1FJGJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1fjgJ00
5LMUJ 5IWAJ 2MTLA 4JI4J 4JI8J 4DV4J 3IMQJ 1XMQJ 2F4VJ 1HNWJ 4NXNJ 2E5LJ 4LFCJ 3J7AN 4AQYJ 2VQEJ 4DV5J 1XMOJ 1XNQJ 4DUYJ 5FLXU 4DR3J 2UU9J 4DV1J 4HHUA 3W1YC 2KVQE 4JI0J 2UUBJ 4NXMJ 4JI2J 4DV3J 4X65J 3D3CJ 2UUCJ 5BR8J 1IBKJ 4JI1J 1N32J 4KHPJ 1HNZJ 4YHHJ 5LMNJ 4B3MJ 4JI6J 3JAMU 4DV0J 1XNRJ 4DV6J 4B3RJ 2ZM6J 1N33J 4LF6J 1I94J 4GKJJ 1N34J 2MEWA 4JI3J 4DR7J 4X64J 5LM7E 4LF9J 4V1Ak 4NEYA 4LF7J 5A2QU 4LF8J 4DR2J 4DR5J 1IBMJ 4B3SJ 4X62J 4PWWA 4DR4J 1N36J 3R2CJ 1HR0J 2HHHJ 3T1HJ 4GKKJ 4DUZJ 3J81U 1J5EJ 4LF5J 3D3BJ 4JI5J 4DR6J 4DV2J 4KYZA 3T1YJ 3OTOJ 3R2DJ 2VQFJ 4KY3A 4X66J 1HNXJ 4LFAJ 4LFBJ 3J80U 4K0KJ 4OX9J 4DV7J 4RJVA 5IT9U 2UUAJ 5AJ3J 4NEZA 4JYAJ 4YY3J 2UXDJ 1IBLJ 2MQ8A 4B3TJ 4DR1J 4LF4J 2UXCJ 2KL8A 2UXBJ 1FJGJ 4JV5J 4JI7J
chains in the Genus database with same CATH superfamily
1FX4A 2MMYA 4K2XA 5AT1B 3FMWA 3U1MA 3TUIC 1ZZFA 2WVCA 2M3DA 1F3FA 2V50A 3MM8A 5AJ3F 5D6GA 2E1PA 2PSZA 2QSFA 1LWCA 1R27B 1EARA 2SXLA 2CQPA 4TU8A 2PMWA 3MCOA 2I8EA 3ZTQA 5KG6A 2UV8A 3HO1A 2QIFA 4KHPJ 7FD1A 3LP0B 2O5DA 2Z0GA 4ZS6A 4TNOA 4CO3A 3NG8A 3OUYA 2OPPA 1ZPWX 3SFGA 1U1PA 3HK2A 3EYZA 3GV5B 4QPXA 2E9TA 2V5HG 3Q86A 3VAJA 4LF6F 2CJAA 4K8RA 1DFDA 3V5RA 4U7UD 1LK7A 4OX8A 2VFRA 3LPYA 2DHSA 2RUGA 1FK9B 2ZZNA 2H9ZA 1RDRA 5H9EK 3J81Y 5HQLA 2QN6B 3L7OA 2JVOA 1SJQA 4NA3A 1WNEA 2DEIA 1RHQB 1FJ7A 4C2MA 4UT4A 1XMQJ 3WIVA 2YNFB 3D6HB 1QAIA 4DSFA 4YB5A 4ZHRA 1S0VA 4HACB 1RT2B 3M2VB 3HHDA 1J5EF 2ACYA 4EFAC 2VB6A 2L9NA 3ZZZA 2WK4A 1RT4A 5BYRA 4KPYA 1VRQC 4PWDA 1RYSA 2H65B 4JOUA 4AE5A 1WF0A 2AX0A 1LK5A 1YJVA 4ZJQA 1TUVA 4OV6A 3MR6A 4L3KA 2BOPA 1U8SA 2OD6A 2YWHA 1X5TA 2YQ3A 5E3AA 1HMVA 2AGPA 5A8RB 4OI0A 4DUYF 3DLKA 1YJ9S 3HHEA 3MR2A 1FRIA 3ISNC 3BBCA 1ZM4A 1LV5A 5HMWA 3BGRB 3Q8UA 1QUVA 1WC3A 3CWJA 2LYVA 3F56A 1L3TA 3I5BA 4MIBA 5JJBA 1HA1A 3ZTSA 3PZPA 5C42A 1RCOB 3G8TA 2D3OR 4LF8F 1OPZA 1YSJA 5HSPA 3DFEA 3FDSA 1YIJS 5KFDA 3EVOA 2M88A 4M63A 3HFVA 4B3TF 1EETA 4CM2A 2A10A 4O23A 2UUCJ 3NGTA 3AJ2A 3D66A 2AX1A 1NDLA 1X9WA 1PO6A 2FVCA 1U49A 2N3OA 4ZP7A 2AJ4A 3GFXA 2AEJA 4RKUC 2L48A 4B3SJ 2HNDA 4K4TA 1NSPA 1EX8A 3HKZD 2NSBA 3EUNA 2V4JA 1WORA 1ZAWA 1YJUA 4LF5J 4O3PA 4GO7X 4JI3F 2CWKA 3M6WA 4F04B 2FJWA 2ZVSA 3RAQA 1D8ZA 1NM2A 4GVBB 1LOUA 1GQEA 2IIHA 3GONA 1NCLA 1WWHA 4BHQA 4B9SA 3JSMB 3TJ8A 2GIRA 3AOAA 5HAOA 1S9EA 3M9NB 4P73A 1N6QA 2XYPB 4USTA 5L1JA 3R5CA 4DPOA 3AD9C 3DRRA 4WU3A 2ZD1A 1YJTA 4I64A 4NI2B 3UDCA 4MMOA 2ZH8A 1HQEA 1SVDA 3CCUS 4B9VA 2LA4A 4ED4A 4OIXA 5IQQA 4LR9A 3J7ZT 4B3MJ 1RHKB 4BC9A 1XNRJ 3VGTA 3AFGA 1UVJA 2OIHA 1LXNA 1BD6A 4A8KA 4C3LA 4ZCKA 4J37A 3TOQA 3I5AA 1REGX 4LSNA 1YKWA 1FNOA 2A1BA 1TKTA 3MD3A 1WC1A 3CCES 5C25B 1OY9A 1KOOA 2BRKA 5BYSA 4O3SA 2Q6BA 4WTYA 1G7CB 2NSCA 1PBAA 2PMHA 2QEXS 2JLGA 3BB5A 1SH0A 3GV7B 4RNMA 4LUBA 3IO1A 4WFYA 3OTOF 4F2SA 1QE1A 5CXTA 2C3UA 4XDDA 1C0TB 1R0BG 3B6BA 4CO2A 1CJKB 3IRWP 2F63A 4GKKF 1XMOJ 3BQ2A 3VVTA 4KKOB 5IC4B 5GADI 5T41A 2UUTA 1OYEA 1PC5A 3C16B 5DQGA 2Z56B 1IBKJ 1VQ7S 3VHQA 5K5MA 4M5DB 3NRBA 2HFZA 4LR7A 5KFUA 2QLXA 2E44A 4CTAA 2VG7B 1IR0A 1UWBA 1F9FA 2Z2MA 4F0MA 1RT7B 3R97A 4RO0A 2KB2A 3K5MA 4PWWA 4JV0A 2IBOA 2D3ZA 3JYTB 4NLPA 4LBIA 4C8OA 1AB8A 3R27A 1NKBA 1FF2A 3MUMP 1IN0A 2OPSB 1NJXA 5GMEA 1SB6A 1XMBA 2K3KA 3NCRA 1YG0A 1XR7A 1R8PA 2RHSB 2EFNA 2F8HA 3TAMA 2W2OP 4YOEA 2YWFA 1HI0P 1Y5LB 2A3JA 1RI7A 3MEGB 2J0SD 5DDOC 3M9OB 2XC9A 4AD6A 1S72S 3OSNA 5KT7A 1Y3JA 3MM6A 2DVIA 2UU9J 3PFOA 2Q43A 2AJFE 4M5MA 5DG8A 2MKSA 1OO0B 4KGMA 3QFWA 5KT2A 5KT3A 1Q5YA 2GQQA 2CADA 3NMAA 2CJBA 5I42A 5KFBA 2KYZA 3CJKA 2R8HA 4OYZA 2BABA 2YWWA 1F1BB 2GMLA 3L7PA 3IAS9 2DRDA 3MFIA 3Q8RB 4I2QA 4I68A 2NXUA 2BX6A 5KFRA 5L1IA 3WX4A 2IRUA 1HWLA 4OYWA 4ZVPB 2E9ZA 2EFVA 1JQGA 4ATNA 2FPHX 1C1BA 1U45A 2Y9HA 2DXEA 5KG1A 5T7LB 3OR1B 1WG1A 4CT8A 2FLNA 1HYSA 1D8YA 2V8DA 1BXNA 4IH7A 3G6ES 3HDSA 4MIWA 3PJ9A 1AA1B 4UUWA 1JXLA 2W2MP 4W98A 2PT0A 3IP0A 3ITHA 3TANA 2GGPB 4JI8J 1QJHA 4URGA 1GAOA 4OJGA 5D4PA 4A8SA 1PIEA 4DG1A 3QIPB 3OLAA 4DSKA 3BO3A 5BYQA 3MCMA 1NKCA 2DBBA 5B08A 4U8VA 4CT9A 2UUBJ 2XCPA 5D15A 1KVJA 2FVPA 4N77A 5IWAF 4DLGA 2V2VA 2N7YA 4X4NA 4TU7A 3PY8A 1S6PB 3J7YU 5L9NA 4ZPAA 5ETVA 2ZJRQ 3DHWC 4YY3F 1RWUA 4Q43A 4X64J 2POKA 2OEMA 1SC6A 4E2FB 2LMIA 3FNNA 4X62J 2V6AA 4MK7A 2B9YA 3J81U 2K1RB 4O4GA 5CCLA 3H5YA 4Q2LA 1FNXH 3ILOA 4FP9A 3DOMA 1TL1A 1HNXJ 2DHGA 2KRBA 1NK7A 1PBUA 1ZH5A 1TKZB 4NLVA 2BE2A 3RW6A 2I6WA 3L9ZA 2VFVA 1IKXA 5IS2A 2CJ9A 1UTAA 1WSRA 2GHPA 4KRWA 1GTEA 3ISND 2GHVC 1NB7A 1NJIT 3QRQA 3MM9A 4USWA 2MKKA 3UDLA 2EKYA 4O3RA 2FJEB 5E3QA 3LO3A 2UXBF 3N79A 4ID5B 5K20B 4JI1J 2AHOB 2GQCA 2MKJA 2QMWA 1N33J 2LQ5A 5H9EJ 4WE1A 2B6AA 4PWUA 3V81B 5KFEA 4LF7J 2MGZB 1P1LA 2ZNYA 3FFIA 4HL9A 4FYYB 4ZJOA 2F3JA 3HX9A 1FKPB 1Y7PA 3T5KA 2W8LA 3AB2B 1FTCA 1XBWA 1ITPA 2KFNA 1CSJA 4CLYA 5L8RC 2Y1LB 2A18A 1VISA 5AJ3J 1R8BA 1NXIA 4P2FA 3DRSA 1FRLA 1L3VA 1PYOB 2B9EA 1BQNB 4Z2XA 5KFLA 1NJZA 2DY1A 4ZLNA 2ZHOA 4BWMA 5I4MA 4ZVTB 1SIWB 4NLYA 2VOPA 3ONQA 3G86A 3NWGA 1HBUB 3MM7A 2MY7A 3D1QA 1H72C 3AA9A 2L9DA 1C4AA 2V34A 3H5SA 1U2RA 3N5BA 3CO9A 1T11A 2Z2LA 4DX5A 1VRUA 4LF6J 2HGMA 4ZN1A 2W7OA 3I4HX 3NL0A 1FVQA 2ZITA 3BN7A 2XMTA 5K9FA 3NS5A 2ROGA 1VHFA 3HULA 4ZP6A 3NNCA 3IR6B 2V2QA 3THTA 1KQKA 2ZC4A 4DQRA 5KFNA 3V6HA 4QW9A 4RWWA 4CLPA 5A6WA 4GKJF 1TV6A 4KT0C 3GZ7A 3OXGA 4Q8EA 3JXOA 1N4LA 1D09B 4OZ2A 4X2BA 1KR4A 2ADBA 5ETPA 5HROB 1CBKA 1JLBB 1I5OB 3UVJB 4OI6A 4B9LA 5KFVA 5KG2A 2ZH1A 3BSCA 2GC8A 2XMVA 3GE9A 3HT0A 2DPIA 3L3CA 5T14A 1YZ6A 1RU2A 3GJQB 3O2IA 1N5TA 4G6VB 2GVDA 1VHIA 3QPIA 4J9QA 1C1CB 1RT1B 1DTQB 3CGIA 4ZN3A 2MKIA 1JB0C 4KB7A 2EFPA 2PI4A 2EG1A 1VQSA 3C15A 3LTOA 3RTVA 2XNRA 1GXLA 1WG4A 3HSJA 2NYIA 3MOZA 4ZJLA 3NMRA 3CD7A 5DS7A 4CYUB 3D6FB 2ZOGA 4ENOA 1RAHB 1NO8A 1EZZB 4K59A 4ZLJA 3IA0A 2FY1A 3DLLQ 2EKNA 4WZMA 1MN7A 1UZDA 4NLOA 1VQ9S 4K4XA 4HLBA 2KHDA 4N7TA 3SV3A 1U2CA 3PYEA 1FD2A 4X4PA 1GX6A 3BSNA 1RU1A 2K3IA 1ZBTA 1NHUA 3T5HA 4C8MA 3GIMA 2CQ3A 3EVMA 2MZJA 1BWEA 1KLMB 4B3TJ 5KFZA 4BCAA 3QMQA 3ENWA 4FVMA 3NNHA 3CMQA 1R7IA 2CDQA 4EMDA 4HDHA 4QIWD 2NXCA 4ZITA 4X4OA 3DC2A 4MKYA 3T5JA 1JLQA 4MH8A 4AFFA 3MMCB 4OZ5A 2BM0A 1APSA 1UPPA 3WC2A 2HKEA 4U7UK 3MCNA 2QA2A 1JLFA 2D74B 1RT6A 4JI3J 3CCJS 1K8AT 1UA0A 4V1Ak 3CDWA 1SUQB 4IKAA 1YITS 2LKZA 3ILJA 2NZCA 3PO4A 1LKZA 3I0SA 4LRAA 3D54A 2FTRA 4P72A 1GT8A 4M5LA 1GMVA 4DF8A 1R31A 4F7VA 1UWAA 3MURP 3HZEA 1U0SA 1M1KT 3AH6A 2BJ7A 3H4BA 5LXRA 3HHKA 3IGVA 1ZZNA 3NNAA 3DOKB 2QLBB 3KK1B 3HM9A 4MKVA 4WFAQ 2H54B 1C4CA 5JXSA 3DI6A 3WIUA 2FJVA 1TAQA 3QAEA 2RSQA 4PR6A 1WEZA 3O44A 2VKZG 1JWWA 3DMJB 3Q8QB 4RW8A 1KTQA 4CM0A 1HWIA 4G1PA 3JQMA 3OHBA 4URQU 5CCMA 3K57A 4QJVA 2X1BA 2XS2A 4NMLA 1JKHB 1MWZA 2G0CA 3SDEB 2PE8A 3W7BA 2NYHA 2ZJPQ 1LWXA 4N41A 1X5OA 3KK3B 3K17A 1CS4A 2E1CA 1SV5A 2GZOA 2H1YA 1F6TA 4RNFA 3OTOJ 2MZRA 1X0PA 3KXDA 4ILLA 4J9LA 2J9EA 1WEXA 4CLSA 5LSOA 1QAJA 4C48A 1XK8A 2WB4A 4ECRA 3SXLA 1AW0A 3PRDA 4DR2F 2PA8D 1LWCB 1VQNS 2J9DE 2DCLA 3M8YA 4CNYA 5KAKA 4ERDA 4RX6A 3VVUA 1SJRA 3H2VE 4N47A 4C11A 2QSWA 4FVCA 1YI2S 4DPTA 2HVZA 1NDPA 1Y11A 1B70B 5B0DA 4ZLLA 1YZ7A 3A4TA 1FRXA 4YDXA 3WQPA 2OPPB 3PIOQ 1QSLA 1WELA 4TY9A 5C24B 2UXCF 3MWBA 2X7IA 4IG3A 3GLJA 3MMBA 5B0EA 4LREA 4QPTA 4USUA 2KFZA 3I87A 3IBFB 3G8SA 1IKWA 2OHDA 2R8JA 1WHWA 5K8PA 5KFGA 3RYLA 5B0CA 1KP6A 1UW4A 4NA2A 3A8EA 3FRYA 1UEVA 2ZBRA 4K50A 1WC0A 4X4RA 1AUSL 1F5BA 4AT1B 3M8SA 1X7VA 2FDNA 2ZWOA 3DXBA 2QLJB 3MR5A 2CVEA 2VPYB 4RW4A 2ROPA 5E5NA 2HFUA 5IM0A 2G13A 4DV2F 4DR7F 4ZHRB 3GYXB 1E6VA 3CMAS 1KN6A 2L08A 5K8MA 3CPWR 3IM9A 3P6YC 4PUOA 1UL3A 1RT4B 5SUHA 2B4VA 4RNHA 2FVQA 3D3CJ 4ZVHA 1LW2B 1U48A 5SZTA 4OLOA 1JLCB 1N5YA 1VC6A 4CLFA 2KO1A 2VBZA 2LXUA 4DOZA 2ROEA 1S4EA 3FBBA 4FZVA 1N0UA 1Q7YT 4R0EA 4ED3A 5AE3A 4OV1A 1RA7A 2C3MA 3UD5A 1RT3A 1P27B 4F26A 4ECQA 3PRBA 4DSJA 5D0EA 3GILA 2PIIA 3W8GA 1HNZF 5C42B 3QGHA 5LMNF 4ILMA 4Q2MA 1FTRA 2VBWA 3L09A 3V6DA 1SKUB 3T9ZA 5IWAJ 2DPJA 3IR5B 5ETTA 1U0HA 4ZP9A 1FWLA 1EJ7L 2W9CA 3GPAA 5KG5A 2YVSA 4TQRA 2H5EA 3C6UB 4C3MA 2A6OA 2CRLA 2VG6A 3B54A 4YMEA 4JV2A 3IG1B 3R6GB 4YDDB 5J2PA 2RT3A 2L9WA 2XZTB 1IXKA 1YLXA 2NPFA 4OYBA 2FVSA 3DYAA 1XTZA 2NREA 2VHGA 2CG8A 5DO2A 2CQ0A 5HP1A 2HS3A 1VBZA 2KKHA 1SKSA 3CIMA 2UVUA 2A6MA 3M8RA 3K8VA 5B7WA 1VQ8S 4Y2MA 4OYAA 3MEKA 3BR9A 5HJXA 3JQKA 1T9UA 2Q66A 2UXBJ 4FYVB 1BGXT 1T9WA 3DRRB 4AYBD 1WHVA 1HQEB 2RRBA 5KFPA 4ES3A 2JHEA 1B0PA 4Y2KA 1S48A 2DNNA 3JTNA 1FEEA 2G9OA 3PJXA 2FIUA 3LP0A 4LF2A 3O8WA 4RW9A 4Y65A 1B0TA 6FD1A 4WXWA 4XO0A 4O0NA 4R25A 3LA0A 3QO9A 2HK3A 2BRLA 1PAEX 1S0OA 2NXNA 5A2QY 4K4ZA 4CIOA 4LSNB 2CQ4A 1JLEB 1TKTB 4O3OA 2VDHA 3I5CA 2YKAA 4Y00A 5ETSA 1FK9A 1YJNS 2NUUG 2QT7A 4M5KA 1H73A 5CD4A 4ECXA 2D3O1 1IQTA 4QU6A 2Z2ZA 2XM3A 1O8BA 1QE1B 5LJ5Y 1RLDA 3CEDA 1OMSA 3M2VA 2DNLA 3HT3A 2BDPA 4LFCJ 4HVZA 3C8YA 2HZVA 3BGUA 1Q16B 5CYMB 5DDRC 2KDOA 2B43A 3IWXA 1ZAXA 2V8HA 4L72B 3SQGA 1DQ9A 4CTAB 1SH2A 3SSQA 2BVZA 4KH1B 3NP5A 4GKJJ 1BE4A 4KQZA 5A8RA 2IM3A 8AT1B 3E2EA 2H51B 4NLGA 2X1GA 4PRFA 4EK2A 3LF0A 4NCBA 3HXMA 2CQ2A 2XYGB 3UCGA 1S57A 3RBEA 3CJSA 4JI5J 2A0FB 5LL6d 1NUEA 3QJLA 2MXYA 3W2WB 3RUBL 3QBCA 1QD1A 1NAQA 3D28A 4NZ7A 5IT0A 2CQCA 4P2SA 3TAMB 2IJRA 3CE8A 2N4DA 1X9SA 4OJ3A 4MFBB 2VFUA 1WC5A 4ECYA 1M5VC 5KG3A 2RILA 2KTQA 4UQGA 1BQXA 3KDNA 2KVIA 4K7QA 2MQQA 3MM6B 3MDFA 3JTPA 3DCAA 2QX0A 2FZGB 1JIHA 3FCWA 3THPA 3ZZPA 1GTHA 4FPRA 5GAHI 1SXLA 5DDQC 5F8IA 3DHXA 2DH7A 2RVJA 4OI2A 2XBPA 2OEKA 3MF5A 2F65A 5CAAA 1JLAA 4DV5F 3QLHB 3R9LA 3IXQA 3GU0A 4IOBA 4I2QB 3A12A 1CULB 2GFFA 1FERA 2WONA 1U1OA 1S6QB 3MMJA 2KHCA 1CJUA 2DNYA 3NBPA 1R3NA 3KYLA 1VLYA 2X1AA 4YS2A 1DQ8A 3OL9A 3CTRA 1HYSB 3H0PA 2RJZA 2N7CA 1NU4A 3T9NA 3JSMA 4M8LA 1MN9A 4RBUA 3TA2A 3ITHB 1FFWB 3EDQB 1B7YB 4PYDA 4F02A 2ZC3A 4P6QA 3EXYA 1VBYA 2RKIB 4M5HA 2AV5A 2MTLA 1DBDA 1SJ1A 4LIRA 4DG1B 1TK0A 1NK8A 4ED6A 1A6LA 2KJVA 1MROB 3ZZRA 2GNKA 3W5YA 1UEUA 2CPYA 2ZKUA 4KGKA 4MYTA 4Q0BA 2NXJA 2KXHA 4KR0B 3KTQA 2I2YA 3P4UB 3QSYB 1YJ7A 5DGBA 4A8YA 1VQMS 3OVSA 1TL5A 3VAFA 4L6V3 2K7KA 1AFJA 1EIYB 2XEXA 2PFDA 3KHHA 1N52B 1U25A 2UXDF 1EKSA 4RUBA 4IH5A 4NEYA 4Q8FA 4CO4A 4CNZA 1UMJA 3KJFB 2RU3A 3DLGB 4ZVEA 2Z4PA 4OI1A 2EC2A 2JSXA 2P6SA 2ATCB 1U1KA 3DOMB 1TL1B 4WIIA 4B3RF 3CSKA 3PX0A 2D3UA 4IOCQ 3K2YA 4ZMMA 4LR8A 4FS2A 1IR1A 4USJC 3QNWB 3US5A 4EU0A 2G4BA 1T95A 2DGVA 5EWGA 3MPDA 1HR0F 4IFYB 3G87A 4IRKA 1C0TA 3ZO7A 