1FJGJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1fjgJ00
3W1YC 5BR8J 5FLXU 3J81U 4B3TJ 2MTLA 4K0KJ 4JI5J 4X64J 2E5LJ 2KVQE 3J7AN 4NXMJ 4YY3J 4LF9J 1XNRJ 1I94J 1N36J 4X66J 1J5EJ 1FJGJ 4GKKJ 4V1Ak 1N32J 2VQFJ 4DR1J 2UUBJ 4JI0J 4LF6J 4DR7J 1XMQJ 5LM7E 4LFAJ 4KYZA 4JI1J 4JI6J 4NEZA 4LF5J 4NEYA 4PWWA 4JYAJ 2UXBJ 4KY3A 4B3RJ 4DUZJ 5LMUJ 4JI3J 5A2QU 5IT9U 1N34J 4DR4J 4HHUA 4RJVA 2HHHJ 4JI2J 2MEWA 5IWAJ 4DV0J 4JV5J 3IMQJ 1IBLJ 4DV3J 2UUCJ 4DUYJ 1HNZJ 4B3MJ 4DV4J 4LFBJ 2F4VJ 4GKJJ 1HR0J 1XMOJ 4LFCJ 3T1YJ 4JI8J 4DR5J 4DR3J 1HNXJ 4DV2J 3D3CJ 4DV5J 2UXCJ 4DV6J 3R2DJ 4DR2J 4YHHJ 1IBKJ 4JI7J 3T1HJ 3R2CJ 2KL8A 4B3SJ 4DV1J 3J80U 4X65J 2MQ8A 2UXDJ 2UU9J 2UUAJ 1HNWJ 3D3BJ 3JAMU 2ZM6J 4LF8J 1XNQJ 4LF4J 4KHPJ 5AJ3J 4LF7J 5LMNJ 4X62J 4JI4J 4DV7J 3OTOJ 4AQYJ 1IBMJ 4OX9J 4DR6J 4NXNJ 2VQEJ 1N33J
chains in the Genus database with same CATH superfamily
4Y0FA 2A1BA 3FCWA 2G0IA 2ZKUA 2B9YA 1YBTA 3UR0A 2NPIA 2NSBA 1SPBP 4IDKB 4LRAA 4IFVA 2EW9A 2IJRA 2RU3A 3K58A 3PW0A 4RNNA 1IWAA 2DKOB 3EVMA 4FKYA 4DQIA 2DNNA 2ZC4A 2GX8A 1UPMB 4LF2A 3JQJA 2ROEA 1ITPA 2CPEA 2CYYA 5IFMA 1PAUB 3I9V9 4CH1A 4FPRA 1S1UA 3GCXP 2LVWA 2JC0A 2V94A 3AY0A 4CNYA 3AA9A 1HYSA 2O5DA 2V9KA 3KG1A 1RT3A 4S0MA 5IV4A 1NM2A 3CJKB 3MMCA 1DLOB 5IT0A 2LQBA 3CVKA 1GMWA 2VFVA 3A13A 2QIFA 1FXDA 4DX7A 5F9NA 3UCUP 2V5HG 3MAHA 4B3RF 2MPUA 3HVAA 4I6AA 2HRTA 3LOUA 3LALA 5M2PA 5C5JA 2YQ0A 2BKPA 1DFDA 3DRRB 2C2ZB 1HBMB 1HBUA 3PY8A 5LM7E 5K5MA 2J6SA 1S10A 2R7OA 1ROFA 4RW8B 1W25A 2HQDA 1CJUB 4ZCKA 1BWVA 2ZITA 4QWDA 5D4OA 1H3DA 3DU6A 1T03B 4ZVGA 3CW2C 1RT4B 1W26A 3H2VE 4OZLA 1ZYQA 2CWXA 3MUTP 3QPIA 3CDUA 1RT1B 2Q3PA 2MKSA 3KLIB 5B0DA 2C3PA 2DO0A 2E5HA 3QWUA 3F0NA 1FCAA 5A6WA 3W5ZA 2PIIA 1OY6A 1F9HA 2CA9A 2N3LA 2AJFE 4X4TA 2KTQA 2Y1IA 5U47A 3M8ZA 1NEEA 2FJAB 1NPRA 4YQWA 1S6QA 2K06A 5B0GA 3RBDA 4JUZA 4X62F 3K57A 1GMWD 1X5PA 2K1RA 1NO8A 3D0HE 1B7FA 3HVWA 2DR7A 4DR6J 3QWPA 3TUIC 1CJVB 1I94J 1YDLA 2DYAA 2QGFB 3EUNA 4B17A 3W62A 2HVDA 3PTWA 1ZPVA 4EBCA 1FWPA 1LXNA 3BBBA 3NGTA 5CYQA 2JHEA 1FRMA 3PO4A 3A3PB 1A6LA 2FLPA 4IR9A 1DY3A 4JI3J 2X1FA 4JI2J 2NXUA 3KK2A 2LCWA 4U95A 4K4TA 2OEJA 2W24A 2J5AA 4GVLA 4PAAA 4F36A 3S01A 4DV5J 3GIMA 4DZ6A 3BGRB 1WI8A 3HSDA 1NSAA 1Q5VA 3OD2A 2H48B 5AE2A 1N52B 3DDIA 1SQFA 1WC0A 2Q79A 4KKOA 2AGQA 4Q8FA 2AJ1A 4HDHA 3F41A 4WZQA 3OTOJ 4RUAA 4DL6A 4OX6A 3OFGA 3EXYA 1WC6A 2WW4A 3C16B 4QIWD 1ZAXA 3K5MA 2NS1B 3ENAA 1RADB 4WFZA 3W65A 4ZP6A 2NZ4A 1SH0A 1T9VA 3QLHA 4PXDA 2MJNA 2WSCC 1TK5A 1NNDA 2HHHJ 1D09B 3BYPA 1RAGB 5ETVA 2OSQA 5RUBA 2DVIA 1GMVA 1HQEA 4M5DB 5KFGA 4TYAA 5KT6A 2O3DA 1R0AB 1S1WA 1U4BA 3GFXA 4A8MP 1VQ4S 3MAAB 5F3TA 3CCRS 1X0PA 2E1MC 3M2VB 1U1OA 2WB4A 1KQSR 1NK4A 2HBZB 2NR0A 2MQ8A 2CIMA 1S6OA 1J5EF 2RJZA 1DARA 2AYEA 3LAKA 3GZ7A 4NZ6A 3RYLA 3OSPA 5F8IA 3VGUA 2VODA 3VAGA 2AYGA 3D67A 1HHQA 2DIVA 3LANA 4C3LA 3MFIA 5I42A 5E3PA 3TZWA 5KFTA 4X4PA 1KVJA 3QIPA 2RVJA 4IRCA 4OYPA 3J7ZT 3F73A 5GADU 2Y3YA 3P6YC 4ANCA 3HXMA 3DLKA 1XQIA 1S7IA 2DB1A 2NUUG 2HKEA 3QBCA 2PMZD 2RKIB 3L7UA 1QAJA 4TN2A 1S49A 4ELUA 3FBBA 2LECA 1SUQB 4WZMA 3H5XA 1LQ9A 4EMDA 3VZHA 3BO4A 4DV4J 3M30A 1FRJA 2V8DA 4ECWA 2QL5B 2YX7A 1OIAA 4AQYF 1CVJA 5KFQA 1S1VB 2KZZA 2KXHA 3MEEA 4RBVA 2FUG9 2VPXB 1RWUA 3UNGC 2W01A 1JLEB 2CPZA 5HLFA 3HHLD 1YI2S 3TJAA 4DV7F 4OX9F 2V2VA 4ZP9A 3ELHA 3MTJA 3NGKA 2VG6B 3PACA 3N6LA 1FJGF 3VAIA 3M2RB 3U1LA 5J1PA 4NLPA 2HNZB 3KUHA 2UV8A 1NDLA 1U0HB 5IQ6A 4I2QB 3D1OA 1D9DA 1SIWB 4ITSA 4WE1B 4U6PA 3LAMA 4XPEA 3CCVS 3RBXA 3KYLA 4PPDA 5KFBA 2VOPA 3QJLA 3PR4A 4OFZA 2LP4A 4QPTA 2PI4A 2D1CA 5D6GA 2LEAA 4DL0C 2ZEJA 1IKXA 1H2TZ 3OV7A 4P75A 3ZZRA 5D4PA 1VRUB 4DV1F 4YB1P 2L08A 1GX6A 1GXTA 1U26A 5HMWA 2VG5A 5ETRA 1SIZA 3PCOB 5GAGI 5CZXA 4EI2A 2BJ8A 3QT5A 1JLBB 4NLGA 3HT0A 1QDUB 1YG0A 5LJ3Y 1X4BA 1VOMA 4DN9A 3Q8QB 1WG5A 3ZNUA 1ZZNA 4ID8A 4LIRA 3BPDA 4G1PA 4X4UA 1K9MT 3T41A 3PFOA 1T0TV 3OVAA 4GKKJ 1D9AA 2ZH4A 4F3QA 3UE2A 2YWFA 2HFVA 3FZBA 3G96A 1FNXH 4NEZA 5KFKA 4QCLA 2MGZB 4Q2MA 1T05B 1UETA 4MTPA 3S6EA 1SV5A 1VRTA 1OQ3A 1K1SA 3BGLA 3N4WA 4PG4A 1U09A 1P9YA 3M6XA 1F2HA 3LGHA 3PYEA 2EBEA 3LP1B 4FBTA 3DYAA 3JSBA 4YB5A 4CTAA 4X65F 5C42A 1K0TA 4PKDB 4U7CA 5GAHU 2NCKL 1SL0A 3V81B 4Q5VA 2JEGA 3IS9B 1OMSA 1YJNS 3N28A 1TKXB 1HMVA 3WQPA 3HHDA 3CC7S 2YKOA 2HPUA 4DQPA 1DBDA 1JLQA 3KJVA 2WOMA 4JI0F 3K2YA 2CJQA 4RW6B 1XWLA 1PCAA 2EPIA 2ASYA 1S79A 2DTJA 4LFAJ 1EZZB 3HVTB 3RB3A 2B3TB 3UO0A 3V4IB 5F8JA 3D6TB 3KLGB 2VB6A 2EWHA 4F4WA 2QFJA 3LPYA 2R8GA 1SQGA 3TAQA 1IJEB 2J0QD 2R3VA 4P6QA 4PG8A 2HURA 3HHLB 1IBLJ 3CCSS 5DS7A 2J8AA 3PM9A 2UZAA 3FJ2A 1N5SA 2CUYA 1YZ6A 2AIRB 4KT0C 1RTIA 3JQKA 2OPPA 3CDBA 2NYIA 2OELA 3CIMA 4EK2A 2M88A 5HATA 5F8MA 1RTJA 2QSFA 2CRLA 2ALYB 1WHVA 2MQNA 2E9TA 1LK5A 3NBPA 3EZUA 4ZPWR 4EBEA 1C1BA 2IPOB 3R27A 1PJ6A 1VRQC 3CE8A 2AX1A 2D9PA 5HANA 2XSJB 3J7AN 1HPZB 3NWRA 1I1GA 4LF6F 4R0JA 1BQNA 2RE1A 1CJTB 2KXNB 2NYHA 3OXFA 3QZ7A 3CD0A 3MCNA 5IS2A 4DUZF 5IOLA 2WTFA 3U7JA 1S1XB 4DWIA 2U1AA 3M8PA 2DRDA 4QWBA 3ZZUA 2QRRA 1S9FA 3T9NA 4A8QA 4YR2A 4B3OB 2QMUB 1TFYA 5C7PA 2RRNA 4LSNA 1LWXA 4TXSA 3TOQA 3NS5A 4CO3A 5GVQA 5DLFA 2H65B 1Q79A 4B08A 3GIJA 3NS7B 1RTDB 3M32A 3OBIA 4B9MA 1F1BB 2NXNA 2W4CA 1SI9A 3I0SA 1M5KC 5KG1A 2GO8A 1QLNA 2KL8A 3MZIA 5F8GA 2J7KA 2BANB 2ZM6F 5T7LA 5KT5A 2Z58B 3CMQA 1G2EA 1S59A 4AT1B 1RP5A 4ANDA 1KLMA 3E51A 2WONA 1DZ5A 3R9LA 2H9ZA 2B51A 1TL3A 3MM7B 1ULRA 2APOA 3PX0A 4NXMF 2VPWB 4C8LA 4I68A 4M5IA 4ZN3A 1N0VC 4NWBA 3MMBB 2CQ2A 1RI7A 4USKA 1K44A 2ALZA 3VGSA 2BE7D 4DJBA 1OY8A 2HVHA 1OWXA 3B54A 1NPPA 1HW8A 2EK1A 3BDPA 2VZ9A 3LO3A 4NI2A 3KLEA 4IKAA 4ICLB 4F7VA 1OS5A 2C42A 5HAOA 3OTEA 4EFAC 3KFWX 2VPZB 1HQUA 2POKA 4Q8EA 2XMMA 1XMOF 4WFAQ 4C0HA 2HFOA 5JVHQ 1X5SA 3K8VA 3QRPA 3FQLA 2W9CA 1N8RT 3HFZB 2B6AA 3CCJS 1U6FA 3OL8A 2QA1A 4ECUA 2RT3A 1HKAA 3FGVA 2IAJA 4LF7J 5LL6d 3RR7A 3CCWA 4FYVB 1D8ZA 4TQRA 3G71S 1CBKA 1AZSA 2X1GA 1QD1A 3NGRA 2BBEA 4CO0A 2DGWA 3Q8SB 3OL9A 2IDEA 1MSWD 1HD1A 1RA7A 3QGPA 2FPHX 1WI6A 3EWGA 2JEFA 5E2QA 3G6ES 2AW0A 3K5OA 3J7A1 2WZ1A 2ZZTA 5JVGQ 2E7VA 4ES2A 1H0HB 2B9EA 5B0FA 4EO8A 4XIUA 2COLA 4MK8A 4ZHRA 2GJ2A 5E0OA 3ITHB 1V5VA 1HR0J 4U8YA 1AUDA 1QE1A 2HHUA 2JVRA 4DR6F 5C24A 5E3RA 2XMUA 4ED4A 3BKTA 3LWMA 2DEJA 4DX8H 2EBGA 3H20A 4EU0A 4WTYA 4X4SA 1NJYA 4LF4F 3TP2A 1Q81T 1LW0B 2MMYA 4ED3A 2Z0GA 4A8FA 5KFDA 1RYSA 5A8WB 2R42A 3GJTB 4FZVA 2OIHA 1P1TA 1FKAF 4AFFA 1MWZA 2KG1A 4P52A 1HIYA 1U1NA 3SQGB 3PW5A 1RWNB 2WHOA 2WVDA 3CUNA 1FEHA 3CJQA 2EKNA 2NREA 2B9WA 2VBYA 4CWBA 1TKZA 4HHJA 1XR7A 4DV5F 1P1LA 1U8SA 4TY8B 3C2PA 1QAXA 3FBFA 1RABB 4CLTA 1BC6A 3C6UB 3PYGA 3D1QA 4V19X 1SC1B 1HARA 4DL5A 3N79A 5FLXY 2F4VJ 1FKPA 2BQ3A 1VBKA 2J9DE 2JRSA 4QYRA 2RQMA 3SI8A 1MU2A 1Q7LB 1Q16B 1G4CA 4OMFG 3KLFB 2Q1LA 2AYMA 2I5JB 2VKRA 3W66A 3IG1B 3Q8YA 3I6PA 3T5KA 1S0OA 3H2LA 4KFBA 4OJGA 1FHTA 1NK9A 2VICA 4DSJA 2E5JA 4ZJLA 4PZVA 3RAXA 3TVZA 4DFKA 4QYZJ 1KD1T 1F5CA 1UA0A 2H51B 4X66F 1T9XA 4W4MA 2HHHF 2E5LJ 2PFFB 2P2CB 4E2FB 1RTHB 3DOKB 4WFXA 2XZTB 1CULB 3I82A 2LQJA 2JEIA 4QJVA 1MMDA 5CZVA 2HW3A 1HNIA 2M52A 4QIFA 4URSA 2OPSB 2KKHA 4K4WA 3H98A 4KIAA 5D8HB 1R27B 4OYIA 5KFRA 2F9DA 4X2BA 3W7BA 3KHHA 2N3OA 3QJJA 2CQ0A 3T1YF 1U25A 2YNGB 2R2SA 1U24A 4DUYJ 4DR5F 1N54B 3OFFA 4O3QA 1LWCA 5D4LA 3QFHA 2AT1B 4NMLA 5J2QA 4USVA 2Y1RI 2J9CA 1VQSA 1NDCA 2KI2A 2UU9F 4WK1A 1B0VA 2YH1A 3IA0A 3FVYA 1XC9A 1B3TA 1HD0A 2BDPA 3BQ2A 1VFJA 3I0RA 5A76A 3JTNA 3Q8PB 2RDDA 1HI8A 4NRTA 1NK5A 4NMXA 3NCQA 3BR9A 1U2RA 2OO4A 3W8GA 1YIJS 1YVFA 2IDLA 4E98A 3MM6A 1EKRA 2QN6B 3P3DA 2XI3A 1F9FA 1TZ0A 3NNAA 1XIQA 1FEEA 3EMTA 4PWUA 4DV4F 3SCIE 3H59A 4QIGA 5KFOA 2CQPA 4M5JA 1S0VA 1WHXA 1A0OB 5EDWA 2BW2A 2RAQA 2V2ZA 1VLOA 1RKIA 3CIZA 1XR6A 2L48A 3CEDA 2HFZA 1X9WA 2RHQB 1IR1A 2EG2A 1M1GA 4AL6A 4IOCQ 4RZRA 4CO4A 1PILA 3N6MA 5KT7A 3DLBA 4M94A 4R5PA 2DK2A 3R1LA 4UOHA 1S9GA 1JLCB 3SCKE 3ISND 1XK8A 2AMCB 1O51A 2O67A 1FWKA 3IN5A 2FDNA 4DSKA 3MMJA 5KFUA 1Y11A 4IG0B 3VCDA 2F8EX 4NPOA 2C3UA 3GSIA 3AH6A 1HWUA 3OTBA 1NK8A 4P2FA 2BKOA 3A8IA 3Q23A 3LPEA 3AODA 2GIFA 4Q2LA 1GX5A 3QRRA 4OJHA 4P71A 2XO7A 4CP5A 4KGXB 4DHVA 1GXUA 4PWWA 1TK8A 4RWWA 4ED5A 5LMUJ 2ZOGA 4C8OA 4ZPAA 4KH0B 2GHVC 5SUHA 2OJ3A 3OFEA 4C6AA 3CMAS 4U96A 1UMJA 4ZVEA 4JV5J 5GAEU 3C46A 1SKWA 3OL6A 2MZJA 2HNDB 3OJSA 1VJWA 5M2UA 4Z37A 4B3SF 5H1SV 4H4OA 1VQOS 8AT1B 2CVIA 1F2GA 4ZPTR 1XN9A 2VC1A 2DPJA 2N82B 1W2BR 2ZJQQ 2IRUA 4KO0B 3F56A 4N41A 3O5TB 3CD7A 2WCXA 3TW0A 4F3OA 1TUGB 5KFXA 3DI6B 3IM8A 3O2IA 1WC1A 2R7QA 4Y2MA 3PKMA 4NCBA 3SBMA 3TX0A 2VDIA 2J6UA 3C14A 2UXBF 1RT7A 1H2VZ 4F67A 2DXEA 1P27B 2VUGA 4J37A 4DR4F 1ZA1B 3L09A 2P6TA 4FYYB 5DG7A 1YWXA 1EQ0A 2E1AA 2AD9A 2KN4A 3M2UA 3KK1A 4Q0BB 1G1XA 5CXTA 2C3YA 4LQ3A 3FRYA 4CIOA 1MW7A 4Z7CA 1NBEB 3SFUA 4JI7J 1ZBTA 3DKDA 5I3UA 2V2QA 2YNHB 2HQ3A 3HSJA 3PKYA 1LKZA 3T9ZA 1FX2A 5HBMA 1LXJA 3SYZA 3MM8A 1LW2A 1WC4A 3Q89A 2YWKA 4R0EA 2JLFA 1FRKA 1YLXA 5BYRA 4LFAF 3FCHA 5BR8F 2HEKA 2MXYA 3NNHA 2HHWA 1EETA 1R0BG 2K3IA 4ES1A 1RWOB 3UNYA 4CDIA 2YWWA 3OLBA 3NCPA 2XYHB 2IRXA 2DRAA 4FXDA 2ZBPA 3OR1B 2IRYA 5DQGA 3E8OA 4NX9A 2CQ1A 1HWJA 1HFEL 4K4ZA 1Q5YA 4DSLA 2LQ5A 3LP2B 3CGIA 2YKAA 2HBRB 3VALA 2B8QA 3DHWC 3MEDA 4JV2A 4RNMA 3D68A 2ZD1B 2CQDA 3PRDA 5CYQB 1IXKA 3P8BB 1WEZA 2IMWP 3UN2A 1PBAA 1JKHB 2HS0A 4I2PB 4M5LA 5J1EA 4HH1A 4JOUA 3LGNA 3UCZP 5LJ5Y 3OJUA 1BMQB 1T94A 1FD2A 4Y65A 3QRQA 4B9NA 5BJRA 2LU1A 3JSMA 3FDSA 4OI0A 4DG1A 2MHEA 2PT0A 3RU0A 1B0TA 2DR5A 4JV1A 4L3NA 2CJYB 4DMZA 2OTLS 2VFUA 2ZVIA 2G13A 4JI4J 1TKTB 2GIRA 4ECTA 4AE5A 4QWEA 3BO3A 2DGTA 3JQMA 1D0EA 4LBHA 4YUDA 2AHOB 5F9LA 2DNMA 2EKYA 4J9RA 2RSQA 4KSEB 2CPIA 4ECVA 3OXGA 3UD3P 2EC2A 3DMJB 2PD1A 3EJMA 3C3LA 5E3QA 1F3VA 3R8YA 4UW2A 4OYMA 3EPIA 2KO1A 4KR0B 2KZMA 1PYOB 5KFAA 1TTHB 1RA6A 1NLKL 4QR1A 3SDEB 3NMRA 2IYIA 4P7TA 4WP3A 1SQEA 4CNZA 3AD8C 2WSFC 1X0FA 4X84A 3AHPA 4L3KA 2ZH7A 2XYGB 3HKZD 4DPUA 1H38A 4KV8B 2OD4A 3A3NB 2BRKA 3QT8A 2ZOMA 1JJ2R 4OYZA 2CPJA 2XTJP 2QA4G 2BACA 3QZ8A 1Q82T 3MEGA 3OTDA 2MQOA 2VJUA 3VQTA 3M8YA 5FJ4A 4U67Q 1YRTA 1YRUA 4WKRA 1R89A 4XAKA 1HBOA 1WC3A 2CJXB 3CCUS 4OYWA 3M6WA 4G65A 2MZSA 1UFWA 2VDHA 3A8KA 4KH1B 3NAHA 1RKJA 2FGOA 2CPHA 3POTA 2A6MA 2CPDA 2OPRA 3GB0A 2XS7A 1R31A 4DV0F 2J9EA 3MM5A 4DCJB 4DN0A 3DFEA 2RRBA 4UUWA 2Z2ZA 1L3TA 3BKFA 5HVFA 3HKWA 1IKYA 3OT9A 1NSPA 2FVSA 3JAMY 5L1KA 4ECRA 1FERA 4RLEA 3BH6B 1W2IA 5MLCV 5IM0A 1C0TB 4N5SA 3W9JA 1FNMA 2Z56B 4OZ2A 2UXDJ 3ULHA 3HT3A 