1FJGJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1fjgJ00
5LMNJ 1FJGJ 4JI8J 4NEYA 4X65J 1XMQJ 4AQYJ 4DV2J 4DR2J 5LM7E 1N32J 2KVQE 1N36J 3IMQJ 4X62J 4LF4J 4DR7J 4DV0J 2VQEJ 2UU9J 4DV1J 4LFBJ 1IBMJ 3JAMU 2UUCJ 1IBLJ 4LF9J 1IBKJ 5IWAJ 4B3SJ 4K0KJ 4DUZJ 4JYAJ 3OTOJ 4JI6J 4PWWA 3J81U 4JI1J 2UXDJ 4GKKJ 1N34J 4JI7J 4DV3J 4DUYJ 4B3TJ 4B3MJ 3R2CJ 2ZM6J 4X66J 4LF6J 2KL8A 4LFAJ 1I94J 4X64J 4KY3A 3J7AN 4NEZA 3J80U 4DR3J 4NXNJ 5FLXU 4LF8J 4YY3J 4OX9J 1XNQJ 3D3BJ 1HR0J 1J5EJ 1N33J 1HNZJ 4LF5J 5BR8J 2HHHJ 3T1HJ 4HHUA 2UUAJ 4JI3J 1XNRJ 4B3RJ 4JI2J 3R2DJ 5A2QU 3D3CJ 1HNXJ 4DV6J 2VQFJ 4LF7J 2MEWA 2UUBJ 4GKJJ 4DV7J 4NXMJ 2UXBJ 4JI0J 2E5LJ 4RJVA 3T1YJ 4DR4J 4YHHJ 4DR6J 2F4VJ 4JV5J 2MQ8A 5AJ3J 4LFCJ 1HNWJ 4DR1J 4JI4J 2MTLA 5IT9U 4DV5J 4DV4J 4KHPJ 3W1YC 4KYZA 4V1Ak 4DR5J 4JI5J 5LMUJ 1XMOJ 2UXCJ
chains in the Genus database with same CATH superfamily
1YGYA 1LFWA 1U1NA 2YWWA 3MR5A 4KKOB 3BZQA 4QIWD 3EGZA 2W2MP 1XMQJ 2ZD1B 1QAXA 2W24A 1TVRA 4MIWA 4H4KA 3OTOF 2KTQA 5JVGQ 3ITHA 5E33A 1L3TA 4UQTA 2D3O1 4JV2A 5KT7A 1U6FA 3PW5A 1MN9A 1VRUA 3ZZRA 4Y2CA 4ECVA 3NKYA 3CDBA 4PUOB 4RPFA 2EW9A 1RT2B 1GH8A 3PXGa 2LA4A 1BE4A 1VIXA 2CQBA 1S1TA 3PX6A 2YX7A 3ETMA 3KJVB 2PSZA 4PUOA 3ZZYA 4IG3B 5ETKA 4AL7A 2DIUA 3K5NA 5DG7A 1S1VB 4ECTA 2VF3A 3QMQA 4KV8A 2DNPA 3PRBA 4FPIA 3SXLA 1X4BA 2WVCA 3THPA 3M8QA 1JWWA 5C2GA 1YJ7A 2RS2A 2WB4A 4CI0B 4OJHA 3OTOJ 5L1IA 3A12A 1QSLA 1S12A 3JQJA 1TL1B 3EXYA 1U8SA 3OV7A 2VUGA 3PV8A 3DOLA 2Z56B 2V68A 3G96A 3MFHA 4JBCA 2C2NA 3GR1A 4ZVOB 2XMJA 4JI7J 2E9TA 1JLAB 2UUAF 5G4DA 4QJVA 2VICA 1EIYB 2ZNZA 3IS9A 1RDRA 1WWHA 1JLGB 2QA1A 3CJ3A 1CPZA 3RGIA 4Y0FA 1Q82T 5KG1A 4G1PA 1GTHA 5IOLA 4D3GA 2KL8A 2VC0A 3MMAB 2HRTA 4DLGA 1WOSA 1KVIA 1VLOA 4ZPDA 2ZWPA 2BQUA 4CNYA 3ADAC 4ZVHA 4TNOA 3QRRA 3AH6A 2XYGB 1BLUA 2BABA 3KK1A 4WIIA 4ECUA 4NLOA 2P8IA 2R8HA 1L5UA 4IR1A 2KN4A 2VB6A 3R5DA 2C2MB 3IG1A 2GHPA 3MM8A 3BF4A 5AJ3F 3EZ5A 2UUBF 4OX9J 3UFCX 3AY0A 3OR2A 2XC9A 3EGVA 3HD2A 3LA0A 5IFMA 2W9AA 8RUCA 2OEKA 4A8FA 1CULA 1VK8A 4WZQA 5C2CA 3FJ2A 1Q8IA 2WK4A 3W66A 4FNIA 2FZGB 4ZIWA 2RT3A 1IBMF 3QJLA 1VS3A 1FKPB 2K2PA 2CG4A 1IR1A 3DCAA 2OMOA 1RT7B 4HEA9 2RVJA 4F4YA 1T05B 5DQGA 3IAM9 3FZ2A 2R2SA 3LGHA 3B8HA 2C3PA 1UCNA 1ELOA 1YKWA 3M6UA 3MMBA 4Y65A 5B09A 5KFEA 3S6EA 3M05A 3LWMA 2W1BA 2IA6A 1JIHA 2OEMA 2VQFJ 3JTNA 1GK8A 2OI2A 5L1LA 3VAKA 1HI8A 2R7QA 2IC3A 3OVAA 1E6VB 2BANA 2XI2A 4G1QA 4LR9A 5KFPA 2Z8QA 4P75A 1NK4A 4NA2A 4AT1B 2VA2A 3BYRA 3W9IA 4YHHJ 4P2XA 1S5ZA 2EG2A 4CT9A 4JV5J 9ATCB 1U0HA 1NK9A 3GJTB 1HNWJ 