2AZ1A 1NBEB 3W62A 4XPCA 2BJ1A 4KKOA 3ZTOA 3DM2A 2P9EA 4QR0A 2RDJA 4HTIA 2V8GA 2C2OB 1AROP 1XEZA 3RRHA 1XWLA 4M5DA 1RAEB 4JI0J 1PJ7A 2OGUA 4USMA 2W7PA 4WE1B 4CLWA 3SV4A 4CRJA 5I3QA 2B6AB 1RT7A 2M52A 3PDNA 2O01C 2F8MA 4U96A 4OJHA 1CEZA 3JYTA 3KMSA 1K1SA 1HFEL 3FVYA 5IXUA 5A8WB 3TW0A 3CULA 2MDAA 3OJSA 1N36J 2HS0A 4PQUB 2DISA 1KDNA 1VJQA 2WVFA 3EM1A 4HH0A 3RW7A 3BDEA 5EUHA 4L76A 3Q8SB 4NRUA 5HI7A 3TA0A 1K47A 4AXIA 2VKRA 1U6BA 3DRSB 1X4HA 4RZRA 7AT1B 3I0RB 2MZTA 5AXNA 3BGLA 1BUXA 3DDIA 1B3TA 2JL9A 2C42A 2VPZB 3T6JA 5D77A 4PZVA 1FDAA 4KTQA 1TVRA 4DCJB 4U67Q 3MR7A 1XC9A 2XB2D 1UFLA 1VJWA 4PKDB 1CJVA 3DLJA 2E1MC 3MM7B 4ECUA 2GAGC 4AL7A 4GRSA 4ELUA 2GQ2A 3M7VA 2HWHA 2LEPA 4HT5A 4RUAA 4KV8B 3BSOA 5CYJA 2BACA 2HNZB 1UVKA 2HGLA 2PA3A 1VRUB 2DNMA 4OFZA 1YRXA 1PILA 3CJ8A 4NYOA 4U95A 3TP2A 3NGKA 4F67A 3PG9A 4NWBA 3B4MA 3VAMA 2YKNB 4LVNP 2W24A 3G9CA 1KEKA 3UDEA 4CLUA 1NSQA 3UCUP 3ZTPA 3OR1A 2MJNA 3KLHA 1OSDA 4DV2J 5J2NA 3TUPA 2VIHA 2LDIA 3CC2S 2RRNA 1FXDA 1ZM9A 4RJVA 3QJPA 2E5JA 4QWDA 1VBXA 1V3RA 3MD1A 2E9RX 4F0HA 5GMDA 1RTHB 2KT3A 2Y0SD 2R8GA 2CPEA 1EKRA 2GVDB 2QA4S 2JOQA 4J9SA 2Z30B 3TWZA 1RHJB 4OI4A 2QTWA 3C15B 4C8NA 1S6PA 3GG0A 4QWCA 4IQXA 2G1HA 1TL3A 3EWGA 1K44A 4ZPTR 4NCAA 2AYMA 4DX8H 2KU7A 3E3XA 2NR0A 3RR8A 4IO9Q 1M5HA 4ZKAA 4QR1A 3CT9A 2CG4A 2K1RA 2J9DA 4ZVUB 5D0HA 1U26A 4ZVOB 4JI7F 4CP5A 2Y3YA 2CQHA 1J5OB 4Y34A 3HVRA 8ATCB 3OVBA 3C6TA 5J2QA 4WJBA 4CWBA 2BQ3A 5AE1A 3OPKA 4X65F 3LALA 4FKYA 4G65A 3EICA 2UP1A 1T9XA 1DARA 2R9LA 4KIAA 2DRAA 3SFUA 5F9LA 3AOBA 3ETOA 1KQGB 2BBEA 4ID5A 2WOMB 2VL1A 2LEBA 2XZWA 2GJFA 2KT2A 4ZCLA 1RT5A 3HLUA 4USHA 2BJ9A 1RT6B 4K5SA 2MGZA 3UFCX 3Q83A 2DR8A 2HVEA 4KO0A 2ZVIA 4Q45A 1VIXA 1KHVA 1VYAA 3DKDA 2CQIA 1FKPA 1RUSA 3W5XA 2R8KA 3TA1A 4IRDA 4OYOA 2J7WA 3I0SB 1Q79A 4J9PA 3QGIA 2DCUB 1SJFA 2HBRB 4IFVA 1N5SA 4ANDA 4L73A 3MEEB 2EI5A 4TY8A 1FJCA 4DQIA 1UCNA 1BQNA 3DDNA 3PM9A 3J7A1 3GP9A 1TMMA 3M8PA 3FJ2A 2GJIA 1EAYC 1SI9A 3OR2B 2ZOFA 3BPDA 2RDIA 4K2JA 3DGPA 4WFXA 2B8QA 4UOHA 1H98A 1OY8A 3MMAA 2DGSA 1WOPA 3HSDA 2XO7A 1MW7A 2HQIA 3H98A 1IBLF 1Q8BA 1T94A 9RUBA 2OP5A 3CVKA 1HBMA 2DIVA 4I6AA 2DD8S 1S9GB 3AXMA 1PJ6A 1DLOB 4P7TA 2ILYA 1ZA2B 2AYEA 2PI5A 4L3NA 3PEJA 3CD0A 1F2GA 1NPKA 3NAIA 1WJ9A 1BC6A 1V9OA 2MQLA 1T3OA 4K5RA 1CS4B 3FEZA 3R1LA 3HJVA 1UFKA 5HQ8A 1SV5B 2AT1B 4GO5X 2R7UA 5GADU 2FLPA 1FWKA 2JEGA 3U1LA 4PXCA 1VQ6S 4OHWA 4NXMF 5HO4A 2B4UA 2Y1JA 4XK8C 3OXFA 4DQSA 4WBFA 1SL0A 3G96A 1TKXB 2ZH4A 5HVGA 1IKVA 3L95X 3TEGA 1RT1A 3H4DA 4C11B 1M1HA 1RWKB 3NOGA 4NPOA 3FQKA 5DZ7A 2J6UA 3O1LA 2Y1IA 4MK9A 2FJBB 2V4QA 4Q7AA 4IRCA 1EQ0A 1DQAA 4BWJA 3C46A 3OFFA 2JJ4D 2AJQA 1BMQB 3WX8A 3FCVA 5KFFA 3MMBB 4FS1A 2AQ4A 1KOHA 1NHKL 2RQMA 2YQ1A 1OIAA 1WHYA 2D69A 1WF1A 2WSEC 3NCPA 3VAHA 1IKWB 1VC5A 3R2CJ 4KGZB 1TP7A 5KFSA 2KM8B 5DM6Q 3JAMY 3OW2R 4KAIA 1N34F 4IYQA 1KQFB 4KGXB 2V9WA 1H6KX 1K9MT 4RW4B 1FCAA 1S5ZA 4OX9J 3DRXA 3M4XA 1IWGA 2BOAA 3R7SB 3N6MA 3TRGA 5IM0B 3Q8PB 1LWFB 1L5UA 4A8WA 3MM5A 3NGDA 2XLIA 4J7CA 1MWYA 4QQBA 2R7XA 4F4ZA 2QMXA 1P1TA 3LW5C 4PUOB 2DKOB 2E5LJ 3I4PA 3HVAA 4DV5J 3BQ1A 5FLXU 3ZZ0A 3I9V9 5CYQB 5ETKA 2V4RA 3GYGA 1W7WA 4ZLPA 2MYFA 2DH8A 1N5YB 1ULRA 3CDAA 3M32B 1MG7A 4B9UA 2H4WB 1NRKA 1SUQA 1QVGR 2KZMA 2BR0A 2OSRA 3R8YA 3OJUA 1ZOTA 2GAHC 2FLOA 2NQPA 4DS4A 4PXBA 3DOLA 4DCOB 2RS8A 2FGOA 5KFCA 3KFWX 3RRGA 5B0BA 4A4JA 1Q86T 2Y8WA 3B4DA 1VK8A 2OTLS 4P10A 4DL4A 3RU0A 3V6DB 4QYZK 2PC6A 4WWSA 2ZM6F 3I96A 1B4SA 2IVMA 3HSZA 3GMGA 2GMJA 3C19A 1U0HB 1U02A 4K4VA 3A13A 2W9CB 2AJ1A 4F0KA 4IQMA 1CJTB 4BBYA 4KHRA 4EYIB 1SCJB 3KLFA 1TKDA 1LW0A 3QJJA 3H25A 2VG6B 3KJVA 2XY6A 3M9MB 2C2MB 1HKAA 2F4VF 4H4OA 4NXNF 1JKHA 4B3RJ 3SDEA 4JBCA 4LRCA 4QWAA 4OHZA 3KK3A 5HP1B 3HCXA 2LQJA 3N28A 1HR0J 3ZNUA 1D9DA 2HQ3A 3BEGB 2CQDA 2E1AA 1FJEB 4Z7YA 4LF9F 3G71S 3GCXP 4NLSA 3QWUA 1HARA 2JC0A 3BYRA 1U1QA 2OTJS 2UUAJ 2XLKA 3M8QA 3MTJA 3SMZA 4DV0F 5F8MA 4R0JA 3LGNA 2QL7B 4JI4J 3Q2SC 4RR5A 4NA1A 2B9WA 3PYDA 4JYAF 3R7NB 4RW9B 2ZHBA 4DV1J 2IM2A 3R1HA 1URNA 1UJ4A 3LP2B 3ENVA 3QO9B 1M5OC 3R5DA 1KHWA 3BZQA 2XNQA 5C24A 2R8IA 4UY85 4R5PB 1QLNA 4JI6J 1P9QC 3GR1A 5JVHQ 1KTVA 3M8WA 5KFYA 3GR0A 2EEYA 1BLUA 4C9DA 4ILRA 3VWSA 3FKBA 1RTIA 2MQOA 3VCDA 3KLEA 3HD1A 3FBEA 2HHVA 1WOOA 2RUSA 4ER8A 4DI6A 2FHJA 1NK9A 3I9ZA 3H2UB 4HR2A 1JX4A 2RQ4A 2HHTA 1YWXA 2ABYA 2UVRA 3CJ2A 4C6AA 3EVWA 5HATA 4QIFA 4NZ0A 2CQGA 4ETZA 3TUZC 5AXMA 4RW6A 4DF4A 1LW2A 3SQGB 1JLCA 5C7PA 1FWPA 1EP4A 5D3GB 4NE9C 2NCKL 4DCPB 2DNRA 2OFGX 3HF5A 3R5GA 2LFVA 2LDYA 2R2UA 2DHXA 2DNGA 1HPZB 4DQQA 2JWNA 2HRYA 2CNNB 4ZOSA 3CUNA 1FX2A 4ZP8A 5I3PA 3UN3A 5K14B 1W2BR 1X4DA 4ICLA 4ANCA 3ETMA 3EDRB 2V2ZA 2BV3A 2VASA 3L7UA 4F8RA 4KE5A 5CQGA 1SQEA 2OELA 3ILIA 1MMDA 1SIZA 4Y6IA 2BQUA 3UN2A 1D9FA 3EZOA 1PCAA 3C6UA 2VQEJ 3MUTP 3V4MA 2BW2A 5KOWA 5CABA 2XY5A 3IG1A 1Y5NB 3NEKA 1JLAB 1AXQA 3HZGA 1ROFA 2KXFA 3AQPA 3TX0A 1URRA 1AUDA 2IJNA 2F9DA 3HFZB 4F36A 4NLTA 4DL0C 2WONB 2HHXA 2EK6A 3B82A 5DG9A 3HFKA 1EQMA 1UJ5A 4LF1A 5F8HA 1ZA1B 3NBPB 1CJUB 2WZ1A 3HI9A 4QIEA 3AOCA 3LOUA 1JJ2R 1WACA 1QY7A 3KMQA 1HD1A 3AJDA 4P7VA 1WKLA 2IY5B 3BR8A 4DPUA 2QE5A 1JJHA 4ZCMA 2MPUA 1S1UB 4WZQA 3P45B 2M8DB 2VG5A 3RB4A 4NLDA 2IC3A 2MJUA 4PXDA 5L1LA 1NK5A 2WW4A 3KJNB 4Y2IA 1MMLA 2DR5A 4LSLB 3E8OA 2W7AA 3IR7B 1VCTA 2W4PA 2KT5A 4TN2A 4B9NA 2KXNB 5E33A 1X60A 4DV4J 4Q0BB 3FMBA 1PC4A 3FEYB 4CO1A 3NLCA 4RNOA 1RHMB 4Q44A 4ZPDA 2JNJA 2KVQE 4EI2A 3GIRA 4CCHA 3W3SA 3RBXA 3FCHA 3JAMU 4DV6J 3MAQA 3RBZA 2CNKB 1JLEA 4UOFA 4NCGB 1NK0A 2ERRA 4ELTA 4AL6A 2O1PA 4B9MA 5KFXA 4PPDA 1XMQF 2WHOA 3IN5A 3PX4A 4MJKA 1Q0NA 4NOHA 4C7QA 2DNQA 2G2OA 4FDFA 2ALYB 1I1GA 1UW9A 4NL5A 3UN5A 1VMBA 3OBIA 2B4PA 4PQAA 1NNDA 3QZ8A 4OLPA 2CKWA 3ET6A 5AE2A 1U2FA 4WP9A 4YR0A 2R4FA 1IBLJ 3DM2B 2VZ9A 3K0JA 3NGUA 1S1XA 2YKOA 1OQ3A 3CJQA 5CYMA 2M4MA 3T19A 4BS2A 2CYYA 3MAAA 3J80Y 2N3LA 1LNQA 4WIQA 2R7VA 1IJEB 4H4KC 4WK1A 1RYRA 1GFWB 3CXCR 1TR0A 1OSCA 3W8PA 1RACB 1WKKA 3TAPA 4IG0B 1U7LA 2OPRB 2YKPA 2HZAA 1TUWA 2IA6A 4N8OA 2KM8C 2EG2A 2RF2B 1KONA 3W2WA 1WEYA 3J7Z5 4DL3A 3R6LB 4MFBA 1Z1ZA 5KOXA 4EBCA 3VAIA 3SZ2A 1S7HA 1VQ5S 4O4RA 4I7FA 4EEYA 4EO6A 2C2RA 1M5KC 3ELHA 1TVRB 1R43A 4YEAA 4EO8A 3GG1A 3JB9k 1KVIA 3CJ5A 4W92B 3N0VA 1X4AA 2LA6A 4JUZA 1CJVB 3M1VA 3UQSA 3PYGA 2GV1A 1HNVA 2JLFA 1Q53A 2XMKA 1IWAA 2F1FA 4XAKA 3G82A 1VQ4S 4K0KF 2E29A 2R7TA 5ETLA 4NLUA 4F50A 3VQTA 1G6BA 2JFKA 2OAUA 2HSEB 4OZ1A 3H5UA 3QLHA 3V2UC 2HQCA 4B3OA 1WHXA 4EZ9A 5D8HB 1T03A 1CULA 1N34J 1OPIA 4QYZJ 5ETMA 2C3PA 2DGTA 1S6QA 4N76A 3E51A 2DR6A 3AA8A 4USIA 3U27A 4F3MA 3LP1A 1V6HA 3KLHB 5J2NB 1R8CA 2PO4A 2X3GA 2DK2A 1J2VA 4TQSA 1QAXA 1VQKS 1H74A 2OFHX 4R8UA 2HVIA 4DR4F 2RKIA 2FC9A 5EX0A 4B3MF 1XNRF 5EN1A 3IRXA 1MROA 2J7KA 3RGIA 4X66F 1LEOA 1U24A 2IRYA 1VQPS 1JXEA 2XWYA 1FD8A 1TL3B 4I69A 2NLWA 2V67A 5BXIA 1IQZA 2YNIA 2JEIA 1K0TA 1B99A 4J9OA 3DLGA 2FJAB 5J1EA 1GXTA 2LEAA 5ETQA 2HFVA 2H4YB 1QUPA 2IM0A 3K5PA 3P5TL 1V3SA 3W61A 1RAGB 3M6UA 3C6TB 1N32F 5J2QB 2HHHJ 4OZ0A 2AEFA 5THWA 1S6OA 3BJYA 1HNIA 2LXIA 1XMOF 4IFYA 2Z2YB 2QLFB 4YN3B 3DXSX 5I3UA 2B3TB 1NK6A 1U6ZA 1NDCA 5EWFA 1WD6A 4F4XA 4DMZA 1IBKF 2P9GA 3QRPA 3SCIE 5KFMA 4G1IA 2EC0A 1FRKA 4LSZB 3R7BB 2OMLA 4HKQA 3S01A 2GW8A 2F4VJ 1DJ0A 4NXNJ 1NH8A 2BE7D 3I6PA 2DJWA 1RT5B 4WP3A 1OQ6A 4LF4F 1KFSA 4KO0B 2W25A 2ZBIA 3CDBA 3BF4A 1FO1A 5A8WA 2E1RA 1B7FA 4PQUA 4LF9J 4WU2A 2W9BA 4FF1A 4OQJA 1O0PA 2AIRB 4IFVB 4JV1A 2DR9A 3FSIA 4DFJA 5F0WA 5HMZA 3D3BJ 2MHEA 1HWJA 4TY8B 2UU9F 3I0RA 1S99A 3IFEA 3M8PB 3Q8YA 1FE0A 2ATLA 2CPJA 2V9KA 3KDOA 2HHSA 1F9EB 3DGPB 2AD9A 4JYAJ 4QOTA 2G1DA 2B7CB 2O66A 3ZXWA 2DNHA 2YQ0A 2MQNA 2MQ8A 4M95A 3MMAB 3CDEA 4MKAA 3MOJB 2BKOA 1S12A 5M2PA 1B0VA 3CDUA 1MWQA 5GAEI 5L9XA 1C2PA 3A1YG 3K59A 4KV8A 2HK2A 1HBNB 2HNZA 1IM4A 3A3OB 1HBMB 4LRFA 4UF4A 3D6MB 2R2SA 4RL1A 2UZAA 2BYCA 2BUNA 4MIAA 1SC4B 3FC9A 4DPWA 2VJVA 1JNZB 3IGNA 3O3LA 2YKNA 1I3OB 1HL6A 2B7BB 2Y1RI 3H20A 2WVBA 3JSBA 4DLEA 2DY9A 1GMWA 5ADZA 1AZSB 1R6YA 1Q1KA 3VF0B 4WXOA 3PV8A 2AGOA 4JI8F 1NMEB 1HLWA 2D9PA 3N01A 3ZTRA 1J5EJ 1UA1A 4O44A 5HMXA 2HBYB 1F3VA 1RLCL 2HHPA 2I9SA 2UUBF 2FZCB 2ZOMA 1Q5VA 2BKNA 1RTHA 1FKOB 3TJAA 7FDRA 1IKVB 5LXYA 1Y5IB 1YQHA 2D7SA 4XPEA 1CQNA 3VGSA 1UVLA 2IBKA 3VGVA 3W60A 1S1TA 2IJFA 4OL8A 2OEJA 4U9RA 4X62F 3MR3A 2FHMA 3CIZA 5J1NA 2MLXA 3H5XA 2ZH3A 4DUYJ 5HLFA 2PGCA 4DHVA 2CXEA 1SC1B 5ETRA 3EGZA 2JH3A 1ZM2A 4M5GA 4WYLA 1QAYA 1S1WA 4UOGA 4DFPA 1JXVA 2LECA 2C1EB 1D1UA 1M5PC 4KH0B 1J5OA 4LF8J 4FPIA 1RGVA 2V94A 1F5AA 2GX8A 4DFMA 2XG8A 1JK9B 1JJ4A 1YVFA 4TXSA 3PXGa 2I5JA 4J9NA 1Z2LA 4OYPA 1D0EA 5M2RA 5HBMB 4LRDA 2R7WA 3TVZA 5GAHU 2CWXA 3PACA 3J80U 3CJ0A 3MM5B 2XS5A 2HG4A 3SCKE 5K8NA 5IT9U 4JI1F 5F8JA 2C2ZB 3T1HF 3P3DA 4CLKA 3K5NA 5HQMA 4DX7A 2L3MA 3KLGA 1D9AA 2WOMA 4LF7F 2W4DA 5A0YA 2OO4A 5M2UA 4OYXA 4P71A 3AQOA 5L39A 4MTPA 2WVEA 2DIUA 2OUGA 3MPVA 1KFDA 5F41A 4CO0A 3UPFA 3QYYA 4YR3A 4FNIA 2ADCA 3AD8C 4YUDA 2AP6A 4UZBA 2CJQA 2OH2A 1X0FA 3DOLB 1YRTA 4C8KA 3LGHA 5U47A 4TVAB 4WFNQ 1Z4UA 2DTJA 3MHYA 3X1LB 2ZDOA 3H90A 3MEEA 2D1CA 3KKFA 2DYAA 1GXUA 4TKTA 4LQ9A 4KYZA 5GAGI 2XQCA 3OR2A 4PXEA 2GA7A 5HMYA 4USVA 1YX2A 4AXJA 1N5QA 1PKUA 5LSLA 4P74A 4FYDA 1HWUA 2UVVA 5HK4A 1PYSB 3IS9B 2XZDB 3KLFB 1LW0B 1B64A 4PEOA 3HVTA 4I6YA 3KJVB 4DV7F 4Q5VA 4Y28C 2PEBA 3Q22A 1S9GA 1DLOA 2GCFA 4IH6A 2VV5A 1FFSB 1DTTB 2HFOA 1U1MA 4D3GA 4H4OB 4ZPVR 3VALA 2G2YA 2L41A 2DGWA 3I55S 4CH0S 2WBRA 2E5GA 4I2PB 2GMHA 4S0MA 3VV2B 1FKAF 1TFYA 4Y0FA 4QU7A 4RW7B 1OY6A 2R7OA 4GKKJ 3ILLA 5MLCV 2QG9B 4LRBA 2IVYA 3W63A 1QSYA 2R7SA 2Q6CA 3C3LA 2EW9A 4PYAA 1FHTA 2YH0A 4O0IA 3M8QB 1QTMA 1TKXA 2G0IA 2UV8G 5MAOA 4FYXB 3LWLA 5D4NA 4DUZF 3TZXA 4ECTA 2XSFA 4DZ6A 4BDPA 3TX8A 4QCLA 5L38A 2FLLA 2QYCA 3WBZA 1U4BA 1T7PA 2QRRA 4KJIA 1C0UA 2VOOA 4CLZA 1KC8T 3GJSB 2EK1A 3N6LA 3KG4A 2ZBQA 1OS5A 1U1RA 2ACMA 2GJ2A 3RZAA 4FXWA 2HHWA 3H2LA 4H4KA 3HVWA 4EBEA 1FDBA 1N8RT 4W90B 3TVKA 1X8DA 4PAAA 2MZQA 1LXJA 5LT5A 3QWPA 3UE2A 1HI8A 2ZH5A 1RTIB 3U02A 3D1HA 2RRAA 4JI2F 3KLEB 3HJFA 3HP6A 2XMJA 3CMES 3DLHA 3PNIA 1G4CA 4K4YA 1IR2A 4YR2A 4OZLA 1LWFA 4ZIVA 5D4OA 3ZNJ1 4PG8A 1XN9A 3BPSP 1T9VA 4K0KJ 4BLGA 2ZZMA 1K73T 3OD2A 2YWGA 4DEZA 3JSRA 4OI3A 3QRRA 4ZPCA 1CC7A 4KSEB 3ZFVA 1FESA 2XYHB 1M90T 1VS3A 4J5OA 3CCTA 4RW6B 3QT8A 2W2QP 5CYQA 2AJ0A 1SL1A 1RE1B 1Y00A 2YH1A 3M2RA 3OTCA 1A9NB 2VBXA 2CJXB 1EP4B 3BM7A 3M32A 2MQPA 2XI3A 5HJYA 1MLAA 4F4YA 5JUMA 2YX7A 3ZC4A 3Q24A 