1JIHA 3ZFVA 1XNQJ 2VH7A 1WF0A 3FUYA 1CEZA 5K8PA 3MEEB 1N5QA 4W98A 3HVRA 4UUXA 2MY8A 3J81U 1EKSA 3QSIA 4RUHA 3PZPA 4C11A 4LVOP 3OW2R 2GVDB 3FSYA 4PG6A 3IRWP 2JWNA 3DN9A 4KYZA 3RRKA 4F0MA 1UFKA 5EWGA 4DF8A 2B0GA 3KLVA 4O3SA 1RT2B 1VBZA 1YBAA 2HQIA 1FJEB 1RAFB 2R7SA 4G1IA 2AV5A 4KGZB 3MHYA 1JNZB 2YWHA 4JBCA 4U9RA 2W2MP 1UP1A 2FLNA 2YXLA 3BSCA 3EGNA 1NB7A 1K8AT 1X9SA 1EP4A 4X4RA 3ISZA 1U0SA 3DRSA 3UN3A 1RWWB 3NXZA 3JAMU 3Q2SC 1EIYB 4X62J 5DM7Q 4OJ1A 2YPYA 3VZIA 5JJBA 4USMA 2C2RA 5GMDA 2EFNA 3KG0A 2V4JA 4C9DA 1N5YA 1NCLA 4KGKA 4J9KA 1N32F 2VQFF 2HZCA 2IVMA 3H4DA 2UUBF 1F6TA 1KONA 1VGYA 2M3DA 4DR7J 2OLWA 2E44A 4QQBA 1C1CB 4K4VA 2AX0A 3GJRB 2OFGX 3KWMA 5KG2A 4ZA1A 4NL5A 3CWJA 4DLEA 5KFMA 3DGVA 2ZHBA 4UOGA 2GQ2A 3FFIB 4K59A 3U27A 2OAUA 2ZNZA 5DRKA 1M0SA 4ID5A 4DX6A 1JLFB 3CD6S 3UDVA 1UEVA 4IQMA 2BE2A 2QE5A 1RT6B 1ELOA 2ILYA 2UVUA 3B6BA 4O3RA 2YWEA 2MQPA 5HMYA 1E6VA 2NLWA 3FZ2A 3PNIA 1E6YA 5J2PA 2HNYB 4NXNF 2VOOA 2U2FA 2R7XA 5L1LA 1GTEA 1PYTA 4K7QA 1WOOA 3ZTOA 3TYTA 4ZVHA 1SJ4P 1PYSB 4LRCA 1RHMB 2GQCA 1HMVB 2DNZA 3HZGA 4LVNP 4HHHA 4ES3A 3VAJA 4DUYF 1LFWA 1ACMB 2D3OR 1M5PC 2L41A 5IV3A 4RX6A 4F4KA 4NEYA 4TKTA 2BYCA 3KJVB 3R97A 1O8BA 3DOMA 2DGSA 2GHWA 5HSPA 4B02A 1IR2A 2F4FA 4BC9A 2A3JA 3ET6A 2N4CA 1TV6A 6FD1A 3RW7A 2XMAA 1APSA 1NUEA 2HMIA 3OUYA 4Q45A 2P8IA 3WIUA 3P45B 2BOPA 3CC2S 2QSWA 3JXOA 5ADZA 3D0GE 3ZC4A 5G0RB 2UUAF 3A8EA 2FJXA 5A8RA 1FKOB 2DJWA 5H9EJ 1VS3A 5AJ3F 2OPPB 3EDRB 4OZ5A 3D6MB 4PQUA 3MM9A 2YNIA 2ZHOA 3HP6A 1SJFA 1AB8A 3DRPA 3NBPB 3UD5A 5AE1A 4J9UE 3MXHP 1TL7B 1J5OB 1P9QC 1U1QA 2EFGA 1V3SA 3HLUA 2OI2A 4IFYB 4PWDB 4BDPA 2CNLB 3LA0A 3DM2B 2DPIA 3AQOA 1S4EA 1OYEA 2XGPA 2QFIA 5GMKa 2XB2D 3TO8A 3AOBA 5L9XA 3ZNJ1 4ZMMA 1P6TA 4LFCF 3RBZA 2HVZA 3R5CA 1DTQB 3PFEA 2XY6A 5F8HA 1P8GA 4ECQA 1FWLA 2F8MA 1UVIA 4LT6A 3OL7A 4I7FB 2NXEA 4TU9A 1FT8A 4R8UA 4M5KA 2K8GA 4OZNA 5KOWA 2C22A 2BJ3A 1N6QB 3BSNA 1FRLA 3BF4A 2R7VA 5B7WA 4B9SA 1MROA 2FVRA 1REVB 2FHJA 4DV7J 3OR2A 3RAQA 4OX9J 3CO0P 1BQXA 4LBIA 2XMVA 1IKVA 1DQAA 3AOAA 7FDRA 1L3VA 2KVQE 1KLMB 4XK8C 3KDOA 1FJGJ 5KG6A 1U45A 4QU7A 1ZZFA 4JV5F 4JI6F 2HZAA 4IDKA 4DL3A 5A8KB 5D3GB 4I64A 4RNFA 1X4EA 2W25A 2IFXA 5L46A 1LWEB 5B08A 5KT2A 1JLGB 1BY9A 1KP6A 4LQ9A 3G9CA 2UUWA 1I5OB 2GNKA 4UTGA 3UD4P 1EQMA 5HL7Q 1X8DA 4WTOB 4WXOA 1PGZA 2BM0A 1R8PA 1UVJA 2OP5A 3BH7B 4URGA 2DHAA 4C48A 3UR3C 5E3CA 4DR2J 1XERA 2CNOB 4DV1J 4IQXA 3GV8B 2HK2A 3CDEA 2GQQA 2CJKA 3QATA 3CJKA 1DLOA 1HNWJ 2Y8WA 1S99A 3CO9A 4OHXA 1LK7A 3R5AA 4FF2A 3KNAA 1MN9A 2FHJD 2W7AA 3DGPB 4A8SA 4LBPA 2XG8A 1M1HA 4Y28C 2HHVA 1UVMA 1JJHA 3MOZA 1HBMA 2KRRA 5KFEA 4DUTA 1NZAA 4ZN1A 1VQPS 1MMNA 3TI0A 3ETOA 1WWHA 3S8SA 3BO2A 4H4KA 4JI7F 3I5CA 4AD6A 3UWTA 4RW8A 4ELTA 1VQNS 1CJUA 3KMQA 1T03A 3BSOA 2WK4A 2O1PA 1RT4A 4GKJJ 2RQ4A 2YKQA 1JWWA 4OZ1A 2C2MB 3KLIA 5GAGU 2DR8A 4P10A 1KQKA 1N56A 1FI4A 4CH0S 2B5JB 4KGVB 4DCPB 4X65J 4DXLA 3E3XA 3NOGA 2JC1A 4LREA 1TVRA 1AFJA 2A10A 1U1MA 4IRDA 1R7IA 3TANA 4Q43A 4BBYA 2NPFA 1NJXA 4M5HA 4ZP8A 2GCFA 5KFHA 1KDNA 5HP1B 4MH8A 3E2EA 2NXCA 2B4VA 1CJVA 2HHXA 3PX4A 4DPOA 3AJ2A 5DDRC 5EWEA 4JI0J 2RDIA 1TP7A 3G2XA 4EWTA 3QGGA 2BUNA 3LQVA 1NSKL 3EGZA 3MURP 2GIQA 3ZZOA 3H40A 3G82B 2A6OA 5F0UA 3K7RA 3TAMB 1QSSA 3DLJA 4GO7X 2YTCA 4X4OA 4HVZA 2WVBA 4MYUA 2BOAA 4JI4F 3FBEA 3PIOQ 2H5JB 5H9FJ 2KM8B 4L74A 4K50A 3C6TB 1JLAB 2IYGA 5EN1A 1KSPA 3HSZA 2RIJA 1K1QA 3SV4A 1R0CB 3IC1A 2OPQB 2YKNB 1UL3A 3I4PA 2VQEF 1BE4A 2Z30B 3M1VB 3KTQA 2BV3A 3THPA 4PUOB 1M1KT 4DL4A 3VR1A 4H4MB 1T9WA 3PEHA 2KVIA 3DRYA 3IR7B 2HRYA 1V3RA 3C16A 4LF6J 3I56S 4DZDA 2KT5A 4WWSA 3MUVP 2HRUA 4ATNA 4PQAA 3UVJB 2ZVSA 4HYKA 1H74A 4DQRA 4DUZJ 3NOCA 3U1NA 5IQQA 1N4LA 1VCTA 3L7PA 3ZTRA 3N6NA 1VC5A 4N77A 1TAQA 4FS2A 2XBPA 3VF0B 1RWXB 2ADCA 2JOQA 4M5DA 1Y9OA 5I3PA 3I96A 2X1BA 1RWMB 2YNFB 1R0AA 3AAWB 1KKHA 3IAM9 3V6DB 3V5RA 3DU5A 4Y34A 4J9OA 4ER8A 3MAAA 4OIXA 1Y7PA 1HHTP 4ZPDA 5LSRA 2CWKA 3O1LA 2LDIA 4NLWA 1WEXA 3TAPA 1Q8BA 3M2VA 1GQEA 2AU0A 3GFZA 5LMNF 3K59A 2ZM6J 2DO4A 2QYGA 3DLGB 2AYBA 1JQGA 3MPYA 1VQMS 4WXWA 5EWFA 3RUBL 2V67A 2E7XA 5EHHA 2GO9A 3WZ0A 1QSLA 4BS2A 4NXMJ 1NMEB 2FJDB 4FF4A 1R8BA 4CO1A 1WHYA 2LFVA 2QG9B 4CO5A 2EEYA 5DETA 4WBFA 1X5TA 3OVSA 5KT4A 2WVFA 2MDAA 4HACA 2H54B 4P2MA 1LWFB 5HO4A 1PJ5A 3LP0B 2QEXS 1S9EB 2EC0A 3GR0A 1MG7A 3D7SB 2RKIA 2UXDF 3GFHA 1TQLA 2WB1D 3MPWA 3NP5A 1SUQA 2AEJA 1XNQF 1FFGB 1XMOJ 2BX6A 4DBQA 1I3OB 1HI1A 5EX3A 4DS5A 3QIDA 2GFFA 4CM0A 2F3JA 1KHWA 4CLUA 5IXUA 1S1VA 9RUBA 3OHAA 3FMBA 3HSGA 2CPFA 4LF8F 4FKXA 4FF3A 2PSZA 3A4TA 1IR0A 1FXRA 4CM2A 1UPPA 3C15B 3MDFA 2X3GA 1Q1KA 4DEZA 1JLEA 1B4SA 2MJUA 2ASLA 4USHA 2E9ZA 4JI5F 3W5YA 3MFHA 2UUTA 3HM9A 5HQMA 2GHPA 3CCZA 3ENWA 1DJ0A 3A3OB 2WBMA 2D3ZA 2VG6A 2Y9HA 1RAJA 4CI0B 3H90A 3M2RA 1HWLA 5A6PA 3Q86A 3IRXB 2VONA 1X4AA 3MUMP 1U0HA 3GP9A 2DR9A 5E3AA 2RMLA 1TELA 2FY8A 4WE1A 1LNQA 4USJC 4CLYA 1Y3JA 2CQCA 2LXIA 1PSDA 4RU2A 3FBCA 4M1KA 2HHQA 1ZTTA 4UQTA 3CJ4A 1HNZJ 4QOTA 2GMLA 2P6SA 3ZZ0A 1TUWA 4C7QA 3T1HF 4KPYA 1FF2A 2ILZA 2VKZG 2NSCA 4ZKAA 3D5MA 1VRUA 2J8SA 2XWYA 2XY7A 2V50A 3PXGa 5DGAA 3LW5C 2Q6BA 4R25A 3QFWA 1QTMA 1KVIA 3BN7A 5CCMA 4LF4J 4DR7F 4AXIA 2AEMA 3C8YA 1G3OA 1JLBA 4P73A 3HD2A 2PI5A 5A0YB 4O3PA 4F2SA 2LEPA 2LMIA 4FS1A 2BJ9A 2VBWA 3KJQB 1NRKA 2MZQA 1ZOTA 3BZQA 4ZVTB 3M9NB 4B9LA 5J2NB 4C8KA 1VBYA 1GXLA 1RAOA 1S97A 3DCAA 4O4RA 4X4QA 1RE1B 2RF2B 3RR8A 3MF5A 2PE8A 1HBNB 2XZDB 2V2KA 1CS4B 2I8EA 2MGZA 5D0RA 1T05A 2QMWA 4IR1A 2PA8D 4JB8B 2MQMA 2LQ9A 5ETOA 2X7IA 4CQ1A 4ECZA 2CJBA 5LOQA 3LP1A 3ZZPA 3KK1B 3BDEA 1B70B 4XO0A 4I1TA 1NSQA 2VU5A 1EJ7L 2FY1A 2CAJA 3M4XA 2CPXA 3LH2S 4ETXA 1ZPWX 2GA7A 3D28A 1GK8A 1WHWA 1NXIA 1RHQB 4MFBB 1ZS6A 3RRHA 3V81A 2M0GB 1Z4UA 1JJ4A 3IM9A 3IS9A 4OYBA 8ATCB 1TKXA 2W9BB 3NNCA 2I6WA 4YB7A 1VHFA 5D0EA 4X66J 5L38A 2HWHA 3ILJA 1UEKA 3PJXA 4RBTA 3BQ0A 1FDNA 1NKBA 1SC3B 1VDHA 3MCSA 4RW6A 2I38A 2ATCB 5CQGA 4NLOA 2B43A 3MR3A 1Y5LB 1KEKA 1BQMB 4ED0A 5B0EA 4O0IA 1VQ6S 2MKKA 3KLGA 3Q24A 3M9OB 3OQ2A 1URRA 1T7PA 4B9VA 3T1YJ 3HHLA 4I6YA 2IVYA 4DR5J 2DGVA 2CDQA 2KYZA 3BBCA 1PBUA 2VA3A 4WCEQ 2EXUA 5K14B 3MTKA 3QT6A 3QAUA 2DRBA 2UU9J 3CDWA 4QPXA 2ZH3A 3G87A 1KOOA 1RISA 1VHIA 3K5LA 3OLAA 3T19A 1H2UX 1AXQA 4J7CA 3JSMB 3VQSA 2X1AA 2L9NA 2CPYA 5E33A 1VR6A 2XSJA 2E29A 1HPZA 4UOFA 1GMUA 5DZ6A 4NLUA 2V8VA 4OHYA 3TA0A 5LSLA 3MAQA 1KR4A 1CJTA 3CT9A 4Y2CA 4LIWA 3VAHA 1Y5IB 2DH8A 2ZFHA 4OJ3A 4P7VA 2K7JA 2G1DA 1S1XA 1KBRA 4OYXA 4DSEA 1WACA 1FJ7A 3HO1A 1IKWB 2DNHA 4B3OA 3K5PA 4PABA 3H5UA 4Y00A 1Y10A 2XCPA 5DO2A 1RLCL 3KG4A 2DGXA 2PEHA 4A48A 2I2YA 1RTDA 1U8WA 1M90T 2ZHAA 3CC4S 2XLKA 1CSJA 1R8AA 2KG0A 2GMHA 3O8WA 2VL1A 2DCUB 2GJFA 1QUVA 2W7OA 2BANA 5KFPA 2BR0A 3CULA 4J9QA 1MNEA 2DIUA 2ERRA 1SKRA 1VMBA 2OD6A 5C25B 2HS3A 4G3IA 1R3NA 2R7UA 3NG8A 3HD1A 3MM7A 3ZTQA 4UQGA 2HQFA 4ZCIA 3DLEB 2YY3A 4A8WA 3B4MA 2GC8A 3CD5A 3VTIA 5IT9Y 2FVPA 3Q8VA 5KG3A 5KFCA 3MMBA 4P2XA 5HJYA 1DQ8A 2B4PA 1S6PB 1ZH5A 1T3NA 4OI4A 3TJ9A 4DR2F 1HQ2A 3IXQA 2MB0B 4HHUA 5KAKA 2Z57B 2D3UA 2DNGA 4ICLA 2GVZB 2RILA 1HNWF 2G0CA 4JI8F 4TNOA 1NKEA 2M9KA 1VQ9S 4G1QB 2OPRB 1NDKA 4IH6A 4F4YA 1FE0A 3P4UB 5IZHA 4B3SJ 1MN7A 2DXFA 1GTHA 2KJWA 4X4VA 2HK3A 1XR5A 4GMKA 4WP8A 2XGQA 2I1RA 4IUFA 1PG5B 1RHJB 1FFSB 3IO1A 4X64F 5KFIA 1HHSA 2XWXA 1SC4B 2KYXA 5KFSA 5MAOA 4QW9A 5B0CA 2RS8A 4DOZA 3P5BP 5B09A 4F3MA 1Q7YT 4GKJF 3DRXA 3PDNA 3CJ8A 1VC0A 2A0FB 1AW0A 3E01B 2UXBJ 2HHSA 3R5GA 5IT9U 4NLXA 4DR4J 4RW4B 3CCQS 2EG1A 3D9BA 4WIQA 3T1AA 2UUCF 1WELA 4TLRA 1EHWA 1XJWB 1OO0B 2XS2A 1U1PA 1FE4A 4EUVA 2DH7A 5FIIA 3ITHA 3EYZA 2M2BA 2RNEA 2H1YA 4C8MA 1V3ZA 3ENVA 4USTA 1Y00A 2JNJA 1C4CA 1SC6A 1Z2LA 4QU6A 1FTRA 1YHQS 4DI6A 1U1KA 2BJEA 2YX1A 1IBMF 1LW0A 3NY0A 1N33F 4KTQA 5A8WA 2V6AA 4MK9A 1S0MA 2Q66A 5BR8J 3I9ZA 4LF9F 4F04B 1RDRA 4LSLB 4K5RA 3PJ9A 2A2CA 3K8WA 5HMZA 1TU0B 8RUCA 1XMQF 3SQGA 3H7HB 4DPTA 3OFHA 4LF5F 2M70A 4MKYA 3RJMB 2BZ2A 3MGJA 3T6BA 2ZBCA 2Z4PA 3TUJC 3RW6A 5AXKA 2D74B 2E66A 4DQSA 4TY8A 3NEKA 1Z1ZA 4NLDA 1JXLA 1PIEA 2F9JA 2BJ1A 2QLXA 4RUBA 5DDPC 3C6UA 1RAHB 4YR0A 3GLJA 4DCOB 5HROB 1KFDA 1RSCA 2RHSB 1SXLA 4GRSA 1DTTA 4NA1A 3UPFA 3KLFA 4FXVA 2I5JA 2AKWB 3IG1A 4OZJA 2BVZA 3ENQA 2ROPA 4HR2A 2R8KA 3FMWA 2CG4A 3PRBA 4UY85 4I67A 1L5UA 4FF1A 1WNEA 1Q86T 2IM3A 4ZLJA 3AJ1A 2ZBQA 1EX8A 2OHDA 2DISA 1TFWA 3HMJG 2Z2MA 1RTHA 2ZH6A 3DOKA 1CULA 1VC6A 4J91A 5DZ7A 1RUSA 3CXCR 1F60B 1D1UA 2W2NP 2F63A 3IGNA 3UFCX 2MSSA 2BKNA 5FDLB 2HHTA 1N34F 4RNOA 3R7NB 5D15A 2OPSA 3UDEA 4MJKA 4LRBA 1WEYA 4NYPA 2CJAA 2VIHA 3D6HB 2MKCA 5E5NA 3S7RA 1H73A 3R5JB 1A9NB 2EK6A 1U6ZA 5ETKA 2YNGA 3DOLB 2XCAA 4YHHF 3KHLA 2J0SD 1S1TB 4NCAA 5KFNA 3L95X 1H7WA 2QA4S 1TV6B 3D6FB 1RT5B 1UTAA 1JJCB 1F5AA 1KWMA 1FNOA 1VISA 3HI9A 2FC8A 3WHIA 2ZE2B 1FO1A 2FYXA 1X60A 3I55S 3MECB 3CJ0A 4K2JA 3W1YC 5BYSA 5ETLA 4ILMA 1PJ7A 3QSYB 2GZOA 4ZVRB 2LKZA 2IA6A 1NHUA 4RW9B 2VG7B 4DFJA 2ZH2A 3GONA 3GJQB 1WTBA 3L4BC 1MWQA 2J0WA 2O66A 1Y4ZB 3PHEA 3JB9k 1RLDA 5IWAJ 3KLHB 1L3KA 4DV0J 1G7CB 3GE9A 3L9ZA 3T3FA 4PG5A 3RG6A 3OPKA 3EZOA 5HJXA 3NGDA 1EARA 3K17A 3TUPA 3I32A 4ETZA 5H9EK 1JLCA 4TVAB 1REGX 4ZPVR 1NDPA 4IH5A 2XSFA 4NYZA 2OGUA 2DNOA 4K2XA 2BE9B 4OI2A 3D3BJ 3VGTA 2PMWA 4FN5A 5DM6Q 4ZVFA 4IG0A 1FRXA 2MKHA 2RH3A 4IG3B 3QO9B 3BN4A 3GQCA 2MTLA 5J2MB 2KDOA 3VGVA 3NLCA 1RBOB 4F4AA 2R7TA 2HLTA 4RW7B 3ZTSA 3KDNA 2Q6CA 4JI1F 1YJRA 3GWCA 1HNZF 3QAEA 3HJFA 2ZDPA 1SB6A 2E7WA 4Z2XA 1V9OA 4ZPCA 2CZ4A 2YQ1A 2N7CA 3HZEA 3TVYA 1KQFB 1U6BA 1S77D 3ONQA 3BB5A 3M05A 1FK9A 5HQ8A 2FLLA 1RBLA 2FHKA 2MKJA 1RK8A 2KXFA 4PG7A 2HNDA 1U49A 4O3OA 2F1FA 3R2CJ 3G8SA 2HFSA 5ETNA 6AT1B 5HQLA 2D41A 2YKPA 4IOAQ 3B82A 2H4WB 3ILOA 1UWBB 2DNRA 2ABYA 2ACMA 1Z2ZA 3R1HA 1BLUA 1C4AA 3EICA 4J9MA 1BWEA 2V69A 2C2DA 4WFBQ 5F3ZA 4KO0A 1TK0A 2WAQD 1NH8A 1R8CA 3ZZZA 5HK4A 4GVBB 4O44B 4A8YA 3DI6A 1ZAWA 3MR6A 3D4JA 1N32J 2VQFJ 2OMOA 3HK2A 1OYDA 2UUBJ 2ZJRQ 1LFPA 5DJBA 3T6JA 2OFHX 4QBUA 3PYFA 1S72S 2B4UA 2DCLA 1JB0C 1QSYA 4N7TA 3DHXA 3RB6A 2D69A 1OPIA 3Q8UA 1RB0A 4Q0BA 1T3OA 2DGQA 4FDFA 4MYTA 4TYBA 4PXEA 4DQQA 3W5XA 3TQEA 2JZ5A 3GMGA 4LF1A 2YNHA 5CA5A 3QQCD 3IAS9 2NXJA 1KFSA 2Y0SD 2JH3A 3JYTA 3BYRA 2R2TA 4NXNJ 2YKMB 1TVRB 1UWAA 4AYBD 4IYQA 3M9MB 2P9GA 1ZM3A 5IC4B 5JXSA 3HHLC 1OPZA 2BQRA 2PO4A 2LA6A 3OR1A 1OSCA 1UKUA 2KJVA 2D3O1 3LP2A 2E1CA 2MY7A 2JJ4D 1VLYA 2E9RX 3BJYA 1TKDA 3BSAA 3UDLA 1U02A 2OKQA 2ZD1A 2IC3B 3ZZYA 4QWAA 2IHR1 2Y1LB 1HNXF 4B3MJ 4NZ7A 1JKHA 4I2PA 