3DDIA 2MB0B 3UPFA 3R1HA 2OD6A 2XCPA 3N4WA 5CYMA 2D69A 4A8SA 3AXMA 2FVCA 2B4OA 3QBCA 1RTIA 1WJ9A 4MKAA 5D3GA 1X4AA 3P49B 2QLJB 1T9WA 1OPZA 1S6PA 4KO0B 4JI8J 4ID8A 3PIOQ 2ZH2A 4E2FB 1RABB 2G1DA 4N47A 3EZUA 4DX6A 4YQWA 2E1CA 1UEKA 4WYWA 5LJ3Y 2C2DA 3DRYA 3OFFA 4C98A 4RNOA 3NAHA 2RF2B 2NPIA 3GSDA 2HNDA 1LOUA 2VDIA 2K06A 3A8IA 4P7TA 1Y3KA 4CLYA 4ECQA 1UA1A 1FKOB 4WE1A 2XNRA 2ZZMA 3R3TA 3IMQJ 1SXLA 3UVJA 2FHJA 4RX6A 2FLOA 2C2OB 4ZJOA 3LWLA 3FQKA 5L46A 2Q43A 2DH7A 2G4BA 3R7SB 2FJBB 4NYZA 2ZC3A 3DRRA 4B08A 4DDFA 4QWAA 3HT3A 3W2VB 4DWIA 3IRXA 5IM0B 1XBWA 2GO8A 1VQKS 2APOA 1FRMA 3KJFB 1R0CB 3BPDA 1R89A 4UOFA 3IXQA 3TA0A 3PVXA 4A8OA 2WOMA 3QZ8A 3MD3A 3BPSP 3ISNC 4DF8A 1RAGB 2HK2A 3MDFA 2LLZA 4OX9F 1GEHA 3VAFA 3ZFVA 3BV8A 1VC0A 4DPUA 4G6VB 3Q8PB 1RAIB 1UWBA 4LRAA 1CSJA 5A8KB 4M1KA 2WONB 3KHLA 3U1NA 1N6QA 2ZVIA 2AJ4A 2GQ2A 1NSAA 4I68A 4ZP8A 2DTJA 1FRKA 1UEVA 1U2CA 3I4PA 2XO7A 1U1KA 1M1KT 2PN6A 5ETOA 3M4XA 2DNNA 4LSLB 1OY9A 3TUZC 3MD1A 4CH1A 4FBUA 3PKMA 2DY9A 2BJ3A 3V4IB 1Q5VA 1D9AA 2GFFA 2L9NA 1TK5A 2DPIA 5LMUF 4XAKA 5F8HA 2LU2A 3C14B 4Q7AA 4O23A 2QYCA 3J7ZT 4HDGA 1KOOA 2Q1LA 2LU1A 3SEOA 2FJAB 3V6KA 1NSKL 4I6WA 4WK1A 2FZKB 3MECB 1PJ7A 3MM8B 2BQ3A 1JKHB 2CNLB 3DRRB 4G65A 1FD8A 1MN7A 1JLCA 1UL3A 1VBKA 1IJFB 1F9EB 2VL1A 2UXDF 3J80U 1Q79A 1RWUA 3BDEA 2WAQD 3CO0P 5CQGA 5THWA 2NYHA 5C24B 3R1LA 4NXNJ 3NNAA 1VFJA 3TVZA 1W26A 4ZP7A 4BWMA 3DXSX 2H51B 4OZ5A 3M7VA 4WE1B 2KJWA 1JMTA 2J9DE 3NG8A 2IM0A 3CJ8A 1WF0A 4RWWA 5K5MA 4K2XA 4RNMA 1U1OA 2J7WA 1HWJA 2E5HA 2GJIA 2EBEA 4L75A 2GHVC 4WKYA 3J7Z5 3RRGA 1U2RA 2MKIA 3RBXA 5IV3A 4N77A 2V67A 2E66A 3UD5A 3VGUA 4KTQA 3BSOA 1BQMA 3HFZB 5ADZA 2EI5A 2ZZTA 4N5SA 1FNXH 2P2CB 4LMZA 2ACYA 2G2ZA 4C8NA 2Q6CA 4OZ2A 1SBRA 2YKMB 3BKFA 1I51B 3NGRA 5CYMB 2R8IA 2CJYB 2C22A 2BJEA 1R0AB 4DX5A 2ZUGA 2OP5A 1DFDA 2MZQA 2OSQA 3IC1A 1YZ6A 3DOMB 1TL4A 2G0JA 1RT3A 3EUNA 3LGNA 4B3OB 2MZTA 2OTJS 1RAHB 2G13A 1JLBB 4JV0A 2N3OA 2R7VA 3CC4S 1R6YA 3IM8A 3JSMB 3GCXP 1XWLA 4OYOA 1X5PA 2UV8A 2W9BA 3CDEA 1Y5NB 1RT2A 1F2GA 4KRWA 4J9MA 2ZJPQ 3FBBA 4Z2XA 3MFIA 2COLA 1ZTTA 4I2PA 2HYIB 3NGKA 2J7UA 2P9GA 3D1HA 2XMWA 4NWBA 3DDNA 1TKXA 1WI6A 2EPIA 1WTBA 2IY5B 3OTDA 2QL7B 1UJ5A 3C15A 2B9XA 3GR0A 4JUZA 2VFTA 1VQYA 2IVYA 2DPJA 3OTCA 4FF3A 4X4NA 4X4PA 1YWXA 2V9WA 3NOGA 1RXOB 2DNLA 1PC5A 2DR6A 5AE2A 3DI6B 2MSSA 2NZCA 2QJ3A 1MU2B 4HT5A 1Y3JA 3I82A 4KJIA 2AIRB 1K9MT 5KFVA 1N32J 2V8DA 5A76A 1X60A 2IYGA 1UFKA 3IA0A 4TY8A 2VG7B 2YWEA 4B02A 4ES1A 1VJQA 4MTPA 4ED6A 2FJWA 4JI2F 4QYZJ 2H4WB 1Y4ZB 1NK8A 2OPSA 2EK1A 