2HVHA 1S0NA 1H7XA 1YHQS 1HW9A 3GB0A 5E41A 3KLVA 1RKIA 2J7UA 1RCXB 1FRMA 2RQCA 4F3OA 1KLNA 4CH7A 3F0NA 4DR4J 1SJ3P 4FBTA 2ZHAA 4UW2A 3EMTA 3I82A 5HANA 1VDHA 3BQ0A 2J0WA 3AB4B 2B5JA 4ICLB 1X5SA 1RWXB 4O3NA 2VC0A 4X66J 3MI7X 2PFFB 3HHLB 4WK3A 5FD1A 3BO4A 2JZ5A 2XI2A 4ECVA 3GIJA 1VRTA 2AKWB 5D4LA 4YY3J 1NJWA 1CJTA 2DR7A 1Q82T 4C8ZA 3RBDA 2IM1A 2WAQD 3LQVA 2F5GA 3HKWA 4DSLA 5F8GA 2VA2A 3BN4A 3PO5A 4C0HA 3NKYA 4ED0A 1NK4A 3OLBA 4FF2A 1RB0A 3ZZUA 1RAOA 2ZFHA 4DJBA 2W2NP 1N32J 2R7QA 5B0AA 3ADAC 3UO0A 1WDDA 3C14A 3D0HE 2G0JA 4YQWA 4F4WA 1G2EA 1SBRA 1UP1A 2DGQA 3D6TB 2DHAA 2H5IB 4GMKA 5EX3A 4J91A 1A7GE 3RR7A 5KG4A 4K4UA 2N4CA 5A76A 4JP8A 2VG5B 1MU2B 2IC3B 2H5JB 1OWXA 3AHPA 3NCQA 3MPUB 2FQQB 5KFAA 1U1LA 3HMJG 5D0RA 4WKYA 1GX5A 4GVLA 3ZZTA 1RZMA 3ZZOA 1PG5B 2FVRA 2J9CA 4N5SA 1L3SA 1T05B 4LF4J 4DR6F 4J9MA 3NXZA 5KFJA 1KSPA 3PW0A 2FGCA 5E3PA 3RB6A 3LP2A 1CQMA 4FF3A 5A8KB 4IDKA 4RUHA 2PDAA 4R5PA 4U6PA 4JV5F 4C97A 1Y3KA 4RWXA 4ES2A 2DT9A 2HYIB 4ZVSB 2VD3A 3QGPA 1N5VA 2J8SA 1S9FA 2ZUAA 3FQLA 1M5SA 4L75A 2PD1A 4FXVA 4QIGA 5KT5A 3QGGA 3G6XA 2H48B 3BYPA 5CA5A 5AXKA 2RQKA 4KHMA 2M5YA 2LCWA 3ET6B 1VOMA 2MKCA 2B51A 5B09A 4OHVA 2QFJA 2HRTA 1S1XB 2KYXA 2R3VA 5IV3A 3HD2A 3IM8A 3BSAA 3OT9A 4KC5A 3MAAB 3ENAA 4DDFA 4FBUA 3EGNA 4TYAA 1WOSA 2DNOA 4LFBF 4HTJA 2I0XA 5DRKA 5D3GA 5H1SV 1YTYA 1BQMA 4X84A 1U47A 3RB0A 3G8QA 4U8YA 2IYIA 2GVZA 5IC6B 5LMUF 5KFOA 5E0OA 1K0VA 2AGQA 1F9HA 1HPZA 5KFKA 4DR3F 3DLBA 4FF4A 4IR9A 3N4WA 2DH9A 4KFBA 2APOA 4DV3F 3M6VA 5L46A 2WSFC 5BR8F 4F2RA 1CPZA 5K14A 2XSJA 3A8JA 4I7FB 3S1TA 3K5OA 4NX9A 2IMWP 4KY3A 4CLLA 1IUJA 2QO3A 1VR6A 4GC6A 1AFIA 1E6YA 1KNZA 3CF5Q 2AJ2A 3M1VB 2E5HA 1HNVB 2AYBA 3G82B 4DFKA 3TO8A 2VUGA 4UZCA 1IKYA 2W9AA 2EBEA 4G3IA 3GFYA 1R89A 2MHNA 3G6VA 2DGUA 3OFGA 2IDEA 2HIQA 3KHLA 1MMNA 3E01B 4B3OB 4C8YA 2GHWA 2HFSA 1T03B 4K4WA 3OVAA 3CO0P 1ACMB 1TK5A 3VQSA 3IC1A 1HBOB 1XJWB 3AJ1A 3QQCD 3LP1B 3QIDA 1S79A 2W1BA 3TJ9A 1H7WA 4DPXA 1TAUA 2JDJA 3T1HJ 3MTKA 1S1UA 4NLQA 4V19J 3OL8A 2WCXA 4DU7A 2XMWA 1RHUB 4R8UB 1S1VA 3UW1A 1RWPB 3KLIA 3P49B 1RTJB 4LSLA 2UVWA 2HWIA 2XCAA 2MY8A 3IRXB 2CPIA 3NWRA 5E3CA 4NEZA 3G4SS 1RK8A 4D3HA 2BW7A 2YNGA 3BREA 1NPPA 4ANEA 3DU6A 2XS7A 1RAAB 2DNZA 2K7JA 3NOCA 3O5TB 4NLRA 1UVMA 2YPYA 4DSEA 3FZBA 2C2DA 3V4IB 4CH1A 5IT4A 2VFSA 2YNIB 5KFHA 4NCGA 3PVXA 5D78A 1X9MA 1FEHA 5J1EB 2F9JA 4ECWA 4MYUA 2EVZA 2HAFA 1X31C 3RB3A 1JLGA 2RE1A 3I32A 2RHQB 1DAXA 3NS6A 2R2RA 2EXUA 1HNIB 4X4TA 2OJ3A 2JEFA 4LFCF 3M2UA 8RUCA 1GEHA 3T5LA 5G0RB 5I3UB 2W01A 2ZKTA 1UFWA 1KVKA 2YX4A 2HNYB 1L3UA 4UTGA 1IBMF 4UQTA 2IMOA 5BJRA 3H40A 4RBVA 1VI7A 2ZH2A 2V68A 3W64A 4DV7J 3PW4A 3SI8A 3W2VB 2M70A 1OYDA 2CJYB 2CNOB 3KK2A 1BHNA 2VQFF 3KNGA 1H2TZ 3EJMA 3W5ZA 1UVNA 5J1PA 5A6PA 1LQ9A 5EGYA 4A8FA 3TEHB 2ASYA 2QL9B 5FLXY 4IG0A 4JI5F 2OPRA 2YXLA 2HHQA 3UCZP 1V5VA 2WW8A 3PW7A 4TLQA 4O3QA 3UD4P 4MKBA 4P2MA 2RU9A 2K2PA 1SKWA 5C5JA 3DN9A 2RF2A 2W9BB 1TL7A 1O51A 1G3OA 1PJ5A 4DSIA 4DR2J 4ZIWA 1HWKA 4ECZA 4X4SA 5KFTA 1S97A 1F0XA 3DNCA 4DUZJ 2IVFB 1L3KA 3MXHP 3A3NB 1CC8A 3PJWA 1VFJA 1N48A 3F44A 2VPWB 2W2PP 4PG7A 1LWEB 1TUGB 3LUYA 2FC8A 2V63A 2AYGA 1HHQA 1TTHB 2ZH7A 3OL7A 1NJYA 3PIPQ 2YNHB 2G2ZA 3GJRB 2UXCJ 2Y0BB 3QSIA 1Y0HA 3IMQJ 2XWXA 3JSYA 4IUFA 1RBAA 4OHYA 1KQSR 4YFUA 3PW5A 1YRUA 3D9BA 2CDRB 2CZ4A 3MEDB 1S77D 1VQYA 1VIOA 4JI2J 1S10A 1H3DA 1WTFA 3F73A 3L4BC 1XERA 2KG0A 2MSSA 5DQIA 4IOAQ 2M7SA 5FDLA 1T0TV 1S0MA 3PFEA 2XMUA 4ECSA 1RTDB 2FY8A 4PG4A 1XNQF 3FZ2A 4DN9A 4DR7J 4ED1A 3GCWP 3H7HB 4A8XA 4DL5A 4CO5A 1TL4A 1I6JA 2P9CA 3FEXB 3QT6A 2RS2A 4CI0B 3HHLC 4O44B 3CCVS 1VLOA 5KG7A 4YHHF 2FJXA 2BQRA 2C3OA 3IBWA 3NGRA 3KWMA 5DLGA 3CCSS 1GMUA 2KRRA 3DLEB 2P2CB 1REVB 1S7IA 2W4CA 2DGXA 1ZS6A 1XR6A 4ZVGA 3DRYA 3TAQA 4TLRA 5J2MA 4QIVA 1DHMA 1S1TB 1O5JA 1Q7LB 4Z37A 3TYTA 3TUJC 4LFAF 5IFMA 3CJ4A 2FJDB 5HLFB 1T9TA 4W4MA 2CZ9A 3EE3A 4DL2A 2ALZA 4HHJA 2XY7A 1Q95G 3PTWA 5F9NA 3R5JB 4C98A 1S1WB 1HQUB 1SQFA 1FJGF 5KTQA 1IVZA 2ZE2A 4WYWA 2HMIA 1HNZJ 5LMNJ 1GNKA 3BV8A 3CJ3A 3M30A 2ZWPA 4X4VA 4CLTA 3CCRS 4QYRA 2IAJB 5ETNA 4QW8A 2IYGA 3DDKA 3BKFA 3MUVP 1S6UA 2I5JB 1D3WA 1T9YA 4J90A 1P8GA 1W25A 2WBMA 4Y2AA 4PABA 5C2CA 4PPZA 2FHKA 3R5BA 3CCQS 3EX7B 2HWTA 3MAHA 2MLYA 3R2DJ 4JI0F 2JVRA 3S6EA 1M1GA 3KLGB 4FKXA 5A0YB 1SC3B 2FZKB 3UR0A 3QATA 4ZA1A 3H8YA 4CDIA 3CNQP 4ZVFA 1UZHA 1N36F 4P9SA 1BWVA 2M2BA 5B0GA 1R0AA 3KG0A 5HN0A 2B8PA 3T1AA 3RJMB 1HI1A 5KFQA 2QMUB 3MM8B 3RG6A 2A2DA 5HVHA 3WHIA 3NGSA 3QT7A 3WC0A 5LSRA 1NZAA 4IO1A 2XGQA 1IBCB 3M8ZA 2V8PA 3EPGA 2CZVC 1K1QA 2DXDA 4M1KA 5F0UA 2AEMA 2AWZA 4NASA 3OUYB 2HVDA 4DR6J 2E7VA 3SSRA 2H3EB 4PG5A 2YKMA 4YB7A 5LOQA 5FJ4A 2YBVA 2HS4A 2YWEA 1RWVB 3SEOA 3BGOP 4WF9Q 1HBNA 1SH3A 3HVTB 2JC1A 3T1YF 4JV5J 1UEKA 1RADB 5B0FA 4ED2A 1H2VZ 2ZH9A 1WUUA 2FD2A 4C0BA 1WI8A 2MQMA 5IOLA 1IM6A 4H4MA 2QZ8A 1VQOS 3CCMS 4OYMA 4OZJA 1VBKA 2ZZTA 3BKUA 3M05A 4NMXA 3IAM9 1AZSA 5KT6A 1DZ5A 1UETA 2VFTA 5GMKa 1PYTA 4E0DA 1FI4A 1A0OB 4PWDB 5LM7E 3TZZA 3BDPA 2ZNZA 3MPWA 4GC7A 1AT1B 1RAJA 1FDNA 1H38A 3SCJE 3LAMA 2YX1A 1Q81T 2B4OA 2RB7A 5GVQA 1I94F 1FKOA 1X4FA 2HBZB 3KUHA 3EXCX 1RA6A 3MECA 1HMVB 4LFBJ 1S4FA 1ICEB 4ELVA 4YB1P 3T3FA 3P5BP 3DLKB 2CQ1A 1C0UB 2HURA 1TMJA 3N6NA 3J7YI 1NKEA 1JJCB 3GYNA 4Y3CA 3OL6A 2BEFA 3DRPA 3PRVA 1T3NA 5LMUJ 1QTNB 2NS1B 2QA1A 4LVOP 1ZETA 3WDOA 3EGVA 1T02A 2CPHA 4DR3J 5E2QA 5AXLA 2U1AA 2BKPA 4DV3J 3TZYA 4I4BA 4DPYA 3B8HA 3BGFA 5BR8J 2JFDA 4A8MP 2HIYA 5DM7Q 3VAKA 1EETB 3QAUA 2ILZA 2COLA 2IA0A 4HEA9 2CAJA 2PEHA 5HBMA 3SIPB 1I51B 3V6JA 3ISZA 1YBAA 3SCLE 2Z57B 1PAUB 2XHCA 2JEJA 3A8KA 2C28A 1FXLA 2HNDB 5LJ3Y 2ASDA 1SL2A 1CVJA 3P8BB 2OPQA 2BANA 4ED5A 1WF2A 5IZHA 4DR5F 2B0GA 2FHJD 2V4JB 1DURA 1T8EA 2C2EA 2Q79A 2CPFA 1FE4A 4G1QA 2XLJA 4YP3A 1QM9A 1U09A 4NLXA 5KG0A 3M2RB 3POTA 3C66A 2I1RA 1OJ4A 2V2KA 2J8AA 3H42A 3N5FA 1S9EB 3KJQB 3NAHA 3ICLA 3N9UC 1N6QB 4DWIA 2ZD1B 1TQLA 2QLWA 5ETOA 4A47A 3KHGA 4OX7A 6AT1B 2C22A 1VC0A 2MEWA 2BJ8A 3B78A 2HLTA 2XMMA 2HQDA 4QWEA 1SPBP 3DGVA 1RWNB 3M6XA 3ULHA 2F7VA 2B5JB 1ELOA 4K4SA 2F40A 3VR1A 2ASJA 2IFXA 1FA0A 1UJ6A 5JMNA 1VRTB 3GIKA 4UUXA 1FXRA 4WKRA 2PN6A 3Q8VA 1JNRB 1M0SA 1RISA 1O6XA 2KFYA 1RXOB 3IS9A 3HHLD 4F4KA 2VDIA 1ZPVA 3PR4A 4C4WA 1VK3A 2UXDJ 3IWLA 2X1FA 5H9FK 1H2UX 1YJWS 5E3RA 4M94A 3OXLA 4QWBA 1DTTA 1UAWA 1KBRA 4J9RA 3CW2C 2AZ3A 2ZUGA 1RTZA 1U1NA 2YNFA 1FRHA 4ZPWR 4I2PA 3OTDA 4HACA 1RT2A 4MT1A 3GSDA 3D5MA 4ZK7M 3C14B 4RW7A 5DJBA 2E5IA 2DGOA 2EWHA 4AQYF 1RWMB 3MPYA 3RAXA 1WDTA 3GWCA 4TU9A 1N88A 2XO6A 1IBMJ 2J6SA 1HD0A 1NPRA 1UWBB 3NY0A 4EUVA 5DG7A 2VQFJ 4WP8A 4ALZA 5DETA 3C2PA 4RNNA 3VTIA 3BGRA 3PHTA 4X4UA 4HH1A 2LU2A 4E8UA 3HSGA 1FT8A 2NXEA 3A3PB 4IDKB 4YB6A 2YPZA 3ZZYA 4F4AA 3FBCA 2HBQB 3PKMA 4A48A 4EZ6A 3W65A 4HHUA 3CCLS 2HAIA 1VQLS 4ES1A 4Y2CA 2R42A 1H0HB 5E7OB 4A8OA 1HNWF 4OX9F 2IRXA 1W26A 4WTOB 2IPOB 1ZM3A 2AU0A 1YGYA 4URSA 2MZ1A 1WC4A 4RU2A 1YDLA 1UVIA 5GAEU 5I42B 2GIFA 3CJKB 3W9IA 1PGZA 2E5LF 1X4BA 1GH8A 5ITHA 3EPIA 2CJKA 2E7XA 3QT5A 3UDVA 2N82B 4WFBQ 5L1KA 3AD7C 5JVGQ 1RAIB 3A8IA 4HT7A 3BKTA 3LWMA 3GFZA 1ZTWA 1C1BB 2HZCA 4F25A 3KUEA 4GVBA 1R6VA 4KGVB 3CD6S 1WI6A 4L74A 4XIUA 1R0CB 1RSCA 4C3KA 1BQMB 2MLZA 2M8HA 4I67A 1QSSA 2GVZB 2WTFA 1XNQJ 4E98A 2QC3A 1F2HA 2FYXA 5DZ6A 1ZTTA 3LAKA 2OD4A 4NI2A 5HVFA 3TQ1A 2MZSA 4B17A 4C0OC 4YHHJ 2BXJA 5DGAA 4V19X 2BA9A 2WB1D 4KFBB 2O67A 4ETXA 4HYKA 1N54B 2HQFA 1VGYA 5RUBA 3K89A 3GQCA 4HI1A 2VC1A 3I31A 3EZUA 1TFWA 2XSJB 1RJJA 3TI0A 1Y10A 3G2XA 1NH7A 2CPDA 2CPXA 2J6TA 1P6TA 3HHLA 4M5IA 2O3DA 2J76E 3R3TA 2MB0B 1E6YB 5F3TA 3OTEA 4LFAJ 1ZYQA 4O4GB 2RD5C 4TYBA 2CVIA 5C25A 3LPEA 4HHHA 3OHAA 3K5LA 3VAGA 2EFOA 1IKYB 1NSAA 4RU9A 3OQ2A 2NZ4A 2HW3A 1FJGJ 2XTJP 2BE2B 4JI7J 3NS7B 2F8EX 1IKXB 2XHWA 4RBTA 3D67A 3EGWB 3O6QA 3J7AN 2JX2A 3V6KA 2EBGA 1YJRA 2MKHA 4QBUA 3W1YC 4DR1F 3UI3A 1CJKA 2VBYA 4I6WA 3MM9B 4C8LA 2VA3A 4X65J 4XTTA 3FBFA 3VZIA 3TQEA 4FXDA 3THVA 1RBLA 2M0GB 2UUAF 3C16A 3FSXA 1Q8KA 2MSTA 3GTYX 1HHSA 2ZBCA 2CFXA 1R8HA 1SJ4P 2J5AA 2P8IA 4OMFG 4NLWA 4KPCA 4JI4F 1MU2A 2QFIA 2VG7A 1S1VB 4KHPF 3KLIB 4OZNA 1EHWA 2E7WA 2HHUA 1HIYA 4NYZA 3Q23A 3P96A 3FFIB 4PG6A 2P6TA 3CCWA 4DV1F 3PKYA 2HQGA 2KG1A 4DU8A 2JLEA 2XULA 1T05A 2Y8YA 2YNGB 1KD1T 2FUG9 1F60B 3FUYA 5KT4A 3LGMA 2Q3PA 4LT6A 2OPSA 2RDDA 3WZ0A 4JI6F 4M5JA 4OHXA 2HGNA 2V0NA 1AYEA 4AUKA 5F8NA 2DHHA 3QFHA 3OFEA 5A8KA 2CQBA 2B56A 2WVDA 2YWKA 4KBIA 2MKYA 3MEGA 2LP4A 4QR2A 3FGVA 5GAGU 4P2XA 4JB8B 3JQJA 2HPUA 2VPXB 1N56A 2QV6A 4NZ6A 3CJRA 3T41A 1JLGB 1P9YA 4LJMA 1WG5A 2AMCB 2DITA 2U2FA 3JS9A 2HLUA 1NZ8A 3K8WA 1WTBA 3VGUA 4EBDA 2BM1A 2EFGA 5DDPC 3PW2A 1Q78A 4A8QA 2B9XA 3M2UB 1SKRA 1Z2ZA 2ZH6A 1PSDA 2LU1A 3BH7B 1N0VC 2VF3A 3D4JA 2K06A 3GFHA 4RLEA 4P75A 2Q1LA 2A2CA 3T1YJ 4FN5A 3PYFA 3KK2B 5IT9Y 1TV6B 2EFQA 2AF6A 2LLZA 4J9VA 1NDKA 1R8AA 3AXKA 4DX6A 5T7LA 4B9TA 4I56A 3LANA 3KNAA 4I0WA 5HL7Q 2PMZD 1V3ZA 1UPMB 2LQ9A 2XGPA 2DB1A 2GGPA 5DQHA 4J9UE 2BJ3A 2ZBPA 1KKHA 4NXMJ 1TELA 2JRSA 3QIPA 2I38A 4DZDA 3MZIA 1BY9A 2KN4A 1TL7B 2YY3A 3MFHA 2RAQA 1RP5A 1U8WA 4EWTA 1Y4ZB 3ENQA 4FYWB 1I94J 1J27A 2KJWA 3D0IE 5A2QU 1TU0B 3D7SB 3D1OA 2UUCF 1WSVA 3BBFA 4PCQA 2VQEF 2NPIA 2OKQA 2WRMA 1KWMA 2HEKA 5CHCB 4LQ3A 4B3SF 4J9KA 2EPIA 1RBOB 2DNPA 3W66A 4ED8A 4LF5F 3W9JA 1TKZA 2BMBA 4UOCA 2ZEJA 3U7JA 1X5PA 3SQOP 3E01A 5EHHA 3R5AA 3CC7S 5C2GA 3PX6A 2RNEA 3EZ5A 4Z7CA 1DRZA 5KFIA 2DO4A 1FFGB 2FB0A 1RQ0A 4I1TA 4OYIA 2R7RA 5FDLB 1HBOA 2CPZA 2BE9B 3GIIA 3TVYA 1JLQB 4XDCA 1GMWD 2VU5A 4H54A 2QL5B 5H9FJ 3PHEA 3VZHA 2KH9A 4DR5J 4U7CA 2GS8A 4ZCIA 3F41A 1JLFB 1FDDA 4DV4F 1NLKL 2GO8A 5DLFA 3V81A 2LQ8A 1RTJA 1X4EA 2CUYA 1LFPA 3HPOA 1YK9A 3KHRA 4OJ1A 1EB0A 4HDGA 5J2MB 3FRZA 4AL5A 3AT1B 3HHNB 2RIJA 1Q4RA 4NRTA 1TK8A 1IJFB 3CCZA 1JMTA 1XQIA 4DV6F 2OSQA 2VICA 3V4IA 3D2WA 2BJDA 2V69A 1XR5A 3OV7A 3AY0A 1S59A 3PCOB 2ZE2B 3UNGC 2HMIB 2VODA 5G4DA 1KS2A 1WKJA 3DI6B 3M30B 4LBPA 3FSYA 1Q8LA 5IQ6A 1HBUA 3DU5A 2DRBA 1KRPA 3GSIA 2W8KA 2ZJQQ 2CA9A 4WPAA 1RWOB 2ZM6J 4RW8B 4DS5A 4ZVQB 2OMOA 3G6YA 2ZDPA 3S7RA 3JTOA 5G0RA 2BJEA 3AODA 3PR5B 2HNYA 3CD5A 1SQGA 3QZ7A 2QGFB 3CJTA 4DUTA 2ASLA 2HRUA 3W2VA 5K8OA 2XMAA 3SSSA 2X51A 4ZDNA 1RKJA 4A46A 3I56S 1NHVA 2V8VA 2KI2A 1S49A 2DXFA 2C2KB 3GJTB 4BC7A 3BBBA 5HROA 1JLBA 1UKUA 1HHTP 2QJ3A 3Q89A 3UVJA 1FVSA 1FNMA 2VONA 4ZPBA 1WC6A 2LQBA 9ATCB 1R0AB 1LFWA 4RUCA 4WCEQ 4AQYJ 3UD3P 3GV8B 2J0QD 1QVFR 3AAWB 3Q2TC 2HFNA 3BH6B 4ZVRB 2F4FA 3D68A 4B08A 1C1CA 1DTQA 5D0GA 1GK8A 3IWNC 4DV0J 2AW0A 5KFWA 2UUWA 2C2NA 4DXLA 1MSWD 5F3ZA 5EWEA 1G1XA 4LMZA 2QA4G 2LVWA 4CYUA 1XIQA 2IDLA 3W9HA 2VH7A 4ED7A 1LWEA 1NEEA 2K8GA 2YKMB 1CG2A 1Q8IA 3RAMA 4IG3B 1MNEA 2YNHA 2WSCC 4ITSA 4IR1A 2KZZA 2DEJA 3TR5A 3SBMA 2VJUA 4RPFA 2YKQA 1RWWB 1W2IA 1X4CA 2J0XA 4N56A 3BS9A 1FRJA 3CB4A 4MK8A 1NSKL 4ID8A 3BO2A 4MAKA 3J81j 4DBQA 1V5IB 4P52A 1QDUB 3MEDA 1KLMA 4H4MB 1HNWJ 3LH2S 3T6BA 2GO9A 5IV4A 1RHRB 1F5CA 2FHOB 1NB2A 4X4QA 1E6VB 3UR3C 4DL7A 3D0GE 3MCSA 3X3UA 1RTDA 5EDWA 4M5NA 2QYGA 3SYZA 3MGJA 2Z58B 3CC4S 3MMCA 2Z8QA 4OZ3A 3KOAA 3UNYA 2X3DA 4DQPA 3DLEA 1REVA 2LXFA 2D9OA 4EGLA 3MECB 3S8SA 3KUGA 2RMLA 4X64F 2OI2A 1HW8A 1U6FA 5CH7B 2R2TA 4CQ1A 1RT3B 1CLFA 3DRPB 4QZVB 1X4GA 3IBCB 4WFZA 2RH3A 3RRKA 1S76D 1HNXF 4HI2A 3DOKA 2M9KA 4UY8T 1YBTA 1HQUA 2D41A 3TNVA 4DL6A 3KK1A 2HHHF 1RABB 2NUHA 3U1NA 2BZ2A 5CZVA 6FDRA 1Y9OA 4USKA 4EYHB 2GIQA 3OSPA 5FIIA 3PEHA 4OX6A 2IAJA 1TZ0A 3DMJA 2DNKA 2E66A 3FK4A 3K7RA 1DY3A 3KG1A 1HQ2A 3OTBA 4B02A 4N8NA 1ZAVA 1RAFB 4DN0A 3TARA 1YBUA 2IHR1 5J2PB 3TZWA 3UWTA 4LBHA 3H59A 2OPQB 2BANB 5F8LA 4LIWA 1N33F 2P5VA 3OFHA 5CZXA 5CD4H 3DYAB 4CZCA 2CIMA 2YTCA 2OLWA 2CNLB 4G1QB 4NYPA 4FNHA 2DO0A 4F3QA 2C3YA 3K58A 3POTB 4DR1J 3Q0AA 2KL8A
