U1L A;  2B7B B;  2DIT A;  1YRX A;  4MK8 A;  4ZS6 A;  3O2I A;  4AT1 B;  4X4S A;  1TEL A;  3NGR A;  4NXM J;  1SJ4 P;  1PAU B;  5KT3 A;  1REV B;  2GW8 A;  3UN3 A;  4HL9 A;  3B54 A;  2FGO A;  3FBC A;  5J2P B;  4KO0 B;  2OD4 A;  4OQJ A;  4FNI A;  2PII A;  3QMQ A;  1CJT B;  2N4C A;  1HNI A;  2CQ1 A;  4RL1 A;  3KK1 B;  1Q8I A;  3N01 A;  4DMZ A;  4XK8 C;  2A6M A;  4RBT A;  5IWA F;  3TO8 A;  1S0V A;  2ZEJ A;  4L72 B;  1Z2Z A;  3KXD A;  1S4E A;  2BE9 B;  4XDC A;  3LP2 A;  1C2P A;  3MCS A;  3TQE A;  3R5D A;  1F6T A;  4QR1 A;  4QCL A;  3DDN A;  4DFJ A;  2IA6 A;  2I9S A;  1JKH B;  5HN0 A;  3UD3 P;  1DQA A;  1N36 F;  1UJ5 A;  1LXJ A;  3IMQ J;  4LF7 F;  3I9V 9;  3KJF B;  5L1K A;  3SDE A;  4UQT A;  3CCM S;  2IJF A;  2ZUG A;  2G1D A;  3OR2 B;  1PIE A;  3MAA A;  1WI8 A;  3M2V B;  2BKO A;  3OFH A;  3QSI A;  2D3Z A;  2IIH A;  1FJ7 A;  4P7T A;  3VR1 A;  3T1Y J;  1FRX A;  3ZFV A;  3H4B A;  3T9Z A;  3R5G A;  5DQH A;  5EWG A;  3DU5 A;  3CO9 A;  5LMU J;  3KG0 A;  3EYZ A;  2PA8 D;  3T6B A;  1S97 A;  2FLN A;  5CYM A;  3MUR P;  3Q23 A;  4ZHR B;  3CO0 P;  3K5M A;  1FRI A;  2RD5 C;  4M5H A;  1VBY A;  2JL9 A;  2Z4P A;  4LF5 J;  2OPS A;  3C8Y A;  4LF2 A;  5T14 A;  2PSZ A;  5LOQ A;  4B9N A;  1R89 A;  3GIL A;  1X4F A;  3MR7 A;  5CZV A;  1EB0 A;  2IVM A;  1RTJ B;  2CQ4 A;  3VGU A;  3X3U A;  3NRB A;  1ZH5 A;  2LP4 A;  4NLP A;  3DXB A;  4J9P A;  3MOZ A;  2PI5 A;  1U1K A;  4C8O A;  4DX8 H;  2JHE A;  5KFO A;  2ZH2 A;  3UFC X;  5EDW A;  1UVM A;  1SKU B;  2D7S A;  3F73 A;  3M6U A;  2L9N A;  2XHC A;  3CCE S;  3ZZR A;  4BBY A;  3KMS A;  4F2S A;  2PD1 A;  2QSF A;  4HEA 9;  1KVJ A;  1YJW S;  3NGK A;  2AGQ A;  3VTI A;  3JSM A;  1N32 F;  3DYA B;  4MTP A;  3KLE A;  2BM1 A;  2JWN A;  1Y7P A;  4P2X A;  1KVI A;  2CKW A;  3V6D A;  1UZH A;  3CD6 S;  5HJX A;  1B0P A;  3THV A;  2UUC F;  4PWW A;  3HKZ D;  3ICL A;  4I56 A;  3WIV A;  3M2R A;  5F9L A;  5GME A;  3D4J A;  1N5T A;  3KDO A;  2DYA A;  4M5I A;  2E5L J;  3UQS A;  4DUZ J;  3HMJ G;  3BZQ A;  2DGS A;  4TY8 A;  4OLO A;  1RHJ B;  1JLA B;  2XLJ A;  1JNR B;  1HQU B;  2FGC A;  1SH2 A;  3NCQ A;  4YR0 A;  1HNZ J;  5DQI A;  2OAU A;  