3PJWA 2DEIA 1UJ6A 3ZTPA 4CRJA 5IC6B 4DV6J 4IO9Q 4DPWA 1YQHA 5D4NA 3AT1B 4K4UA 1RU2A 3VWSA 1TL1B 2UUAJ 2HHPA 3FSIA 2C3MA 5I3QA 5AJ3J 4ZLLA 4Z7YA 4GC7A 2GW8A 4A8XA 2HZVA 3O44A 1T95A 1T9TA 2FZCB 3MPUB 1TKTA 3EXCX 1C0UB 1D8YA 3H5SA 1AROP 4CYUA 2DHHA 4EZ9A 3MMAB 2EFPA 2RUSA 3W2VB 2D7SA 5CYMB 4K4XA 1CQNA 2JEJA 1OY9A 1SH3A 3DMJA 5LXYA 4ECYA 3G86A 4F2RA 1YKWA 2CQ3A 3M8QB 3GYNA 1XMBA 2IBKA 1QM9A 3ILIA 2MZTA 1MWYA 2R7WA 3SDEA 2DHGA 1HW9A 3J80Y 3CMES 4KBIA 2G2OA 4LFCJ 1ZM4A 4NCGB 5H9FK 4YP3A 2W2OP 3V4MA 1WUUA 4A4JA 2BMBA 4ZVQB 3HULA 1JNRB 3KK3B 4NA2A 4KV8A 3MCOA 3SSQA 3I4HX 5G4DA 3OXLA 2K7KA 1CJKB 1HNVB 2IY5B 5ETSA 2QL9B 2ZH1A 4YFUA 3SCLE 2C1EB 3J7YU 4CLLA 1UEUA 2GGPA 1K73T 4IFVB 3MD3A 3BREA 2H5EA 2J9DA 4M63A 2YBVA 4JYAF 1PKUA 4MMOA 4JI6J 2W4PA 3EGWB 2PFDA 2VF3A 1YBUA 4HLBA 4EYIB 2VD3A 1N48A 3W2WA 2KH9A 2HWTA 4KC5A 3QJPA 3GCWP 3US5A 2HSEB 1WJ9A 2XNQA 3BEGB 4HACB 3BGUA 2NUHA 5K8MA 1S1UB 4DV2F 4CH7A 2FZKB 1HYSB 4OLOA 1RT3B 3HFKA 3FKBA 1WG4A 2J0XA 4LRFA 4YB6A 3MMCB 1KHVA 1LEOA 4ELVA 4NLVA 4RWXA 3J80U 1C0TA 1R43A 3VAMA 4W90B 4ECSA 2P9EA 3QNWB 1TAUA 2VA2A 4Q7AA 2HQGA 4TU7A 5J1NA 1W7WA 3NGUA 4LR9A 3H4BA 2CQBA 1HBUB 3C66A 2Y1JA 4WIIA 4DU7A 1R8HA 1WKKA 3L7OA 1WD6A 3CCTA 2GVDA 4V1Ak 4K4YA 2MLYA 4USUA 1YITS 1NZ8A 2IBOA 2R2UA 2FD2A 4EYHB 2VBZA 2R2RA 1NH7A 4DX5A 1M5OC 1RT2A 4OHWA 1Q8KA 1AFIA 2JL9A 4USIA 3V6HA 4DV3J 4C3MA 4N76A 4OL8A 4OV6A 4GO5X 1TR0A 4M8LA 1VQLS 4N8OA 3Q8RB 3FNNA 2VV5A 1S6QB 2OH2A 2K1RB 2R7RA 2KT3A 2HFUA 3ZXWA 4BWMA 1HWIA 3MR7A 2RS2A 4K0KF 4OX7A 4YY3F 2ZWPA 2M5YA 3R7SB 2YPZA 1N36J 3TQ1A 2MLZA 4KB7A 5CYJA 2XI2A 3QMQA 3U1MA 4OZ3A 1M5HA 2RB7A 3BS9A 1C1CA 3JTPA 4DS4A 4NLTA 3SEOA 1B0PA 3KK2B 4TU8A 3AXMA 2JLGA 1SBRA 2OEKA 3SV3A 4FP9A 3RAMA 4DFMA 4K5SA 2G9OA 3PIPQ 2EVZA 4F4ZA 3N5FA 2KFNA 3FFIA 4DR3J 2IVFB 1F9EB 1LV5A 1QAYA 3LGMA 1S4FA 1KOHA 2J7UA 2AEFA 3FEXB 1JLFA 3IR6B 3AB4B 2Z2YB 3VAFA 4KKOB 1RT6A 3RRGA 3RB0A 2CJ9A 5JUMA 2LQ8A 2ZBIA 3DXSX 3TRGA 2DH9A 2HNYA 4WYLA 4BC7A 2VQEJ 4B3TJ 4O3NA 1ICEB 1Q0NA 2BRLA 1XNRJ 2QLFB 4NE9C 4LSZB 1O0PA 2YVSA 2JFDA 3PHTA 4F25A 1RXOB 3QLHB 2C2OB 4L75A 4KE5A 3AD9C 4O4GA 1IQZA 1HQEB 2XMJA 2MEWA 4QR2A 4M5NA 1S1WB 4IOBA 2R8JA 3MWBA 3J81Y 4C8YA 2UXCF 2ZUGA 3W64A 2L9DA 2C2KB 3CJ2A 2FQQB 4L73A 3GSDA 5E41A 4YR3A 4DF4A 4CT8A 3JS9A 4ZCLA 1I6JA 2XNRA 1S12A 2ZH5A 5G0RA 3TNVA 2V8GA 4QW8A 3B4DA 1FKOA 1NJIT 4PEOA 1JMTA 2OTJS 5LMNJ 2FIUA 3G4SS 2A18A 4U8VA 1QY7A 3J81j 1ZA2B 4JV0A 5I42B 2XC9A 2E5GA 4HH0A 1C2PA 2LU2A 3QIPB 2FVCA 4NRUA 3J7Z5 1FESA 5JMNA 4GC6A 4E0DA 2M7SA 2AJ4A 3HX9A 4ZVOB 4WYWA 3DLKB 5IWAF 1DURA 4QWCA 1OSDA 1TL7A 1J5OA 1VQYA 4YN3B 4IFYA 3EDQB 2B7CB 1A7GE 4OX8A 3B8HA 4PWDA 3KOAA 3OVBA 3DM2A 1AUSL 2W2QP 3M30B 4ZJQA 3WDOA 5BYQA 4OI6A 2YWGA 2AGOA 4CLKA 1IBKF 1DTQA 2DNKA 1YJ7A 2VPYB 4QZVB 2DHXA 3EVWA 4TQSA 2QYCA 2CQIA 3BV8A 4MKBA 3WC0A 2JVOA 4I7FA 1FJCA 5ITHA 4WU3A 4CO2A 2X51A 5HLFB 1N6QA 4LF8J 1X9MA 1PAEX 1DQ9A 1X31C 4ZIWA 1N5VA 2BM1A 3UN5A 4OQJA 1REVA 5KFJA 4JI5J 4FYWB 5DG9A 5D78A 2W4DA 3TR5A 2PMHA 1ZETA 2G2YA 3Q0AA 3MCMA 3O3LA 4OI3A 1RGVA 2MZRA 2HYIB 5A8KA 3FEYB 2FB0A 5D3GA 3IFEA 3Q22A 1KQGB 2DGOA 3HHKA 2VHGA 1LWEA 1JLGA 2ADBA 4MK7A 4PXCA 1IKXB 4C3KA 2RDJA 7AT1B 5AXLA 3I5AA 1Q95G 3BGFA 4C8ZA 2AJQA 4WF9Q 5CD4A 2V4QA 2VG5B 3T1HJ 3MOJB 4O23A 3G6YA 2AF6A 1SCJB 2DGUA 5D0GA 4DPYA 4CLPA 2DNPA 1HLWA 4PYDA 4I69A 1WKJA 5T41A 1SH2A 4ZJOA 1VIXA 3WX8A 4RKUC 1KTQA 1CC8A 3H8YA 2PGCA 3R6LB 4PCQA 3T5JA 2DNYA 3GFYA 5B0AA 3D66A 4RNHA 3TWZA 3GG1A 4BWJA 3DGPA 4ZLPA 3PX6A 1IQTA 2B7BB 2IJFA 2HIYA 3IBFB 2QLWA 1FDAA 1SJ1A 2IJNA 3P96A 2MKYA 1J27A 4L72B 2HVIA 1WSRA 1HI0P 2EFVA 3M8SA 1SV5B 2OEMA 1VRTB 1WTFA 2WRMA 2B4OA 1NU4A 3NGSA 1KNZA 1XEZA 4YMEA 1GH8A 3CDAA 1V5IB 2ZZMA 4LFBJ 3AB2B 3DYAB 3CJSA 3NRBA 2DBBA 4F0HA 4CTAB 5C42B 4FNHA 3KNGA 3CJRA 5K8OA 1UVKA 2MYFA 1GFWB 4I4BA 1KVKA 1F0XA 1RJJA 4AXJA 2B5JA 5ETMA 3FRZA 3ZO7A 3D2WA 3MPVA 4P72A 3ISNC 1KN6A 4NYOA 3RGIA 1IJFB 1VK8A 2BJ7A 3VVTA 1UW4A 1I94F 4ED1A 1JLQB 2WOMB 3CJ5A 1DRZA 5HP1A 1Y5NB 1GEHA 2E1PA 2C28A 5DDQC 1NK7A 1WF2A 4B3MF 2V9WA 2DXDA 2RD5C 4EBDA 4DL2A 2ATLA 4JI3F 2M8DB 3S1TA 4DV6F 4XTTA 3PV8A 2B56A 4UT4A 4JI2F 2W8KA 4UZCA 3V6KA 1QTNB 2D9OA 3BQ1A 3PYDA 4CLZA 3G82A 1G6BA 1U1LA 3TAMA 3DLLQ 1RTIB 3FEZA 3UW1A 3FCVA 5B0BA 2HFNA 4DFPA 4U7UK 4RPFA 5HN0A 3WX4A 1RTJB 3TZYA 1NHVA 3C6TA 3BPSP 1JLAA 1KLNA 2ASDA 1C1BB 4FYXB 1HL6A 2VFTA 3OTOF 3H5YA 1DTTB 4OV1A 2DY1A 1VQ5S 3UDCA 2OPQA 2YKNA 1YJTA 2CXEA 5C2CA 3M1VA 3R5DA 4PUOA 4ZIVA 1BQNB 2LA4A 5KTQA 4H4MA 1IVZA 4RUCA 2HBYB 2CQGA 4K8RA 3M8PB 1X4FA 3EZ5A 5GADI 1VIOA 3UVJA 4RJVA 1X4CA 4LSNB 2XM3A 2ZJPQ 1SJQA 2GS8A 2BEFA 2WW8A 1HWKA 9ATCB 3M6UA 3AD7C 2ZWOA 5KFYA 2GAGC 5FD1A 1AYEA 3M32B 1UFLA 3I0SB 2UVRA 3O6QA 2YNFA 1IBCB 2HWIA 2BXJA 4KGMA 3AOCA 2DNLA 3V6DA 1AA1B 1S7HA 5T7LB 2HGNA 2CFXA 4E8UA 2IM1A 2K2PA 3SXLA 1WDTA 2WONB 4M5MA 2EFOA 3U02A 1TL3B 4A8KA 4HTJA 3L3CA 3R3TA 2LYVA 3DLGA 4OZ0A 2ACYA 4FBUA 5FLXU 1RWVB 1SVDA 2PDAA 1T02A 3TA1A 1YJUA 4FNIA 5DLGA 2Z8QA 3NL0A 4XDDA 4NI2B 4EGLA 4WFNQ 1TL4A 3KLEB 4HI2A 3GYXB 4AUKA 3WIVA 1HQUB 1O6XA 1LWFA 3LP0A 1S9EA 3GYGA 4P9SA 4ED6A 2ZC3A 4J90A 3D54A 2W9CB 2F5GA 4JI8J 2H4YB 2B6AB 3DC2A 2UVVA 3N9UC 2XMTA 4CZCA 3EM1A 3MEKA 1S48A 2IAJB 3TX8A 4BLGA 3BBFA 2AGPA 3CCES 3W9IA 3DXBA 3DRRA 4PR6A 1AZSB 2V4RA 5THWA 1SKSA 3C15A 1M5VC 2HAIA 3H42A 2RRAA 4Y2AA 4K4SA 4X64J 2UVWA 1DAXA 1BD6A 4F0KA 3IP0A 4FVMA 3GILA 2L3MA 4W92B 4DV3F 4IRKA 3D0IE 5GMEA 3PW7A 3IRXA 2M4MA 2AJ0A 4ZCMA 1RT1A 4KJIA 4F26A 1RHUB 4ZHRB 5EUHA 1YJWS 2JLEA 5DG8A 1NK0A 1JK9B 3G6XA 1UVNA 4EO6A 4UF4A 4QR0A 2UUCJ 1QE1B 2Y8YA 2G2ZA 4J9NA 3MD1A 1X7VA 4B9UA 4FVCA 1WORA 2ROGA 5C24B 3EX7B 1Y0HA 2YX4A 3R2DJ 1VJQA 1X5OA 1FK9B 2CNNB 4CLSA 1N36F 5EGYA 4EEYA 5K9FA 1IM4A 1QVGR 2V68A 2FJEB 4WU2A 3SSRA 3CCLS 4EZ6A 5GAHI 4NLSA 1IBMJ 1U1RA 1N33J 2RUGA 2LEBA 2C2NA 2MZ1A 1PO6A 3HHNB 4WKYA 4GKKF 5A0YA 3KHGA 4LF9J 4HT7A 1SKUB 2X3DA 3NKYA 3G6VA 2H5IB 2IM0A 1XMQJ 1TKZB 4P2SA 5CABA 1CPZA 1SJRA 5J2NA 4DR3F 2FJBB 4LF5J 1YZ7A 1B7YB 3THTA 2RF2A 3AJDA 4Q44A 4V19J 1HBNA 2MHNA 1CS4A 3BGRA 3R6GB 4I6WA 3GIRA 5KG0A 1FKPB 4ILLA 2KT2A 1HA1A 3AFGA 1MU2B 7FD1A 4RL1A 3N0VA 2JDJA 2XEXA 1WKLA 1KC8T 4B3TF 1VK3A 4L6V3 3UCGA 1M5SA 2SXLA 4N56A 4KFBB 4Y2IA 1XNRF 5DGBA 4RBUA 1S5ZA 4I56A 5IT4A 2N7YA 1WF1A 5ETTA 5F0WA 4KHPJ 2I9SA 2ZKTA 5BXIA 3X1LB 5EX0A 2OUGA 4MFBA 2KB2A 2Q43A 4LRDA 1Q8LA 1WDDA 1NJWA 5KFVA 4ZLNA 1H6KX 3CJ3A 2W9BA 1HNIB 3JYTB 1NJZA 3AA8A 3V6JA 3QGHA 4H54A 4CCHA 3LUYA 3QYYA 3HJVA 4C2MA 1U2CA 1L3SA 1N34J 1F5BA 1UZHA 4RR5A 2ZH9A 1BQMA 4A46A 3IR5B 2BA9A 1QVFR 1IBLF 4X4NA 3IBCB 3IWXA 1TUVA 1FD8A 2C2EA 5ETQA 1LWCB 4ANEA 3KHRA 5J2QB 4QYZK 4PRFA 3TARA 4YHHJ 5D77A 2QZ8A 2YH0A 2J6TA 3I0RB 4MIBA 5K14A 5CAAA 2R8IA 2BW7A 1FTCA 4MT1A 2C3OA 5HVGA 4M95A 1U2FA 2MKIA 1YX2A 1FDDA 3MM6B 2CQHA 2XULA 2I0XA 4J9SA 4ENOA 3B78A 4C97A 2QA2A 1WC5A 5LXRA 2DY9A 1RTZA 4KAIA 1UZDA 3TZZA 3W60A 4CYUB 2B9XA 1UAWA 1YRXA 1VQ7S 5M2RA 4I0WA 4AL7A 3GR1A 3DDKA 4R5PB 1IKWA 3H25A 1S9GB 3TJ8A 5KFWA 2A2DA 3GV7B 3TVKA 1RYRA 4CT9A 2DHSA 4NOHA 3KUGA 3LTOA 2E1RA 4B9TA 1VBXA 4ILRA 3OTCA 1B99A 1RHKB 3SZ2A 2JX2A 2Z2LA 3K89A 4J9LA 1K47A 1Q78A 2DNQA 4P74A 2G1HA 2ZOFA 2CDRB 2HNZA 5D0HA 2ZZNA 2KHDA 5C25A 1RAAB 4I2QA 1QJHA 2QO3A 1OQ6A 3DLEA 3F44A 1FXLA 1WSVA 2CG8A 3I5BA 5LT5A 2G4BA 4DR1J 2CNKB 4DL7A 4C4WA 4JI1J 4QIVA 1TMJA 2XLIA 2GGPB 1N88A 1QUPA 3W63A 1S6PA 3H2UB 1BUXA 3CCMS 4ED7A 3PG9A 5SZTA 4Y3CA 3FSXA 3QGIA 3EE3A 4LUBA 4KHMA 1MLAA 3W2WB 2AJ2A 2GVZA 2R4FA 2UV8G 3SQOP 2DT9A 4ZVSB 4FXWA 4G1QA 1RZMA 3W8PA 2LXUA 2ZBRA 1PC5A 4H4OB 3JTOA 1YSJA 4J5OA 4F02A 2HGMA 1H7XA 5K20B 1NAQA 1L3UA 4LF7F 3A1YG 2XLJA 3TZXA 2WSEC 4HT5A 3NS6A 3M8RA 1Q4RA 3HF5A 3ICLA 4LJMA 3G8TA 5LSOA 1X4DA 1YTYA 4ED8A 6FDRA 4OI1A 4RO0A 4PYAA 1IN0A 1LOUA 3SIPB 3G8QA 4Y2KA 3C14B 2CVEA 2NQPA 1RT7B 4LFBF 4FPIA 3UI3A 5KT3A 2MQLA 3PO5A 2QV6A 1UCNA 4ZPBA 5CH7B 1O5JA 4B3RJ 1CQMA 1YK9A 3HPOA 2WVCA 4IO1A 4G6VB 1RU1A 3E01A 3HFVA 3M2UB 4OYAA 4RW4A 3W9HA 5L1IA 3DNCA 1UA1A 4ECXA 1HR0F 2XZWA 3IGVA 3IMQJ 4A47A 3MPDA 1NKCA 4AL5A 5F41A 2DITA 4D3GA 2FVQA 5E7OB 1KRPA 5I3UB 4DPXA 1UW9A 3N01A 2QL7B 4C98A 5HBMB 2NZCA 1U47A 3MM8B 1LW2B 2WBRA 4DU8A 1FFWB 2R9LA 2W2PP 2FHOB 5DDOC 3BGOP 2QJ3A 4RU9A 4ZDNA 3M7VA 1EETB 2HGLA 1RQ0A 4ZITA 3TEGA 2PEBA 4UOCA 1U48A 3HVTA 3V4IA 1IUJA 1R6VA 2KRBA 3QT7A 3FK4A 4OHZA 2L9WA 4LSLA 3NMAA 2VFRA 1JX4A 2QC3A 2KM8C 3MEDB 4URQU 2IA0A 1T8EA 2IM2A 2XHWA 2DD8S 2F40A 3UQSA 2FLOA 5C2GA 2F4VF 5J1EB 4Y6IA 1V6HA 4N47A 2VC0A 1HNXJ 1UVLA 5KG7A 1YJVA 3BR8A 5HROA 4YDXA 2QLBB 2KHCA 3KJFB 4DG1B 1N5TA 4CLFA 4LR8A 2KFZA 1GT8A 1KS2A 4WPAA 2IIHA 2PA3A 3RZAA 2LLZA 3KMSA 2ZNYA 3VHQA 5HMXA 2LDYA 1T9UA 1XBWA 4ZOSA 4D3HA 3IWLA 2E5LF 4UY8T 1T9YA 1NPKA 2GJIA 1BXNA 3PRVA 4NLQA 3SFGA 3MI7X 3PW4A 5KFFA 4XDCA 2CZVC 3HCXA 4CLWA 1J2VA 4F50A 2XYPB 2O01C 4NASA 5KFZA 3NAIA 1FA0A 2VASA 4HEA9 5FDLA 3THVA 3GPAA 3Q83A 2GAHC 4TLQA 3HHEA 4WP9A 4NZ0A 4HI1A 3KJNB 5L9NA 4O4GB 2AQ4A 2B8PA 1JXEA 4ZP7A 2ZUAA 4C0BA 2FZGB 3DOLA 2KFYA 3SCJE 2P5VA 1FVSA 1S1TA 3DLHA 4ALZA 4L76A 1CC7A 4WK3A 3CB4A 5HI7A 1FRHA 3K0JA 1RT5A 2QTWA 3Q2TC 3MEGB 3CSKA 4U7UD 2ZE2A 4OYOA 5L8RC 3HDSA 1HBOB 2M8HA 3MECA 1ZM9A 1RCXB 1J5EJ 2BJDA 2XHCA 4RW9A 3K5NA 4FYDA 3OSNA 2W1BA 4M5GA 2VG7A 3POTB 2EFQA 3VAKA 4JYAJ 5AT1B 3CNQP 1FRIA 5CHCB 5KG5A 4C8NA 3GTYX 3MM5B 2H3EB 3EGVA 1GAOA 2DR6A 2QT7A 3WBZA 3J7YI 2GMJA 2XMWA 2GV1A 1AT1B 1IKYB 4JP8A 1S76D 3KLHA 2V34A 1YGYA 4DV2J 4ZVUB 2HLUA 2ASJA 4H4KC 1UJ4A 5IM0B 3TA2A 1S0NA 4N8NA 5GAEI 1Q53A 5KG4A 5DQHA 1SL1A 1PC4A 4QIEA 2MQQA 1TMMA 2V63A 3C19A 1WG1A 2BABA 4DLGA 2HG4A 2ZDOA 3P49B 1XTZA 4ZVPB 4HDGA 1RBAA 4PXBA 2XQCA 1S57A 3CTRA 3NWGA 1BGXT 1SL2A 3PEJA 4AQYJ 1IM6A 5CCLA 1BHNA 2J76E 4C11B 2ZH8A 2FJWA 1EB0A 2N4DA 4IG3A 1MMLA 1ZTWA 2XMKA 3QO9A 4O0NA 5J2MA 2IMOA 3GIIA 1DHMA 2CZ9A 1TL5A 1ZM2A 4RW7A 5KOXA 2K3KA 3AXKA 5LMUF 2F7VA 3A12A 1WOPA 3PVXA 2MLXA 1H98A 4ERDA 4HL9A 1YJ9S 2FC9A 2LXFA 4XPCA 1RHRB 4USWA 1NB2A 3RTVA 3LF0A 3BM7A 4MIAA 4YS2A 3W3SA 4ZS6A 4UZBA 3P5TL 2CQ4A 2RQKA 3I87A 5AXNA 2FTRA 3TUZC 1EP4B 1FVQA 4F4XA 3JSYA 5AXMA 3DRSB 3FQKA 3ZZTA 3GV5B 4MIWA 1QAIA 3VV2B 2Y0BB 2HVEA 3T5LA 1VQKS 1UWBA 4BHQA 5CD4H 2QMXA 1K0VA 2V4JB 2XY5A 2AWZA 1N5YB 1FDBA 4K0KJ 4NA3A 4YY3J 4GVBA 4ED2A 5A2QY 2KU7A 1GNKA 4O44A 2XS5A 2R8HA 1OJ4A 1D3WA 4KPCA 4DDFA 1UJ5A 4BCAA 3DDNA 4TY9A 3X3UA 1VYAA 4F8RA 4KQZA 1RCOB 3RB4A 2E5IA 5L39A 3ILLA 2W9AA 4KHPF 3VVUA 4ID5B 2HBQB 1N0UA 3D3CJ 2VJVA 4OHVA 2BE2B 3SMZA 4WJBA 3N5BA 3OHBA 3BKUA 2XO6A 1CLFA 1E6VB 1KTVA 2BQUA 3KKFA 1S6UA 1Y3KA 2W7PA 1E6YB 3PW2A 2V8HA 5J2PB 4IH7A 3KUEA 2F8HA 3R7BB 2HS4A 3V2UC 2QX0A 2AP6A 3M8WA 3KXDA 2AZ1A 1IWGA 4J9VA 5AE3A 4YDDB 2YQ3A 3A8JA 1EAYC 1FX4A 2YKMA 2PN6A 2V0NA 2F65A 3TEHB 2HIQA 3WC2A 4DSFA 2JFKA 5ETPA 5HVHA 1CG2A 2WVEA 2VFSA 3EPGA 1VI7A 3DOMB 3JSRA 5KFLA 4KY3A 5T14A 5A2QU 1NHKL 1URNA 2CADA 3IWNC 1D9FA 3ET6B 3RBEA 2AZ3A 2FHMA 3AQPA 4C0OC 3ADAC 3MR2A 3M6VA 1ZAVA 4NLRA 2HMIB 4LMZA 3OUYB 2QLJB 2IC3A 3D1HA 3GU0A 1RWKB 2V8PA 2UXCJ 3PR5B 3H0PA 3GIKA 4A8OA 3EVOA 3MR5A 5A8RB 2RU9A 3SSSA 4DSIA 4WFYA 1R6YA 1RAEB 1TL1A 4KHRA 3LWLA 2W8LA 2FJVA 4PQUB 3CF5Q 3MM9B 2YNIB 4MAKA 2OMLA 3CPWR 3DRPB 1C0UA 3I31A 1H72C 3FC9A 2CKWA 3T5HA 3MMAA 1X4GA 3ETMA 1NK6A 1RACB 3GG0A 3W61A 1WOSA 1VQ8S 3GJSB 3W2VA 2HQCA 3CJTA 1X4HA 5CYMA 3NCRA 2OSRA 4YOEA 5L1JA 2J7WA 5I4MA 1JXVA 4HKQA 1RWPB 3M8QA 2UP1A 4ZK7M 5F8NA 2JSXA 4PPZA 4MKAA 2RQCA 2FGCA 4KRWA 4LR7A 4OLPA 1SJ3P 2VBXA 1B64A 1RAIB 1I51B 1U7LA 4R8UB 2P9CA 4NCGA 1IBKJ 4YEAA 4MKVA 1T11A 5K8NA 1F3FA 2HAFA 2PC6A 5DQIA 3R5BA 4J9PA 3KK3A 5F8LA 2G0JA 3IBWA 4DR1F 1MROB 3OR2B 2EI5A 1CJKA 1IKVB 1Q8IA 2MSTA 4HTIA 1HNVA 4NLYA