chains in the Genus database with same CATH topology
5LMUJ 5IWAJ 2MTLA 4JI4J 4JI8J 4DV4J 3IMQJ 1XMQJ 2F4VJ 1HNWJ 4NXNJ 2E5LJ 4LFCJ 3J7AN 4AQYJ 2VQEJ 4DV5J 1XMOJ 1XNQJ 4DUYJ 5FLXU 4DR3J 2UU9J 4DV1J 4HHUA 3W1YC 2KVQE 4JI0J 2UUBJ 4NXMJ 4JI2J 4DV3J 4X65J 3D3CJ 2UUCJ 5BR8J 1IBKJ 4JI1J 1N32J 4KHPJ 1HNZJ 4YHHJ 5LMNJ 4B3MJ 4JI6J 3JAMU 4DV0J 1XNRJ 4DV6J 4B3RJ 2ZM6J 1N33J 4LF6J 1I94J 4GKJJ 1N34J 2MEWA 4JI3J 4DR7J 4X64J 5LM7E 4LF9J 4V1Ak 4NEYA 4LF7J 5A2QU 4LF8J 4DR2J 4DR5J 1IBMJ 4B3SJ 4X62J 4PWWA 4DR4J 1N36J 3R2CJ 1HR0J 2HHHJ 3T1HJ 4GKKJ 4DUZJ 3J81U 1J5EJ 4LF5J 3D3BJ 4JI5J 4DR6J 4DV2J 4KYZA 3T1YJ 3OTOJ 3R2DJ 2VQFJ 4KY3A 4X66J 1HNXJ 4LFAJ 4LFBJ 3J80U 4K0KJ 4OX9J 4DV7J 4RJVA 5IT9U 2UUAJ 5AJ3J 4NEZA 4JYAJ 4YY3J 2UXDJ 1IBLJ 2MQ8A 4B3TJ 4DR1J 4LF4J 2UXCJ 2KL8A 2UXBJ 1FJGJ 4JV5J 4JI7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU J;  5IWA J;  2MTL A;  4JI4 J;  4JI8 J;  4DV4 J;  3IMQ J;  1XMQ J;  2F4V J;  1HNW J;  4NXN J;  2E5L J;  4LFC J;  3J7A N;  4AQY J;  2VQE J;  4DV5 J;  1XMO J;  1XNQ J;  4DUY J;  5FLX U;  4DR3 J;  2UU9 J;  4DV1 J;  4HHU A;  3W1Y C;  2KVQ E;  4JI0 J;  2UUB J;  4NXM J;  4JI2 J;  4DV3 J;  4X65 J;  3D3C J;  2UUC J;  5BR8 J;  1IBK J;  4JI1 J;  1N32 J;  4KHP J;  1HNZ J;  4YHH J;  5LMN J;  4B3M J;  4JI6 J;  3JAM U;  4DV0 J;  1XNR J;  4DV6 J;  4B3R J;  2ZM6 J;  1N33 J;  4LF6 J;  1I94 J;  4GKJ J;  1N34 J;  2MEW A;  4JI3 J;  4DR7 J;  4X64 J;  5LM7 E;  4LF9 J;  4V1A k;  4NEY A;  4LF7 J;  5A2Q U;  4LF8 J;  4DR2 J;  4DR5 J;  1IBM J;  4B3S J;  4X62 J;  4PWW A;  4DR4 J;  1N36 J;  3R2C J;  1HR0 J;  2HHH J;  3T1H J;  4GKK J;  4DUZ J;  3J81 U;  1J5E J;  4LF5 J;  3D3B J;  4JI5 J;  4DR6 J;  4DV2 J;  4KYZ A;  3T1Y J;  3OTO J;  3R2D J;  2VQF J;  4KY3 A;  4X66 J;  1HNX J;  4LFA J;  4LFB J;  3J80 U;  4K0K J;  4OX9 J;  4DV7 J;  4RJV A;  5IT9 U;  2UUA J;  5AJ3 J;  4NEZ A;  4JYA J;  4YY3 J;  2UXD J;  1IBL J;  2MQ8 A;  4B3T J;  4DR1 J;  4LF4 J;  2UXC J;  2KL8 A;  2UXB J;  1FJG J;  4JV5 J;  4JI7 J; 
#chains in the Genus database with same CATH topology
 1FX4 A;  2MMY A;  4K2X A;  5AT1 B;  3FMW A;  3U1M A;  3TUI C;  1ZZF A;  2WVC A;  2M3D A;  1F3F A;  2V50 A;  3MM8 A;  5AJ3 F;  5D6G A;  2E1P A;  2PSZ A;  2QSF A;  1LWC A;  1R27 B;  1EAR A;  2SXL A;  2CQP A;  4TU8 A;  2PMW A;  3MCO A;  2I8E A;  3ZTQ A;  5KG6 A;  2UV8 A;  3HO1 A;  2QIF A;  4KHP J;  7FD1 A;  3LP0 B;  2O5D A;  2Z0G A;  4ZS6 A;  4TNO A;  4CO3 A;  3NG8 A;  3OUY A;  2OPP A;  1ZPW X;  3SFG A;  1U1P A;  3HK2 A;  3EYZ A;  3GV5 B;  4QPX A;  2E9T A;  2V5H G;  3Q86 A;  3VAJ A;  4LF6 F;  2CJA A;  4K8R A;  1DFD A;  3V5R A;  4U7U D;  1LK7 A;  4OX8 A;  2VFR A;  3LPY A;  2DHS A;  2RUG A;  1FK9 B;  2ZZN A;  2H9Z A;  1RDR A;  5H9E K;  3J81 Y;  5HQL A;  2QN6 B;  3L7O A;  2JVO A;  1SJQ A;  4NA3 A;  1WNE A;  2DEI A;  1RHQ B;  1FJ7 A;  4C2M A;  4UT4 A;  1XMQ J;  3WIV A;  2YNF B;  3D6H B;  1QAI A;  4DSF A;  4YB5 A;  4ZHR A;  1S0V A;  4HAC B;  1RT2 B;  3M2V B;  3HHD A;  1J5E F;  2ACY A;  4EFA C;  2VB6 A;  2L9N A;  3ZZZ A;  2WK4 A;  1RT4 A;  5BYR A;  4KPY A;  1VRQ C;  4PWD A;  1RYS A;  2H65 B;  4JOU A;  4AE5 A;  1WF0 A;  2AX0 A;  1LK5 A;  1YJV A;  4ZJQ A;  1TUV A;  4OV6 A;  3MR6 A;  4L3K A;  2BOP A;  1U8S A;  2OD6 A;  2YWH A;  1X5T A;  2YQ3 A;  5E3A A;  1HMV A;  2AGP A;  5A8R B;  4OI0 A;  4DUY F;  3DLK A;  1YJ9 S;  3HHE A;  3MR2 A;  1FRI A;  3ISN C;  3BBC A;  1ZM4 A;  1LV5 A;  5HMW A;  3BGR B;  3Q8U A;  1QUV A;  1WC3 A;  3CWJ A;  2LYV A;  3F56 A;  1L3T A;  3I5B A;  4MIB A;  5JJB A;  1HA1 A;  3ZTS A;  3PZP A;  5C42 A;  1RCO B;  3G8T A;  2D3O R;  4LF8 F;  1OPZ A;  1YSJ A;  5HSP A;  3DFE A;  3FDS A;  1YIJ S;  5KFD A;  3EVO A;  2M88 A;  4M63 A;  3HFV A;  4B3T F;  1EET A;  4CM2 A;  2A10 A;  4O23 A;  2UUC J;  3NGT A;  3AJ2 A;  3D66 A;  2AX1 A;  1NDL A;  1X9W A;  1PO6 A;  2FVC A;  1U49 A;  2N3O A;  4ZP7 A;  2AJ4 A;  3GFX A;  2AEJ A;  4RKU C;  2L48 A;  4B3S J;  2HND A;  4K4T A;  1NSP A;  1EX8 A;  3HKZ D;  2NSB A;  3EUN A;  2V4J A;  1WOR A;  1ZAW A;  1YJU A;  4LF5 J;  4O3P A;  4GO7 X;  4JI3 F;  2CWK A;  3M6W A;  4F04 B;  2FJW A;  2ZVS A;  3RAQ A;  1D8Z A;  1NM2 A;  4GVB B;  1LOU A;  1GQE A;  2IIH A;  3GON A;  1NCL A;  1WWH A;  4BHQ A;  4B9S A;  3JSM B;  3TJ8 A;  2GIR A;  3AOA A;  5HAO A;  1S9E A;  3M9N B;  4P73 A;  1N6Q A;  2XYP B;  4UST A;  5L1J A;  3R5C A;  4DPO A;  3AD9 C;  3DRR A;  4WU3 A;  2ZD1 A;  1YJT A;  4I64 A;  4NI2 B;  3UDC A;  4MMO A;  2ZH8 A;  1HQE A;  1SVD A;  3CCU S;  4B9V A;  2LA4 A;  4ED4 A;  4OIX A;  5IQQ A;  4LR9 A;  3J7Z T;  4B3M J;  1RHK B;  4BC9 A;  1XNR J;  3VGT A;  3AFG A;  1UVJ A;  2OIH A;  1LXN A;  1BD6 A;  4A8K A;  4C3L A;  4ZCK A;  4J37 A;  3TOQ A;  3I5A A;  1REG X;  4LSN A;  1YKW A;  1FNO A;  2A1B A;  1TKT A;  3MD3 A;  1WC1 A;  3CCE S;  5C25 B;  1OY9 A;  1KOO A;  2BRK A;  5BYS A;  4O3S A;  2Q6B A;  4WTY A;  1G7C B;  2NSC A;  1PBA A;  2PMH A;  2QEX S;  2JLG A;  3BB5 A;  1SH0 A;  3GV7 B;  4RNM A;  4LUB A;  3IO1 A;  4WFY A;  3OTO F;  4F2S A;  1QE1 A;  5CXT A;  2C3U A;  4XDD A;  1C0T B;  1R0B G;  3B6B A;  4CO2 A;  1CJK B;  3IRW P;  2F63 A;  4GKK F;  1XMO J;  3BQ2 A;  3VVT A;  4KKO B;  5IC4 B;  5GAD I;  5T41 A;  2UUT A;  1OYE A;  1PC5 A;  3C16 B;  5DQG A;  2Z56 B;  1IBK J;  1VQ7 S;  3VHQ A;  5K5M A;  4M5D B;  3NRB A;  2HFZ A;  4LR7 A;  5KFU A;  2QLX A;  2E44 A;  4CTA A;  2VG7 B;  1IR0 A;  1UWB A;  1F9F A;  2Z2M A;  4F0M A;  1RT7 B;  3R97 A;  4RO0 A;  2KB2 A;  3K5M A;  4PWW A;  4JV0 A;  2IBO A;  2D3Z A;  3JYT B;  4NLP A;  4LBI A;  4C8O A;  1AB8 A;  3R27 A;  1NKB A;  1FF2 A;  3MUM P;  1IN0 A;  2OPS B;  1NJX A;  5GME A;  1SB6 A;  1XMB A;  2K3K A;  3NCR A;  1YG0 A;  1XR7 A;  1R8P A;  2RHS B;  2EFN A;  2F8H A;  3TAM A;  2W2O P;  4YOE A;  2YWF A;  1HI0 P;  1Y5L B;  2A3J A;  1RI7 A;  3MEG B;  2J0S D;  5DDO C;  3M9O B;  2XC9 A;  4AD6 A;  1S72 S;  3OSN A;  5KT7 A;  1Y3J A;  3MM6 A;  2DVI A;  2UU9 J;  3PFO A;  2Q43 A;  2AJF E;  4M5M A;  5DG8 A;  2MKS A;  1OO0 B;  4KGM A;  3QFW A;  5KT2 A;  5KT3 A;  1Q5Y A;  2GQQ A;  2CAD A;  3NMA A;  2CJB A;  5I42 A;  5KFB A;  2KYZ A;  3CJK A;  2R8H A;  4OYZ A;  2BAB A;  2YWW A;  1F1B B;  2GML A;  3L7P A;  3IAS 9;  2DRD A;  3MFI A;  3Q8R B;  4I2Q A;  4I68 A;  2NXU A;  2BX6 A;  5KFR A;  5L1I A;  3WX4 A;  2IRU A;  1HWL A;  4OYW A;  4ZVP B;  2E9Z A;  2EFV A;  1JQG A;  4ATN A;  2FPH X;  1C1B A;  1U45 A;  2Y9H A;  2DXE A;  5KG1 A;  5T7L B;  3OR1 B;  1WG1 A;  4CT8 A;  2FLN A;  1HYS A;  1D8Y A;  2V8D A;  1BXN A;  4IH7 A;  3G6E S;  3HDS A;  4MIW A;  3PJ9 A;  1AA1 B;  4UUW A;  1JXL A;  2W2M P;  4W98 A;  2PT0 A;  3IP0 A;  3ITH A;  3TAN A;  2GGP B;  4JI8 J;  1QJH A;  4URG A;  1GAO A;  4OJG A;  5D4P A;  4A8S A;  1PIE A;  4DG1 A;  3QIP B;  3OLA A;  4DSK A;  3BO3 A;  5BYQ A;  3MCM A;  1NKC A;  2DBB A;  5B08 A;  4U8V A;  4CT9 A;  2UUB J;  2XCP A;  5D15 A;  1KVJ A;  2FVP A;  4N77 A;  5IWA F;  4DLG A;  2V2V A;  2N7Y A;  4X4N A;  4TU7 A;  3PY8 A;  1S6P B;  3J7Y U;  5L9N A;  4ZPA A;  5ETV A;  2ZJR Q;  3DHW C;  4YY3 F;  1RWU A;  4Q43 A;  4X64 J;  2POK A;  2OEM A;  1SC6 A;  4E2F B;  2LMI A;  3FNN A;  4X62 J;  2V6A A;  4MK7 A;  2B9Y A;  3J81 U;  2K1R B;  4O4G A;  5CCL A;  3H5Y A;  4Q2L A;  1FNX H;  3ILO A;  4FP9 A;  3DOM A;  1TL1 A;  1HNX J;  2DHG A;  2KRB A;  1NK7 A;  1PBU A;  1ZH5 A;  1TKZ B;  4NLV A;  2BE2 A;  3RW6 A;  2I6W A;  3L9Z A;  2VFV A;  1IKX A;  5IS2 A;  2CJ9 A;  1UTA A;  1WSR A;  2GHP A;  4KRW A;  1GTE A;  3ISN D;  2GHV C;  1NB7 A;  1NJI T;  3QRQ A;  3MM9 A;  4USW A;  2MKK A;  3UDL A;  2EKY A;  4O3R A;  2FJE B;  5E3Q A;  3LO3 A;  2UXB F;  3N79 A;  4ID5 B;  5K20 B;  4JI1 J;  2AHO B;  2GQC A;  2MKJ A;  2QMW A;  1N33 J;  2LQ5 A;  5H9E J;  4WE1 A;  2B6A A;  4PWU A;  3V81 B;  5KFE A;  4LF7 J;  2MGZ B;  1P1L A;  2ZNY A;  3FFI A;  4HL9 A;  4FYY B;  4ZJO A;  2F3J A;  3HX9 A;  1FKP B;  1Y7P A;  3T5K A;  2W8L A;  3AB2 B;  1FTC A;  1XBW A;  1ITP A;  2KFN A;  1CSJ A;  4CLY A;  5L8R C;  2Y1L B;  2A18 A;  1VIS A;  5AJ3 J;  1R8B A;  1NXI A;  4P2F A;  3DRS A;  1FRL A;  1L3V A;  1PYO B;  2B9E A;  1BQN B;  4Z2X A;  5KFL A;  1NJZ A;  2DY1 A;  4ZLN A;  2ZHO A;  4BWM A;  5I4M A;  4ZVT B;  1SIW B;  4NLY A;  2VOP A;  3ONQ A;  3G86 A;  3NWG A;  1HBU B;  3MM7 A;  2MY7 A;  3D1Q A;  1H72 C;  3AA9 A;  2L9D A;  1C4A A;  2V34 A;  3H5S A;  1U2R A;  3N5B A;  3CO9 A;  1T11 A;  2Z2L A;  4DX5 A;  1VRU A;  4LF6 J;  2HGM A;  4ZN1 A;  2W7O A;  3I4H X;  3NL0 A;  1FVQ A;  2ZIT A;  3BN7 A;  2XMT A;  5K9F A;  3NS5 A;  2ROG A;  1VHF A;  3HUL A;  4ZP6 A;  3NNC A;  3IR6 B;  2V2Q A;  3THT A;  1KQK A;  2ZC4 A;  4DQR A;  5KFN A;  3V6H A;  4QW9 A;  4RWW A;  4CLP A;  5A6W A;  4GKJ F;  1TV6 A;  4KT0 C;  3GZ7 A;  3OXG A;  4Q8E A;  3JXO A;  1N4L A;  1D09 B;  4OZ2 A;  4X2B A;  1KR4 A;  2ADB A;  5ETP A;  5HRO B;  1CBK A;  1JLB B;  1I5O B;  3UVJ B;  4OI6 A;  4B9L A;  5KFV A;  5KG2 A;  2ZH1 A;  3BSC A;  2GC8 A;  2XMV A;  3GE9 A;  3HT0 A;  2DPI A;  3L3C A;  5T14 A;  1YZ6 A;  1RU2 A;  3GJQ B;  3O2I A;  1N5T A;  4G6V B;  2GVD