4NLD A;  1F9E B;  1WDT A;  3MMB B;  2W1B A;  4MAK A;  5J2N B;  4F7V A;  2QL9 B;  2CJY B;  4OI2 A;  4UW2 A;  4EU0 A;  2GJF A;  4CZC A;  2EFO A;  1FX4 A;  1XMO F;  1UFK A;  4MIW A;  3MFH A;  4B3S F;  2FJB B;  4IR1 A;  4ZPT R;  4IH5 A;  4CO5 A;  1V3R A;  4LFA J;  1TKX B;  4NEZ A;  2JEI A;  2XYH B;  2DRA A;  3SFG A;  3FC9 A;  2MZS A;  1HMV A;  2MKI A;  1NJI T;  2BAN A;  4DFK A;  3HJV A;  2I6W A;  3ET6 B;  1NME B;  3CED A;  2ASL A;  4OZ0 A;  1TL4 A;  3TA0 A;  4LF9 J;  1S9G B;  1UEK A;  2QMX A;  8ATC B;  2F9D A;  1HI8 A;  1CQN A;  4ED2 A;  3LWM A;  2F8M A;  2HSE B;  1W2B R;  4DR1 J;  2QSW A;  4RR5 A;  2WB1 D;  3W2W A;  4LR7 A;  1UZD A;  1FK9 A;  3RB6 A;  3PJW A;  1YVF A;  1TUW A;  4ZPC A;  1R8H A;  3UDL A;  4DV3 F;  2B4P A;  2MQ8 A;  2CPF A;  5GMK a;  3EGN A;  4K4X A;  1VQ7 S;  1RHQ B;  2GQ2 A;  2YKP A;  4QBU A;  5DG9 A;  4MMO A;  3WX8 A;  4BCA A;  1U1R A;  4LVO P;  1SKS A;  3BF4 A;  4F3Q A;  1WKJ A;  2UXB J;  3R5J B;  2MLZ A;  1FNO A;  1XIQ A;  3HT3 A;  2GNK A;  1SQG A;  3FBE A;  4F3O A;  3IM9 A;  2MDA A;  1RI7 A;  3NNC A;  4WTY A;  1ZM2 A;  1VC0 A;  4Q0B A;  1NHU A;  4JYA J;  2J7U A;  1U26 A;  3ISN D;  2XZW A;  4JV5 J;  2J9C A;  4HTJ A;  3OL6 A;  5CAB A;  3CDA A;  4ES2 A;  4NLS A;  4DV2 J;  1CC7 A;  4WTO B;  2HRU A;  1U09 A;  2DEI A;  2DXF A;  4B3T J;  2IC3 B;  1EKS A;  4FS1 A;  1URR A;  3R5B A;  4IFV A;  3RW6 A;  1QAJ A;  4QW9 A;  3IBC B;  1K0V A;  1L3U A;  2BM0 A;  2OSR A;  3NLC A;  3EPG A;  1WSR A;  1RT7 A;  3TAM B;  4AD6 A;  3CJ8 A;  2PE8 A;  2IPO B;  4O44 B;  1S9E B;  5E5N A;  1CS4 A;  3D6F B;  5BYQ A;  1YJN S;  2XNR A;  2RT3 A;  4QW8 A;  2ZH6 A;  4ELV A;  4PCQ A;  4LBI A;  4JP8 A;  1OYD A;  2DRB A;  2G2Z A;  2GX8 A;  4C0H A;  3W60 A;  4KGZ B;  2QEX S;  5B0D A;  1Z1Z A;  3T6J A;  1R8A A;  3MR3 A;  3UNY A;  1NK9 A;  2IJR A;  1F2G A;  4ZVP B;  1HWK A;  2DEJ A;  2IRX A;  2W25 A;  2DNY A;  2GMJ A;  4X66 J;  1QDU B;  2K3K A;  1FXR A;  3ENW A;  3Q2T C;  1FHT A;  3GB0 A;  2IYI A;  2AJ2 A;  4TXS A;  3M32 A;  2RKI B;  2JDJ A;  1Y3J A;  1YBU A;  3AFG A;  3M6W A;  4KE5 A;  3SQO P;  2KL8 A;  3IR7 B;  1X4B A;  2XZT B;  4H54 A;  5HLF B;  3PX6 