3RB3A 1JLEA 4EZ9A 1NO8A 2WSFC 2NXEA 3T9NA 4YS2A 2UUCF 4LBIA 5IXUA 3W62A 1JNRB 1HARA 3FMBA 4OX7A 1VQ7S 4PWDB 2XO6A 1R8BA 3DU6A 3E01A 5GAHU 4HHJA 3IP0A 4PG7A 3CF5Q 2KVIA 2FYXA 2A3JA 3M1VA 4C9DA 1Q5YA 4RW4A 3EX7B 1NJZA 4ZVRB 4JI1J 2HGNA 3DGPA 4RNNA 1S72S 2HHQA 5B0DA 2FC9A 4GKKF 1JXEA 2DGVA 4P2MA 4DV3J 2UVVA 4FBTA 3M2VA 3R5JB 2YPZA 5G0RB 4DUYJ 2ZKUA 1FFWB 2XCAA 3TR5A 2YNFB 2CNOB 3N6MA 1NU4A 2QGFB 4DSFA 4EZ6A 2EK6A 2B9WA 1RT1B 1SH3A 3O44A 4ZK7M 1NDPA 8AT1B 4QR1A 2AF6A 4U67Q 1T9UA 1JLCB 2FPHX 1FA0A 2RQ4A 1T9VA 2YQ1A 3L9ZA 3BQ2A 4KY3A 3KJVA 3H42A 3Q2TC 2M0GB 5HP1A 3HKZD 1UZDA 5H1SV 1H98A 2J9EA 3CCTA 1NKCA 3VGSA 2XWYA 4C11B 5FLXU 3X3UA 3H5YA 1HBOA 3MI7X 3V6JA 3M8PA 4TU9A 2IM3A 1X8DA 4M5GA 1TQLA 2OPPB 1HR0F 2H4YB 1FNOA 4HKQA 3LO3A 3TNVA 4U6PA 2DGQA 1CBKA 2MZJA 2DGTA 2L08A 3SQGA 1SJ3P 3DRSA 1Q81T 4L3KA 2HBYB 4JI5F 4EBDA 1FDNA 2DHGA 2OFHX 1H7WA 2ZBIA 3M6XA 3PX4A 3VV2B 3CUNA 1W25A 1XNRF 3KUHA 4N41A 1RWNB 3S8SA 1F5AA 4ZCLA 2NUHA 5J2NA 1FHTA 2X1GA 2YWHA 4USIA 2DH8A 2YKNA 4K8RA 5A8WB 4HDHA 3M32A 4A46A 4J9NA 3QAEA 4P73A 2BQRA 2B8PA 4YN3B 1AA1B 2AEFA 2GVDA 2UXBJ 3NGUA 4QU6A 2HHSA 4ZOSA 2R2UA 3F41A 3KKFA 4JB8B 2V2VA 1RA7A 1J5OB 4EO8A 2R7SA 2XMTA 1U26A 1JJ2R 4WKRA 4EO6A 3MR3A 2FJVA 3QZ7A 4DR3F 2DR8A 2QL9B 2B7BB 2MQ8A 1JJCB 2YNIA 2H1YA 1Q7YT 3LH2S 2GMJA 4TYBA 4DU8A 4J37A 1FWLA 5DM7Q 1KTVA 2VODA 3ILOA 1G6BA 1S79A 3PCOB 2AWZA 4V1Ak 3C3LA 2XZTB 4NLVA 4P9SA 2GO9A 4C8LA 1TU0B 3Q89A 1R0BG 1Z1ZA 2HZAA 4WFAQ 5LMNJ 4JI7F 2RRBA 3UR3C 1VOMA 2ZHAA 3DU5A 5A8RA 3T6JA 3CCES 3T5LA 2BE7D 1NPRA 2JFKA 4QR2A 4DOZA 2VD3A 2UXBF 3TW0A 3AA8A 1AZSB 4WTOB 1U02A 1WHWA 5L1KA 1QD1A 3FKBA 5E0OA 1N36F 4LF6F 1WUUA 2DO4A 4MK7A 1XR6A 1FWKA 1O51A 4DHVA 3OUYB 3HVAA 4X62J 3GIMA 4OHZA 2CJ9A 3NGTA 3TEGA 1LEOA 4JV1A 3CJRA 2B6AB 2IM1A 4K59A 2HLUA 4LRBA 2DVIA 4KFBA 3NLCA 2UU9J 1AFIA 2A6OA 5KTQA 3I9V9 4ICLA 3B82A 4MIBA 3ZTOA 1ZBTA 4CNZA 2ZDOA 2K3KA 4HT7A 5KFMA 1BWVA 2CJAA 2KHCA 3TUIC 4YDDB 3EWGA 3HDSA 2FC8A 5IWAJ 3FGVA 4TVAB 2B8QA 5CXTA 4PPZA 1PSDA 3SZ2A 1MROA 1UJ4A 3HSJA 2MQLA 3K5MA 4ZJLA 4EWTA 2KXHA 4B9LA 1WDTA 1F2HA 5GMEA 2RD5C 1UPMB 2VDHA 1W2IA 1B7FA 1AYEA 2FHKA 1HQ2A 2RU3A 3BO2A 2XHWA 3EJMA 1XTZA 4IFYB 2F65A 2ZUAA 3EZOA 4Q0BA 1TFYA 3IWLA 3BN7A 3M2VB 1PO6A 2HNDB 1RLDA 3TARA 4ETZA 2ZITA 3IFEA 3ZC4A 4I64A 3ZTQA 1JB0C 2W9CB 1HW9A 3CO9A 1KP6A 2ZBPA 2ZE2A 4I0WA 3U1MA 2XM3A 2JSXA 2BM1A 2ZNYA 3KLHA 4PWUA 5E2QA 1GT8A 2ZHBA 2E5LF 1H7XA 5I42A 5C5JA 2ZHOA 1LWFB 4ZP6A 1HPZB 3JTPA 1AT1B 1YX2A 1D09B 1HHQA 1S57A 1UWAA 2UZAA 3LF0A 3CCZA 1M0SA 4MYUA 