A;  1VHI A;  3QPI A;  4J9Q A;  1C1C B;  1RT1 B;  1DTQ B;  3CGI A;  4ZN3 A;  2MKI A;  1JB0 C;  4KB7 A;  2EFP A;  2PI4 A;  2EG1 A;  1VQS A;  3C15 A;  3LTO A;  3RTV A;  2XNR A;  1GXL A;  1WG4 A;  3HSJ A;  2NYI A;  3MOZ A;  4ZJL A;  3NMR A;  3CD7 A;  5DS7 A;  4CYU B;  3D6F B;  2ZOG A;  4ENO A;  1RAH B;  1NO8 A;  1EZZ B;  4K59 A;  4ZLJ A;  3IA0 A;  2FY1 A;  3DLL Q;  2EKN A;  4WZM A;  1MN7 A;  1UZD A;  4NLO A;  1VQ9 S;  4K4X A;  4HLB A;  2KHD A;  4N7T A;  3SV3 A;  1U2C A;  3PYE A;  1FD2 A;  4X4P A;  1GX6 A;  3BSN A;  1RU1 A;  2K3I A;  1ZBT A;  1NHU A;  3T5H A;  4C8M A;  3GIM A;  2CQ3 A;  3EVM A;  2MZJ A;  1BWE A;  1KLM B;  4B3T J;  5KFZ A;  4BCA A;  3QMQ A;  3ENW A;  4FVM A;  3NNH A;  3CMQ A;  1R7I A;  2CDQ A;  4EMD A;  4HDH A;  4QIW D;  2NXC A;  4ZIT A;  4X4O A;  3DC2 A;  4MKY A;  3T5J A;  1JLQ A;  4MH8 A;  4AFF A;  3MMC B;  4OZ5 A;  2BM0 A;  1APS A;  1UPP A;  3WC2 A;  2HKE A;  4U7U K;  3MCN A;  2QA2 A;  1JLF A;  2D74 B;  1RT6 A;  4JI3 J;  3CCJ S;  1K8A T;  1UA0 A;  4V1A k;  3CDW A;  1SUQ B;  4IKA A;  1YIT S;  2LKZ A;  3ILJ A;  2NZC A;  3PO4 A;  1LKZ A;  3I0S A;  4LRA A;  3D54 A;  2FTR A;  4P72 A;  1GT8 A;  4M5L A;  1GMV A;  4DF8 A;  1R31 A;  4F7V A;  1UWA A;  3MUR P;  3HZE A;  1U0S A;  1M1K T;  3AH6 A;  2BJ7 A;  3H4B A;  5LXR A;  3HHK A;  3IGV A;  1ZZN A;  3NNA A;  3DOK B;  2QLB B;  3KK1 B;  3HM9 A;  4MKV A;  4WFA Q;  2H54 B;  1C4C A;  5JXS A;  3DI6 A;  3WIU A;  2FJV A;  1TAQ A;  3QAE A;  2RSQ A;  4PR6 A;  1WEZ A;  3O44 A;  2VKZ G;  1JWW A;  3DMJ B;  3Q8Q B;  4RW8 A;  1KTQ A;  4CM0 A;  1HWI A;  4G1P A;  3JQM A;  3OHB A;  4URQ U;  5CCM A;  3K57 A;  4QJV A;  2X1B A;  2XS2 A;  4NML A;  1JKH B;  1MWZ A;  2G0C A;  3SDE B;  2PE8 A;  3W7B A;  2NYH A;  2ZJP Q;  1LWX A;  4N41 A;  1X5O A;  3KK3 B;  3K17 A;  1CS4 A;  2E1C A;  1SV5 A;  2GZO A;  2H1Y A;  1F6T A;  4RNF A;  3OTO J;  2MZR A;  1X0P A;  3KXD A;  4ILL A;  4J9L A;  2J9E A;  1WEX A;  4CLS A;  5LSO A;  1QAJ A;  4C48 A;  1XK8 A;  2WB4 A;  4ECR A;  3SXL A;  1AW0 A;  3PRD A;  4DR2 F;  2PA8 D;  1LWC B;  1VQN S;  2J9D E;  2DCL A;  3M8Y A;  4CNY A;  5KAK A;  4ERD A;  4RX6 A;  3VVU A;  1SJR A;  3H2V E;  4N47 A;  4C11 A;  2QSW A;  4FVC A;  1YI2 S;  4DPT A;  2HVZ A;  1NDP A;  1Y11 A;  1B70 B;  5B0D A;  4ZLL A;  1YZ7 A;  3A4T A;  1FRX A;  4YDX A;  3WQP A;  2OPP B;  3PIO Q;  1QSL A;  1WEL A;  4TY9 A;  5C24 B;  2UXC F;  3MWB A;  2X7I A;  4IG3 A;  3GLJ A;  3MMB A;  5B0E A;  4LRE A;  4QPT A;  4USU A;  2KFZ A;  3I87 A;  3IBF B;  3G8S A;  1IKW A;  2OHD A;  2R8J A;  1WHW A;  5K8P A;  5KFG A;  3RYL A;  5B0C A;  1KP6 A;  1UW4 A;  4NA2 A;  3A8E A;  3FRY A;  1UEV A;  2ZBR A;  4K50 A;  1WC0 A;  4X4R A;  1AUS L;  1F5B A;  4AT1 B;  3M8S A;  1X7V A;  2FDN A;  2ZWO A;  3DXB A;  2QLJ B;  3MR5 A;  2CVE A;  2VPY B;  4RW4 A;  2ROP A;  5E5N A;  2HFU A;  5IM0 A;  2G13 A;  4DV2 F;  4DR7 F;  4ZHR B;  3GYX B;  1E6V A;  3CMA S;  1KN6 A;  2L08 A;  5K8M A;  3CPW R;  3IM9 A;  3P6Y C;  4PUO A;  1UL3 A;  1RT4 B;  5SUH A;  2B4V A;  4RNH A;  2FVQ A;  3D3C J;  4ZVH A;  1LW2 B;  1U48 A;  5SZT A;  4OLO A;  1JLC B;  1N5Y A;  1VC6 A;  4CLF A;  2KO1 A;  2VBZ A;  2LXU A;  4DOZ A;  2ROE A;  1S4E A;  3FBB A;  4FZV A;  1N0U A;  1Q7Y T;  4R0E A;  4ED3 A;  5AE3 A;  4OV1 A;  1RA7 A;  2C3M A;  3UD5 A;  1RT3 A;  1P27 B;  4F26 A;  4ECQ A;  3PRB A;  4DSJ A;  5D0E A;  3GIL A;  2PII A;  3W8G A;  1HNZ F;  5C42 B;  3QGH A;  5LMN F;  4ILM A;  4Q2M A;  1FTR A;  2VBW A;  3L09 A;  3V6D A;  1SKU B;  3T9Z A;  5IWA J;  2DPJ A;  3IR5 B;  5ETT A;  1U0H A;  4ZP9 A;  1FWL A;  1EJ7 L;  2W9C A;  3GPA A;  5KG5 A;  2YVS A;  4TQR A;  2H5E A;  3C6U B;  4C3M A;  2A6O A;  2CRL A;  2VG6 A;  3B54 A;  4YME A;  4JV2 A;  3IG1 B;  3R6G B;  4YDD B;  5J2P A;  2RT3 A;  2L9W A;  2XZT B;  1IXK A;  1YLX A;  2NPF A;  4OYB A;  2FVS A;  3DYA A;  1XTZ A;  2NRE A;  2VHG A;  2CG8 A;  5DO2 A;  2CQ0 A;  5HP1 A;  2HS3 A;  1VBZ A;  2KKH A;  1SKS A;  3CIM A;  2UVU A;  2A6M A;  3M8R A;  3K8V A;  5B7W A;  1VQ8 S;  4Y2M A;  4OYA A;  3MEK A;  3BR9 A;  5HJX A;  3JQK A;  1T9U A;  2Q66 A;  2UXB J;  4FYV B;  1BGX T;  1T9W A;  3DRR B;  4AYB D;  1WHV A;  1HQE B;  2RRB A;  5KFP A;  4ES3 A;  2JHE A;  1B0P A;  4Y2K A;  1S48 A;  2DNN A;  3JTN A;  1FEE A;  2G9O A;  3PJX A;  2FIU A;  3LP0 A;  4LF2 A;  3O8W A;  4RW9 A;  4Y65 A;  1B0T A;  6FD1 A;  4WXW A;  4XO0 A;  4O0N A;  4R25 A;  3LA0 A;  3QO9 A;  2HK3 A;  2BRL A;  1PAE X;  1S0O A;  2NXN A;  5A2Q Y;  4K4Z A;  4CIO A;  4LSN B;  2CQ4 A;  1JLE B;  1TKT B;  4O3O A;  2VDH A;  3I5C A;  2YKA A;  4Y00 A;  5ETS A;  1FK9 A;  1YJN S;  2NUU G;  2QT7 A;  4M5K A;  1H73 A;  5CD4 A;  4ECX A;  2D3O 1;  1IQT A;  4QU6 A;  2Z2Z A;  2XM3 A;  1O8B A;  1QE1 B;  5LJ5 Y;  1RLD A;  3CED A;  1OMS A;  3M2V A;  2DNL A;  3HT3 A;  2BDP A;  4LFC J;  4HVZ A;  3C8Y A;  2HZV A;  3BGU A;  1Q16 B;  5CYM B;  5DDR C;  2KDO A;  2B43 A;  3IWX A;  1ZAX A;  2V8H A;  4L72 B;  3SQG A;  1DQ9 A;  4CTA B;  1SH2 A;  3SSQ A;  2BVZ A;  4KH1 B;  3NP5 A;  4GKJ J;  1BE4 A;  4KQZ A;  5A8R A;  2IM3 A;  8AT1 B;  3E2E A;  2H51 B;  4NLG A;  2X1G A;  4PRF A;  4EK2 A;  3LF0 A;  4NCB A;  3HXM A;  2CQ2 A;  2XYG B;  3UCG A;  1S57 A;  3RBE A;  3CJS A;  4JI5 J;  2A0F B;  5LL6 d;  1NUE A;  3QJL A;  2MXY A;  3W2W B;  3RUB L;  3QBC A;  1QD1 A;  1NAQ A;  3D28 A;  4NZ7 A;  5IT0 A;  2CQC A;  4P2S A;  3TAM B;  2IJR A;  3CE8 A;  2N4D A;  1X9S A;  4OJ3 A;  4MFB B;  2VFU A;  1WC5 A;  4ECY A;  1M5V C;  5KG3 A;  2RIL A;  2KTQ A;  4UQG A;  1BQX A;  3KDN A;  2KVI A;  4K7Q A;  2MQQ A;  3MM6 B;  3MDF A;  3JTP A;  3DCA A;  2QX0 A;  2FZG B;  1JIH A;  3FCW A;  3THP A;  3ZZP A;  1GTH A;  4FPR A;  5GAH I;  1SXL A;  5DDQ C;  5F8I A;  3DHX A;  2DH7 A;  2RVJ A;  4OI2 A;  2XBP A;  2OEK A;  3MF5 A;  2F65 A;  5CAA A;  1JLA A;  4DV5 F;  3QLH B;  3R9L A;  3IXQ A;  3GU0 A;  4IOB A;  4I2Q B;  3A12 A;  1CUL B;  2GFF A;  1FER A;  2WON A;  1U1O A;  1S6Q B;  3MMJ A;  2KHC A;  1CJU A;  2DNY A;  3NBP A;  1R3N A;  3KYL A;  1VLY A;  2X1A A;  4YS2 A;  1DQ8 A;  3OL9 A;  3CTR A;  1HYS B;  3H0P A;  2RJZ A;  2N7C A;  1NU4 A;  3T9N A;  3JSM A;  4M8L A;  1MN9 A;  4RBU A;  3TA2 A;  3ITH B;  1FFW B;  3EDQ B;  1B7Y B;  4PYD A;  4F02 A;  2ZC3 A;  4P6Q A;  3EXY A;  1VBY A;  2RKI B;  4M5H A;  2AV5 A;  2MTL A;  1DBD A;  1SJ1 A;  4LIR A;  4DG1 B;  1TK0 A;  1NK8 A;  4ED6 A;  1A6L A;  2KJV A;  1MRO B;  3ZZR A;  2GNK A;  3W5Y A;  1UEU A;  2CPY A;  2ZKU A;  4KGK A;  4MYT A;  4Q0B A;  2NXJ A;  2KXH A;  4KR0 B;  3KTQ A;  2I2Y A;  3P4U B;  3QSY B;  1YJ7 A;  5DGB A;  4A8Y A;  1VQM S;  3OVS A;  1TL5 A;  3VAF A;  4L6V 3;  2K7K A;  1AFJ A;  1EIY B;  2XEX A;  2PFD A;  3KHH A;  1N52 B;  1U25 A;  2UXD F;  1EKS A;  4RUB A;  4IH5 A;  4NEY A;  4Q8F A;  4CO4 A;  4CNZ A;  1UMJ A;  3KJF B;  2RU3 A;  3DLG B;  4ZVE A;  2Z4P A;  4OI1 A;  2EC2 A;  2JSX A;  2P6S A;  2ATC B;  1U1K A;  3DOM B;  1TL1 B;  4WII A;  4B3R F;  3CSK A;  3PX0 A;  2D3U A;  4IOC Q;  3K2Y A;  4ZMM A;  4LR8 A;  4FS2 A;  1IR1 A;  4USJ C;  3QNW B;  3US5 A;  4EU0 A;  2G4B A;  1T95 A;  2DGV A;  5EWG A;  3MPD A;  1HR0 F;  4IFY B;  3G87 A;  4IRK A;  1C0T A;  3ZO7 A;  2AZ1 A;  1NBE B;  3W62 A;  4XPC A;  2BJ1 A;  4KKO A;  3ZTO A;  3DM2 A;  2P9E A;  4QR0 A;  2RDJ A;  4HTI A;  2V8G A;  2C2O B;  1ARO P;  1XEZ A;  3RRH A;  1XWL A;  4M5D A;  1RAE B;  4JI0 J;  1PJ7 A;  2OGU A;  4USM A;  2W7P A;  4WE1 B;  4CLW A;  3SV4 A;  4CRJ A;  5I3Q A;  2B6A B;  1RT7 A;  2M52 A;  3PDN A;  2O01 C;  2F8M A;  4U96 A;  4OJH A;  1CEZ A;  3JYT A;  3KMS A;  1K1S A;  1HFE L;  3FVY A;  5IXU A;  5A8W B;  3TW0 A;  3CUL A;  2MDA A;  3OJS A;  1N36 J;  2HS0 A;  4PQU B;  2DIS A;  1KDN A;  1VJQ A;  2WVF A;  3EM1 A;  4HH0 A;  3RW7 A;  3BDE A;  5EUH A;  4L76 A;  3Q8S B;  4NRU A;  5HI7 A;  3TA0 A;  1K47 A;  4AXI A;  2VKR A;  1U6B A;  3DRS B;  1X4H A;  4RZR A;  7AT1 B;  3I0R B;  2MZT A;  5AXN A;  3BGL A;  1BUX A;  3DDI A;  1B3T A;  2JL9 A;  2C42 A;  2VPZ B;  3T6J A;  5D77 A;  4PZV A;  1FDA A;  4KTQ A;  1TVR A;  4DCJ B;  4U67 Q;  3MR7 A;  1XC9 A;  2XB2 D;  1UFL A;  1VJW A;  4PKD B;  1CJV A;  3DLJ A;  2E1M C;  3MM7 B;  4ECU A;  2GAG C;  4AL7 A;  4GRS A;  4ELU A;  2GQ2 A;  3M7V A;  2HWH A;  2LEP A;  4HT5 A;  4RUA A;  4KV8 B;  3BSO A;  5CYJ A;  2BAC A;  2HNZ B;  1UVK A;  2HGL A;  2PA3 A;  1VRU B;  2DNM A;  4OFZ A;  1YRX A;  1PIL A;  3CJ8 A;  4NYO A;  4U95 A;  3TP2 A;  3NGK A;  4F67 A;  3PG9 A;  4NWB A;  3B4M A;  3VAM A;  2YKN B;  4LVN P;  2W24 A;  3G9C A;  1KEK A;  3UDE A;  4CLU A;  1NSQ A;  3UCU P;  3ZTP A;  3OR1 A;  2MJN A;  3KLH A;  1OSD A;  4DV2 J;  5J2N A;  3TUP A;  2VIH A;  2LDI A;  3CC2 S;  2RRN A;  1FXD A;  1ZM9 A;  4RJV A;  3QJP A;  2E5J A;  4QWD A;  1VBX A;  1V3R A;  3MD1 A;  2E9R X;  4F0H A;  5GMD A;  1RTH B;  2KT3 A;  2Y0S D;  2R8G A;  2CPE A;  1EKR A;  2GVD B;  2QA4 S;  2JOQ A;  4J9S A;  2Z30 B;  3TWZ A;  1RHJ B;  4OI4 A;  2QTW A;  3C15 B;  4C8N A;  1S6P A;  3GG0 A;  4QWC A;  4IQX A;  2G1H A;  1TL3 A;  3EWG A;  1K44 A;  4ZPT R;  4NCA A;  2AYM A;  4DX8 H;  2KU7 A;  3E3X A;  2NR0 A;  3RR8 A;  4IO9 Q;  1M5H A;  4ZKA A;  4QR1 A;  3CT9 A;  2CG4 A;  2K1R A;  2J9D A;  4ZVU B;  5D0H A;  1U26 A;  4ZVO B;  4JI7 F;  4CP5 A;  2Y3Y A;  2CQH A;  1J5O B;  4Y34 A;  3HVR A;  8ATC B;  3OVB A;  3C6T A;  5J2Q A;  4WJB A;  4CWB A;  2BQ3 A;  5AE1 A;  3OPK A;  4X65 F;  3LAL A;  4FKY A;  4G65 A;  3EIC A;  2UP1 A;  1T9X A;  1DAR A;  2R9L A;  4KIA A;  2DRA A;  3SFU A;  5F9L A;  3AOB A;  3ETO A;  1KQG B;  2BBE A;  4ID5 A;  2WOM B;  2VL1 A;  2LEB A;  2XZW A;  2GJF A;  2KT2 A;  4ZCL A;  1RT5 A;  3HLU A;  4USH A;  2BJ9 A;  1RT6 B;  4K5S A;  2MGZ A;  3UFC X;  3Q83 A;  2DR8 A;  2HVE A;  4KO0 A;  2ZVI A;  4Q45 A;  1VIX A;  1KHV A;  1VYA A;  3DKD A;  2CQI A;  1FKP A;  1RUS A;  3W5X A;  2R8K A;  3TA1 A;  4IRD A;  4OYO A;  2J7W A;  3I0S B;  1Q79 A;  4J9P A;  3QGI A;  2DCU B;  1SJF A;  2HBR B;  4IFV A;  1N5S A;  4AND A;  4L73 A;  3MEE B;  2EI5 A;  4TY8 A;  1FJC A;  4DQI A;  1UCN A;  1BQN A;  3DDN A;  3PM9 A;  3J7A 1;  3GP9 A;  1TMM A;  3M8P A;  3FJ2 A;  2GJI A;  1EAY C;  1SI9 A;  3OR2 B;  2ZOF A;  3BPD A;  2RDI A;  4K2J A;  3DGP A;  4WFX A;  2B8Q A;  4UOH A;  1H98 A;  1OY8 A;  3MMA A;  2DGS A;  1WOP A;  3HSD A;  2XO7 A;  1MW7 A;  2HQI A;  3H98 A;  1IBL F;  1Q8B A;  1T94 