A;  3X1L B;  2ZWO A;  3RBZ A;  2NLW A;  3W66 A;  4B9M A;  2H3E B;  2HPU A;  2C22 A;  1U6Z A;  2BV3 A;  1VC6 A;  2YNH A;  1XNQ F;  2ZFH A;  4C8Y A;  2IDL A;  4WXO A;  5EX3 A;  2SXL A;  2I0X A;  4ANC A;  5B0G A;  4NLR A;  2IY5 B;  5AT1 B;  1Y5N B;  4PQA A;  2DNQ A;  2MKY A;  3OT9 A;  2MXY A;  2B9W A;  3KLF A;  2C2R A;  1CG2 A;  4DV4 J;  3J81 Y;  4U6P A;  3I87 A;  1U1N A;  2RAQ A;  4K4W A;  3BGU A;  3J7A 1;  1MN9 A;  2ACY A;  3LP0 B;  3VHQ A;  3QAT A;  4NLO A;  5GAD U;  1K1Q A;  1RBL A;  3GV8 B;  1T7P A;  1WWH A;  3GIM A;  1EQ0 A;  3L7P A;  2LA6 A;  4RZR A;  1T02 A;  2BE2 B;  4ECQ A;  2JNJ A;  3PG9 A;  4NCG B;  3ITH B;  4MFB A;  4TY9 A;  1NLK L;  3KNA A;  2GAH C;  4WFZ A;  3PR5 B;  4KFB A;  4NAS A;  4A8S A;  2DR9 A;  3EXY A;  1Y3K A;  5CYJ A;  1C1C A;  2H54 B;  3BR8 A;  3MMA B;  4O4R A;  1HNW F;  5HO4 A;  3FMW A;  3OXG A;  4ZHR A;  2J7K A;  3K89 A;  2Z0G A;  4U8Y A;  2M9K A;  2MSS A;  2ILZ A;  3H5U A;  2G2Y A;  2D3O R;  2H9Z A;  4PAA A;  4LFB J;  2LU2 A;  1JJH A;  3B78 A;  4Y6I A;  4NZ6 A;  2UXB F;  2C28 A;  2RDD A;  2HLT A;  2FZG B;  1XK8 A;  5K8P A;  2HIY A;  3TP2 A;  5KFA A;  1PJ7 A;  1DUR A;  2FD2 A;  3NAI A;  3UVJ B;  4F4Z A;  3ZZ0 A;  3G6X A;  3LGN A;  2IDE A;  3KK3 B;  3KLH B;  3IN5 A;  1VFJ A;  2QC3 A;  2ABY A;  1LW0 A;  4DQS A;  2F8H A;  3ILJ A;  1VLO A;  3Q86 A;  3TR5 A;  5CXT A;  4M5G A;  3N79 A;  4LSZ B;  3ZTO A;  4EGL A;  1MLA A;  3M8Q A;  2DCL A;  3AXM A;  2AKW B;  4KHR A;  1NU4 A;  3MCM A;  4M8L A;  1UJ4 A;  3TRG A;  4GVL A;  2ZH1 A;  4YDD B;  4B3T F;  4E8U A;  4F04 B;  1OY9 A;  4FF4 A;  3MD1 A;  2E44 A;  2IHR 1;  4YHH J;  2HK3 A;  3K8W A;  3CCL S;  1EJ7 L;  2DO4 A;  2PEH A;  3OVA A;  5HRO A;  4QOT A;  3QT8 A;  4HH0 A;  1SUQ A;  3FEY B;  3BGO P;  1S1X B;  3NBP A;  1JLA A;  4QYZ K;  4EFA C;  3QRQ A;  5IQQ A;  2CJA A;  4LBH A;  4LF6 J;  3PW5 A;  2HFO A;  2HBQ B;  2IYG A;  1A9N B;  2MHE A;  1NCL A;  1PJ5 A;  3PFE A;  4J9Q A;  3KUG A;  5F9N A;  1MML A;  4RW6 A;  2ADC A;  4FDF A;  2D74 B;  2X51 A;  3OL7 A;  2AX1 A;  2HLU A;  1FFS B;  1RWM B;  3HT0 A;  4A8X A;  2C2Z B;  1Q8K A;  3PV8 A;  4ECT A;  3LF0 A;  3C6U B;  4WP8 