4GKJF 3PRDA 5GAHI 2JFDA 1S9FA 3A3PB 4X4RA 4NCBA 1SCJB 4OI4A 2BE9B 2UUWA 2NXUA 3G82B 3QIPA 4F67A 2Q66A 2W7AA 1URNA 3D66A 3P8BB 4OZJA 3RYLA 1K1SA 3IM9A 3T1HJ 1GX5A 5MAOA 3Q8QB 2FLNA 2GNKA 5EWEA 1U0HB 1WDDA 5KFUA 2CQGA 2N4CA 1Q8LA 3MPYA 2W8LA 4FS2A 4DL4A 1SVDA 4RUHA 4QR0A 4TQSA 3PIPQ 1IBCB 4MFBB 2X3DA 1KHWA 2HFSA 3GJQB 3Q2SC 1VJWA 4NL5A 1BQXA 2B9YA 1HWLA 2CQ2A 1UW4A 3M6VA 3MEDB 3SFUA 4M5JA 4AD6A 3PKYA 4GKJJ 1RADB 2RUSA 2MXYA 2HURA 2BDPA 2JLFA 2QL5B 2X7IA 3D6TB 1B0TA 1YJRA 2V8GA 5CYJA 4O3SA 2IMOA 1N5QA 5F8GA 2HQDA 3CJKB 2E1PA 4L74A 5KG4A 3TX0A 4F4KA 4ENOA 1PJ6A 3DLJA 4M5LA 2XY7A 4PKDB 2ROPA 3T1AA 1RTDA 1M1HA 1MMDA 4DCJB 3J80Y 1T05A 3U02A 1PYOB 4OHWA 2K7JA 4OI1A 4RW8A 4E0DA 5DDPC 3KXDA 4YDXA 2PA8D 3OUYA 1N5YA 2GW8A 1WG4A 5D0RA 2DY1A 3U1LA 2ROEA 3DOMA 1ULRA 1RT3B 4RBVA 2V4JA 3IGNA 2UXCJ 4CLKA 3BGFA 4LVNP 2OTLS 2ALYB 2LEAA 3AOCA 1FJGJ 1UVNA 5HL7Q 2MDAA 4FYXB 3Q22A 1FNMA 2RF2A 2YKMA 3ISZA 1R0AA 1J2VA 1SB6A 4I6AA 4ERDA 3H40A 1P1TA 2DGOA 5H9FK 3GONA 4TU7A 1WF1A 3NCQA 5F3ZA 4H4MB 1IKYB 5ETVA 1FK9A 1FFSB 2A1BA 3VVUA 3H2VE 4UUWA 1KBRA 4YP3A 4RW4B 4NLQA 1RTJA 2UVUA 4DPOA 1HKAA 1WC5A 3M6WA 4DUTA 4E98A 2KZMA 2H54B 4DR7J 3OQ2A 2FJEB 1R6VA 2C1EB 2D74B 1S9EA 1UW9A 2QSWA 5CD4H 3Q8SB 2VBZA 4NRUA 3JSBA 1IUJA 1IBLJ 2FY1A 1WHVA 2CQ4A 4KO0A 4RU9A 2BJ8A 3HM9A 4N8OA 2J9DA 3WHIA 3PHEA 3TVKA 4A8WA 2R7UA 1SJRA 3H90A 1IKXA 1HBNA 1YLXA 1Z4UA 5B0GA 1OJ4A 1WG5A 2CWXA 3FCVA 2D9PA 3JAMU 3MEEA 4J9OA 3ET6B 4BC9A 3D0IE 4USTA 4ZDNA 5EWFA 3A4TA 5IZHA 1SQEA 4H54A 4EU0A 2KG0A 4OYAA 4ATNA 4AUKA 2MZSA 1TK0A 2NREA 2Y8YA 4OZ3A 4EYIB 3TAQA 1SJ4P 1T94A 3DI6A 1L3UA 4GO5X 3IR7B 4ZP9A 1T9XA 5K8MA 2SXLA 3PW4A 1FJ7A 4X66J 3KK2B 4DG1B 5F9LA 2A6MA 3PYEA 2C3YA 4RNHA 4FKYA 3TAMB 1FRLA 3KLEA 1C0UA 3ZZTA 2XMAA 3VQTA 4A48A 2W7PA 2ACMA 2CQDA 1FKPA 2NPFA 1N52B 2RE1A 3KDOA 1S1XB 4Y34A 3TA2A 1JLFB 1FVSA 2B7CB 1SI9A 2WVFA 4J9UE 3CCLS 4USWA 4RL1A 4CLTA 3A13A 1WI8A 4M5DA 1T3OA 3NBPB 4IYQA 5AT1B 3V5RA 3HVRA 1S1WB 1HQEA 1ZH5A 3FDSA 4J9SA 2DNRA 3I0SB 4ECWA 1UVMA 2KRRA 3ILJA 1H74A 2F5GA 5CAAA 4CO1A 1SL2A 4B3OA 3PW7A 5D4PA 1V3SA 2I38A 3AOAA 1SPBP 1GMWA 2AV5A 4ZPAA 4ZN3A 5ETPA 3M9OB 3CULA 4IH7A 3I5BA 1WOPA 4DXLA 1XN9A 1S0MA 1TUVA 1ZOTA 3Q8UA 2RIJA 4J9KA 4E8UA 5IT4A 2AT1B 4JI2J 2B56A 2J0SD 1QJHA 1DQ9A 2ZH6A 1N5SA 4QPTA 2HVZA 3C6TB 5DGAA 1KQKA 1HHSA 4OZ0A 4DN0A 3THVA 2RDIA 2QMUB 3I9ZA 2ZC4A 3B6BA 3HHLA 4ANDA 4N56A 3O5TB 2UUBJ 3M9MB 1RTIB 2CDRB 1T9YA 2BJ9A 4J9QA 5ETMA 4R0JA 1R7IA 1TKZA 2QMWA 3BDPA 4IRKA 4JI0J 2R7XA 1FE4A 1RGVA 4RW8B 2M5YA 4W4MA 4HHHA 4H4KC 2BXJA 1GNKA 3K59A 4B17A 4YB7A 1RAEB 4FKXA 2HAFA 1BXNA 4X62F 2CJKA 2VBYA 3VQSA 4WP9A 4DR1J 1TK8A 4B3SF 3NMAA 2ZBRA 2Z58B 4ITSA 1CJTB 1YK9A 2HWTA 2HQGA 2R8JA 5KAKA 4HI2A 1IQTA 4Z7YA 4JV5F 3ELHA 1SC1B 2L9DA 3UDEA 2YQ0A 1DLOA 3P3DA 4M5DB 1WC6A 5KFSA 1GFWB 4MKYA 3NEKA 5IWAF 3AD9C 1FDBA 5D0EA 4QWBA 2ADBA 1QLNA 4X2BA 2QLXA 5IV4A 2DRAA 4U7CA 2MQMA 1FEEA 3CJTA 2XZDB 2LXIA 2WVEA 2KFYA 1EQ0A 1HQUB 2KYZA 4ZHRB 4OV1A 4XK8C 4DR5F 4DV2J 2C2EA 4F2RA 2JC1A 5LM7E 4OX8A 1KQFB 4O3NA 5HN0A 2FIUA 3H7HB 1S9GB 1VI7A 1RBOB 2B5JA 3PG9A 4KKOA 4X4QA 1CJVB 1ICEB 3BGUA 2W7OA 2DHSA 3RB6A 2DNOA 2BM0A 4OZNA 2AJ0A 1R8PA 4S0MA 4ZIVA 5KOXA 1PC4A 1NAQA 4IOBA 2C3MA 3Q23A 5J1EA 1PG5B 2NYIA 3RU0A 4LFBJ 1IKVA 1IBMJ 3Q24A 3MXHP 3HT0A 3M30A 2FUG9 2NUUG 5A8RB 3OJSA 4LFAF 1CC8A 1UEUA 3R97A 1VLYA 3MEGA 4F4ZA 1NZ8A 3QPIA 3M2RB 2FQQB 4K0KJ 1Q8KA 2H65B 3EGNA 1BQMB 3LPEA 5F0UA 1LXNA 1YITS 2WB1D 4USKA 2LMIA 1JLGA 3GTYX 2HIQA 2G2YA 2V2KA 1U0SA 3MCMA 2ZOFA 3MM9B 5CCMA 4CO0A 3GV8B 4QOTA 1HPZA 2D7SA 2JRSA 3AB4B 1RKJA 2RRNA 4MKBA 1Y11A 4EGLA 2O67A 2LFVA 4C8YA 3UR0A 1T8EA 3BH6B 1S59A 3VZIA 2OELA 3QSIA 2Z2YB 1FXLA 1FRXA 3D1OA 5AXLA 2GMLA 3D6MB 5D3GB 4C2MA 1X31C 2IAJB 1VGYA 4UW2A 2RAQA 1S48A 3PYFA 1FT8A 3EMTA 3OSPA 4TLQA 1WEZA 7FDRA 4W90B 3DMJA 3OJUA 2ADCA 4WZMA 2PD1A 5HBMA 4I7FB 1C0TB 4RNFA 1RUSA 3M8WA 4ZCMA 2I5JB 4GMKA 4DR3J 2CPFA 2VPXB 2XGPA 3BSNA 4YHHF 3WIVA 1S9GA 2Q3PA 2GVZB 3CEDA 5E7OB 4C48A 1BQNB 2LQ5A 3FZBA 4ECZA 1S1WA 2AJFE 3OD2A 4KFBB 4PR6A 3T1YF 2B43A 2QRRA 3PZPA 2C42A 3DGVA 2QA4G 4IR9A 4QU7A 1ZAVA 2R9LA 2HIYA 1U1MA 2CAJA 1KRPA 1H6KX 3SMZA 2E7VA 1K47A 3N79A 2H5EA 4HHUA 1ZS6A 3RB0A 3NNCA 5E41A 4B3RJ 3CJQA 4JI8F 1TR0A 1HNIA 1D3WA 1RT6B 3TJ8A 5GAGU 3ZNJ1 5M2UA 2IDLA 3H4BA 5A2QU 5H9EJ 2BMBA 1NH7A 3GSIA 1Q16B 5KFOA 2XQCA 1SV5A 2PC6A 1XMBA 4JP8A 4NLUA 4QYRA 4K7QA 4DV7J 3KK3B 4F0MA 3G82A 3ZZ0A 4MH8A 2V94A 4DCOB 1T02A 3CE8A 4LUBA 1RBLA 5AXNA 4I7FA 3LP2A 4X65F 2A2DA 3RBZA 3I6PA 3VHQA 4RBUA 4O44A 4LIWA 5DS7A 4OYWA 2XLJA 4DR4J 1CJTA 1KVJA 5C42A 1Q78A 1RQ0A 4WWSA 2G0CA 3AT1B 1N0UA 5E3PA 5D0HA 3W5XA 3UCZP 3KHHA 3HKWA 4B3TJ 4JI4J 1REVB 1LV5A 3HMJG 2NSCA 3ONQA 5JVHQ 2CQIA 2YNGA 4DF4A 3LW5C 1S6PB 3DHXA 2E44A 3JXOA 4ED8A 1VC5A 2H5JB 3LALA 3M1VB 5HVFA 2EVZA 5BR8F 2HK3A 1U1LA 2GJ2A 1VQ5S 1VCTA 5KFJA 1HYSB 4LSNA 3TI0A 3DXBA 1KFSA 4RWXA 2VIHA 2BKOA 2G2OA 4ED3A 1PIEA 1YRUA 1YJTA 2M8HA 1FFGB 3KUGA 4H4OA 5HMWA 2FY8A 5KFAA 3A8EA 4C8ZA 1DJ0A 1SV5B 3FRZA 2CQ0A 5GMDA 3UI3A 3W5YA 5K8NA 4OX6A 1X9MA 1N48A 4JI4F 5GAEU 3PRVA 3LP2B 2ZH8A 4IQMA 3TAMA 