A;  9RUB A;  2OP5 A;  3CVK A;  1HBM A;  2DIV A;  4I6A A;  2DD8 S;  1S9G B;  3AXM A;  1PJ6 A;  1DLO B;  4P7T A;  2ILY A;  1ZA2 B;  2AYE A;  2PI5 A;  4L3N A;  3PEJ A;  3CD0 A;  1F2G A;  1NPK A;  3NAI A;  1WJ9 A;  1BC6 A;  1V9O A;  2MQL A;  1T3O A;  4K5R A;  1CS4 B;  3FEZ A;  3R1L A;  3HJV A;  1UFK A;  5HQ8 A;  1SV5 B;  2AT1 B;  4GO5 X;  2R7U A;  5GAD U;  2FLP A;  1FWK A;  2JEG A;  3U1L A;  4PXC A;  1VQ6 S;  4OHW A;  4NXM F;  5HO4 A;  2B4U A;  2Y1J A;  4XK8 C;  3OXF A;  4DQS A;  4WBF A;  1SL0 A;  3G96 A;  1TKX B;  2ZH4 A;  5HVG A;  1IKV A;  3L95 X;  3TEG A;  1RT1 A;  3H4D A;  4C11 B;  1M1H A;  1RWK B;  3NOG A;  4NPO A;  3FQK A;  5DZ7 A;  2J6U A;  3O1L A;  2Y1I A;  4MK9 A;  2FJB B;  2V4Q A;  4Q7A A;  4IRC A;  1EQ0 A;  1DQA A;  4BWJ A;  3C46 A;  3OFF A;  2JJ4 D;  2AJQ A;  1BMQ B;  3WX8 A;  3FCV A;  5KFF A;  3MMB B;  4FS1 A;  2AQ4 A;  1KOH A;  1NHK L;  2RQM A;  2YQ1 A;  1OIA A;  1WHY A;  2D69 A;  1WF1 A;  2WSE C;  3NCP A;  3VAH A;  1IKW B;  1VC5 A;  3R2C J;  4KGZ B;  1TP7 A;  5KFS A;  2KM8 B;  5DM6 Q;  3JAM Y;  3OW2 R;  4KAI A;  1N34 F;  4IYQ A;  1KQF B;  4KGX B;  2V9W A;  1H6K X;  1K9M T;  4RW4 B;  1FCA A;  1S5Z A;  4OX9 J;  3DRX A;  3M4X A;  1IWG A;  2BOA A;  3R7S B;  3N6M A;  3TRG A;  5IM0 B;  3Q8P B;  1LWF B;  1L5U A;  4A8W A;  3MM5 A;  3NGD A;  2XLI A;  4J7C A;  1MWY A;  4QQB A;  2R7X A;  4F4Z A;  2QMX A;  1P1T A;  3LW5 C;  4PUO B;  2DKO B;  2E5L J;  3I4P A;  3HVA A;  4DV5 J;  3BQ1 A;  5FLX U;  3ZZ0 A;  3I9V 9;  5CYQ B;  5ETK A;  2V4R A;  3GYG A;  1W7W A;  4ZLP A;  2MYF A;  2DH8 A;  1N5Y B;  1ULR A;  3CDA A;  3M32 B;  1MG7 A;  4B9U A;  2H4W B;  1NRK A;  1SUQ A;  1QVG R;  2KZM A;  2BR0 A;  2OSR A;  3R8Y A;  3OJU A;  1ZOT A;  2GAH C;  2FLO A;  2NQP A;  4DS4 A;  4PXB A;  3DOL A;  4DCO B;  2RS8 A;  2FGO A;  5KFC A;  3KFW X;  3RRG A;  5B0B A;  4A4J A;  1Q86 T;  2Y8W A;  3B4D A;  1VK8 A;  2OTL S;  4P10 A;  4DL4 A;  3RU0 A;  3V6D B;  4QYZ K;  2PC6 A;  4WWS A;  2ZM6 F;  3I96 A;  1B4S A;  2IVM A;  3HSZ A;  3GMG A;  2GMJ A;  3C19 A;  1U0H B;  1U02 A;  4K4V A;  3A13 A;  2W9C B;  2AJ1 A;  4F0K A;  4IQM A;  1CJT B;  4BBY A;  4KHR A;  4EYI B;  1SCJ B;  3KLF A;  1TKD A;  1LW0 A;  3QJJ A;  3H25 A;  2VG6 B;  3KJV A;  2XY6 A;  3M9M B;  2C2M B;  1HKA A;  2F4V F;  4H4O A;  4NXN F;  1JKH A;  4B3R J;  3SDE A;  4JBC A;  4LRC A;  4QWA A;  4OHZ A;  3KK3 A;  5HP1 B;  3HCX A;  2LQJ A;  3N28 A;  1HR0 J;  3ZNU A;  1D9D A;  2HQ3 A;  3BEG B;  2CQD A;  2E1A A;  1FJE B;  4Z7Y A;  4LF9 F;  3G71 S;  3GCX P;  4NLS A;  3QWU A;  1HAR A;  2JC0 A;  3BYR A;  1U1Q A;  2OTJ S;  2UUA J;  2XLK A;  3M8Q A;  3MTJ A;  3SMZ A;  4DV0 F;  5F8M A;  4R0J A;  3LGN A;  2QL7 B;  4JI4 J;  3Q2S C;  4RR5 A;  4NA1 A;  2B9W A;  3PYD A;  4JYA F;  3R7N B;  4RW9 B;  2ZHB A;  4DV1 J;  2IM2 A;  3R1H A;  1URN A;  1UJ4 A;  3LP2 B;  3ENV A;  3QO9 B;  1M5O C;  3R5D A;  1KHW A;  3BZQ A;  2XNQ A;  5C24 A;  2R8I A;  4UY8 5;  4R5P B;  1QLN A;  4JI6 J;  1P9Q C;  3GR1 A;  5JVH Q;  1KTV A;  3M8W A;  5KFY A;  3GR0 A;  2EEY A;  1BLU A;  4C9D A;  4ILR A;  3VWS A;  3FKB A;  1RTI A;  2MQO A;  3VCD A;  3KLE A;  3HD1 A;  3FBE A;  2HHV A;  1WOO A;  2RUS A;  4ER8 A;  4DI6 A;  2FHJ A;  1NK9 A;  3I9Z A;  3H2U B;  4HR2 A;  1JX4 A;  2RQ4 A;  2HHT A;  1YWX A;  2ABY A;  2UVR A;  3CJ2 A;  4C6A A;  3EVW A;  5HAT A;  4QIF A;  4NZ0 A;  2CQG A;  4ETZ A;  3TUZ C;  5AXM A;  4RW6 A;  4DF4 A;  1LW2 A;  3SQG B;  1JLC A;  5C7P A;  1FWP A;  1EP4 A;  5D3G B;  4NE9 C;  2NCK L;  4DCP B;  2DNR A;  2OFG X;  3HF5 A;  3R5G A;  2LFV A;  2LDY A;  2R2U A;  2DHX A;  2DNG A;  1HPZ B;  4DQQ A;  2JWN A;  2HRY A;  2CNN B;  4ZOS A;  3CUN A;  1FX2 A;  4ZP8 A;  5I3P A;  3UN3 A;  5K14 B;  1W2B R;  1X4D A;  4ICL A;  4ANC A;  3ETM A;  3EDR B;  2V2Z A;  2BV3 A;  2VAS A;  3L7U A;  4F8R A;  4KE5 A;  5CQG A;  1SQE A;  2OEL A;  3ILI A;  1MMD A;  1SIZ A;  4Y6I A;  2BQU A;  3UN2 A;  1D9F A;  3EZO A;  1PCA A;  3C6U A;  2VQE J;  3MUT P;  3V4M A;  2BW2 A;  5KOW A;  5CAB A;  2XY5 A;  3IG1 A;  1Y5N B;  3NEK A;  1JLA B;  1AXQ A;  3HZG A;  1ROF A;  2KXF A;  3AQP A;  3TX0 A;  1URR A;  1AUD A;  2IJN A;  2F9D A;  3HFZ B;  4F36 A;  4NLT A;  4DL0 C;  2WON B;  2HHX A;  2EK6 A;  3B82 A;  5DG9 A;  3HFK A;  1EQM A;  1UJ5 A;  4LF1 A;  5F8H A;  1ZA1 B;  3NBP B;  1CJU B;  2WZ1 A;  3HI9 A;  4QIE A;  3AOC A;  3LOU A;  1JJ2 R;  1WAC A;  1QY7 A;  3KMQ A;  1HD1 A;  3AJD A;  4P7V A;  1WKL A;  2IY5 B;  3BR8 A;  4DPU A;  2QE5 A;  1JJH A;  4ZCM A;  2MPU A;  1S1U B;  4WZQ A;  3P45 B;  2M8D B;  2VG5 A;  3RB4 A;  4NLD A;  2IC3 A;  2MJU A;  4PXD A;  5L1L A;  1NK5 A;  2WW4 A;  3KJN B;  4Y2I A;  1MML A;  2DR5 A;  4LSL B;  3E8O A;  2W7A A;  3IR7 B;  1VCT A;  2W4P A;  2KT5 A;  4TN2 A;  4B9N A;  2KXN B;  5E33 A;  1X60 A;  4DV4 J;  4Q0B B;  3FMB A;  1PC4 A;  3FEY B;  4CO1 A;  3NLC A;  4RNO A;  1RHM B;  4Q44 A;  4ZPD A;  2JNJ A;  2KVQ E;  4EI2 A;  3GIR A;  4CCH A;  3W3S A;  3RBX A;  3FCH A;  3JAM U;  4DV6 J;  3MAQ A;  3RBZ A;  2CNK B;  1JLE A;  4UOF A;  4NCG B;  1NK0 A;  2ERR A;  4ELT A;  4AL6 A;  2O1P A;  4B9M A;  5KFX A;  4PPD A;  1XMQ F;  2WHO A;  3IN5 A;  3PX4 A;  4MJK A;  1Q0N A;  4NOH A;  4C7Q A;  2DNQ A;  2G2O A;  4FDF A;  2ALY B;  1I1G A;  1UW9 A;  4NL5 A;  3UN5 A;  1VMB A;  3OBI A;  2B4P A;  4PQA A;  1NND A;  3QZ8 A;  4OLP A;  2CKW A;  3ET6 A;  5AE2 A;  1U2F A;  4WP9 A;  4YR0 A;  2R4F A;  1IBL J;  3DM2 B;  2VZ9 A;  3K0J A;  3NGU A;  1S1X A;  2YKO A;  1OQ3 A;  3CJQ A;  5CYM A;  2M4M A;  3T19 A;  4BS2 A;  2CYY A;  3MAA A;  3J80 Y;  2N3L A;  1LNQ A;  4WIQ A;  2R7V A;  1IJE B;  4H4K C;  4WK1 A;  1RYR A;  1GFW B;  3CXC R;  1TR0 A;  1OSC A;  3W8P A;  1RAC B;  1WKK A;  3TAP A;  4IG0 B;  1U7L A;  2OPR B;  2YKP A;  2HZA A;  1TUW A;  2IA6 A;  4N8O A;  2KM8 C;  2EG2 A;  2RF2 B;  1KON A;  3W2W A;  1WEY A;  3J7Z 5;  4DL3 A;  3R6L B;  4MFB A;  1Z1Z A;  5KOX A;  4EBC A;  3VAI A;  3SZ2 A;  1S7H A;  1VQ5 S;  4O4R A;  4I7F A;  4EEY A;  4EO6 A;  2C2R A;  1M5K C;  3ELH A;  1TVR B;  1R43 A;  4YEA A;  4EO8 A;  3GG1 A;  3JB9 k;  1KVI A;  3CJ5 A;  4W92 B;  3N0V A;  1X4A A;  2LA6 A;  4JUZ A;  1CJV B;  3M1V A;  3UQS A;  3PYG A;  2GV1 A;  1HNV A;  2JLF A;  1Q53 A;  2XMK A;  1IWA A;  2F1F A;  4XAK A;  3G82 A;  1VQ4 S;  4K0K F;  2E29 A;  2R7T A;  5ETL A;  4NLU A;  4F50 A;  3VQT A;  1G6B A;  2JFK A;  2OAU A;  2HSE B;  4OZ1 A;  3H5U A;  3QLH A;  3V2U C;  2HQC A;  4B3O A;  1WHX A;  4EZ9 A;  5D8H B;  1T03 A;  1CUL A;  1N34 J;  1OPI A;  4QYZ J;  5ETM A;  2C3P A;  2DGT A;  1S6Q A;  4N76 A;  3E51 A;  2DR6 A;  3AA8 A;  4USI A;  3U27 A;  4F3M A;  3LP1 A;  1V6H A;  3KLH B;  5J2N B;  1R8C A;  2PO4 A;  2X3G A;  2DK2 A;  1J2V A;  4TQS A;  1QAX A;  1VQK S;  1H74 A;  2OFH X;  4R8U A;  2HVI A;  4DR4 F;  2RKI A;  2FC9 A;  5EX0 A;  4B3M F;  1XNR F;  5EN1 A;  3IRX A;  1MRO A;  2J7K A;  3RGI A;  4X66 F;  1LEO A;  1U24 A;  2IRY A;  1VQP S;  1JXE A;  2XWY A;  1FD8 A;  1TL3 B;  4I69 A;  2NLW A;  2V67 A;  5BXI A;  1IQZ A;  2YNI A;  2JEI A;  1K0T A;  1B99 A;  4J9O A;  3DLG A;  2FJA B;  5J1E A;  1GXT A;  2LEA A;  5ETQ A;  2HFV A;  2H4Y B;  1QUP A;  2IM0 A;  3K5P A;  3P5T L;  1V3S A;  3W61 A;  1RAG B;  3M6U A;  3C6T B;  1N32 F;  5J2Q B;  2HHH J;  4OZ0 A;  2AEF A;  5THW A;  1S6O A;  3BJY A;  1HNI A;  2LXI A;  1XMO F;  4IFY A;  2Z2Y B;  2QLF B;  4YN3 B;  3DXS X;  5I3U A;  2B3T B;  1NK6 A;  1U6Z A;  1NDC A;  5EWF A;  1WD6 A;  4F4X A;  4DMZ A;  1IBK F;  2P9G A;  3QRP A;  3SCI E;  5KFM A;  4G1I A;  2EC0 A;  1FRK A;  4LSZ B;  3R7B B;  2OML A;  4HKQ A;  3S01 A;  2GW8 A;  2F4V J;  1DJ0 A;  4NXN J;  1NH8 A;  2BE7 D;  3I6P A;  2DJW A;  1RT5 B;  4WP3 A;  1OQ6 A;  4LF4 F;  1KFS A;  4KO0 B;  2W25 A;  2ZBI A;  3CDB A;  3BF4 A;  1FO1 A;  5A8W A;  2E1R A;  1B7F A;  4PQU A;  4LF9 J;  4WU2 A;  2W9B A;  4FF1 A;  4OQJ A;  1O0P A;  2AIR B;  4IFV B;  4JV1 A;  2DR9 A;  3FSI A;  4DFJ A;  5F0W A;  5HMZ A;  3D3B J;  2MHE A;  1HWJ A;  4TY8 B;  2UU9 F;  3I0R A;  1S99 A;  3IFE A;  3M8P B;  3Q8Y A;  1FE0 A;  2ATL A;  2CPJ A;  2V9K A;  3KDO A;  2HHS A;  1F9E B;  3DGP B;  2AD9 A;  4JYA J;  4QOT A;  2G1D A;  2B7C B;  2O66 A;  3ZXW A;  2DNH A;  2YQ0 A;  2MQN A;  2MQ8 A;  4M95 A;  3MMA B;  3CDE A;  4MKA A;  3MOJ B;  2BKO A;  1S12 A;  5M2P A;  1B0V A;  3CDU A;  1MWQ A;  5GAE I;  5L9X A;  1C2P A;  3A1Y G;  3K59 A;  4KV8 A;  2HK2 A;  1HBN B;  2HNZ A;  1IM4 A;  3A3O B;  1HBM B;  4LRF A;  4UF4 A;  3D6M B;  2R2S A;  4RL1 A;  2UZA A;  2BYC A;  2BUN A;  4MIA A;  1SC4 B;  3FC9 A;  4DPW A;  2VJV A;  1JNZ B;  3IGN A;  3O3L A;  2YKN A;  1I3O B;  1HL6 A;  2B7B B;  2Y1R I;  3H20 A;  2WVB A;  3JSB A;  4DLE A;  2DY9 A;  1GMW A;  5ADZ A;  1AZS B;  1R6Y A;  1Q1K A;  3VF0 B;  4WXO A;  3PV8 A;  2AGO A;  4JI8 F;  1NME B;  1HLW A;  2D9P A;  3N01 A;  3ZTR A;  1J5E J;  1UA1 A;  4O44 A;  5HMX A;  2HBY B;  1F3V A;  1RLC L;  2HHP A;  2I9S A;  2UUB F;  2FZC B;  2ZOM A;  1Q5V A;  2BKN A;  1RTH A;  1FKO B;  3TJA A;  7FDR A;  1IKV B;  5LXY A;  1Y5I B;  1YQH A;  2D7S A;  4XPE A;  1CQN A;  3VGS A;  1UVL A;  2IBK A;  3VGV A;  3W60 A;  1S1T A;  2IJF A;  4OL8 A;  2OEJ A;  4U9R A;  4X62 F;  3MR3 A;  2FHM A;  3CIZ A;  5J1N A;  2MLX A;  3H5X A;  2ZH3 A;  4DUY J;  5HLF A;  2PGC A;  4DHV A;  2CXE A;  1SC1 B;  5ETR A;  3EGZ A;  2JH3 A;  1ZM2 A;  4M5G A;  4WYL A;  1QAY A;  1S1W A;  4UOG A;  4DFP A;  1JXV A;  2LEC A;  2C1E B;  1D1U A;  1M5P C;  4KH0 B;  1J5O A;  4LF8 J;  4FPI A;  1RGV A;  2V94 A;  1F5A A;  2GX8 A;  4DFM A;  2XG8 A;  1JK9 B;  1JJ4 A;  1YVF A;  4TXS A;  3PXG a;  2I5J A;  4J9N A;  1Z2L A;  4OYP A;  1D0E A;  5M2R A;  5HBM B;  4LRD A;  2R7W A;  3TVZ A;  5GAH U;  2CWX A;  3PAC A;  3J80 U;  3CJ0 A;  3MM5 B;  2XS5 A;  2HG4 A;  3SCK E;  5K8N A;  5IT9 U;  4JI1 F;  5F8J A;  2C2Z B;  3T1H F;  3P3D A;  4CLK A;  3K5N A;  5HQM A;  4DX7 A;  2L3M A;  3KLG A;  1D9A A;  2WOM A;  4LF7 F;  2W4D A;  5A0Y A;  2OO4 A;  5M2U A;  4OYX A;  4P71 A;  3AQO A;  5L39 A;  4MTP A;  2WVE A;  2DIU A;  2OUG A;  3MPV A;  1KFD A;  5F41 A;  4CO0 A;  3UPF A;  3QYY A;  4YR3 A;  4FNI A;  2ADC A;  3AD8 C;  4YUD A;  2AP6 A;  4UZB A;  2CJQ A;  2OH2 A;  1X0F A;  3DOL B;  1YRT A;  4C8K A;  3LGH A;  5U47 A;  4TVA B;  4WFN Q;  1Z4U A;  2DTJ A;  3MHY A;  3X1L B;  2ZDO A;  3H90 A;  3MEE A;  2D1C A;  3KKF A;  2DYA A;  1GXU