A;  1TKX A;  2PA3 A;  3O6Q A;  3GIJ A;  3P3D A;  4C98 A;  2BOP A;  4Y0F A;  5KFV A;  3GTY X;  5E3Q A;  2AZ3 A;  3ET6 A;  1ELO A;  2DNG A;  4J9S A;  4PWD A;  3SQG A;  4DR7 J;  1VMB A;  4ILM A;  4DL3 A;  1X9S A;  1DTT B;  4LRE A;  3OTB A;  4HDG A;  5KG7 A;  3PTW A;  4CLL A;  4K4T A;  2W4C A;  1ZA1 B;  1ZPW X;  4ELU A;  1RT2 B;  1ZZF A;  2MQM A;  3M2U A;  2HHH J;  1RTD B;  4D3H A;  2V34 A;  3QT7 A;  4DSJ A;  3HSJ A;  2J76 E;  2GHW A;  3H5X A;  2HND A;  1ZAX A;  1BY9 A;  2W24 A;  3EZO A;  1WEL A;  3IA0 A;  4DS4 A;  4IKA A;  2D9P A;  2CWX A;  1F9F A;  2A1B A;  1KQS R;  1HD1 A;  3L7O A;  1HKA A;  2MKC A;  3OUY B;  5K8N A;  3SEO A;  2HWH A;  2OFH X;  3I5B A;  3HPO A;  3UDE A;  1FEE A;  3CJ3 A;  4EK2 A;  2E5H A;  2CPZ A;  1S77 D;  2HVZ A;  4HAC B;  5K5M A;  1GH8 A;  1S6Q A;  3V6J A;  3C46 A;  2CIM A;  2MEW A;  4MT1 A;  3VAG A;  2HEK A;  4DV4 F;  2DR8 A;  4ZPV R;  2VF3 A;  1YZ6 A;  1U7L A;  4C97 A;  4JUZ A;  1QD1 A;  5I42 B;  3PW0 A;  4UF4 A;  5M2R A;  4K5S A;  3HCX A;  2A6O A;  2M8H A;  3DRX A;  1VQN S;  1YG0 A;  3J81 U;  5A8R B;  2POK A;  1NK7 A;  2L48 A;  2I1R A;  4F25 A;  3HM9 A;  3FNN A;  1S4F A;  4DJB A;  3JQJ A;  3MMC B;  4RUC A;  5KTQ A;  4URQ U;  3A1Y G;  3IRX B;  3QRR A;  2VG7 B;  4PEO A;  1YJ7 A;  3MEC B;  1C1B A;  4NLX A;  4RW4 B;  1AFI A;  1BD6 A;  4ENO A;  3ONQ A;  2AW0 A;  1RKI A;  2EFV A;  5GVQ A;  2ZOG A;  2XWY A;  4LJM A;  4FPI A;  4WII A;  3MEK A;  2AQ4 A;  3TAM A;  1CJV A;  5G0R B;  3CCV S;  3GON A;  4OX8 A;  2Z30 B;  2GJI A;  3ZNJ 1;  3DHW C;  5M2U A;  1PYO B;  4DQR A;  4OYO A;  2C2M B;  5D3G B;  1FKO B;  2RH3 A;  3ZNU A;  4GO7 X;  2EBE A;  3VAL A;  4C2M A;  4DSE A;  4MKY A;  1BQX A;  4IRK A;  1AFJ A;  1R7I A;  1D0E A;  2HGL A;  2J5A A;  2C1E B;  7FDR A;  4YEA A;  1JLQ B;  1KTQ A;  4NLV A;  3EDQ B;  1FI4 A;  3POT B;  3VF0 B;  1BHN A;  4ZMM A;  1XN9 A;  2YWF A;  3RAM A;  2RS8 A;  2J0W A;  3GP9 A;  3DGV A;  4U95 A;  2COL A;  2B43 A;  3RG6 A;  2C2O B;  3M8P A;  3BEG B;  1HA1 A;  2KT3 A;  1D9D A;  3GFX A;  1MWY A;  3PHE A;  5HVF A;  1UA0 A;  2KH9 A;  2HWI A;  2IVY A;  2O3D A;  2C3O A;  2VQF J;  1FWP A;  4G1Q B;  4OYM