2MJNA 4ID5A 4R5PA 1P8GA 1UJ6A 5J2QB 4K4SA 4QYZK 3Q8RB 2AZ1A 3AD8C 4DSEA 4DSKA 3PJXA 2W4CA 4YMEA 2K1RB 3MTKA 3N6NA 3OVBA 3HLUA 4NCGB 1WKJA 1RP5A 4AFFA 2UXCF 4G1IA 1U1RA 2JEJA 5F8NA 4DPTA 5HO4A 1X5OA 3L09A 1N6QB 2OD4A 1DBDA 1QM9A 4WP8A 3KLVA 4EBCA 3IBCB 4USVA 2HFOA 5HQMA 1LXJA 3BBBA 4B9SA 3D54A 3GMGA 4PWWA 2A18A 2WSCC 1VDHA 1WC1A 4O3QA 4PG8A 1EETA 2HNZA 4NA3A 2ROGA 5D4NA 3RAQA 2NXJA 2OLWA 1RYRA 1FF2A 4GVLA 1FI4A 2E5IA 4DS4A 1D9FA 2HVDA 3QIDA 3NL0A 1FRIA 3DOKA 2IBOA 1BQNA 4WJBA 5GVQA 3TP2A 2VOOA 6AT1B 3G6VA 3QYYA 5L9XA 4C7QA 4J91A 2M3DA 4RLEA 5DRKA 1SH2A 3D1QA 2KDOA 2ERRA 3CJSA 3KFWX 3K89A 4R8UA 1SKWA 2HVHA 1MWQA 2J6SA 2K7KA 4ZLJA 2BKNA 3PACA 3V81B 4XTTA 2VQEF 3ET6A 3H98A 1V9OA 3U27A 3IR5B 1GXTA 1TUGB 4U9RA 3J7YU 5KT4A 2ABYA 3ZZPA 3D28A 4WTYA 2P9CA 3PYGA 4ER8A 5M2RA 3R9LA 3CDAA 2Z4PA 2WW4A 2ZDPA 5CD4A 1SKRA 4TYAA 3FEYB 1V5IB 5KOWA 4OHVA 5BYSA 2D3OR 2AGPA 1S0NA 4XPEA 1QVGR 1TL5A 1K0VA 2DK2A 2YX1A 1SH0A 3RB4A 1I6JA 2HHPA 4OZ1A 1C1BB 1EX8A 2PFDA 2POKA 4NLSA 1H73A 2CPIA 3NWRA 3IS9B 4Y2KA 4P72A 1DTTA 2RSQA 4JI3J 1JK9B 3P6YC 3GFHA 2IJRA 2OPRA 3KLFA 4ES2A 3GFZA 4DQPA 3MGJA 2RQMA 3K5LA 5KG6A 1Y7PA 5KFTA 1Y0HA 3D3CJ 2Z0GA 1TL1A 3N6LA 1HNXJ 2MYFA 4DV6J 3GIRA 2WZ1A 3NXZA 3W63A 4NA1A 1TZ0A 2R2TA 3T3FA 1RHUB 2DR7A 4ECXA 3G8QA 2AX0A 3AQPA 5AE1A 2F9DA 2FJXA 3ICLA 3MM5A 4RJVA 4C0BA 2VOPA 1N5VA 4C11A 4DR6J 4TU8A 1YHQS 2FVRA 4KH1B 4PG5A 4UF4A 1EKRA 2HRUA 1WC4A 3A1YG 5T41A 4MYTA 4LF4F 1U6BA 2CUYA 2FGCA 2MJUA 2Z2MA 3JSMA 2BEFA 1R8CA 4U8YA 3R5GA 2PT0A 4OI3A 3N01A 4OYBA 1NB2A 4LQ3A 3MR6A 1NK7A 5KFWA 2GGPA 2B51A 1TVRB 2IVMA 1X0FA 2FJDB 1HBUB 2DGXA 2N82B 1PCAA 4U96A 4DX7A 3ENQA 4NRTA 4FF1A 2F4FA 2EC0A 3MAAA 1NK5A 4FXDA 3V6DA 3I87A 1SJQA 3D7SB 3WBZA 3MOZA 1RAFB 4ID5B 2QZ8A 3HHLB 2IJFA 1SIZA 1B99A 1F9FA 1YDLA 2ZBCA 3RW7A 3TJAA 3KYLA 1QAIA 5GADU 1TKZB 3VAHA 2FVQA 3C2PA 1RISA 1S9EB 1SC6A 4TY9A 2L3MA 2B0GA 4CDIA 4DV0J 4ZJQA 2IMWP 2RKIA 3MPUB 1P9YA 1BGXT 2XMVA 2EFVA 3CCVS 3PR4A 2CIMA 1CEZA 1YVFA 2ASDA 2W4DA 1XERA 4OJGA 1CQNA 2GQQA 2V2ZA 3AODA 2VBWA 4BLGA 1NEEA 1RCXB 1RU1A 1N0VC 4R8UB 1SJ1A 2LCWA 4ZPTR 5ETRA 4HR2A 3E51A 3E8OA 3JB9k 2DXEA 2FHOB 4NLDA 1FVQA 1IM6A 1X7VA 3BYPA 5CCLA 1J5OA 4C8KA 1CVJA 5L39A 2PIIA 2J8SA 4M95A 2DNHA 2XMMA 4GC7A 2IIHA 2QO3A 2AJQA 5D77A 3MR7A 1OWXA 4W92B 3H8YA 2OHDA 1M5OC 1NRKA 3P96A 4TXSA 2HBQB 1G4CA 3FC9A 1C0UB 1HNIB 3QFHA 3MF5A 3KTQA 3D5MA 3KLIA 2QYGA 1XR5A 2BW7A 1OY8A 1MW7A 1NDCA 4FVMA 4O4GA 4GC6A 4A8KA 3W61A 1KLMA 2QA4S 4K4ZA 1U1PA 4ICLB 1KD1T 1OYEA 5HQLA 4K4UA 3OSNA 2VA3A 4URGA 