A;  4TKT A;  4LQ9 A;  4KYZ A;  5GAG I;  2XQC A;  3OR2 A;  4PXE A;  2GA7 A;  5HMY A;  4USV A;  1YX2 A;  4AXJ A;  1N5Q A;  1PKU A;  5LSL A;  4P74 A;  4FYD A;  1HWU A;  2UVV A;  5HK4 A;  1PYS B;  3IS9 B;  2XZD B;  3KLF B;  1LW0 B;  1B64 A;  4PEO A;  3HVT A;  4I6Y A;  3KJV B;  4DV7 F;  4Q5V A;  4Y28 C;  2PEB A;  3Q22 A;  1S9G A;  1DLO A;  2GCF A;  4IH6 A;  2VV5 A;  1FFS B;  1DTT B;  2HFO A;  1U1M A;  4D3G A;  4H4O B;  4ZPV R;  3VAL A;  2G2Y A;  2L41 A;  2DGW A;  3I55 S;  4CH0 S;  2WBR A;  2E5G A;  4I2P B;  2GMH A;  4S0M A;  3VV2 B;  1FKA F;  1TFY A;  4Y0F A;  4QU7 A;  4RW7 B;  1OY6 A;  2R7O A;  4GKK J;  3ILL A;  5MLC V;  2QG9 B;  4LRB A;  2IVY A;  3W63 A;  1QSY A;  2R7S A;  2Q6C A;  3C3L A;  2EW9 A;  4PYA A;  1FHT A;  2YH0 A;  4O0I A;  3M8Q B;  1QTM A;  1TKX A;  2G0I A;  2UV8 G;  5MAO A;  4FYX B;  3LWL A;  5D4N A;  4DUZ F;  3TZX A;  4ECT A;  2XSF A;  4DZ6 A;  4BDP A;  3TX8 A;  4QCL A;  5L38 A;  2FLL A;  2QYC A;  3WBZ A;  1U4B A;  1T7P A;  2QRR A;  4KJI A;  1C0U A;  2VOO A;  4CLZ A;  1KC8 T;  3GJS B;  2EK1 A;  3N6L A;  3KG4 A;  2ZBQ A;  1OS5 A;  1U1R A;  2ACM A;  2GJ2 A;  3RZA A;  4FXW A;  2HHW A;  3H2L A;  4H4K A;  3HVW A;  4EBE A;  1FDB A;  1N8R T;  4W90 B;  3TVK A;  1X8D A;  4PAA A;  2MZQ A;  1LXJ A;  5LT5 A;  3QWP A;  3UE2 A;  1HI8 A;  2ZH5 A;  1RTI B;  3U02 A;  3D1H A;  2RRA A;  4JI2 F;  3KLE B;  3HJF A;  3HP6 A;  2XMJ A;  3CME S;  3DLH A;  3PNI A;  1G4C A;  4K4Y A;  1IR2 A;  4YR2 A;  4OZL A;  1LWF A;  4ZIV A;  5D4O A;  3ZNJ 1;  4PG8 A;  1XN9 A;  3BPS P;  1T9V A;  4K0K J;  4BLG A;  2ZZM A;  1K73 T;  3OD2 A;  2YWG A;  4DEZ A;  3JSR A;  4OI3 A;  3QRR A;  4ZPC A;  1CC7 A;  4KSE B;  3ZFV A;  1FES A;  2XYH B;  1M90 T;  1VS3 A;  4J5O A;  3CCT A;  4RW6 B;  3QT8 A;  2W2Q P;  5CYQ A;  2AJ0 A;  1SL1 A;  1RE1 B;  1Y00 A;  2YH1 A;  3M2R A;  3OTC A;  1A9N B;  2VBX A;  2CJX B;  1EP4 B;  3BM7 A;  3M32 A;  2MQP A;  2XI3 A;  5HJY A;  1MLA A;  4F4Y A;  5JUM A;  2YX7 A;  3ZC4 A;  3Q24 A;  2HVH A;  1S0N A;  1H7X A;  1YHQ S;  1HW9 A;  3GB0 A;  5E41 A;  3KLV A;  1RKI A;  2J7U A;  1RCX B;  1FRM A;  2RQC A;  4F3O A;  1KLN A;  4CH7 A;  3F0N A;  4DR4 J;  1SJ3 P;  4FBT A;  2ZHA A;  4UW2 A;  3EMT A;  3I82 A;  5HAN A;  1VDH A;  3BQ0 A;  2J0W A;  3AB4 B;  2B5J A;  4ICL B;  1X5S A;  1RWX B;  4O3N A;  2VC0 A;  4X66 J;  3MI7 X;  2PFF B;  3HHL B;  4WK3 A;  5FD1 A;  3BO4 A;  2JZ5 A;  2XI2 A;  4ECV A;  3GIJ A;  1VRT A;  2AKW B;  5D4L A;  4YY3 J;  1NJW A;  1CJT A;  2DR7 A;  1Q82 T;  4C8Z A;  3RBD A;  2IM1 A;  2WAQ D;  3LQV A;  2F5G A;  3HKW A;  4DSL A;  5F8G A;  2VA2 A;  3BN4 A;  3PO5 A;  4C0H A;  3NKY A;  4ED0 A;  1NK4 A;  3OLB A;  4FF2 A;  1RB0 A;  3ZZU A;  1RAO A;  2ZFH A;  4DJB A;  2W2N P;  1N32 J;  2R7Q A;  5B0A A;  3ADA C;  3UO0 A;  1WDD A;  3C14 A;  3D0H E;  2G0J A;  4YQW A;  4F4W A;  1G2E A;  1SBR A;  1UP1 A;  2DGQ A;  3D6T B;  2DHA A;  2H5I B;  4GMK A;  5EX3 A;  4J91 A;  1A7G E;  3RR7 A;  5KG4 A;  4K4U A;  2N4C A;  5A76 A;  4JP8 A;  2VG5 B;  1MU2 B;  2IC3 B;  2H5J B;  1OWX A;  3AHP A;  3NCQ A;  3MPU B;  2FQQ B;  5KFA A;  1U1L A;  3HMJ G;  5D0R A;  4WKY A;  1GX5 A;  4GVL A;  3ZZT A;  1RZM A;  3ZZO A;  1PG5 B;  2FVR A;  2J9C A;  4N5S A;  1L3S A;  1T05 B;  4LF4 J;  4DR6 F;  4J9M A;  3NXZ A;  5KFJ A;  1KSP A;  3PW0 A;  2FGC A;  5E3P A;  3RB6 A;  3LP2 A;  1CQM A;  4FF3 A;  5A8K B;  4IDK A;  4RUH A;  2PDA A;  4R5P A;  4U6P A;  4JV5 F;  4C97 A;  1Y3K A;  4RWX A;  4ES2 A;  2DT9 A;  2HYI B;  4ZVS B;  2VD3 A;  3QGP A;  1N5V A;  2J8S A;  1S9F A;  2ZUA A;  3FQL A;  1M5S A;  4L75 A;  2PD1 A;  4FXV A;  4QIG A;  5KT5 A;  3QGG A;  3G6X A;  2H48 B;  3BYP A;  5CA5 A;  5AXK A;  2RQK A;  4KHM A;  2M5Y A;  2LCW A;  3ET6 B;  1VOM A;  2MKC A;  2B51 A;  5B09 A;  4OHV A;  2QFJ A;  2HRT A;  1S1X B;  2KYX A;  2R3V A;  5IV3 A;  3HD2 A;  3IM8 A;  3BSA A;  3OT9 A;  4KC5 A;  3MAA B;  3ENA A;  4DDF A;  4FBU A;  3EGN A;  4TYA A;  1WOS A;  2DNO A;  4LFB F;  4HTJ A;  2I0X A;  5DRK A;  5D3G A;  5H1S V;  1YTY A;  1BQM A;  4X84 A;  1U47 A;  3RB0 A;  3G8Q A;  4U8Y A;  2IYI A;  2GVZ A;  5IC6 B;  5LMU F;  5KFO A;  5E0O A;  1K0V A;  2AGQ A;  1F9H A;  1HPZ A;  5KFK A;  4DR3 F;  3DLB A;  4FF4 A;  4IR9 A;  3N4W A;  2DH9 A;  4KFB A;  2APO A;  4DV3 F;  3M6V A;  5L46 A;  2WSF C;  5BR8 F;  4F2R A;  1CPZ A;  5K14 A;  2XSJ A;  3A8J A;  4I7F B;  3S1T A;  3K5O A;  4NX9 A;  2IMW P;  4KY3 A;  4CLL A;  1IUJ A;  2QO3 A;  1VR6 A;  4GC6 A;  1AFI A;  1E6Y A;  1KNZ A;  3CF5 Q;  2AJ2 A;  3M1V B;  2E5H A;  1HNV B;  2AYB A;  3G82 B;  4DFK A;  3TO8 A;  2VUG A;  4UZC A;  1IKY A;  2W9A A;  2EBE A;  4G3I A;  3GFY A;  1R89 A;  2MHN A;  3G6V A;  2DGU A;  3OFG A;  2IDE A;  2HIQ A;  3KHL A;  1MMN A;  3E01 B;  4B3O B;  4C8Y A;  2GHW A;  2HFS A;  1T03 B;  4K4W A;  3OVA A;  3CO0 P;  1ACM B;  1TK5 A;  3VQS A;  3IC1 A;  1HBO B;  1XJW B;  3AJ1 A;  3QQC D;  3LP1 B;  3QID A;  1S79 A;  2W1B A;  3TJ9 A;  1H7W A;  4DPX A;  1TAU A;  2JDJ A;  3T1H J;  3MTK A;  1S1U A;  4NLQ A;  4V19 J;  3OL8 A;  2WCX A;  4DU7 A;  2XMW A;  1RHU B;  4R8U B;  1S1V A;  3UW1 A;  1RWP B;  3KLI A;  3P49 B;  1RTJ B;  4LSL A;  2UVW A;  2HWI A;  2XCA A;  2MY8 A;  3IRX B;  2CPI A;  3NWR A;  5E3C A;  4NEZ A;  3G4S S;  1RK8 A;  4D3H A;  2BW7 A;  2YNG A;  3BRE A;  1NPP A;  4ANE A;  3DU6 A;  2XS7 A;  1RAA B;  2DNZ A;  2K7J A;  3NOC A;  3O5T B;  4NLR A;  1UVM A;  2YPY A;  4DSE A;  3FZB A;  2C2D A;  3V4I B;  4CH1 A;  5IT4 A;  2VFS A;  2YNI B;  5KFH A;  4NCG A;  3PVX A;  5D78 A;  1X9M A;  1FEH A;  5J1E B;  2F9J A;  4ECW A;  4MYU A;  2EVZ A;  2HAF A;  1X31 C;  3RB3 A;  1JLG A;  2RE1 A;  3I32 A;  2RHQ B;  1DAX A;  3NS6 A;  2R2R A;  2EXU A;  1HNI B;  4X4T A;  2OJ3 A;  2JEF A;  4LFC F;  3M2U A;  8RUC A;  1GEH A;  3T5L A;  5G0R B;  5I3U B;  2W01 A;  2ZKT A;  1UFW A;  1KVK A;  2YX4 A;  2HNY B;  1L3U A;  4UTG A;  1IBM F;  4UQT A;  2IMO A;  5BJR A;  3H40 A;  4RBV A;  1VI7 A;  2ZH2 A;  2V68 A;  3W64 A;  4DV7 J;  3PW4 A;  3SI8 A;  3W2V B;  2M70 A;  1OYD A;  2CJY B;  2CNO B;  3KK2 A;  1BHN A;  2VQF F;  3KNG A;  1H2T Z;  3EJM A;  3W5Z A;  1UVN A;  5J1P A;  5A6P A;  1LQ9 A;  5EGY A;  4A8F A;  3TEH B;  2ASY A;  2QL9 B;  5FLX Y;  4IG0 A;  4JI5 F;  2OPR A;  2YXL A;  2HHQ A;  3UCZ P;  1V5V A;  2WW8 A;  3PW7 A;  4TLQ A;  4O3Q A;  3UD4 P;  4MKB A;  4P2M A;  2RU9 A;  2K2P A;  1SKW A;  5C5J A;  3DN9 A;  2RF2 A;  2W9B B;  1TL7 A;  1O51 A;  1G3O A;  1PJ5 A;  4DSI A;  4DR2 J;  4ZIW A;  1HWK A;  4ECZ A;  4X4S A;  5KFT A;  1S97 A;  1F0X A;  3DNC A;  4DUZ J;  2IVF B;  1L3K A;  3MXH P;  3A3N B;  1CC8 A;  3PJW A;  1VFJ A;  1N48 A;  3F44 A;  2VPW B;  2W2P P;  4PG7 A;  1LWE B;  1TUG B;  3LUY A;  2FC8 A;  2V63 A;  2AYG A;  1HHQ A;  1TTH B;  2ZH7 A;  3OL7 A;  1NJY A;  3PIP Q;  2YNH B;  2G2Z A;  3GJR B;  2UXC J;  2Y0B B;  3QSI A;  1Y0H A;  3IMQ J;  2XWX A;  3JSY A;  4IUF A;  1RBA A;  4OHY A;  1KQS R;  4YFU A;  3PW5 A;  1YRU A;  3D9B A;  2CDR B;  2CZ4 A;  3MED B;  1S77 D;  1VQY A;  1VIO A;  4JI2 J;  1S10 A;  1H3D A;  1WTF A;  3F73 A;  3L4B C;  1XER A;  2KG0 A;  2MSS A;  5DQI A;  4IOA Q;  2M7S A;  5FDL A;  1T0T V;  1S0M A;  3PFE A;  2XMU A;  4ECS A;  1RTD B;  2FY8 A;  4PG4 A;  1XNQ F;  3FZ2 A;  4DN9 A;  4DR7 J;  4ED1 A;  3GCW P;  3H7H B;  4A8X A;  4DL5 A;  4CO5 A;  1TL4 A;  1I6J A;  2P9C A;  3FEX B;  3QT6 A;  2RS2 A;  4CI0 B;  3HHL C;  4O44 B;  3CCV S;  1VLO A;  5KG7 A;  4YHH F;  2FJX A;  2BQR A;  2C3O A;  3IBW A;  3NGR A;  3KWM A;  5DLG A;  3CCS S;  1GMU A;  2KRR A;  3DLE B;  2P2C B;  1REV B;  1S7I A;  2W4C A;  2DGX A;  1ZS6 A;  1XR6 A;  4ZVG A;  3DRY A;  3TAQ A;  4TLR A;  5J2M A;  4QIV A;  1DHM A;  1S1T B;  1O5J A;  1Q7L B;  4Z37 A;  3TYT A;  3TUJ C;  4LFA F;  5IFM A;  3CJ4 A;  2FJD B;  5HLF B;  1T9T A;  4W4M A;  2CZ9 A;  3EE3 A;  4DL2 A;  2ALZ A;  4HHJ A;  2XY7 A;  1Q95 G;  3PTW A;  5F9N A;  3R5J B;  4C98 A;  1S1W B;  1HQU B;  1SQF A;  1FJG F;  5KTQ A;  1IVZ A;  2ZE2 A;  4WYW A;  2HMI A;  1HNZ J;  5LMN J;  1GNK A;  3BV8 A;  3CJ3 A;  3M30 A;  2ZWP A;  4X4V A;  4CLT A;  3CCR S;  4QYR A;  2IAJ B;  5ETN A;  4QW8 A;  2IYG A;  3DDK A;  3BKF A;  3MUV P;  1S6U A;  2I5J B;  1D3W A;  1T9Y A;  4J90 A;  1P8G A;  1W25 A;  2WBM A;  4Y2A A;  4PAB A;  5C2C A;  4PPZ A;  2FHK A;  3R5B A;  3CCQ S;  3EX7 B;  2HWT A;  3MAH A;  2MLY A;  3R2D J;  4JI0 F;  2JVR A;  3S6E A;  1M1G A;  3KLG B;  4FKX A;  5A0Y B;  1SC3 B;  2FZK B;  3UR0 A;  3QAT A;  4ZA1 A;  3H8Y A;  4CDI A;  3CNQ P;  4ZVF A;  1UZH A;  1N36 F;  4P9S A;  1BWV A;  2M2B A;  5B0G A;  1R0A A;  3KG0 A;  5HN0 A;  2B8P A;  3T1A A;  3RJM B;  1HI1 A;  5KFQ A;  2QMU B;  3MM8 B;  3RG6 A;  2A2D A;  5HVH A;  3WHI A;  3NGS A;  3QT7 A;  3WC0 A;  5LSR A;  1NZA A;  4IO1 A;  2XGQ A;  1IBC B;  3M8Z A;  2V8P A;  3EPG A;  2CZV C;  1K1Q A;  2DXD A;  4M1K A;  5F0U A;  2AEM A;  2AWZ A;  4NAS A;  3OUY B;  2HVD A;  4DR6 J;  2E7V A;  3SSR A;  2H3E B;  4PG5 A;  2YKM A;  4YB7 A;  5LOQ A;  5FJ4 A;  2YBV A;  2HS4 A;  2YWE A;  1RWV B;  3SEO A;  3BGO P;  4WF9 Q;  1HBN A;  1SH3 A;  3HVT B;  2JC1 A;  3T1Y F;  4JV5 J;  1UEK A;  1RAD B;  5B0F A;  4ED2 A;  1H2V Z;  2ZH9 A;  1WUU A;  2FD2 A;  4C0B A;  1WI8 A;  2MQM A;  5IOL A;  1IM6 A;  4H4M A;  2QZ8 A;  1VQO S;  3CCM S;  4OYM A;  4OZJ A;  1VBK A;  2ZZT A;  3BKU A;  3M05 A;  4NMX A;  3IAM 9;  1AZS A;  5KT6 A;  1DZ5 A;  1UET A;  2VFT A;  5GMK a;  1PYT A;  4E0D A;  1FI4 A;  1A0O B;  4PWD B;  5LM7 E;  3TZZ A;  3BDP A;  2ZNZ A;  3MPW A;  4GC7 A;  1AT1 B;  1RAJ A;  1FDN A;  1H38 A;  3SCJ E;  3LAM A;  2YX1 A;  1Q81 T;  2B4O A;  2RB7 A;  5GVQ A;  1I94 F;  1FKO A;  1X4F A;  2HBZ B;  3KUH A;  3EXC X;  1RA6 A;  3MEC A;  1HMV B;  4LFB J;  1S4F A;  1ICE B;  4ELV A;  4YB1 P;  3T3F A;  3P5B P;  3DLK B;  2CQ1 A;  1C0U B;  2HUR A;  1TMJ A;  3N6N A;  3J7Y I;  1NKE A;  1JJC B;  3GYN A;  4Y3C A;  3OL6 A;  2BEF A;  3DRP A;  3PRV A;  1T3N A;  5LMU J;  1QTN B;  2NS1 B;  2QA1 A;  4LVO P;  1ZET A;  3WDO A;  3EGV A;  1T02 A;  2CPH A;  4DR3 J;  5E2Q A;  5AXL A;  2U1A A;  2BKP A;  4DV3 J;  3TZY A;  4I4B A;  4DPY A;  3B8H A;  3BGF A;  5BR8 J;  2JFD A;  4A8M P;  2HIY A;  5DM7 Q;  3VAK A;  1EET B;  3QAU A;  2ILZ A;  2COL A;  2IA0 A;  4HEA 9;  2CAJ A;  2PEH A;  5HBM A;  3SIP B;  1I51 B;  3V6J A;  3ISZ A;  1YBA A;  3SCL E;  2Z57 B;  1PAU B;  2XHC A;  2JEJ A;  3A8K A;  2C28 A;  1FXL A;  2HND B;  5LJ3 Y;  2ASD A;  1SL2 A;  1CVJ A;  3P8B B;  2OPQ A;  2BAN A;  4ED5 A;  1WF2 A;  5IZH A;  4DR5 F;  2B0G A;  2FHJ D;  2V4J B;  1DUR A;  1T8E A;  2C2E A;  2Q79 A;  2CPF A;  1FE4 A;  4G1Q A;  2XLJ A;  4YP3 A;  1QM9 A;  1U09 A;  4NLX A;  5KG0 A;  3M2R B;  3POT A;  3C66 A;  2I1R A;  1OJ4 A;  2V2K A;  2J8A A;  3H42 A;  3N5F A;  1S9E B;  3KJQ B;  3NAH A;  3ICL A;  3N9U C;  1N6Q B;  4DWI A;  2ZD1 B;  1TQL A;  2QLW A;  5ETO A;  4A47 A;  3KHG A;  4OX7 A;  6AT1 B;  2C22 A;  1VC0 A;  2MEW A;  2BJ8 A;  3B78 A;  2HLT A;  2XMM A;  2HQD A;  4QWE A;  1SPB P;  3DGV A;  1RWN B;  3M6X A;  3ULH A;  2F7V A;  2B5J B;  1ELO A;  4K4S A;  2F40 A;  3VR1 A;  2ASJ A;  2IFX A;  1FA0 A;  1UJ6 A;  5JMN A;  1VRT B;  3GIK A;  4UUX A;  1FXR A;  4WKR A;  2PN6 A;  3Q8V A;  1JNR B;  1M0S A;  1RIS A;  1O6X A;  2KFY A;  1RXO B;  3IS9 A;  3HHL D;  4F4K A;  2VDI A;  1ZPV A;  3PR4 A;  4C4W A;  1VK3 A;  2UXD J;  3IWL A;  2X1F A;  5H9F K;  1H2U X;  1YJW S;  5E3R A;  4M94 A;  3OXL A;  4QWB A;  1DTT A;  1UAW A;  1KBR A;  4J9R A;  3CW2 C;  2AZ3 A;  2ZUG A;  1RTZ A;  1U1N A;  2YNF A;  1FRH A;  4ZPW R;  4I2P A;  3OTD A;  4HAC A;  1RT2 A;  4MT1 A;  3GSD A;  3D5M A;  4ZK7 M;  3C14 B;  4RW7 A;  5DJB A;  2E5I A;  2DGO A;  2EWH A;  4AQY F;  1RWM B;  3MPY A;  3RAX A;  1WDT A;  3GWC A;  4TU9 A;  1N88 A;  2XO6 A;  1IBM J;  2J6S A;  1HD0 A;  1NPR A;  1UWB B;  3NY0 A;  4EUV A;  5DG7 A;  2VQF J;  4WP8 A;  4ALZ A;  5DET A;  3C2P A;  4RNN A;  3VTI A;  3BGR A;  3PHT A;  4X4U A;  4HH1 A;  2LU2 A;  4E8U A;  3HSG A;  1FT8 A;  2NXE A;  3A3P B;  4IDK B;  4YB6 A;  2YPZ A;  3ZZY A;  4F4A A;  3FBC A;  2HBQ B;  3PKM A;  4A48 A;  4EZ6 A;  3W65 A;  4HHU A;  3CCL S;  2HAI A;  1VQL S;  4ES1 A;  4Y2C A;  2R42 A;  1H0H B;  5E7O B;  4A8O A;  1HNW F;  4OX9 F;  2IRX A;  1W26 A;  4WTO B;  2IPO B;  1ZM3 A;  2AU0 A;  1YGY A;  4URS A;  2MZ1 A;  1WC4 A;  4RU2 A;  1YDL A;  1UVI A;  5GAE U;  5I42 B;  2GIF A;  3CJK B;  3W9I A;  1PGZ A;  2E5L F;  1X4B A;  1GH8 A;  5ITH A;  3EPI A;  2CJK A;  2E7X A;  3QT5 A;  3UDV A;  2N82 B;  4WFB Q;  5L1K A;  3AD7 C;  5JVG Q;  1RAI B;  3A8I A;  4HT7 A;  3BKT A;  3LWM A;  3GFZ A;  1ZTW A;  1C1B B;  2HZC A;  4F25 A;  3KUE A;  4GVB A;  1R6V A;  4KGV B;  3CD6 S;  1WI6 A;  4L74 A;  4XIU A;  1R0C B;  1RSC A;  4C3K A;  1BQM B;  2MLZ A;  2M8H A;  4I67 A;  1QSS A;  2GVZ B;  2WTF A;  1XNQ J;  4E98 A;  2QC3 A;  1F2H A;  2FYX A;  5DZ6 A;  1ZTT A;  3LAK A;  2OD4 A;  4NI2 A;  5HVF A;  3TQ1 A;  2MZS A;  4B17 A;  4C0O C;  4YHH J;  2BXJ A;  5DGA A;  4V19 X;  2BA9 A;  2WB1 D;  4KFB B;  2O67 A;  4ETX A;  4HYK A;  1N54 B;  2HQF A;  1VGY A;  5RUB A;  3K89 A;  3GQC A;  4HI1 A;  2VC1 A;  3I31 A;  3EZU A;  1TFW A;  2XSJ B;  1RJJ A;  3TI0 A;  1Y10 A;  3G2X A;  1NH7 A;  2CPD A;  2CPX A;  2J6T A;  1P6T A;  3HHL A;  4M5I A;  2O3D A;  2J76 E;  3R3T A;  2MB0 B;  1E6Y B;  5F3T A;  3OTE A;  4LFA J;  1ZYQ A;  4O4G B;  2RD5 C;  4TYB A;  2CVI A;  5C25 A;  3LPE A;  4HHH A;  3OHA A;  3K5L A;  3VAG A;  2EFO A;  1IKY B;  1NSA A;  4RU9 A;  3OQ2 A;  2NZ4 A;  2HW3 A;  1FJG J;  2XTJ P;  2BE2 B;  4JI7 J;  3NS7 B;  2F8E X;  1IKX B;  2XHW A;  4RBT A;  3D67 A;  3EGW B;  3O6Q A;  3J7A N;  2JX2 A;  3V6K A;  2EBG A;  1YJR A;  2MKH A;  4QBU A;  3W1Y C;  4DR1 F;  3UI3 A;  1CJK A;  2VBY A;  4I6W A;  3MM9 B;  4C8L A;  2VA3 A;  4X65 J;  4XTT A;  3FBF A;  3VZI A;  3TQE A;  4FXD A;  3THV A;  1RBL A;  2M0G B;  2UUA F;  3C16 A;  3FSX A;  1Q8K A;  2MST A;  3GTY X;  1HHS A;  2ZBC A;  2CFX A;  1R8H A;  1SJ4 P;  2J5A A;  2P8I A;  4OMF G;  4NLW A;  4KPC A;  4JI4 F;  1MU2 A;  2QFI A;  2VG7 A;  1S1V B;  4KHP F;  3KLI B;  4OZN A;  1EHW A;  2E7W A;  2HHU A;  1HIY A;  4NYZ A;  3Q23 A;  3P96 A;  3FFI B;  4PG6 A;  2P6T A;  3CCW A;  4DV1 F;  3PKY A;  2HQG A;  2KG1 A;  4DU8 A;  2JLE A;  2XUL A;  1T05 A;  2Y8Y A;  2YNG B;  1KD1 T;  2FUG 9;  1F60 B;  3FUY A;  5KT4 A;  3LGM A;  2Q3P A;  4LT6 A;  2OPS A;  2RDD A;  3WZ0 A;  4JI6 F;  4M5J A;  4OHX A;  2HGN A;  2V0N A;  1AYE A;  4AUK A;  5F8N A;  2DHH A;  3QFH A;  3OFE A;  5A8K A;  2CQB A;  2B56 A;  2WVD A;  2YWK A;  4KBI A;  2MKY A;  3MEG A;  2LP4 A;  4QR2 A;  3FGV A;  5GAG U;  4P2X A;  4JB8 B;  3JQJ A;  2HPU A;  2VPX B;  1N56 A;  2QV6 A;  4NZ6 A;  3CJR A;  3T41 A;  1JLG B;  1P9Y A;  4LJM A;  1WG5 A;  2AMC B;  2DIT A;  2U2F A;  3JS9 A;  2HLU A;  1NZ8 A;  3K8W A;  1WTB A;  3VGU A;  4EBD A;  2BM1 A;  2EFG A;  5DDP C;  3PW2 A;  1Q78 A;  4A8Q A;  2B9X A;  3M2U B;  1SKR A;  1Z2Z A;  2ZH6 A;  1PSD A;  2LU1 A;  3BH7 B;  1N0V C;  2VF3 A;  3D4J A;  2K06 A;  3GFH A;  4RLE A;  4P75 A;  2Q1L A;  2A2C A;  3T1Y J;  4FN5 A;  3PYF A;  3KK2 B;  5IT9 Y;  1TV6 B;  2EFQ A;  2AF6 A;  2LLZ A;  4J9V A;  1NDK A;  1R8A A;  3AXK A;  4DX6 A;  5T7L A;  4B9T A;  4I56 A;  3LAN A;  3KNA A;  4I0W A;  5HL7 Q;  2PMZ D;  1V3Z A;  1UPM B;  2LQ9 A;  2XGP A;  2DB1 A;  2GGP A;  5DQH A;  4J9U E;  2BJ3 A;  2ZBP A;  1KKH A;  4NXM J;  1TEL A;  2JRS A;  3QIP A;  2I38 A;  4DZD A;  3MZI A;  1BY9 A;  2KN4 A;  1TL7 B;  2YY3 A;  3MFH A;  2RAQ A;  1RP5 A;  1U8W A;  4EWT A;  1Y4Z B;  3ENQ A;  4FYW B;  1I94 J;  1J27 A;  2KJW A;  3D0I E;  5A2Q U;  1TU0 B;  3D7S B;  3D1O A;  2UUC F;  1WSV A;  3BBF A;  4PCQ A;  2VQE F;  2NPI A;  2OKQ A;  2WRM A;  1KWM A;  2HEK A;  5CHC B;  4LQ3 A;  4B3S F;  4J9K A;  2EPI A;  1RBO B;  2DNP A;  3W66 A;  4ED8 A;  4LF5 F;  3W9J A;  1TKZ A;  2BMB A;  4UOC A;  2ZEJ A;  3U7J A;  1X5P A;  3SQO P;  3E01 A;  5EHH A;  3R5A A;  3CC7 S;  5C2G A;  3PX6 A;  2RNE A;  3EZ5 A;  4Z7C A;  1DRZ A;  5KFI A;  2DO4 A;  1FFG B;  2FB0 A;  1RQ0 A;  4I1T A;  4OYI A;  2R7R A;  5FDL B;  1HBO A;  2CPZ A;  2BE9 B;  3GII A;  3TVY A;  1JLQ B;  4XDC A;  1GMW D;  2VU5 A;  4H54 A;  2QL5 B;  5H9F J;  3PHE A;  3VZH A;  2KH9 A;  4DR5 J;  4U7C A;  2GS8 A;  4ZCI A;  3F41 A;  1JLF B;  1FDD A;  4DV4 F;  1NLK L;  2GO8 A;  5DLF A;  3V81 A;  2LQ8 A;  1RTJ A;  1X4E A;  2CUY A;  1LFP A;  3HPO A;  1YK9 A;  3KHR A;  4OJ1 A;  1EB0 A;  4HDG A;  5J2M B;  3FRZ A;  4AL5 A;  3AT1 B;  3HHN B;  2RIJ A;  1Q4R A;  4NRT A;  1TK8 A;  1IJF B;  3CCZ A;  1JMT A;  1XQI A;  4DV6 F;  2OSQ A;  2VIC A;  3V4I A;  3D2W A;  2BJD A;  2V69 A;  1XR5 A;  3OV7 A;  3AY0 A;  1S59 A;  3PCO B;  2ZE2 B;  3UNG C;  2HMI B;  2VOD A;  5G4D A;  1KS2 A;  1WKJ A;  3DI6 B;  3M30 B;  4LBP A;  3FSY A;  1Q8L A;  5IQ6 A;  1HBU A;  3DU5 A;  2DRB A;  1KRP A;  3GSI A;  2W8K A;  2ZJQ Q;  2CA9 A;  4WPA A;  1RWO B;  2ZM6 J;  4RW8 B;  4DS5 A;  4ZVQ B;  2OMO A;  3G6Y A;  2ZDP A;  3S7R A;  3JTO A;  5G0R A;  2BJE A;  3AOD A;  3PR5 B;  2HNY A;  3CD5 A;  1SQG A;  3QZ7 A;  2QGF B;  3CJT A;  4DUT A;  2ASL A;  2HRU A;  3W2V A;  5K8O A;  2XMA A;  3SSS A;  2X51 A;  4ZDN A;  1RKJ A;  4A46 A;  3I56 S;  1NHV A;  2V8V A;  2KI2 A;  1S49 A;  2DXF A;  2C2K B;  3GJT B;  4BC7 A;  3BBB A;  5HRO A;  1JLB A;  1UKU A;  1HHT P;  2QJ3 A;  3Q89 A;  3UVJ A;  1FVS A;  1FNM A;  2VON A;  4ZPB A;  1WC6 A;  2LQB A;  9ATC B;  1R0A B;  1LFW A;  4RUC A;  4WCE Q;  4AQY J;  3UD3 P;  3GV8 B;  2J0Q D;  1QVF R;  3AAW B;  3Q2T C;  2HFN A;  3BH6 B;  4ZVR B;  2F4F A;  3D68 A;  4B08 A;  1C1C A;  1DTQ A;  5D0G A;  1GK8 A;  3IWN C;  4DV0 J;  2AW0 A;  5KFW A;  2UUW A;  2C2N A;  4DXL A;  1MSW D;  5F3Z A;  5EWE A;  1G1X A;  4LMZ A;  2QA4 G;  2LVW A;  4CYU A;  1XIQ A;  2IDL A;  3W9H A;  2VH7 A;  4ED7 A;  1LWE A;  1NEE A;  2K8G A;  2YKM B;  1CG2 A;  1Q8I A;  3RAM A;  4IG3 B;  1MNE A;  2YNH A;  2WSC C;  4ITS A;  4IR1 A;  2KZZ A;  2DEJ A;  3TR5 A;  3SBM A;  2VJU A;  4RPF A;  2YKQ A;  1RWW B;  1W2I A;  1X4C A;  2J0X A;  4N56 A;  3BS9 A;  1FRJ A;  3CB4 A;  4MK8 A;  1NSK L;  4ID8 A;  3BO2 A;  4MAK A;  3J81 j;  4DBQ A;  1V5I B;  4P52 A;  1QDU B;  3MED A;  1KLM A;  4H4M B;  1HNW J;  3LH2 S;  3T6B A;  2GO9 A;  5IV4 A;  1RHR B;  1F5C A;  2FHO B;  1NB2 A;  4X4Q A;  1E6V B;  3UR3 C;  4DL7 A;  3D0G E;  3MCS A;  3X3U A;  1RTD A;  5EDW A;  4M5N A;  2QYG A;  3SYZ A;  3MGJ A;  2Z58 B;  3CC4 S;  3MMC A;  2Z8Q A;  4OZ3 A;  3KOA A;  3UNY A;  2X3D A;  4DQP A;  3DLE A;  1REV A;  2LXF A;  2D9O A;  4EGL A;  3MEC B;  3S8S A;  3KUG A;  2RML A;  4X64 F;  2OI2 A;  1HW8 A;  1U6F A;  5CH7 B;  2R2T A;  4CQ1 A;  1RT3 B;  1CLF A;  3DRP B;  4QZV B;  1X4G A;  3IBC B;  4WFZ A;  2RH3 A;  3RRK A;  1S76 D;  1HNX F;  4HI2 A;  3DOK A;  2M9K A;  4UY8 T;  1YBT A;  1HQU A;  2D41 A;  3TNV A;  4DL6 A;  3KK1 A;  2HHH F;  1RAB B;  2NUH A;  3U1N A;  2BZ2 A;  5CZV A;  6FDR A;  1Y9O A;  4USK A;  4EYH B;  2GIQ A;  3OSP A;  5FII A;  3PEH A;  4OX6 A;  2IAJ A;  1TZ0 A;  3DMJ A;  2DNK A;  2E66 A;  3FK4 A;  3K7R A;  1DY3 A;  3KG1 A;  1HQ2 A;  3OTB A;  4B02 A;  4N8N A;  1ZAV A;  1RAF B;  4DN0 A;  3TAR A;  1YBU A;  2IHR 1;  5J2P B;  3TZW A;  3UWT A;  4LBH A;  3H59 A;  2OPQ B;  2BAN B;  5F8L A;  4LIW A;  1N33 F;  2P5V A;  3OFH A;  5CZX A;  5CD4 H;  3DYA B;  4CZC A;  2CIM A;  2YTC A;  2OLW A;  2CNL B;  4G1Q B;  4NYP A;  4FNH A;  2DO0 A;  4F3Q A;  2C3Y A;  3K58 A;  3POT B;  4DR1 J;  3Q0A A;  2KL8 A; 
#chains in the Genus database with same CATH homology
 5LMU J;  5IWA J;  2MTL A;  4JI4 J;  4JI8 J;  4DV4 J;  3IMQ J;  1XMQ J;  2F4V J;  1HNW J;  4NXN J;  2E5L J;  4LFC J;  3J7A N;  4AQY J;  2VQE J;  4DV5 J;  1XMO J;  1XNQ J;  4DUY J;  5FLX U;  4DR3 J;  2UU9 J;  4DV1 J;  4HHU A;  3W1Y C;  2KVQ E;  4JI0 J;  2UUB J;  4NXM J;  4JI2 J;  4DV3 J;  4X65 J;  3D3C J;  2UUC J;  5BR8 J;  1IBK J;  4JI1 J;  1N32 J;  4KHP J;  1HNZ J;  4YHH J;  5LMN J;  4B3M J;  4JI6 J;  3JAM U;  4DV0 J;  1XNR J;  4DV6 J;  4B3R J;  2ZM6 J;  1N33 J;  4LF6 J;  1I94 J;  4GKJ J;  1N34 J;  2MEW A;  4JI3 J;  4DR7 J;  4X64 J;  5LM7 E;  4LF9 J;  4V1A k;  4NEY A;  4LF7 J;  5A2Q U;  4LF8 J;  4DR2 J;  4DR5 J;  1IBM J;  4B3S J;  4X62 J;  4PWW A;  4DR4 J;  1N36 J;  3R2C J;  1HR0 J;  2HHH J;  3T1H J;  4GKK J;  4DUZ J;  3J81 U;  1J5E J;  4LF5 J;  3D3B J;  4JI5 J;  4DR6 J;  4DV2 J;  4KYZ A;  3T1Y J;  3OTO J;  3R2D J;  2VQF J;  4KY3 A;  4X66 J;  1HNX J;  4LFA J;  4LFB J;  3J80 U;  4K0K J;  4OX9 J;  4DV7 J;  4RJV A;  5IT9 U;  2UUA J;  5AJ3 J;  4NEZ A;  4JYA J;  4YY3 J;  2UXD J;  1IBL J;  2MQ8 A;  4B3T J;  4DR1 J;  4LF4 J;  2UXC J;  2KL8 A;  2UXB J;  1FJG J;  4JV5 J;  4JI7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...