chains in the Genus database with same CATH topology
3W1YC 5BR8J 5FLXU 3J81U 4B3TJ 2MTLA 4K0KJ 4JI5J 4X64J 2E5LJ 2KVQE 3J7AN 4NXMJ 4YY3J 4LF9J 1XNRJ 1I94J 1N36J 4X66J 1J5EJ 1FJGJ 4GKKJ 4V1Ak 1N32J 2VQFJ 4DR1J 2UUBJ 4JI0J 4LF6J 4DR7J 1XMQJ 5LM7E 4LFAJ 4KYZA 4JI1J 4JI6J 4NEZA 4LF5J 4NEYA 4PWWA 4JYAJ 2UXBJ 4KY3A 4B3RJ 4DUZJ 5LMUJ 4JI3J 5A2QU 5IT9U 1N34J 4DR4J 4HHUA 4RJVA 2HHHJ 4JI2J 2MEWA 5IWAJ 4DV0J 4JV5J 3IMQJ 1IBLJ 4DV3J 2UUCJ 4DUYJ 1HNZJ 4B3MJ 4DV4J 4LFBJ 2F4VJ 4GKJJ 1HR0J 1XMOJ 4LFCJ 3T1YJ 4JI8J 4DR5J 4DR3J 1HNXJ 4DV2J 3D3CJ 4DV5J 2UXCJ 4DV6J 3R2DJ 4DR2J 4YHHJ 1IBKJ 4JI7J 3T1HJ 3R2CJ 2KL8A 4B3SJ 4DV1J 3J80U 4X65J 2MQ8A 2UXDJ 2UU9J 2UUAJ 1HNWJ 3D3BJ 3JAMU 2ZM6J 4LF8J 1XNQJ 4LF4J 4KHPJ 5AJ3J 4LF7J 5LMNJ 4X62J 4JI4J 4DV7J 3OTOJ 4AQYJ 1IBMJ 4OX9J 4DR6J 4NXNJ 2VQEJ 1N33J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1Y C;  5BR8 J;  5FLX U;  3J81 U;  4B3T J;  2MTL A;  4K0K J;  4JI5 J;  4X64 J;  2E5L J;  2KVQ E;  3J7A N;  4NXM J;  4YY3 J;  4LF9 J;  1XNR J;  1I94 J;  1N36 J;  4X66 J;  1J5E J;  1FJG J;  4GKK J;  4V1A k;  1N32 J;  2VQF J;  4DR1 J;  2UUB J;  4JI0 J;  4LF6 J;  4DR7 J;  1XMQ J;  5LM7 E;  4LFA J;  4KYZ A;  4JI1 J;  4JI6 J;  4NEZ A;  4LF5 J;  4NEY A;  4PWW A;  4JYA J;  2UXB J;  4KY3 A;  4B3R J;  4DUZ J;  5LMU J;  4JI3 J;  5A2Q U;  5IT9 U;  1N34 J;  4DR4 J;  4HHU A;  4RJV A;  2HHH J;  4JI2 J;  2MEW A;  5IWA J;  4DV0 J;  4JV5 J;  3IMQ J;  1IBL J;  4DV3 J;  2UUC J;  4DUY J;  1HNZ J;  4B3M J;  4DV4 J;  4LFB J;  2F4V J;  4GKJ J;  1HR0 J;  1XMO J;  4LFC J;  3T1Y J;  4JI8 J;  4DR5 J;  4DR3 J;  1HNX J;  4DV2 J;  3D3C J;  4DV5 J;  2UXC J;  4DV6 J;  3R2D J;  4DR2 J;  4YHH J;  1IBK J;  4JI7 J;  3T1H J;  3R2C J;  2KL8 A;  4B3S J;  4DV1 J;  3J80 U;  4X65 J;  2MQ8 A;  2UXD J;  2UU9 J;  2UUA J;  1HNW J;  3D3B J;  3JAM U;  2ZM6 J;  4LF8 J;  1XNQ J;  4LF4 J;  4KHP J;  5AJ3 J;  4LF7 J;  5LMN J;  4X62 J;  4JI4 J;  4DV7 J;  3OTO J;  4AQY J;  1IBM J;  4OX9 J;  4DR6 J;  4NXN J;  2VQE J;  1N33 J; 
#chains in the Genus database with same CATH topology
 4Y0F A;  2A1B A;  3FCW A;  2G0I A;  2ZKU A;  2B9Y A;  1YBT A;  3UR0 A;  2NPI A;  2NSB A;  1SPB P;  4IDK B;  4LRA A;  4IFV A;  2EW9 A;  2IJR A;  2RU3 A;  3K58 A;  3PW0 A;  4RNN A;  1IWA A;  2DKO B;  3EVM A;  4FKY A;  4DQI A;  2DNN A;  2ZC4 A;  2GX8 A;  1UPM B;  4LF2 A;  3JQJ A;  2ROE A;  1ITP A;  2CPE A;  2CYY A;  5IFM A;  1PAU B;  3I9V 9;  4CH1 A;  4FPR A;  1S1U A;  3GCX P;  2LVW A;  2JC0 A;  2V94 A;  3AY0 A;  4CNY A;  3AA9 A;  1HYS A;  2O5D A;  2V9K A;  3KG1 A;  1RT3 A;  4S0M A;  5IV4 A;  1NM2 A;  3CJK B;  3MMC A;  1DLO B;  5IT0 A;  2LQB A;  3CVK A;  1GMW A;  2VFV A;  3A13 A;  2QIF A;  1FXD A;  4DX7 A;  5F9N A;  3UCU P;  2V5H G;  3MAH A;  4B3R F;  2MPU A;  3HVA A;  4I6A A;  2HRT A;  3LOU A;  3LAL A;  5M2P A;  5C5J A;  2YQ0 A;  2BKP A;  1DFD A;  3DRR B;  2C2Z B;  1HBM B;  1HBU A;  3PY8 A;  5LM7 E;  5K5M A;  2J6S A;  1S10 A;  2R7O A;  1ROF A;  4RW8 B;  1W25 A;  2HQD A;  1CJU B;  4ZCK A;  1BWV A;  2ZIT A;  4QWD A;  5D4O A;  1H3D A;  3DU6 A;  1T03 B;  4ZVG A;  3CW2 C;  1RT4 B;  1W26 A;  3H2V E;  4OZL A;  1ZYQ A;  2CWX A;  3MUT P;  3QPI A;  3CDU A;  1RT1 B;  2Q3P A;  2MKS A;  3KLI B;  5B0D A;  2C3P A;  2DO0 A;  2E5H A;  3QWU A;  3F0N A;  1FCA A;  5A6W A;  3W5Z A;  2PII A;  1OY6 A;  1F9H A;  2CA9 A;  2N3L A;  2AJF E;  4X4T A;  2KTQ A;  2Y1I A;  5U47 A;  3M8Z A;  1NEE A;  2FJA B;  1NPR A;  4YQW A;  1S6Q A;  2K06 A;  5B0G A;  3RBD A;  4JUZ A;  4X62 F;  3K57 A;  1GMW D;  1X5P A;  2K1R A;  1NO8 A;  3D0H E;  1B7F A;  3HVW A;  2DR7 A;  4DR6 J;  3QWP A;  3TUI C;  1CJV B;  1I94 J;  1YDL A;  2DYA A;  2QGF B;  3EUN A;  4B17 A;  3W62 A;  2HVD A;  3PTW A;  1ZPV A;  4EBC A;  1FWP A;  1LXN A;  3BBB A;  3NGT A;  5CYQ A;  2JHE A;  1FRM A;  3PO4 A;  3A3P B;  1A6L A;  2FLP A;  4IR9 A;  1DY3 A;  4JI3 J;  2X1F A;  4JI2 J;  2NXU A;  3KK2 A;  2LCW A;  4U95 A;  4K4T A;  2OEJ A;  2W24 A;  2J5A A;  4GVL A;  4PAA A;  4F36 A;  3S01 A;  4DV5 J;  3GIM A;  4DZ6 A;  3BGR B;  1WI8 A;  3HSD A;  1NSA A;  1Q5V A;  3OD2 A;  2H48 B;  5AE2 A;  1N52 B;  3DDI A;  1SQF A;  1WC0 A;  2Q79 A;  4KKO A;  2AGQ A;  4Q8F A;  2AJ1 A;  4HDH A;  3F41 A;  4WZQ A;  3OTO J;  4RUA A;  4DL6 A;  4OX6 A;  3OFG A;  3EXY A;  1WC6 A;  2WW4 A;  3C16 B;  4QIW D;  1ZAX A;  3K5M A;  2NS1 B;  3ENA A;  1RAD B;  4WFZ A;  3W65 A;  4ZP6 A;  2NZ4 A;  1SH0 A;  1T9V A;  3QLH A;  4PXD A;  2MJN A;  2WSC C;  1TK5 A;  1NND A;  2HHH J;  1D09 B;  3BYP A;  1RAG B;  5ETV A;  2OSQ A;  5RUB A;  2DVI A;  1GMV A;  1HQE A;  4M5D B;  5KFG A;  4TYA A;  5KT6 A;  2O3D A;  1R0A B;  1S1W A;  1U4B A;  3GFX A;  4A8M P;  1VQ4 S;  3MAA B;  5F3T A;  3CCR S;  1X0P A;  2E1M C;  3M2V B;  1U1O A;  2WB4 A;  1KQS R;  1NK4 A;  2HBZ B;  2NR0 A;  2MQ8 A;  2CIM A;  1S6O A;  1J5E F;  2RJZ A;  1DAR A;  2AYE A;  3LAK A;  3GZ7 A;  4NZ6 A;  3RYL A;  3OSP A;  5F8I A;  3VGU A;  2VOD A;  3VAG A;  2AYG A;  3D67 A;  1HHQ A;  2DIV A;  3LAN A;  4C3L A;  3MFI A;  5I42 A;  5E3P A;  3TZW A;  5KFT A;  4X4P A;  1KVJ A;  3QIP A;  2RVJ A;  4IRC A;  4OYP A;  3J7Z T;  3F73 A;  5GAD U;  2Y3Y A;  3P6Y C;  4ANC A;  3HXM A;  3DLK A;  1XQI A;  1S7I A;  2DB1 A;  2NUU G;  2HKE A;  3QBC A;  2PMZ D;  2RKI B;  3L7U A;  1QAJ A;  4TN2 A;  1S49 A;  4ELU A;  3FBB A;  2LEC A;  1SUQ B;  4WZM A;  3H5X A;  1LQ9 A;  4EMD A;  3VZH A;  3BO4 A;  4DV4 J;  3M30 A;  1FRJ A;  2V8D A;  4ECW A;  2QL5 B;  2YX7 A;  1OIA A;  4AQY F;  1CVJ A;  5KFQ A;  1S1V B;  2KZZ A;  2KXH A;  3MEE A;  4RBV A;  2FUG 9;  2VPX B;  1RWU A;  3UNG C;  2W01 A;  1JLE B;  2CPZ A;  5HLF A;  3HHL D;  1YI2 S;  3TJA A;  4DV7 F;  4OX9 F;  2V2V A;  4ZP9 A;  3ELH A;  3MTJ A;  3NGK A;  2VG6 B;  3PAC A;  3N6L A;  1FJG F;  3VAI A;  3M2R B;  3U1L A;  5J1P A;  4NLP A;  2HNZ B;  3KUH A;  2UV8 A;  1NDL A;  1U0H B;  5IQ6 A;  4I2Q B;  3D1O A;  1D9D A;  1SIW B;  4ITS A;  4WE1 B;  4U6P A;  3LAM A;  4XPE A;  3CCV S;  3RBX A;  3KYL A;  4PPD A;  5KFB A;  2VOP A;  3QJL A;  3PR4 A;  4OFZ A;  2LP4 A;  4QPT A;  2PI4 A;  2D1C A;  5D6G A;  2LEA A;  4DL0 C;  2ZEJ A;  1IKX A;  1H2T Z;  3OV7 A;  4P75 A;  3ZZR A;  5D4P A;  1VRU B;  4DV1 F;  4YB1 P;  2L08 A;  1GX6 A;  1GXT A;  1U26 A;  5HMW A;  2VG5 A;  5ETR A;  1SIZ A;  3PCO B;  5GAG I;  5CZX A;  4EI2 A;  2BJ8 A;  3QT5 A;  1JLB B;  4NLG A;  3HT0 A;  1QDU B;  1YG0 A;  5LJ3 Y;  1X4B A;  1VOM A;  4DN9 A;  3Q8Q B;  1WG5 A;  3ZNU A;  1ZZN A;  4ID8 A;  4LIR A;  3BPD A;  4G1P A;  4X4U A;  1K9M T;  3T41 A;  3PFO A;  1T0T V;  3OVA A;  4GKK J;  1D9A A;  2ZH4 A;  4F3Q A;  3UE2 A;  2YWF A;  2HFV A;  3FZB A;  3G96 A;  1FNX H;  4NEZ A;  5KFK A;  4QCL A;  2MGZ B;  4Q2M A;  1T05 B;  1UET A;  4MTP A;  3S6E A;  1SV5 A;  1VRT A;  1OQ3 A;  1K1S A;  3BGL A;  3N4W A;  4PG4 A;  1U09 A;  1P9Y A;  3M6X A;  1F2H A;  3LGH A;  3PYE A;  2EBE A;  3LP1 B;  4FBT A;  3DYA A;  3JSB A;  4YB5 A;  4CTA A;  4X65 F;  5C42 A;  1K0T A;  4PKD B;  4U7C A;  5GAH U;  2NCK L;  1SL0 A;  3V81 B;  4Q5V A;  2JEG A;  3IS9 B;  1OMS A;  1YJN S;  3N28 A;  1TKX B;  1HMV A;  3WQP A;  3HHD A;  3CC7 S;  2YKO A;  2HPU A;  4DQP A;  1DBD A;  1JLQ A;  3KJV A;  2WOM A;  4JI0 F;  3K2Y A;  2CJQ A;  4RW6 B;  1XWL A;  1PCA A;  2EPI A;  2ASY A;  1S79 A;  2DTJ A;  4LFA J;  1EZZ B;  3HVT B;  3RB3 A;  2B3T B;  3UO0 A;  3V4I B;  5F8J A;  3D6T B;  3KLG B;  2VB6 A;  2EWH A;  4F4W A;  2QFJ A;  3LPY A;  2R8G A;  1SQG A;  3TAQ A;  1IJE B;  2J0Q D;  2R3V A;  4P6Q A;  4PG8 A;  2HUR A;  3HHL B;  1IBL J;  3CCS S;  5DS7 A;  2J8A A;  3PM9 A;  2UZA A;  3FJ2 A;  1N5S A;  2CUY A;  1YZ6 A;  2AIR B;  4KT0 C;  1RTI A;  3JQK A;  2OPP A;  3CDB A;  2NYI A;  2OEL A;  3CIM A;  4EK2 A;  2M88 A;  5HAT A;  5F8M A;  1RTJ A;  2QSF A;  2CRL A;  2ALY B;  1WHV A;  2MQN A;  2E9T A;  1LK5 A;  3NBP A;  3EZU A;  4ZPW R;  4EBE A;  1C1B A;  2IPO B;  3R27 A;  1PJ6 A;  1VRQ C;  3CE8 A;  2AX1 A;  2D9P A;  5HAN A;  2XSJ B;  3J7A N;  1HPZ B;  3NWR A;  1I1G A;  4LF6 F;  4R0J A;  1BQN A;  2RE1 A;  1CJT B;  2KXN B;  2NYH A;  3OXF A;  3QZ7 A;  3CD0 A;  3MCN A;  5IS2 A;  4DUZ F;  5IOL A;  2WTF A;  3U7J A;  1S1X B;  4DWI A;  2U1A A;  3M8P A;  2DRD A;  4QWB A;  3ZZU A;  2QRR A;  1S9F A;  3T9N A;  4A8Q A;  4YR2 A;  4B3O B;  2QMU B;  1TFY A;  5C7P A;  2RRN A;  4LSN A;  1LWX A;  4TXS A;  3TOQ A;  3NS5 A;  4CO3 A;  5GVQ A;  5DLF A;  2H65 B;  1Q79 A;  4B08 A;  3GIJ A;  3NS7 B;  1RTD B;  3M32 A;  3OBI A;  4B9M A;  1F1B B;  2NXN A;  2W4C A;  1SI9 A;  3I0S A;  1M5K C;  5KG1 A;  2GO8 A;  1QLN A;  2KL8 A;  3MZI A;  5F8G A;  2J7K A;  2BAN B;  2ZM6 F;  5T7L A;  5KT5 A;  2Z58 B;  3CMQ A;  1G2E A;  1S59 A;  4AT1 B;  1RP5 A;  4AND A;  1KLM A;  3E51 A;  2WON A;  1DZ5 A;  3R9L A;  2H9Z A;  2B51 A;  1TL3 A;  3MM7 B;  1ULR A;  2APO A;  3PX0 A;  4NXM F;  2VPW B;  4C8L A;  4I68 A;  4M5I A;  4ZN3 A;  1N0V C;  4NWB A;  3MMB B;  2CQ2 A;  1RI7 A;  4USK A;  1K44 A;  2ALZ A;  3VGS A;  2BE7 D;  4DJB A;  1OY8 A;  2HVH A;  1OWX A;  3B54 A;  1NPP A;  1HW8 A;  2EK1 A;  3BDP A;  2VZ9 A;  3LO3 A;  4NI2 