A;  4DS5 A;  1F5C A;  2W4P A;  5HLF A;  4UZB A;  4OLP A;  2GJ2 A;  5F3T A;  1N0V C;  3GG0 A;  4DV0 J;  3DDI A;  4YHH F;  4CNY A;  2IM1 A;  5HAO A;  2XB2 D;  5T41 A;  4TU8 A;  3TEH B;  4HDH A;  4KB7 A;  2XS7 A;  3QQC D;  4G65 A;  4OMF G;  5IXU A;  3GV7 B;  2YBV A;  1PJ6 A;  2KYX A;  3CT9 A;  1KP6 A;  2V4R A;  1Y5L B;  1OO0 B;  4LF6 F;  1X7V A;  2CJK A;  5ADZ A;  2I8E A;  2VAS A;  3QFW A;  1NK0 A;  3BGR B;  4JI6 J;  1S1T B;  3IP0 A;  4JI7 J;  2WB4 A;  4MKB A;  3FK4 A;  1IKY A;  1R8C A;  1NDL A;  4X62 F;  1NKC A;  1VBZ A;  3W5Z A;  1I94 J;  3UN5 A;  2RF2 B;  3PVX A;  1HBU B;  1FVS A;  2Z57 B;  4P2S A;  3H2U B;  5EWF A;  2V2K A;  2IJN A;  2BE2 A;  3MHY A;  3T1A A;  3CCQ S;  4P2M A;  3CCZ A;  2UZA A;  3ITH A;  4PKD B;  1RAE B;  3FDS A;  1M5O C;  2XO6 A;  1Q78 A;  3ZZO A;  2W8K A;  3SSR A;  2HS3 A;  2JSX A;  1ZET A;  1ZA2 B;  2BA9 A;  2EG2 A;  3LP1 B;  4ILL A;  3D68 A;  1MWQ A;  1VQY A;  1A6L A;  2XMW A;  4IQM A;  5DG8 A;  3PCO B;  1YQH A;  4DFM A;  2H5J B;  2CFX A;  3QBC A;  4XPE A;  5KFN A;  2QO3 A;  4A8F A;  2J7W A;  2V67 A;  2CNO B;  1QSS A;  5AXL A;  3BJY A;  5KFI A;  4DX6 A;  2KO1 A;  2Y9H A;  4PXE A;  2LMI A;  3SV4 A;  4Y34 A;  1YBA A;  2YNF B;  1NK5 A;  4H4K C;  2HVH A;  2FZC B;  3FZB A;  4OYP A;  2C2E A;  1UPM B;  3S6E A;  2FVR A;  4KHP J;  4PXD A;  4JOU A;  4G6V B;  4IFY B;  5KT4 A;  1S1V A;  3KLG A;  3QJJ A;  2E66 A;  2EK6 A;  2BW7 A;  2XM3 A;  3CUN A;  2OHD A;  2B8P A;  1KOH A;  3L9Z A;  6FDR A;  1NK6 A;  3R8Y A;  1FCA A;  4X65 J;  4DXL A;  2B4O A;  1YJR A;  3L7U A;  2JRS A;  2HHV A;  1RT3 B;  1Z2L A;  3PR4 A;  2XMM A;  2XEX A;  1WHV A;  2CZ4 A;  1B4S A;  3FSY A;  4RBU A;  3V5R A;  3HP6 A;  1TR0 A;  4NYP A;  1IN0 A;  2ZKT A;  4X4P A;  1SC6 A;  3HD2 A;  3TOQ A;  4ZK7 M;  3W9I A;  1MW7 A;  2BKN A;  2QE5 A;  2XQC A;  1IJF B;  3QLH B;  2CPI A;  2AT1 B;  2HNY A;  3G71 S;  3G96 A;  1SQE A;  1TUG B;  2UVV A;  5IC6 B;  4OZ3 A;  3P49 B;  4KGX B;  3CSK A;  2ASY A;  2OH2 A;  2B9Y A;  1IXK A;  2BJ3 A;  2UUA F;  4ER8 A;  2M5Y A;  1MU2 B;  3R97 A;  4CH7 A;  2FDN A;  1VC5 A;  4YB6 A;  4KJI A;  5IT9 Y;  3DGP B;  4MYU A;  1IR1 A;  5DDO