2YKPA 3ISND 4EBEA 1C4CA 1AZSA 2DNYA 2MHNA 3AQOA 4ED4A 3NAIA 3HJFA 4O3OA 4DR6F 1U25A 2LQ8A 4NMXA 1B7YB 2MMYA 2W2PP 2F1FA 5ETNA 2HGMA 1XNQJ 1HHTP 2RILA 2LDYA 2Y3YA 2VPWB 2PDAA 3N28A 1M5HA 1Y5LB 2VG6A 3SCIE 1N56A 4UTGA 3DMJB 2W01A 1VBZA 4IRDA 1LQ9A 1T95A 1RA6A 3ILIA 3A8KA 2HGLA 2H5IB 3CDWA 3CCQS 4X4VA 2I5JA 2RB7A 1SL1A 3BGLA 3PO4A 3G9CA 3RRHA 1TV6B 3IN5A 2XS5A 2BX6A 4C0OC 4ZCIA 1Q1KA 1UVJA 2DKOB 2CRLA 2DRDA 2IRYA 2FVSA 2YPYA 5KG5A 4LF7J 3TQ1A 3GG0A 3UN5A 2I6WA 4NXMJ 3I0RB 3SV3A 4AE5A 4XIUA 3QSYB 1WHXA 5DM6Q 2I8EA 1RU2A 3WQPA 2JNJA 3AJDA 2QMXA 3V2UC 3T1YJ 1YG0A 1S0VA 3CMES 3VAMA 3QRPA 5E3CA 2GMHA 3CIMA 3NNHA 2N3LA 2VFVA 3O3LA 1TMMA 4P71A 5IC6B 3EYZA 1EKSA 2I0XA 3CSKA 4WFBQ 2M4MA 1T03B 4LFCJ 1N54B 2YWKA 5FDLA 5IT9U 2DYAA 3BGOP 2KKHA 5KT2A 4I69A 3FK4A 4AXJA 2KM8B 5EN1A 4O3RA 1IR2A 2VG6B 3GIJA 1O6XA 3U7JA 5J1EB 5D8HB 2Y0SD 4Y3CA 4ZVGA 5LMUJ 3HK2A 2XLIA 2JH3A 2FLLA 5F3TA 3BGRB 3QWUA 4YR2A 1RWKB 2D3UA 5CYQA 5LL6d 1A6LA 1AROP 2FHMA 1RT4B 2FD2A 3FNNA 4NEYA 4ZVEA 3NS6A 3TX8A 4X65J 3D9BA 5KG3A 1NB7A 1JXVA 3CJ5A 1KDNA 2KXFA 3PJ9A 4KAIA 3KK2A 4FVCA 4NXNF 3K0JA 2MLZA 1VQMS 1N36J 1HBOB 3THTA 2IA0A 4GVBA 5E5NA 2L41A 4EYHB 1S4FA 2PO4A 1VRQC 2VFSA 1I5OB 3FRYA 2UUTA 3X1LB 1FEHA 2DHAA 2DNZA 3HSDA 5D0GA 4DV1J 2Y1LB 5CH7B 3PDNA 3GFYA 5DG9A 4KGVB 2XS7A 2DR5A 3HHEA 2YVSA 2LKZA 1T03A 1IBKJ 1C1CA 2XSJB 2IRXA 2YKOA 2XMKA 2DNQA 2Y9HA 5B0EA 4IUFA 1XNQF 1IXKA 3GYXB 5CABA 1F0XA 2C2KB 3IWXA 3ETOA 3NWGA 1HWUA 3OR2B 3CVKA 4RW9A 4CM0A 2MQNA 3BREA 4MIAA 5I3PA 1R3NA 1X9SA 5HANA 2PMZD 4O0NA 3POTA 3AOBA 3OTEA 4IH5A 2NXCA 4MK8A 4GRSA 5KFBA 4HYKA 3AXKA 3MOJB 1XIQA 1VRTA 2ZE2B 5EWGA 5HI7A 1VK3A 4IDKA 3K17A 3TZYA 4WCEQ 3DFEA 3BN4A 1Q0NA 2RU9A 4FP9A 2JVOA 3MCOA 4ECYA 3NGSA 5KFDA 1KFDA 1U48A 3O2IA 4CYUB 1RHKB 4NLYA 1JLEB 1UFLA 3RR7A 3Q86A 5E3RA 2DXFA 2GAGC 4KV8B 3W2WA 1FTCA 3OFEA 2CVEA 2ATLA 3SCJE 1E6YA 5DJBA 3D6FB 4HI1A 1WSRA 1YI2S 3I55S 5E3AA 1X9WA 3DDKA 4ETXA 2QC3A 5C24A 3HHLD 1N33J 8ATCB 3JQMA 2V0NA 5B08A 3OW2R 3DRXA 2QFIA 3K7RA 2DEJA 1EETB 3D4JA 4M63A 5F8MA 5DDRC 1F9HA 1ZZFA 2ZJQQ 4LF5J 3NS5A 5DO2A 3TYTA 4DS5A 1IKWB 3SCLE 2CZ4A 1TMJA 2BR0A 3DOKB 4DR7F 3PW0A 3W8PA 3N0VA 3OLBA 2V4QA 2XBPA 1QTNB 2EKNA 4UOHA 3ZZUA 3I56S 3G71S 3OL8A 1I3OB 2LXUA 3MEDA 2GIFA 4ZPWR 3GU0A 1IBLF 3SIPB 5CA5A 5DDQC 4MJKA 3VAJA 1B64A 4DZDA 1KHVA 3LAKA 1DLOB 5LSOA 1MMNA 2W9BB 1WKKA 2MKSA 2WOMB 3PTWA 2M52A 4NLXA 3G8SA 4N7TA 2P5VA 4CLWA 4LF2A 2VBXA 3TAPA 2IJNA 1QAJA 2BRKA 2GA7A 4PXEA 2V63A 2BOAA 2F9JA 2YTCA 3BH7B 4IO1A 4ANCA 3TZXA 4K50A 1ZA2B 