A;  3KLE A;  4IKA A;  4ICL B;  4F7V A;  1OS5 A;  2C42 A;  5HAO A;  3OTE A;  4EFA C;  3KFW X;  2VPZ B;  1HQU A;  2POK A;  4Q8E A;  2XMM A;  1XMO F;  4WFA Q;  4C0H A;  2HFO A;  5JVH Q;  1X5S A;  3K8V A;  3QRP A;  3FQL A;  2W9C A;  1N8R T;  3HFZ B;  2B6A A;  3CCJ S;  1U6F A;  3OL8 A;  2QA1 A;  4ECU A;  2RT3 A;  1HKA A;  3FGV A;  2IAJ A;  4LF7 J;  5LL6 d;  3RR7 A;  3CCW A;  4FYV B;  1D8Z A;  4TQR A;  3G71 S;  1CBK A;  1AZS A;  2X1G A;  1QD1 A;  3NGR A;  2BBE A;  4CO0 A;  2DGW A;  3Q8S B;  3OL9 A;  2IDE A;  1MSW D;  1HD1 A;  1RA7 A;  3QGP A;  2FPH X;  1WI6 A;  3EWG A;  2JEF A;  5E2Q A;  3G6E S;  2AW0 A;  3K5O A;  3J7A 1;  2WZ1 A;  2ZZT A;  5JVG Q;  2E7V A;  4ES2 A;  1H0H B;  2B9E A;  5B0F A;  4EO8 A;  4XIU A;  2COL A;  4MK8 A;  4ZHR A;  2GJ2 A;  5E0O A;  3ITH B;  1V5V A;  1HR0 J;  4U8Y A;  1AUD A;  1QE1 A;  2HHU A;  2JVR A;  4DR6 F;  5C24 A;  5E3R A;  2XMU A;  4ED4 A;  3BKT A;  3LWM A;  2DEJ A;  4DX8 H;  2EBG A;  3H20 A;  4EU0 A;  4WTY A;  4X4S A;  1NJY A;  4LF4 F;  3TP2 A;  1Q81 T;  1LW0 B;  2MMY A;  4ED3 A;  2Z0G A;  4A8F A;  5KFD A;  1RYS A;  5A8W B;  2R42 A;  3GJT B;  4FZV A;  2OIH A;  1P1T A;  1FKA F;  4AFF A;  1MWZ A;  2KG1 A;  4P52 A;  1HIY A;  1U1N A;  3SQG B;  3PW5 A;  1RWN B;  2WHO A;  2WVD A;  3CUN A;  1FEH A;  3CJQ A;  2EKN A;  2NRE A;  2B9W A;  2VBY A;  4CWB A;  1TKZ A;  4HHJ A;  1XR7 A;  4DV5 F;  1P1L A;  1U8S A;  4TY8 B;  3C2P A;  1QAX A;  3FBF A;  1RAB B;  4CLT A;  1BC6 A;  3C6U B;  3PYG A;  3D1Q A;  4V19 X;  1SC1 B;  1HAR A;  4DL5 A;  3N79 A;  5FLX Y;  2F4V J;  1FKP A;  2BQ3 A;  1VBK A;  2J9D E;  2JRS A;  4QYR A;  2RQM A;  3SI8 A;  1MU2 A;  1Q7L B;  1Q16 B;  1G4C A;  4OMF G;  3KLF B;  2Q1L A;  2AYM A;  2I5J B;  2VKR A;  3W66 A;  3IG1 B;  3Q8Y A;  3I6P A;  3T5K A;  1S0O A;  3H2L A;  4KFB A;  4OJG A;  1FHT A;  1NK9 A;  2VIC A;  4DSJ A;  2E5J A;  4ZJL A;  4PZV A;  3RAX A;  3TVZ A;  4DFK A;  4QYZ J;  1KD1 T;  1F5C A;  1UA0 A;  2H51 B;  4X66 F;  1T9X A;  4W4M A;  2HHH F;  2E5L J;  2PFF B;  2P2C B;  4E2F B;  1RTH B;  3DOK B;  4WFX A;  2XZT B;  1CUL B;  3I82 A;  2LQJ A;  2JEI A;  4QJV A;  1MMD A;  5CZV A;  2HW3 A;  1HNI A;  2M52 A;  4QIF A;  4URS A;  2OPS B;  2KKH A;  4K4W A;  3H98 A;  4KIA A;  5D8H B;  1R27 B;  4OYI A;  5KFR A;  2F9D A;  4X2B A;  3W7B A;  3KHH A;  2N3O A;  3QJJ A;  2CQ0 A;  3T1Y F;  1U25 A;  2YNG B;  2R2S A;  1U24 A;  4DUY J;  4DR5 F;  1N54 B;  3OFF A;  4O3Q A;  1LWC A;  5D4L A;  3QFH A;  2AT1 B;  4NML A;  5J2Q A;  4USV A;  2Y1R I;  2J9C A;  1VQS A;  1NDC A;  2KI2 A;  2UU9 F;  4WK1 A;  1B0V A;  2YH1 A;  3IA0 A;  3FVY A;  1XC9 A;  1B3T A;  1HD0 A;  2BDP A;  3BQ2 A;  1VFJ A;  3I0R A;  5A76 A;  3JTN A;  3Q8P B;  2RDD A;  1HI8 A;  4NRT A;  1NK5 A;  4NMX A;  3NCQ A;  3BR9 A;  1U2R A;  2OO4 A;  3W8G A;  1YIJ S;  1YVF A;  2IDL A;  4E98 A;  3MM6 A;  1EKR A;  2QN6 B;  3P3D A;  2XI3 A;  1F9F A;  1TZ0 A;  3NNA A;  1XIQ A;  1FEE A;  3EMT A;  4PWU A;  4DV4 F;  3SCI E;  3H59 A;  4QIG A;  5KFO A;  2CQP A;  4M5J A;  1S0V A;  1WHX A;  1A0O B;  5EDW A;  2BW2 A;  2RAQ A;  2V2Z A;  1VLO A;  1RKI A;  3CIZ A;  1XR6 A;  2L48 A;  3CED A;  2HFZ A;  1X9W A;  2RHQ B;  1IR1 A;  2EG2 A;  1M1G A;  4AL6 A;  4IOC Q;  4RZR A;  4CO4 A;  1PIL A;  3N6M A;  5KT7 A;  3DLB A;  4M94 A;  4R5P A;  2DK2 A;  3R1L A;  4UOH A;  1S9G A;  1JLC B;  3SCK E;  3ISN D;  1XK8 A;  2AMC B;  1O51 A;  2O67 A;  1FWK A;  3IN5 A;  2FDN A;  4DSK A;  3MMJ A;  5KFU A;  1Y11 A;  4IG0 B;  3VCD A;  2F8E X;  4NPO A;  2C3U A;  3GSI A;  3AH6 A;  1HWU A;  3OTB A;  1NK8 A;  4P2F A;  2BKO A;  3A8I A;  3Q23 A;  3LPE A;  3AOD A;  2GIF A;  4Q2L A;  1GX5 A;  3QRR A;  4OJH A;  4P71 A;  2XO7 A;  4CP5 A;  4KGX B;  4DHV A;  1GXU A;  4PWW A;  1TK8 A;  4RWW A;  4ED5 A;  5LMU J;  2ZOG A;  4C8O A;  4ZPA A;  4KH0 B;  2GHV C;  5SUH A;  2OJ3 A;  3OFE A;  4C6A A;  3CMA S;  4U96 A;  1UMJ A;  4ZVE A;  4JV5 J;  5GAE U;  3C46 A;  1SKW A;  3OL6 A;  2MZJ A;  2HND B;  3OJS A;  1VJW A;  5M2U A;  4Z37 A;  4B3S F;  5H1S V;  4H4O A;  1VQO S;  8AT1 B;  2CVI A;  1F2G A;  4ZPT R;  1XN9 A;  2VC1 A;  2DPJ A;  2N82 B;  1W2B R;  2ZJQ Q;  2IRU A;  4KO0 B;  3F56 A;  4N41 A;  3O5T B;  3CD7 A;  2WCX A;  3TW0 A;  4F3O A;  1TUG B;  5KFX A;  3DI6 B;  3IM8 A;  3O2I A;  1WC1 A;  2R7Q A;  4Y2M A;  3PKM A;  4NCB A;  3SBM A;  3TX0 A;  2VDI A;  2J6U A;  3C14 A;  2UXB F;  1RT7 A;  1H2V Z;  4F67 A;  2DXE A;  1P27 B;  2VUG A;  4J37 A;  4DR4 F;  1ZA1 B;  3L09 A;  2P6T A;  4FYY B;  5DG7 A;  1YWX A;  1EQ0 A;  2E1A A;  2AD9 A;  2KN4 A;  3M2U A;  3KK1 A;  4Q0B B;  1G1X A;  5CXT A;  2C3Y A;  4LQ3 A;  3FRY A;  4CIO A;  1MW7 A;  4Z7C A;  1NBE B;  3SFU A;  4JI7 J;  1ZBT A;  3DKD A;  5I3U A;  2V2Q A;  2YNH B;  2HQ3 A;  3HSJ A;  3PKY A;  1LKZ A;  3T9Z A;  1FX2 A;  5HBM A;  1LXJ A;  3SYZ A;  3MM8 A;  1LW2 A;  1WC4 A;  3Q89 A;  2YWK A;  4R0E A;  2JLF A;  1FRK A;  1YLX A;  5BYR A;  4LFA F;  3FCH A;  5BR8 F;  2HEK A;  2MXY A;  3NNH A;  2HHW A;  1EET A;  1R0B G;  2K3I A;  4ES1 A;  1RWO B;  3UNY A;  4CDI A;  2YWW A;  3OLB A;  3NCP A;  2XYH B;  2IRX A;  2DRA A;  4FXD A;  2ZBP A;  3OR1 B;  2IRY A;  5DQG A;  3E8O A;  4NX9 A;  2CQ1 A;  1HWJ A;  1HFE L;  4K4Z A;  1Q5Y A;  4DSL A;  2LQ5 A;  3LP2 B;  3CGI A;  2YKA A;  2HBR B;  3VAL A;  2B8Q A;  3DHW C;  3MED A;  4JV2 A;  4RNM A;  3D68 A;  2ZD1 B;  2CQD A;  3PRD A;  5CYQ B;  1IXK A;  3P8B B;  1WEZ A;  2IMW P;  3UN2 A;  1PBA A;  1JKH B;  2HS0 A;  4I2P B;  4M5L A;  5J1E A;  4HH1 A;  4JOU A;  3LGN A;  3UCZ P;  5LJ5 Y;  3OJU A;  1BMQ B;  1T94 A;  1FD2 A;  4Y65 A;  3QRQ A;  4B9N A;  5BJR A;  2LU1 A;  3JSM A;  3FDS A;  4OI0 A;  4DG1 A;  2MHE A;  2PT0 A;  3RU0 A;  1B0T A;  2DR5 A;  4JV1 A;  4L3N A;  2CJY B;  4DMZ A;  2OTL S;  2VFU A;  2ZVI A;  2G13 A;  4JI4 J;  1TKT B;  2GIR A;  4ECT A;  4AE5 A;  4QWE A;  3BO3 A;  2DGT A;  3JQM A;  1D0E A;  4LBH A;  4YUD A;  2AHO B;  5F9L A;  2DNM A;  2EKY A;  4J9R A;  2RSQ A;  4KSE B;  2CPI A;  4ECV A;  3OXG A;  3UD3 P;  2EC2 A;  3DMJ B;  2PD1 A;  3EJM A;  3C3L A;  5E3Q A;  1F3V A;  3R8Y A;  4UW2 A;  4OYM A;  3EPI A;  2KO1 A;  4KR0 B;  2KZM A;  1PYO B;  5KFA A;  1TTH B;  1RA6 A;  1NLK L;  4QR1 A;  3SDE B;  3NMR A;  2IYI A;  4P7T A;  4WP3 A;  1SQE A;  4CNZ A;  3AD8 C;  2WSF C;  1X0F A;  4X84 A;  3AHP A;  4L3K A;  2ZH7 A;  2XYG B;  3HKZ D;  4DPU A;  1H38 A;  4KV8 B;  2OD4 A;  3A3N B;  2BRK A;  3QT8 A;  2ZOM A;  1JJ2 R;  4OYZ A;  2CPJ A;  2XTJ P;  2QA4 G;  2BAC A;  3QZ8 A;  1Q82 T;  3MEG A;  3OTD A;  2MQO A;  2VJU A;  3VQT A;  3M8Y A;  5FJ4 A;  4U67 Q;  1YRT A;  1YRU A;  4WKR A;  1R89 A;  4XAK A;  1HBO A;  1WC3 A;  2CJX B;  3CCU S;  4OYW A;  3M6W A;  4G65 A;  2MZS A;  1UFW A;  2VDH A;  3A8K A;  4KH1 B;  3NAH A;  1RKJ A;  2FGO A;  2CPH A;  3POT A;  2A6M A;  2CPD A;  2OPR A;  3GB0 A;  2XS7 A;  1R31 A;  4DV0 F;  2J9E A;  3MM5 A;  4DCJ B;  4DN0 A;  3DFE A;  2RRB A;  4UUW A;  2Z2Z A;  1L3T A;  3BKF A;  5HVF A;  3HKW A;  1IKY A;  3OT9 A;  1NSP A;  2FVS A;  3JAM Y;  5L1K A;  4ECR A;  1FER A;  4RLE A;  3BH6 B;  1W2I A;  5MLC V;  5IM0 A;  1C0T B;  4N5S A;  3W9J A;  1FNM A;  2Z56 B;  4OZ2 A;  2UXD J;  3ULH A;  3HT3 A;  1JIH A;  3ZFV A;  1XNQ J;  2VH7 A;  1WF0 A;  3FUY A;  1CEZ A;  5K8P A;  3MEE B;  1N5Q A;  4W98 A;  3HVR A;  4UUX A;  2MY8 A;  3J81 U;  1EKS A;  3QSI A;  4RUH A;  3PZP A;  4C11 A;  4LVO P;  3OW2 R;  2GVD B;  3FSY A;  4PG6 A;  3IRW P;  2JWN A;  3DN9 A;  4KYZ A;  3RRK A;  4F0M A;  1UFK A;  5EWG A;  4DF8 A;  2B0G A;  3KLV A;  4O3S A;  1RT2 B;  1VBZ A;  1YBA A;  2HQI A;  1FJE B;  1RAF B;  2R7S A;  4G1I A;  2AV5 A;  4KGZ B;  3MHY A;  1JNZ B;  2YWH A;  4JBC A;  4U9R A;  2W2M P;  1UP1 A;  2FLN A;  2YXL A;  3BSC A;  3EGN A;  1NB7 A;  1K8A T;  1X9S A;  1EP4 A;  4X4R A;  3ISZ A;  1U0S A;  3DRS A;  3UN3 A;  1RWW B;  3NXZ A;  3JAM U;  3Q2S C;  1EIY B;  4X62 J;  5DM7 Q;  4OJ1 A;  2YPY A;  3VZI A;  5JJB A;  4USM A;  2C2R A;  5GMD A;  2EFN A;  3KG0 A;  2V4J A;  4C9D A;  1N5Y A;  1NCL A;  4KGK A;  4J9K A;  1N32 F;  2VQF F;  2HZC A;  2IVM A;  3H4D A;  2UUB F;  1F6T A;  1KON A;  1VGY A;  2M3D A;  4DR7 J;  2OLW A;  2E44 A;  4QQB A;  1C1C B;  4K4V A;  2AX0 A;  3GJR B;  2OFG X;  3KWM A;  5KG2 A;  4ZA1 A;  4NL5 A;  3CWJ A;  4DLE A;  5KFM A;  3DGV A;  2ZHB A;  4UOG A;  2GQ2 A;  3FFI B;  4K59 A;  3U27 A;  2OAU A;  2ZNZ A;  5DRK A;  1M0S A;  4ID5 A;  4DX6 A;  1JLF B;  3CD6 S;  3UDV A;  1UEV A;  4IQM A;  2BE2 A;  2QE5 A;  1RT6 B;  1ELO A;  2ILY A;  2UVU A;  3B6B A;  4O3R A;  2YWE A;  2MQP A;  5HMY A;  1E6V A;  2NLW A;  3FZ2 A;  3PNI A;  1E6Y A;  5J2P A;  2HNY B;  4NXN F;  2VOO A;  2U2F A;  2R7X A;  5L1L A;  1GTE A;  1PYT A;  4K7Q A;  1WOO A;  3ZTO A;  3TYT A;  4ZVH A;  1SJ4 P;  1PYS B;  4LRC A;  1RHM B;  2GQC A;  1HMV B;  2DNZ A;  3HZG A;  4LVN P;  4HHH A;  4ES3 A;  3VAJ A;  4DUY F;  1LFW A;  1ACM B;  2D3O R;  1M5P C;  2L41 A;  5IV3 A;  4RX6 A;  4F4K A;  4NEY A;  4TKT A;  2BYC A;  3KJV B;  3R97 A;  1O8B A;  3DOM A;  2DGS A;  2GHW A;  5HSP A;  4B02 A;  1IR2 A;  2F4F A;  4BC9 A;  2A3J A;  3ET6 A;  2N4C A;  1TV6 A;  6FD1 A;  3RW7 A;  2XMA A;  1APS A;  1NUE A;  2HMI A;  3OUY A;  4Q45 A;  2P8I A;  3WIU A;  3P45 B;  2BOP A;  3CC2 S;  2QSW A;  3JXO A;  5ADZ A;  3D0G E;  3ZC4 A;  5G0R B;  2UUA F;  3A8E A;  2FJX A;  5A8R A;  1FKO B;  2DJW A;  5H9E J;  1VS3 A;  5AJ3 F;  2OPP B;  3EDR B;  4OZ5 A;  3D6M B;  4PQU A;  3MM9 A;  2YNI A;  2ZHO A;  3HP6 A;  1SJF A;  1AB8 A;  3DRP A;  3NBP B;  3UD5 A;  5AE1 A;  4J9U E;  3MXH P;  1TL7 B;  1J5O B;  1P9Q C;  1U1Q A;  2EFG A;  1V3S A;  3HLU A;  2OI2 A;  4IFY B;  4PWD B;  4BDP A;  2CNL B;  3LA0 A;  3DM2 B;  2DPI A;  3AQO A;  1S4E A;  1OYE A;  2XGP A;  2QFI A;  5GMK a;  2XB2 D;  3TO8 A;  3AOB A;  5L9X A;  3ZNJ 1;  4ZMM A;  1P6T A;  4LFC F;  3RBZ A;  2HVZ A;  3R5C A;  1DTQ B;  3PFE A;  2XY6 A;  5F8H A;  1P8G A;  4ECQ A;  1FWL A;  2F8M A;  1UVI A;  4LT6 A;  3OL7 A;  4I7F B;  2NXE A;  4TU9 A;  1FT8 A;  4R8U A;  4M5K A;  2K8G A;  4OZN A;  5KOW A;  2C22 A;  2BJ3 A;  1N6Q B;  3BSN A;  1FRL A;  3BF4 A;  2R7V A;  5B7W A;  4B9S A;  1MRO A;  2FVR A;  1REV B;  2FHJ A;  4DV7 J;  3OR2 A;  3RAQ A;  4OX9 J;  3CO0 P;  1BQX A;  4LBI A;  2XMV A;  1IKV A;  1DQA A;  3AOA A;  7FDR A;  1L3V A;  2KVQ E;  1KLM B;  4XK8 C;  3KDO A;  1FJG J;  5KG6 A;  1U45 A;  4QU7 