C;  4XO0 A;  5CZX A;  4F4A A;  5C42 B;  1EZZ B;  1H74 A;  1IKX B;  1LXN A;  3PYG A;  2W9B B;  1DBD A;  1MNE A;  3TI0 A;  2FJE B;  2V2Q A;  2DH9 A;  2AYB A;  5KT5 A;  2HHU A;  4N47 A;  3J7Z 5;  3QIP A;  4CO4 A;  3PX0 A;  1UEU A;  4YOE A;  4WZQ A;  4J9M A;  2NCK L;  2OO4 A;  1K9M T;  2R8H A;  4KKO A;  1NB7 A;  2VQF F;  3CIM A;  1LW2 B;  3NS6 A;  2DNR A;  3D0G E;  3FSI A;  1RTD A;  4ZPD A;  3Q83 A;  2RVJ A;  2V4J B;  4DV0 F;  2FVS A;  2HFU A;  4F0M A;  1DLO A;  2ROP A;  3BBB A;  4P73 A;  1RWN B;  3RB4 A;  1RCO B;  3VGT A;  5HJY A;  2F1F A;  5J1P A;  1TK8 A;  3M8R A;  5HK4 A;  1WOR A;  2VUG A;  2DRD A;  1XMQ J;  4HAC A;  2IFX A;  1CJK B;  2QYC A;  1K8A T;  2H5E A;  4QR0 A;  3D1O A;  2ZH8 A;  1FJC A;  2AJ4 A;  4P71 A;  2LVW A;  4JI7 F;  4IRD A;  2CNN B;  4JI5 J;  4OHV A;  4O3P A;  4C8Z A;  4UOH A;  4DR5 F;  4I2P A;  5KAK A;  1DTQ B;  1UWB A;  1D09 B;  4HHH A; 
#chains in the Genus database with same CATH homology
 2KL8 A;  3D3B J;  2VQE J;  4DV7 J;  5BR8 J;  1HR0 J;  4NEY A;  3W1Y C;  2MTL A;  4DR2 J;  5LMN J;  4JI4 J;  4B3R J;  5A2Q U;  2MQ8 A;  3D3C J;  1XNR J;  4RJV A;  1HNW J;  1FJG J;  2UXC J;  3R2D J;  4B3M J;  2KVQ E;  4JI2 J;  2UXD J;  4X64 J;  4DR7 J;  1IBM J;  4DV1 J;  4V1A k;  4X62 J;  1N33 J;  2UXB J;  4YY3 J;  4JI0 J;  3J81 U;  3T1Y J;  4JI6 J;  4LFA J;  4NXM J;  4NEZ A;  4LF4 J;  4JI7 J;  1IBK J;  2UUC J;  4LFC J;  2UUB J;  4KYZ A;  4YHH J;  2UUA J;  4HHU A;  5LMU J;  4DV6 J;  5IWA J;  1N34 J;  2HHH J;  1I94 J;  4AQY J;  3T1H J;  4NXN J;  4DV4 J;  4GKK J;  1J5E J;  4JI1 J;  2F4V J;  4PWW A;  4LFB J;  4GKJ J;  4LF9 J;  4KHP J;  4JYA J;  4DV5 J;  5FLX U;  4KY3 A;  4DR4 J;  1XMQ J;  2VQF J;  4JV5 J;  2UU9 J;  4LF6 J;  4LF5 J;  4JI3 J;  4JI8 J;  1N36 J;  2E5L J;  3OTO J;  4X66 J;  4DR5 J;  4DUZ J;  5IT9 U;  3J7A N;  4B3S J;  4DUY J;  4DV2 J;  4LF7 J;  4LF8 J;  4DR3 J;  3R2C J;  1HNX J;  4DR1 J;  5LM7 E;  1IBL J;  4DV3 J;  4B3T J;  3JAM U;  2ZM6 J;  4DV0 J;  5AJ3 J;  4JI5 J;  4OX9 J;  1HNZ J;  3J80 U;  4DR6 J;  1N32 J;  3IMQ J;  4X65 J;  1XMO J;  4K0K J;  2MEW A;  1XNQ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...