A;  1ZZF A;  4JV5 F;  4JI6 F;  2HZA A;  4IDK A;  4DL3 A;  5A8K B;  5D3G B;  4I64 A;  4RNF A;  1X4E A;  2W25 A;  2IFX A;  5L46 A;  1LWE B;  5B08 A;  5KT2 A;  1JLG B;  1BY9 A;  1KP6 A;  4LQ9 A;  3G9C A;  2UUW A;  1I5O B;  2GNK A;  4UTG A;  3UD4 P;  1EQM A;  5HL7 Q;  1X8D A;  4WTO B;  4WXO A;  1PGZ A;  2BM0 A;  1R8P A;  1UVJ A;  2OP5 A;  3BH7 B;  4URG A;  2DHA A;  4C48 A;  3UR3 C;  5E3C A;  4DR2 J;  1XER A;  2CNO B;  4DV1 J;  4IQX A;  3GV8 B;  2HK2 A;  3CDE A;  2GQQ A;  2CJK A;  3QAT A;  3CJK A;  1DLO A;  1HNW J;  2Y8W A;  1S99 A;  3CO9 A;  4OHX A;  1LK7 A;  3R5A A;  4FF2 A;  3KNA A;  1MN9 A;  2FHJ D;  2W7A A;  3DGP B;  4A8S A;  4LBP A;  2XG8 A;  1M1H A;  4Y28 C;  2HHV A;  1UVM A;  1JJH A;  3MOZ A;  1HBM A;  2KRR A;  5KFE A;  4DUT A;  1NZA A;  4ZN1 A;  1VQP S;  1MMN A;  3TI0 A;  3ETO A;  1WWH A;  3S8S A;  3BO2 A;  4H4K A;  4JI7 F;  3I5C A;  4AD6 A;  3UWT A;  4RW8 A;  4ELT A;  1VQN S;  1CJU A;  3KMQ A;  1T03 A;  3BSO A;  2WK4 A;  2O1P A;  1RT4 A;  4GKJ J;  2RQ4 A;  2YKQ A;  1JWW A;  4OZ1 A;  2C2M B;  3KLI A;  5GAG U;  2DR8 A;  4P10 A;  1KQK A;  1N56 A;  1FI4 A;  4CH0 S;  2B5J B;  4KGV B;  4DCP B;  4X65 J;  4DXL A;  3E3X A;  3NOG A;  2JC1 A;  4LRE A;  1TVR A;  1AFJ A;  2A10 A;  1U1M A;  4IRD A;  1R7I A;  3TAN A;  4Q43 A;  4BBY A;  2NPF A;  1NJX A;  4M5H A;  4ZP8 A;  2GCF A;  5KFH A;  1KDN A;  5HP1 B;  4MH8 A;  3E2E A;  2NXC A;  2B4V A;  1CJV A;  2HHX A;  3PX4 A;  4DPO A;  3AJ2 A;  5DDR C;  5EWE A;  4JI0 J;  2RDI A;  1TP7 A;  3G2X A;  4EWT A;  3QGG A;  2BUN A;  3LQV A;  1NSK L;  3EGZ A;  3MUR P;  2GIQ A;  3ZZO A;  3H40 A;  3G82 B;  2A6O A;  5F0U A;  3K7R A;  3TAM B;  1QSS A;  3DLJ A;  4GO7 X;  2YTC A;  4X4O A;  4HVZ A;  2WVB A;  4MYU A;  2BOA A;  4JI4 F;  3FBE A;  3PIO Q;  2H5J B;  5H9F J;  2KM8 B;  4L74 A;  4K50 A;  3C6T B;  1JLA B;  2IYG A;  5EN1 A;  1KSP A;  3HSZ A;  2RIJ A;  1K1Q A;  3SV4 A;  1R0C B;  3IC1 A;  2OPQ B;  2YKN B;  1UL3 A;  3I4P A;  2VQE F;  1BE4 A;  2Z30 B;  3M1V B;  3KTQ A;  2BV3 A;  3THP A;  4PUO B;  1M1K T;  4DL4 A;  3VR1 A;  4H4M B;  1T9W A;  3PEH A;  2KVI A;  3DRY A;  3IR7 B;  2HRY A;  1V3R A;  3C16 A;  4LF6 J;  3I56 S;  4DZD A;  2KT5 A;  4WWS A;  3MUV P;  2HRU A;  4ATN A;  4PQA A;  3UVJ B;  2ZVS A;  4HYK A;  1H74 A;  4DQR A;  4DUZ J;  3NOC A;  3U1N A;  5IQQ A;  1N4L A;  1VCT A;  3L7P A;  3ZTR A;  3N6N A;  1VC5 A;  4N77 A;  1TAQ A;  4FS2 A;  2XBP A;  3VF0 B;  1RWX B;  2ADC A;  2JOQ A;  4M5D A;  1Y9O A;  5I3P A;  3I96 A;  2X1B A;  1RWM B;  2YNF B;  1R0A A;  3AAW B;  1KKH A;  3IAM 9;  3V6D B;  3V5R A;  3DU5 A;  4Y34 A;  4J9O A;  4ER8 A;  3MAA A;  4OIX A;  1Y7P A;  1HHT P;  4ZPD A;  5LSR A;  2CWK A;  3O1L A;  2LDI A;  4NLW A;  1WEX A;  3TAP A;  1Q8B A;  3M2V A;  1GQE A;  2AU0 A;  3GFZ A;  5LMN F;  3K59 A;  2ZM6 J;  2DO4 A;  2QYG A;  3DLG B;  2AYB A;  1JQG A;  3MPY A;  1VQM S;  4WXW A;  5EWF A;  3RUB L;  2V67 A;  2E7X A;  5EHH A;  2GO9 A;  3WZ0 A;  1QSL A;  4BS2 A;  4NXM J;  1NME B;  2FJD B;  4FF4 A;  1R8B A;  4CO1 A;  1WHY A;  2LFV A;  2QG9 B;  4CO5 A;  2EEY A;  5DET A;  4WBF A;  1X5T A;  3OVS A;  5KT4 A;  2WVF A;  2MDA A;  4HAC A;  2H54 B;  4P2M A;  1LWF B;  5HO4 A;  1PJ5 A;  3LP0 B;  2QEX S;  1S9E B;  2EC0 A;  3GR0 A;  1MG7 A;  3D7S B;  2RKI A;  2UXD F;  3GFH A;  1TQL A;  2WB1 D;  3MPW A;  3NP5 A;  1SUQ A;  2AEJ A;  1XNQ F;  1FFG B;  1XMO J;  2BX6 A;  4DBQ A;  1I3O B;  1HI1 A;  5EX3 A;  4DS5 A;  3QID A;  2GFF A;  4CM0 A;  2F3J A;  1KHW A;  4CLU A;  5IXU A;  1S1V A;  9RUB A;  3OHA A;  3FMB A;  3HSG A;  2CPF A;  4LF8 F;  4FKX A;  4FF3 A;  2PSZ A;  3A4T A;  1IR0 A;  1FXR A;  4CM2 A;  1UPP A;  3C15 B;  3MDF A;  2X3G A;  1Q1K A;  4DEZ A;  1JLE A;  1B4S A;  2MJU A;  2ASL A;  4USH A;  2E9Z A;  4JI5 F;  3W5Y A;  3MFH A;  2UUT A;  3HM9 A;  5HQM A;  2GHP A;  3CCZ A;  3ENW A;  1DJ0 A;  3A3O B;  2WBM A;  2D3Z A;  2VG6 A;  2Y9H A;  1RAJ A;  4CI0 B;  3H90 A;  3M2R A;  1HWL A;  5A6P A;  3Q86 A;  3IRX B;  2VON A;  1X4A A;  3MUM P;  1U0H A;  3GP9 A;  2DR9 A;  5E3A A;  2RML A;  1TEL A;  2FY8 A;  4WE1 A;  1LNQ A;  4USJ C;  4CLY A;  1Y3J A;  2CQC A;  2LXI A;  1PSD A;  4RU2 A;  3FBC A;  4M1K A;  2HHQ A;  1ZTT A;  4UQT A;  3CJ4 A;  1HNZ J;  4QOT A;  2GML A;  2P6S A;  3ZZ0 A;  1TUW A;  4C7Q A;  3T1H F;  4KPY A;  1FF2 A;  2ILZ A;  2VKZ G;  2NSC A;  4ZKA A;  3D5M A;  1VRU A;  2J8S A;  2XWY A;  2XY7 A;  2V50 A;  3PXG a;  5DGA A;  3LW5 C;  2Q6B A;  4R25 A;  3QFW A;  1QTM A;  1KVI A;  3BN7 A;  5CCM A;  4LF4 J;  4DR7 F;  4AXI A;  2AEM A;  3C8Y A;  1G3O A;  1JLB A;  4P73 A;  3HD2 A;  2PI5 A;  5A0Y B;  4O3P A;  4F2S A;  2LEP A;  2LMI A;  4FS1 A;  2BJ9 A;  2VBW A;  3KJQ B;  1NRK A;  2MZQ A;  1ZOT A;  3BZQ A;  4ZVT B;  3M9N B;  4B9L A;  5J2N B;  4C8K A;  1VBY A;  1GXL A;  1RAO A;  1S97 A;  3DCA A;  4O4R A;  4X4Q A;  1RE1 B;  2RF2 B;  3RR8 A;  3MF5 A;  2PE8 A;  1HBN B;  2XZD B;  2V2K A;  1CS4 B;  2I8E A;  2MGZ A;  5D0R A;  1T05 A;  2QMW A;  4IR1 A;  2PA8 D;  4JB8 B;  2MQM A;  2LQ9 A;  5ETO A;  2X7I A;  4CQ1 A;  4ECZ A;  2CJB A;  5LOQ A;  3LP1 A;  3ZZP A;  3KK1 B;  3BDE A;  1B70 B;  4XO0 A;  4I1T A;  1NSQ A;  2VU5 A;  1EJ7 L;  2FY1 A;  2CAJ A;  3M4X A;  2CPX A;  3LH2 S;  4ETX A;  1ZPW X;  2GA7 A;  3D28 A;  1GK8 A;  1WHW A;  1NXI A;  1RHQ B;  4MFB B;  1ZS6 A;  3RRH A;  3V81 A;  2M0G B;  1Z4U A;  1JJ4 A;  3IM9 A;  3IS9 A;  4OYB A;  8ATC B;  1TKX A;  2W9B B;  3NNC A;  2I6W A;  4YB7 A;  1VHF A;  5D0E A;  4X66 J;  5L38 A;  2HWH A;  3ILJ A;  1UEK A;  3PJX A;  4RBT A;  3BQ0 A;  1FDN A;  1NKB A;  1SC3 B;  1VDH A;  3MCS A;  4RW6 A;  2I38 A;  2ATC B;  5CQG A;  4NLO A;  2B43 A;  3MR3 A;  1Y5L B;  1KEK A;  1BQM B;  4ED0 A;  5B0E A;  4O0I A;  1VQ6 S;  2MKK A;  3KLG A;  3Q24 A;  3M9O B;  3OQ2 A;  1URR A;  1T7P A;  4B9V A;  3T1Y J;  3HHL A;  4I6Y A;  2IVY A;  4DR5 J;  2DGV A;  2CDQ A;  2KYZ A;  3BBC A;  1PBU A;  2VA3 A;  4WCE Q;  2EXU A;  5K14 B;  3MTK A;  3QT6 A;  3QAU A;  2DRB A;  2UU9 J;  3CDW A;  4QPX A;  2ZH3 A;  3G87 A;  1KOO A;  1RIS A;  1VHI A;  3K5L A;  3OLA A;  3T19 A;  1H2U X;  1AXQ A;  4J7C A;  3JSM B;  3VQS A;  2X1A A;  2L9N A;  2CPY A;  5E33 A;  1VR6 A;  2XSJ A;  2E29 A;  1HPZ A;  4UOF A;  1GMU A;  5DZ6 A;  4NLU A;  2V8V A;  4OHY A;  3TA0 A;  5LSL A;  3MAQ A;  1KR4 A;  1CJT A;  3CT9 A;  4Y2C A;  4LIW A;  3VAH A;  1Y5I B;  2DH8 A;  2ZFH A;  4OJ3 A;  4P7V A;  2K7J A;  2G1D A;  1S1X A;  1KBR A;  4OYX A;  4DSE A;  1WAC A;  1FJ7 A;  3HO1 A;  1IKW B;  2DNH A;  4B3O A;  3K5P A;  4PAB A;  3H5U A;  4Y00 A;  1Y10 A;  2XCP A;  5DO2 A;  1RLC L;  3KG4 A;  2DGX A;  2PEH A;  4A48 A;  2I2Y A;  1RTD A;  1U8W A;  1M90 T;  2ZHA A;  3CC4 S;  2XLK A;  1CSJ A;  1R8A A;  2KG0 A;  2GMH A;  3O8W A;  2VL1 A;  2DCU B;  2GJF A;  1QUV A;  2W7O A;  2BAN A;  5KFP A;  2BR0 A;  3CUL A;  4J9Q A;  1MNE A;  2DIU A;  2ERR A;  1SKR A;  1VMB A;  2OD6 A;  5C25 B;  2HS3 A;  4G3I A;  1R3N A;  2R7U A;  3NG8 A;  3HD1 A;  3MM7 A;  3ZTQ A;  4UQG A;  2HQF A;  4ZCI A;  3DLE B;  2YY3 A;  4A8W A;  3B4M A;  2GC8 A;  3CD5 A;  3VTI A;  5IT9 Y;  2FVP A;  3Q8V A;  5KG3 A;  5KFC A;  3MMB A;  4P2X A;  5HJY A;  1DQ8 A;  2B4P A;  1S6P B;  1ZH5 A;  1T3N A;  4OI4 A;  3TJ9 A;  4DR2 F;  1HQ2 A;  3IXQ A;  2MB0 B;  4HHU A;  5KAK A;  2Z57 B;  2D3U A;  2DNG A;  4ICL A;  2GVZ B;  2RIL A;  1HNW F;  2G0C A;  4JI8 F;  4TNO A;  1NKE A;  2M9K A;  1VQ9 S;  4G1Q B;  2OPR B;  1NDK A;  4IH6 A;  4F4Y A;  1FE0 A;  3P4U B;  5IZH A;  4B3S J;  1MN7 A;  2DXF A;  1GTH A;  2KJW A;  4X4V A;  2HK3 A;  1XR5 A;  4GMK A;  4WP8 A;  2XGQ A;  2I1R A;  4IUF A;  1PG5 B;  1RHJ B;  1FFS B;  3IO1 A;  4X64 F;  5KFI A;  1HHS A;  2XWX A;  1SC4 B;  2KYX A;  5KFS A;  5MAO A;  4QW9 A;  5B0C A;  2RS8 A;  4DOZ A;  3P5B P;  5B09 A;  4F3M A;  1Q7Y T;  4GKJ F;  3DRX A;  3PDN A;  3CJ8 A;  1VC0 A;  2A0F B;  1AW0 A;  3E01 B;  2UXB J;  2HHS A;  3R5G A;  5IT9 U;  4NLX A;  4DR4 J;  4RW4 B;  3CCQ S;  2EG1 A;  3D9B A;  4WIQ A;  3T1A A;  2UUC F;  1WEL A;  4TLR A;  1EHW A;  1XJW B;  1OO0 B;  2XS2 A;  1U1P A;  1FE4 A;  4EUV A;  2DH7 A;  5FII A;  3ITH A;  3EYZ A;  2M2B A;  2RNE A;  2H1Y A;  4C8M A;  1V3Z A;  3ENV A;  4UST A;  1Y00 A;  2JNJ A;  1C4C A;  1SC6 A;  1Z2L A;  4QU6 A;  1FTR A;  1YHQ S;  4DI6 A;  1U1K A;  2BJE A;  2YX1 A;  1IBM F;  1LW0 A;  3NY0 A;  1N33 F;  4KTQ A;  5A8W A;  2V6A A;  4MK9 A;  1S0M A;  2Q66 A;  5BR8 J;  3I9Z A;  4LF9 F;  4F04 B;  1RDR A;  4LSL B;  4K5R A;  3PJ9 A;  2A2C A;  3K8W A;  5HMZ A;  1TU0 B;  8RUC A;  1XMQ F;  3SQG A;  3H7H B;  4DPT A;  3OFH A;  4LF5 F;  2M70 A;  4MKY A;  3RJM B;  2BZ2 A;  3MGJ A;  3T6B A;  2ZBC A;  2Z4P A;  3TUJ C;  3RW6 A;  5AXK A;  2D74 B;  2E66 A;  4DQS A;  4TY8 A;  3NEK A;  1Z1Z A;  4NLD A;  1JXL A;  1PIE A;  2F9J A;  2BJ1 A;  2QLX A;  4RUB A;  5DDP C;  3C6U A;  1RAH B;  4YR0 A;  3GLJ A;  4DCO B;  5HRO B;  1KFD A;  1RSC A;  2RHS B;  1SXL A;  4GRS A;  1DTT A;  4NA1 A;  3UPF A;  3KLF A;  4FXV A;  2I5J A;  2AKW B;  3IG1 A;  4OZJ A;  2BVZ A;  3ENQ A;  2ROP A;  4HR2 A;  2R8K A;  3FMW A;  2CG4 A;  3PRB A;  4UY8 5;  4I67 A;  1L5U A;  4FF1 A;  1WNE A;  1Q86 T;  2IM3 A;  4ZLJ A;  3AJ1 A;  2ZBQ A;  1EX8 A;  2OHD A;  2DIS A;  1TFW A;  3HMJ G;  2Z2M A;  1RTH A;  2ZH6 A;  3DOK A;  1CUL A;  1VC6 A;  4J91 A;  5DZ7 A;  1RUS A;  3CXC R;  1F60 B;  1D1U A;  2W2N P;  2F63 A;  3IGN A;  3UFC X;  2MSS A;  2BKN A;  5FDL B;  2HHT A;  1N34 F;  4RNO A;  3R7N B;  5D15 A;  2OPS A;  3UDE A;  4MJK A;  4LRB A;  1WEY A;  4NYP A;  2CJA A;  2VIH A;  3D6H B;  2MKC A;  5E5N A;  3S7R A;  1H73 A;  3R5J B;  1A9N B;  2EK6 A;  1U6Z A;  5ETK A;  2YNG A;  3DOL B;  2XCA A;  4YHH F;  3KHL A;  2J0S D;  1S1T B;  4NCA A;  5KFN A;  3L95 X;  1H7W A;  2QA4 S;  1TV6 B;  3D6F B;  1RT5 B;  1UTA A;  1JJC B;  1F5A A;  1KWM A;  1FNO A;  1VIS A;  3HI9 A;  2FC8 A;  3WHI A;  2ZE2 B;  1FO1 A;  2FYX A;  1X60 A;  3I55 S;  3MEC B;  3CJ0 A;  4K2J A;  3W1Y C;  5BYS A;  5ETL A;  4ILM A;  1PJ7 A;  3QSY B;  2GZO A;  4ZVR B;  2LKZ A;  2IA6 A;  1NHU A;  4RW9 B;  2VG7 B;  4DFJ A;  2ZH2 A;  3GON A;  3GJQ B;  1WTB A;  3L4B C;  1MWQ A;  2J0W A;  2O66 A;  1Y4Z B;  3PHE A;  3JB9 k;  1RLD A;  5IWA J;  3KLH B;  1L3K A;  4DV0 J;  1G7C B;  3GE9 A;  3L9Z A;  3T3F A;  4PG5 A;  3RG6 A;  3OPK A;  3EZO A;  5HJX A;  3NGD A;  1EAR A;  3K17 A;  3TUP A;  3I32 A;  4ETZ A;  5H9E K;  1JLC A;  4TVA B;  1REG X;  4ZPV R;  1NDP A;  4IH5 A;  2XSF A;  4NYZ A;  2OGU A;  2DNO A;  4K2X A;  2BE9 B;  4OI2 A;  3D3B J;  3VGT A;  2PMW A;  4FN5 A;  5DM6 Q;  4ZVF A;  4IG0 A;  1FRX A;  2MKH A;  2RH3 A;  4IG3 B;  3QO9 B;  3BN4 A;  3GQC A;  2MTL A;  5J2M B;  2KDO A;  3VGV A;  3NLC A;  1RBO B;  4F4A A;  2R7T A;  2HLT A;  4RW7 B;  3ZTS A;  3KDN A;  2Q6C A;  4JI1 F;  1YJR A;  3GWC A;  1HNZ F;  3QAE A;  3HJF A;  2ZDP A;  1SB6 A;  2E7W A;  4Z2X A;  1V9O A;  4ZPC A;  2CZ4 A;  2YQ1 A;  2N7C A;  3HZE A;  3TVY A;  1KQF B;  1U6B A;  1S77 D;  3ONQ A;  3BB5 A;  3M05 A;  1FK9 A;  5HQ8 A;  2FLL A;  1RBL A;  2FHK A;  2MKJ A;  1RK8 A;  2KXF A;  4PG7 A;  2HND A;  1U49 A;  4O3O A;  2F1F A;  3R2C J;  3G8S A;  2HFS A;  5ETN A;  6AT1 B;  5HQL A;  2D41 A;  2YKP A;  4IOA Q;  3B82 A;  2H4W B;  3ILO A;  1UWB B;  2DNR A;  2ABY A;  2ACM A;  1Z2Z A;  3R1H A;  1BLU A;  1C4A A;  3EIC A;  4J9M A;  1BWE A;  2V69 A;  2C2D A;  4WFB Q;  5F3Z A;  4KO0 A;  1TK0 A;  2WAQ D;  1NH8 A;  1R8C A;  3ZZZ A;  5HK4 A;  4GVB B;  4O44 B;  4A8Y A;  3DI6 A;  1ZAW A;  3MR6 A;  3D4J A;  1N32 J;  2VQF J;  2OMO A;  3HK2 A;  1OYD A;  2UUB J;  2ZJR Q;  1LFP A;  5DJB A;  3T6J A;  2OFH X;  4QBU A;  3PYF A;  1S72 S;  2B4U A;  2DCL A;  1JB0 C;  1QSY A;  4N7T A;  3DHX A;  3RB6 A;  2D69 A;  1OPI A;  3Q8U A;  1RB0 A;  4Q0B A;  1T3O A;  2DGQ A;  4FDF A;  4MYT A;  4TYB A;  4PXE A;  4DQQ A;  3W5X A;  3TQE A;  2JZ5 A;  3GMG A;  4LF1 A;  2YNH A;  5CA5 A;  3QQC D;  3IAS 9;  2NXJ A;  1KFS A;  2Y0S D;  2JH3 A;  3JYT A;  3BYR A;  2R2T A;  4NXN J;  2YKM B;  1TVR B;  1UWA A;  4AYB D;  4IYQ A;  3M9M B;  2P9G A;  1ZM3 A;  5IC4 B;  5JXS A;  3HHL C;  1OPZ A;  2BQR A;  2PO4 A;  2LA6 A;  3OR1 A;  1OSC A;  1UKU A;  2KJV A;  2D3O 1;  3LP2 A;  2E1C A;  2MY7 A;  2JJ4 D;  1VLY A;  2E9R X;  3BJY A;  1TKD A;  3BSA A;  3UDL A;  1U02 A;  2OKQ A;  2ZD1 A;  2IC3 B;  3ZZY A;  4QWA A;  2IHR 1;  2Y1L B;  1HNX F;  4B3M J;  4NZ7 A;  1JKH A;  4I2P A;  3PJW A;  2DEI A;  1UJ6 A;  3ZTP A;  4CRJ A;  5IC6 B;  4DV6 J;  4IO9 Q;  4DPW A;  1YQH A;  5D4N A;  3AT1 B;  4K4U A;  1RU2 A;  3VWS A;  1TL1 B;  2UUA J;  2HHP A;  3FSI A;  2C3M A;  5I3Q A;  5AJ3 J;  4ZLL A;  4Z7Y A;  4GC7 A;  2GW8 A;  4A8X A;  2HZV A;  3O44 A;  1T95 A;  1T9T A;  2FZC B;  3MPU B;  1TKT A;  3EXC X;  1C0U B;  1D8Y A;  3H5S A;  1ARO P;  4CYU A;  2DHH A;  4EZ9 A;  3MMA B;  2EFP A;  2RUS A;  3W2V B;  2D7S A;  5CYM B;  4K4X A;  1CQN A;  2JEJ A;  1OY9 A;  1SH3 A;  3DMJ A;  5LXY A;  4ECY A;  3G86 A;  4F2R A;  1YKW A;  2CQ3 A;  3M8Q B;  3GYN A;  1XMB A;  2IBK A;  1QM9 A;  3ILI A;  2MZT A;  1MWY A;  2R7W A;  3SDE A;  2DHG A;  1HW9 A;  3J80 Y;  3CME S;  4KBI A;  2G2O A;  4LFC J;  1ZM4 A;  4NCG B;  5H9F K;  4YP3 A;  2W2O P;  3V4M A;  1WUU A;  4A4J A;  2BMB A;  4ZVQ B;  3HUL A;  1JNR B;  3KK3 B;  4NA2 A;  4KV8 A;  3MCO A;  3SSQ A;  3I4H X;  5G4D A;  3OXL A;  2K7K A;  1CJK B;  1HNV B;  2IY5 B;  5ETS A;  2QL9 B;  2ZH1 A;  4YFU A;  3SCL E;  2C1E B;  3J7Y U;  4CLL A;  1UEU A;  2GGP A;  1K73 T;  4IFV B;  3MD3 A;  3BRE A;  2H5E A;  2J9D A;  4M63 A;  2YBV A;  4JYA F;  1PKU A;  4MMO A;  4JI6 J;  2W4P A;  3EGW B;  2PFD A;  2VF3 A;  1YBU A;  4HLB A;  4EYI B;  2VD3 A;  1N48 A;  3W2W A;  2KH9 A;  2HWT A;  4KC5 A;  3QJP A;  3GCW P;  3US5 A;  2HSE B;  1WJ9 A;  2XNQ A;  3BEG B;  4HAC B;  3BGU A;  2NUH A;  5K8M A;  1S1U B;  4DV2 F;  4CH7 A;  2FZK B;  1HYS B;  4OLO A;  1RT3 B;  3HFK A;  3FKB A;  1WG4 A;  2J0X A;  4LRF A;  4YB6 A;  3MMC B;  1KHV A;  1LEO A;  4ELV A;  4NLV A;  4RWX A;  3J80 U;  1C0T A;  1R43 A;  3VAM A;  4W90 B;  4ECS A;  2P9E A;  3QNW B;  1TAU A;  2VA2 A;  4Q7A A;  2HQG A;  4TU7 A;  5J1N A;  1W7W A;  3NGU A;  4LR9 A;  3H4B A;  2CQB A;  1HBU B;  3C66 A;  2Y1J A;  4WII A;  4DU7 A;  1R8H A;  1WKK A;  3L7O A;  1WD6 A;  3CCT A;  2GVD A;  4V1A k;  4K4Y A;  2MLY A;  4USU A;  1YIT S;  1NZ8 A;  2IBO A;  2R2U A;  2FD2 A;  4EYH B;  2VBZ A;  2R2R A;  1NH7 A;  4DX5 A;  1M5O C;  1RT2 A;  4OHW A;  1Q8K A;  1AFI A;  2JL9 A;  4USI A;  3V6H A;  4DV3 J;  4C3M A;  4N76 A;  4OL8 A;  4OV6 A;  4GO5 X;  1TR0 A;  4M8L A;  1VQL S;  4N8O A;  3Q8R B;  3FNN A;  2VV5 A;  1S6Q B;  2OH2 A;  2K1R B;  2R7R A;  2KT3 A;  2HFU A;  3ZXW A;  4BWM A;  1HWI A;  3MR7 A;  2RS2 A;  4K0K F;  4OX7 A;  4YY3 F;  2ZWP A;  2M5Y A;  3R7S B;  2YPZ A;  1N36 J;  3TQ1 A;  2MLZ A;  4KB7 A;  5CYJ A;  2XI2 A;  3QMQ A;  3U1M A;  4OZ3 A;  1M5H A;  2RB7 A;  3BS9 A;  1C1C A;  3JTP A;  4DS4 A;  4NLT A;  3SEO A;  1B0P A;  3KK2 B;  4TU8 A;  3AXM A;  2JLG A;  1SBR A;  2OEK A;  3SV3 A;  4FP9 A;  3RAM A;  4DFM A;  4K5S A;  2G9O A;  3PIP Q;  2EVZ A;  4F4Z A;  3N5F A;  2KFN A;  3FFI A;  4DR3 J;  2IVF B;  1F9E B;  1LV5 A;  1QAY A;  3LGM A;  1S4F A;  1KOH A;  2J7U A;  2AEF A;  3FEX B;  1JLF A;  3IR6 B;  3AB4 B;  2Z2Y B;  3VAF A;  4KKO B;  1RT6 A;  3RRG A;  3RB0 A;  2CJ9 A;  5JUM A;  2LQ8 A;  2ZBI A;  3DXS X;  3TRG A;  2DH9 A;  2HNY A;  4WYL A;  4BC7 A;  2VQE J;  4B3T J;  4O3N A;  1ICE B;  1Q0N A;  2BRL A;  1XNR J;  2QLF B;  4NE9 C;  4LSZ B;  1O0P A;  2YVS A;  2JFD A;  3PHT A;  4F25 A;  1RXO B;  3QLH B;  2C2O B;  4L75 A;  4KE5 A;  3AD9 C;  4O4G A;  1IQZ A;  1HQE B;  2XMJ A;  2MEW A;  4QR2 A;  4M5N A;  1S1W B;  4IOB A;  2R8J A;  3MWB A;  3J81 Y;  4C8Y A;  2UXC F;  2ZUG A;  3W64 A;  2L9D A;  2C2K B;  3CJ2 A;  2FQQ B;  4L73 A;  3GSD A;  5E41 A;  4YR3 A;  4DF4 A;  4CT8 A;  3JS9 A;  4ZCL A;  1I6J A;  2XNR A;  1S12 A;  2ZH5 A;  5G0R A;  3TNV A;  2V8G A;  4QW8 A;  3B4D A;  1FKO A;  1NJI T;  4PEO A;  1JMT A;  2OTJ S;  5LMN J;  2FIU A;  3G4S S;  2A18 A;  4U8V A;  1QY7 A;  3J81 j;  1ZA2 B;  4JV0 A;  5I42 B;  2XC9 A;  2E5G A;  4HH0 A;  1C2P A;  2LU2 A;  3QIP B;  2FVC A;  4NRU A;  3J7Z 5;  1FES A;  5JMN A;  4GC6 A;  4E0D A;  2M7S A;  2AJ4 A;  3HX9 A;  4ZVO B;  4WYW A;  3DLK B;  5IWA F;  1DUR A;  4QWC A;  1OSD A;  1TL7 A;  1J5O A;  1VQY A;  4YN3 B;  4IFY A;  3EDQ B;  2B7C B;  1A7G E;  4OX8 A;  3B8H A;  4PWD A;  3KOA A;  3OVB A;  3DM2 A;  1AUS L;  2W2Q P;  3M30 B;  4ZJQ A;  3WDO A;  5BYQ A;  4OI6 A;  2YWG A;  2AGO A;  4CLK A;  1IBK F;  1DTQ A;  2DNK A;  1YJ7 A;  2VPY B;  4QZV B;  2DHX A;  3EVW A;  4TQS A;  2QYC A;  2CQI A;  3BV8 A;  4MKB A;  3WC0 A;  2JVO A;  4I7F A;  1FJC A;  5ITH A;  4WU3 A;  4CO2 A;  2X51 A;  5HLF B;  1N6Q A;  4LF8 J;  1X9M A;  1PAE X;  1DQ9 A;  1X31 C;  4ZIW A;  1N5V A;  2BM1 A;  3UN5 A;  4OQJ A;  1REV A;  5KFJ A;  4JI5 J;  4FYW B;  5DG9 A;  5D78 A;  2W4D A;  3TR5 A;  2PMH A;  1ZET A;  2G2Y A;  3Q0A A;  3MCM A;  3O3L A;  4OI3 A;  1RGV A;  2MZR A;  2HYI B;  5A8K A;  3FEY B;  2FB0 A;  5D3G A;  3IFE A;  3Q22 A;  1KQG B;  2DGO A;  3HHK A;  2VHG A;  1LWE A;  1JLG A;  2ADB A;  4MK7 A;  4PXC A;  1IKX B;  4C3K A;  2RDJ A;  7AT1 B;  5AXL A;  3I5A A;  1Q95 G;  3BGF A;  4C8Z A;  2AJQ A;  4WF9 Q;  5CD4 A;  2V4Q A;  2VG5 B;  3T1H J;  3MOJ B;  4O23 A;  3G6Y A;  2AF6 A;  1SCJ B;  2DGU A;  5D0G A;  4DPY A;  4CLP A;  2DNP A;  1HLW A;  4PYD A;  4I69 A;  1WKJ A;  5T41 A;  1SH2 A;  4ZJO A;  1VIX A;  3WX8 A;  4RKU C;  1KTQ A;  1CC8 A;  3H8Y A;  2PGC A;  3R6L B;  4PCQ A;  3T5J A;  2DNY A;  3GFY A;  5B0A A;  3D66 A;  4RNH A;  3TWZ A;  3GG1 A;  4BWJ A;  3DGP A;  4ZLP A;  3PX6 A;  1IQT A;  2B7B B;  2IJF A;  2HIY A;  3IBF B;  2QLW A;  1FDA A;  1SJ1 A;  2IJN A;  3P96 A;  2MKY A;  1J27 A;  4L72 B;  2HVI A;  1WSR A;  1HI0 P;  2EFV A;  3M8S A;  1SV5 B;  2OEM A;  1VRT B;  1WTF A;  2WRM A;  2B4O A;  1NU4 A;  3NGS A;  1KNZ A;  1XEZ A;  4YME A;  1GH8 A;  3CDA A;  1V5I B;  2ZZM A;  4LFB J;  3AB2 B;  3DYA B;  3CJS A;  3NRB A;  2DBB A;  4F0H A;  4CTA B;  5C42 B;  4FNH A;  3KNG A;  3CJR A;  5K8O A;  1UVK A;  2MYF A;  1GFW B;  4I4B A;  1KVK A;  1F0X A;  1RJJ A;  4AXJ A;  2B5J A;  5ETM A;  3FRZ A;  3ZO7 A;  3D2W A;  3MPV A;  4P72 A;  3ISN C;  1KN6 A;  4NYO A;  3RGI A;  1IJF B;  1VK8 A;  2BJ7 A;  3VVT A;  1UW4 A;  1I94 F;  4ED1 A;  1JLQ B;  2WOM B;  3CJ5 A;  1DRZ A;  5HP1 A;  1Y5N B;  1GEH A;  2E1P A;  2C28 A;  5DDQ C;  1NK7 A;  1WF2 A;  4B3M F;  2V9W A;  2DXD A;  2RD5 C;  4EBD A;  4DL2 A;  2ATL A;  4JI3 F;  2M8D B;  3S1T A;  4DV6 F;  4XTT A;  3PV8 A;  2B56 A;  4UT4 A;  4JI2 F;  2W8K A;  4UZC A;  3V6K A;  1QTN B;  2D9O A;  3BQ1 A;  3PYD A;  4CLZ A;  3G82 A;  1G6B A;  1U1L A;  3TAM A;  3DLL Q;  1RTI B;  3FEZ A;  3UW1 A;  3FCV A;  5B0B A;  2HFN A;  4DFP A;  4U7U K;  4RPF A;  5HN0 A;  3WX4 A;  1RTJ B;  3TZY A;  1NHV A;  3C6T A;  3BPS P;  1JLA A;  1KLN A;  2ASD A;  1C1B B;  4FYX B;  1HL6 A;  2VFT A;  3OTO F;  3H5Y A;  1DTT B;  4OV1 A;  2DY1 A;  1VQ5 S;  3UDC A;  2OPQ A;  2YKN A;  1YJT A;  2CXE A;  5C2C A;  3M1V A;  3R5D A;  4PUO A;  4ZIV A;  1BQN B;  2LA4 A;  5KTQ A;  4H4M A;  1IVZ A;  4RUC A;  2HBY B;  2CQG A;  4K8R A;  3M8P B;  1X4F A;  3EZ5 A;  5GAD I;  1VIO A;  3UVJ A;  4RJV A;  1X4C A;  4LSN B;  2XM3 A;  2ZJP Q;  1SJQ A;  2GS8 A;  2BEF A;  2WW8 A;  1HWK A;  9ATC B;  3M6U A;  3AD7 C;  2ZWO A;  5KFY A;  2GAG C;  5FD1 A;  1AYE A;  3M32 B;  1UFL A;  3I0S B;  2UVR A;  3O6Q A;  2YNF A;  1IBC B;  2HWI A;  2BXJ A;  4KGM A;  3AOC A;  2DNL A;  3V6D A;  1AA1 B;  1S7H A;  5T7L B;  2HGN A;  2CFX A;  4E8U A;  2IM1 A;  2K2P A;  3SXL A;  1WDT A;  2WON B;  4M5M A;  2EFO A;  3U02 A;  1TL3 B;  4A8K A;  4HTJ A;  3L3C A;  3R3T A;  2LYV A;  3DLG A;  4OZ0 A;  2ACY A;  4FBU A;  5FLX U;  1RWV B;  1SVD A;  2PDA A;  1T02 A;  3TA1 A;  1YJU A;  4FNI A;  5DLG A;  2Z8Q A;  3NL0 A;  4XDD A;  4NI2 B;  4EGL A;  4WFN Q;  1TL4 A;  3KLE B;  4HI2 A;  3GYX B;  4AUK A;  3WIV A;  1HQU B;  1O6X A;  1LWF A;  3LP0 A;  1S9E A;  3GYG A;  4P9S A;  4ED6 A;  2ZC3 A;  4J90 A;  3D54 A;  2W9C B;  2F5G A;  4JI8 J;  2H4Y B;  2B6A B;  3DC2 A;  2UVV A;  3N9U C;  2XMT A;  4CZC A;  3EM1 A;  3MEK A;  1S48 A;  2IAJ B;  3TX8 A;  4BLG A;  3BBF A;  2AGP A;  3CCE S;  3W9I A;  3DXB A;  3DRR A;  4PR6 A;  1AZS B;  2V4R A;  5THW A;  1SKS A;  3C15 A;  1M5V C;  2HAI A;  3H42 A;  2RRA A;  4Y2A A;  4K4S A;  4X64 J;  2UVW A;  1DAX A;  1BD6 A;  4F0K A;  3IP0 A;  4FVM A;  3GIL A;  2L3M A;  4W92 B;  4DV3 F;  4IRK A;  3D0I E;  5GME A;  3PW7 A;  3IRX A;  2M4M A;  2AJ0 A;  4ZCM A;  1RT1 A;  4KJI A;  4F26 A;  1RHU B;  4ZHR B;  5EUH A;  1YJW S;  2JLE A;  5DG8 A;  1NK0 A;  1JK9 B;  3G6X A;  1UVN A;  4EO6 A;  4UF4 A;  4QR0 A;  2UUC J;  1QE1 B;  2Y8Y A;  2G2Z A;  4J9N A;  3MD1 A;  1X7V A;  4B9U A;  4FVC A;  1WOR A;  2ROG A;  5C24 B;  3EX7 B;  1Y0H A;  2YX4 A;  3R2D J;  1VJQ A;  1X5O A;  1FK9 B;  2CNN B;  4CLS A;  1N36 F;  5EGY A;  4EEY A;  5K9F A;  1IM4 A;  1QVG R;  2V68 A;  2FJE B;  4WU2 A;  3SSR A;  3CCL S;  4EZ6 A;  5GAH I;  4NLS A;  1IBM J;  1U1R A;  1N33 J;  2RUG A;  2LEB A;  2C2N A;  2MZ1 A;  1PO6 A;  3HHN B;  4WKY A;  4GKK F;  5A0Y A;  3KHG A;  4LF9 J;  4HT7 A;  1SKU B;  2X3D A;  3NKY A;  3G6V A;  2H5I B;  2IM0 A;  1XMQ J;  1TKZ B;  4P2S A;  5CAB A;  1CPZ A;  1SJR A;  5J2N A;  4DR3 F;  2FJB B;  4LF5 J;  1YZ7 A;  1B7Y B;  3THT A;  2RF2 A;  3AJD A;  4Q44 A;  4V19 J;  1HBN A;  2MHN A;  1CS4 A;  3BGR A;  3R6G B;  4I6W A;  3GIR A;  5KG0 A;  1FKP B;  4ILL A;  2KT2 A;  1HA1 A;  3AFG A;  1MU2 B;  7FD1 A;  4RL1 A;  3N0V A;  2JDJ A;  2XEX A;  1WKL A;  1KC8 T;  4B3T F;  1VK3 A;  4L6V 3;  3UCG A;  1M5S A;  2SXL A;  4N56 A;  4KFB B;  4Y2I A;  1XNR F;  5DGB A;  4RBU A;  1S5Z A;  4I56 A;  5IT4 A;  2N7Y A;  1WF1 A;  5ETT A;  5F0W A;  4KHP J;  2I9S A;  2ZKT A;  5BXI A;  3X1L B;  5EX0 A;  2OUG A;  4MFB A;  2KB2 A;  2Q43 A;  4LRD A;  1Q8L A;  1WDD A;  1NJW A;  5KFV A;  4ZLN A;  1H6K X;  3CJ3 A;  2W9B A;  1HNI B;  3JYT B;  1NJZ A;  3AA8 A;  3V6J A;  3QGH A;  4H54 A;  4CCH A;  3LUY A;  3QYY A;  3HJV A;  4C2M A;  1U2C A;  1L3S A;  1N34 J;  1F5B A;  1UZH A;  4RR5 A;  2ZH9 A;  1BQM A;  4A46 A;  3IR5 B;  2BA9 A;  1QVF R;  1IBL F;  4X4N A;  3IBC B;  3IWX A;  1TUV A;  1FD8 A;  2C2E A;  5ETQ A;  1LWC B;  4ANE A;  3KHR A;  5J2Q B;  4QYZ K;  4PRF A;  3TAR A;  4YHH J;  5D77 A;  2QZ8 A;  2YH0 A;  2J6T A;  3I0R B;  4MIB A;  5K14 A;  5CAA A;  2R8I A;  2BW7 A;  1FTC A;  4MT1 A;  2C3O A;  5HVG A;  4M95 A;  1U2F A;  2MKI A;  1YX2 A;  1FDD A;  3MM6 B;  2CQH A;  2XUL A;  2I0X A;  4J9S A;  4ENO A;  3B78 A;  4C97 A;  2QA2 A;  1WC5 A;  5LXR A;  2DY9 A;  1RTZ A;  4KAI A;  1UZD A;  3TZZ A;  3W60 A;  4CYU B;  2B9X A;  1UAW A;  1YRX A;  1VQ7 S;  5M2R A;  4I0W A;  4AL7 A;  3GR1 A;  3DDK A;  4R5P B;  1IKW A;  3H25 A;  1S9G B;  3TJ8 A;  5KFW A;  2A2D A;  3GV7 B;  3TVK A;  1RYR A;  4CT9 A;  2DHS A;  4NOH A;  3KUG A;  3LTO A;  2E1R A;  4B9T A;  1VBX A;  4ILR A;  3OTC A;  1B99 A;  1RHK B;  3SZ2 A;  2JX2 A;  2Z2L A;  3K89 A;  4J9L A;  1K47 A;  1Q78 A;  2DNQ A;  4P74 A;  2G1H A;  2ZOF A;  2CDR B;  2HNZ A;  5D0H A;  2ZZN A;  2KHD A;  5C25 A;  1RAA B;  4I2Q A;  1QJH A;  2QO3 A;  1OQ6 A;  3DLE A;  3F44 A;  1FXL A;  1WSV A;  2CG8 A;  3I5B A;  5LT5 A;  2G4B A;  4DR1 J;  2CNK B;  4DL7 A;  4C4W A;  4JI1 J;  4QIV A;  1TMJ A;  2XLI A;  2GGP B;  1N88 A;  1QUP A;  3W63 A;  1S6P A;  3H2U B;  1BUX A;  3CCM S;  4ED7 A;  3PG9 A;  5SZT A;  4Y3C A;  3FSX A;  3QGI A;  3EE3 A;  4LUB A;  4KHM A;  1MLA A;  3W2W B;  2AJ2 A;  2GVZ A;  2R4F A;  2UV8 G;  3SQO P;  2DT9 A;  4ZVS B;  4FXW A;  4G1Q A;  1RZM A;  3W8P A;  2LXU A;  2ZBR A;  1PC5 A;  4H4O B;  3JTO A;  1YSJ A;  4J5O A;  4F02 A;  2HGM A;  1H7X A;  5K20 B;  1NAQ A;  1L3U A;  4LF7 F;  3A1Y G;  2XLJ A;  3TZX A;  2WSE C;  4HT5 A;  3NS6 A;  3M8R A;  1Q4R A;  3HF5 A;  3ICL A;  4LJM A;  3G8T A;  5LSO A;  1X4D A;  1YTY A;  4ED8 A;  6FDR A;  4OI1 A;  4RO0 A;  4PYA A;  1IN0 A;  1LOU A;  3SIP B;  3G8Q A;  4Y2K A;  3C14 B;  2CVE A;  2NQP A;  1RT7 B;  4LFB F;  4FPI A;  3UI3 A;  5KT3 A;  2MQL A;  3PO5 A;  2QV6 A;  1UCN A;  4ZPB A;  5CH7 B;  1O5J A;  4B3R J;  1CQM A;  1YK9 A;  3HPO A;  2WVC A;  4IO1 A;  4G6V B;  1RU1 A;  3E01 A;  3HFV A;  3M2U B;  4OYA A;  4RW4 A;  3W9H A;  5L1I A;  3DNC A;  1UA1 A;  4ECX A;  1HR0 F;  2XZW A;  3IGV A;  3IMQ J;  4A47 A;  3MPD A;  1NKC A;  4AL5 A;  5F41 A;  2DIT A;  4D3G A;  2FVQ A;  5E7O B;  1KRP A;  5I3U B;  4DPX A;  1UW9 A;  3N01 A;  2QL7 B;  4C98 A;  5HBM B;  2NZC A;  1U47 A;  3MM8 B;  1LW2 B;  2WBR A;  4DU8 A;  1FFW B;  2R9L A;  2W2P P;  2FHO B;  5DDO C;  3BGO P;  2QJ3 A;  4RU9 A;  4ZDN A;  3M7V A;  1EET B;  2HGL A;  1RQ0 A;  4ZIT A;  3TEG A;  2PEB A;  4UOC A;  1U48 A;  3HVT A;  3V4I A;  1IUJ A;  1R6V A;  2KRB A;  3QT7 A;  3FK4 A;  4OHZ A;  2L9W A;  4LSL A;  3NMA A;  2VFR A;  1JX4 A;  2QC3 A;  2KM8 C;  3MED B;  4URQ U;  2IA0 A;  1T8E A;  2IM2 A;  2XHW A;  2DD8 S;  2F40 A;  3UQS A;  2FLO A;  5C2G A;  2F4V F;  5J1E B;  4Y6I A;  1V6H A;  4N47 A;  2VC0 A;  1HNX J;  1UVL A;  5KG7 A;  1YJV A;  3BR8 A;  5HRO A;  4YDX A;  2QLB B;  2KHC A;  3KJF B;  4DG1 B;  1N5T A;  4CLF A;  4LR8 A;  2KFZ A;  1GT8 A;  1KS2 A;  4WPA A;  2IIH A;  2PA3 A;  3RZA A;  2LLZ A;  3KMS A;  2ZNY A;  3VHQ A;  5HMX A;  2LDY A;  1T9U A;  1XBW A;  4ZOS A;  4D3H A;  3IWL A;  2E5L F;  4UY8 T;  1T9Y A;  1NPK A;  2GJI A;  1BXN A;  3PRV A;  4NLQ A;  3SFG A;  3MI7 X;  3PW4 A;  5KFF A;  4XDC A;  2CZV C;  3HCX A;  4CLW A;  1J2V A;  4F50 A;  2XYP B;  2O01 C;  4NAS A;  5KFZ A;  3NAI A;  1FA0 A;  2VAS A;  4HEA 9;  5FDL A;  3THV A;  3GPA A;  3Q83 A;  2GAH C;  4TLQ A;  3HHE A;  4WP9 A;  4NZ0 A;  4HI1 A;  3KJN B;  5L9N A;  4O4G B;  2AQ4 A;  2B8P A;  1JXE A;  4ZP7 A;  2ZUA A;  4C0B A;  2FZG B;  3DOL A;  2KFY A;  3SCJ E;  2P5V A;  1FVS A;  1S1T A;  3DLH A;  4ALZ A;  4L76 A;  1CC7 A;  4WK3 A;  3CB4 A;  5HI7 A;  1FRH A;  3K0J A;  1RT5 A;  2QTW A;  3Q2T C;  3MEG B;  3CSK A;  4U7U D;  2ZE2 A;  4OYO A;  5L8R C;  3HDS A;  1HBO B;  2M8H A;  3MEC A;  1ZM9 A;  1RCX B;  1J5E J;  2BJD A;  2XHC A;  4RW9 A;  3K5N A;  4FYD A;  3OSN A;  2W1B A;  4M5G A;  2VG7 A;  3POT B;  2EFQ A;  3VAK A;  4JYA J;  5AT1 B;  3CNQ P;  1FRI A;  5CHC B;  5KG5 A;  4C8N A;  3GTY X;  3MM5 B;  2H3E B;  3EGV A;  1GAO A;  2DR6 A;  2QT7 A;  3WBZ A;  3J7Y I;  2GMJ A;  2XMW A;  2GV1 A;  1AT1 B;  1IKY B;  4JP8 A;  1S76 D;  3KLH A;  2V34 A;  1YGY A;  4DV2 J;  4ZVU B;  2HLU A;  2ASJ A;  4H4K C;  1UJ4 A;  5IM0 B;  3TA2 A;  1S0N A;  4N8N A;  5GAE I;  1Q53 A;  5KG4 A;  5DQH A;  1SL1 A;  1PC4 A;  4QIE A;  2MQQ A;  1TMM A;  2V63 A;  3C19 A;  1WG1 A;  2BAB A;  4DLG A;  2HG4 A;  2ZDO A;  3P49 B;  1XTZ A;  4ZVP B;  4HDG A;  1RBA A;  4PXB A;  2XQC A;  1S57 A;  3CTR A;  3NWG A;  1BGX T;  1SL2 A;  3PEJ A;  4AQY J;  1IM6 A;  5CCL A;  1BHN A;  2J76 E;  4C11 B;  2ZH8 A;  2FJW A;  1EB0 A;  2N4D A;  4IG3 A;  1MML A;  1ZTW A;  2XMK A;  3QO9 A;  4O0N A;  5J2M A;  2IMO A;  3GII A;  1DHM A;  2CZ9 A;  1TL5 A;  1ZM2 A;  4RW7 A;  5KOX A;  2K3K A;  3AXK A;  5LMU F;  2F7V A;  3A12 A;  1WOP A;  3PVX A;  2MLX A;  1H98 A;  4ERD A;  4HL9 A;  1YJ9 S;  2FC9 A;  2LXF A;  4XPC A;  1RHR B;  4USW A;  1NB2 A;  3RTV A;  3LF0 A;  3BM7 A;  4MIA A;  4YS2 A;  3W3S A;  4ZS6 A;  4UZB A;  3P5T L;  2CQ4 A;  2RQK A;  3I87 A;  5AXN A;  2FTR A;  3TUZ C;  1EP4 B;  1FVQ A;  4F4X A;  3JSY A;  5AXM A;  3DRS B;  3FQK A;  3ZZT A;  3GV5 B;  4MIW A;  1QAI A;  3VV2 B;  2Y0B B;  2HVE A;  3T5L A;  1VQK S;  1UWB A;  4BHQ A;  5CD4 H;  2QMX A;  1K0V A;  2V4J B;  2XY5 A;  2AWZ A;  1N5Y B;  1FDB A;  4K0K J;  4NA3 A;  4YY3 J;  4GVB A;  4ED2 A;  5A2Q Y;  2KU7 A;  1GNK A;  4O44 A;  2XS5 A;  2R8H A;  1OJ4 A;  1D3W A;  4KPC A;  4DDF A;  1UJ5 A;  4BCA A;  3DDN A;  4TY9 A;  3X3U A;  1VYA A;  4F8R A;  4KQZ A;  1RCO B;  3RB4 A;  2E5I A;  5L39 A;  3ILL A;  2W9A A;  4KHP F;  3VVU A;  4ID5 B;  2HBQ B;  1N0U A;  3D3C J;  2VJV A;  4OHV A;  2BE2 B;  3SMZ A;  4WJB A;  3N5B A;  3OHB A;  3BKU A;  2XO6 A;  1CLF A;  1E6V B;  1KTV A;  2BQU A;  3KKF A;  1S6U A;  1Y3K A;  2W7P A;  1E6Y B;  3PW2 A;  2V8H A;  5J2P B;  4IH7 A;  3KUE A;  2F8H A;  3R7B B;  2HS4 A;  3V2U C;  2QX0 A;  2AP6 A;  3M8W A;  3KXD A;  2AZ1 A;  1IWG A;  4J9V A;  5AE3 A;  4YDD B;  2YQ3 A;  3A8J A;  1EAY C;  1FX4 A;  2YKM A;  2PN6 A;  2V0N A;  2F65 A;  3TEH B;  2HIQ A;  3WC2 A;  4DSF A;  2JFK A;  5ETP A;  5HVH A;  1CG2 A;  2WVE A;  2VFS A;  3EPG A;  1VI7 A;  3DOM B;  3JSR A;  5KFL A;  4KY3 A;  5T14 A;  5A2Q U;  1NHK L;  1URN A;  2CAD A;  3IWN C;  1D9F A;  3ET6 B;  3RBE A;  2AZ3 A;  2FHM A;  3AQP A;  4C0O C;  3ADA C;  3MR2 A;  3M6V A;  1ZAV A;  4NLR A;  2HMI B;  4LMZ A;  3OUY B;  2QLJ B;  2IC3 A;  3D1H A;  3GU0 A;  1RWK B;  2V8P A;  2UXC J;  3PR5 B;  3H0P A;  3GIK A;  4A8O A;  3EVO A;  3MR5 A;  5A8R B;  2RU9 A;  3SSS A;  4DSI A;  4WFY A;  1R6Y A;  1RAE B;  1TL1 A;  4KHR A;  3LWL A;  2W8L A;  2FJV A;  4PQU B;  3CF5 Q;  3MM9 B;  2YNI B;  4MAK A;  2OML A;  3CPW R;  3DRP B;  1C0U A;  3I31 A;  1H72 C;  3FC9 A;  2CKW A;  3T5H A;  3MMA A;  1X4G A;  3ETM A;  1NK6 A;  1RAC B;  3GG0 A;  3W61 A;  1WOS A;  1VQ8 S;  3GJS B;  3W2V A;  2HQC A;  3CJT A;  1X4H A;  5CYM A;  3NCR A;  2OSR A;  4YOE A;  5L1J A;  2J7W A;  5I4M A;  1JXV A;  4HKQ A;  1RWP B;  3M8Q A;  2UP1 A;  4ZK7 M;  5F8N A;  2JSX A;  4PPZ A;  4MKA A;  2RQC A;  2FGC A;  4KRW A;  4LR7 A;  4OLP A;  1SJ3 P;  2VBX A;  1B64 A;  1RAI B;  1I51 B;  1U7L A;  4R8U B;  2P9C A;  4NCG A;  1IBK J;  4YEA A;  4MKV A;  1T11 A;  5K8N A;  1F3F A;  2HAF A;  2PC6 A;  5DQI A;  3R5B A;  4J9P A;  3KK3 A;  5F8L A;  2G0J A;  3IBW A;  4DR1 F;  1MRO B;  3OR2 B;  2EI5 A;  1CJK A;  1IKV B;  1Q8I A;  2MST A;  4HTI A;  1HNV A;  4NLY A; 
#chains in the Genus database with same CATH homology
 3W1Y C;  5BR8 J;  5FLX U;  3J81 U;  4B3T J;  2MTL A;  4K0K J;  4JI5 J;  4X64 J;  2E5L J;  2KVQ E;  3J7A N;  4NXM J;  4YY3 J;  4LF9 J;  1XNR J;  1I94 J;  1N36 J;  4X66 J;  1J5E J;  1FJG J;  4GKK J;  4V1A k;  1N32 J;  2VQF J;  4DR1 J;  2UUB J;  4JI0 J;  4LF6 J;  4DR7 J;  1XMQ J;  5LM7 E;  4LFA J;  4KYZ A;  4JI1 J;  4JI6 J;  4NEZ A;  4LF5 J;  4NEY A;  4PWW A;  4JYA J;  2UXB J;  4KY3 A;  4B3R J;  4DUZ J;  5LMU J;  4JI3 J;  5A2Q U;  5IT9 U;  1N34 J;  4DR4 J;  4HHU A;  4RJV A;  2HHH J;  4JI2 J;  2MEW A;  5IWA J;  4DV0 J;  4JV5 J;  3IMQ J;  1IBL J;  4DV3 J;  2UUC J;  4DUY J;  1HNZ J;  4B3M J;  4DV4 J;  4LFB J;  2F4V J;  4GKJ J;  1HR0 J;  1XMO J;  4LFC J;  3T1Y J;  4JI8 J;  4DR5 J;  4DR3 J;  1HNX J;  4DV2 J;  3D3C J;  4DV5 J;  2UXC J;  4DV6 J;  3R2D J;  4DR2 J;  4YHH J;  1IBK J;  4JI7 J;  3T1H J;  3R2C J;  2KL8 A;  4B3S J;  4DV1 J;  3J80 U;  4X65 J;  2MQ8 A;  2UXD J;  2UU9 J;  2UUA J;  1HNW J;  3D3B J;  3JAM U;  2ZM6 J;  4LF8 J;  1XNQ J;  4LF4 J;  4KHP J;  5AJ3 J;  4LF7 J;  5LMN J;  4X62 J;  4JI4 J;  4DV7 J;  3OTO J;  4AQY J;  1IBM J;  4OX9 J;  4DR6 J;  4NXN J;  2VQE J;  1N33 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...