3DM2A 5J2MB 4DQSA 1B0PA 4YFUA 4DV5J 4DPWA 1FKOA 1FX4A 2KRBA 2OO4A 2QT7A 4XDCA 4CH0S 3UD3P 1IN0A 1B0VA 3W1YC 3DHWC 2H9ZA 1XMOF 3R7NB 3NOCA 4FDFA 4Q8FA 2HFZA 2VU5A 3KUEA 3QFWA 4KE5A 3P5BP 1G1XA 1FJGF 2GHWA 3DNCA 4B3TF 3PM9A 3UDCA 5HMZA 3VAIA 4CLUA 3SQOP 2DNMA 1V6HA 2LA6A 2Z2LA 4LBHA 1Y00A 4Q2MA 4ZVFA 2YKNB 3FCWA 4Q2LA 5SUHA 3CJ2A 4LF1A 5T7LB 5CZVA 3VGTA 4X4OA 2MQPA 4N76A 1Y10A 2V8VA 3A3NB 1PGZA 2YXLA 2AKWB 4HACB 4LF4J 2F63A 2E1MC 1SIWB 4M94A 1NH8A 1PYSB 2HFVA 4BDPA 3PR5B 2JL9A 2W2QP 1SJFA 4QBUA 3MECA 3R6LB 2UUCJ 4LSLA 2QTWA 3LP0A 2GX8A 4RW9B 3UDLA 4LF9J 4TQRA 2NZ4A 1LWEB 1WKLA 2GAHC 1NDKA 2PI5A 3Q83A 1UVIA 4OYXA 2CPYA 2VPYB 1WG1A 3LQVA 1FE0A 2HNZB 3I96A 5KFLA 3ZXWA 3RBEA 2GZOA 3BBCA 4GKKJ 3K8VA 1DHMA 4AL5A 1VQNS 3PY8A 1DAXA 2XMUA 1GX6A 3WX8A 3W65A 2V6AA 1UTAA 2VKRA 2RQCA 4DUYF 2LECA 3PW2A 4DG1A 1SQGA 4CLSA 3M8PB 2HFUA 2ASYA 2CVIA 3IRXB 4GO7X 3W9JA 4C0HA 5HLFB 4AQYF 4OLPA 2BYCA 3DLGA 1QDUB 3H20A 1UVKA 2EFOA 2VASA 3VWSA 1KKHA 4LFAJ 2JHEA 1M5SA 2EWHA 2LP4A 5T14A 5HP1B 4UY8T 4HACA 1HWIA 1QY7A 2CXEA 1C1BA 2J8AA 1HWKA 5A8KA 1WEYA 4U7UK 3MWBA 3J7AN 4CM2A 2DR9A 5F8LA 3KLFB 4EMDA 2KYXA 5EUHA 1NNDA 1URRA 3WDOA 2V4RA 4B9VA 1RTHA 4L73A 5IC4B 3C16B 1N8RT 1LWEA 1EHWA 4ZPBA 2IFXA 3KK1B 4OI6A 2VC1A 4LF8J 3O1LA 2RJZA 5H9FJ 5BXIA 1HYSA 1MWYA 4PG4A 1E6YB 1Q86T 2XS2A 4RW6A 2OSRA 4OYPA 2HHUA 1Q95G 5A2QY 4PYDA 2HS0A 1PYTA 2W2OP 2KT2A 1HNZJ 3MMCB 5BJRA 1P27B 4DFPA 4DL2A 1XR7A 1NJYA 1NCLA 2YKQA 2QSFA 4NPOA 3LTOA 4WFYA 4ES3A 2HHHJ 3CWJA 5ETTA 3IBFB 3C6TA 4RUCA 1N4LA 2HQIA 2UUAJ 1WACA 2B4UA 4LRDA 3MUTP 5F41A 5A8WA 1BY9A 3FCHA 5KG7A 1OSDA 3OR1A 4FPRA 2E1RA 3R2DJ 1LK5A 3KMSA 4OYIA 2IPOB 3CW2C 2BANB 3BBFA 3M8YA 4HLBA 5I3QA 1U4BA 1ROFA 2GGPB 2CJQA 1KQGB 1S6QB 2PEHA 3EE3A 4F0HA 5HVGA 4B9NA 4DQIA 3EDQB 3QATA 3G6XA 4FYDA 2NR0A 3J81Y 1T9TA 2YNHB 4WP3A 5DZ6A 2CPXA 4Y28C 2CZ9A 4DL3A 1S6OA 4KQZA 3O6QA 2NSBA 3QGHA 4AXIA 4Q8EA 1E6VA 4G1QB 4F3MA 2IDEA 1MLAA 1MU2A 4K5SA 1RT7A 5LJ5Y 4RUAA 5AJ3J 4J9PA 3DKDA 4NCGA 3HZGA 1O0PA 1U8WA 3B54A 5KFYA 2XY6A 4DV4J 3MMBB 5ITHA 1YJNS 3IR6B 4U8VA 1IWGA 1HBMA 1ZAXA 1A0OB 2AX1A 3VZHA 4DL6A 4A8XA 4IG0A 4U95A 2CPDA 1RBAA 1EQMA 1NPKA 1PBAA 1RI7A 1YJVA 2RUGA 3B4MA 3GV5B 3EPIA 2K1RA 1VQSA 1FDDA 2GVZA 2JJ4D 3MM5B 4KT0C 4K4VA 2GIQA 1RJJA 4MFBA 3HULA 4ZA1A 2W2NP 1QUVA 2LQBA 3KG0A 1ZM2A 2O01C 4DR2J 7FD1A 4YB5A 4YR0A 2GCFA 3KG4A 1FJEB 1Y9OA 1EJ7L 5LSLA 2KVQE 1JLBA 2RNEA 1S99A 2CPEA 4LIRA 4ZVTB 1YBAA 3FSIA 4ED0A 1U6ZA 1FCAA 1F6TA 4QIFA 3S1TA 2ASJA 2N4DA 1A7GE 3CB4A 1LW2B 1CULB 2R3VA 4Y00A 4ZMMA 5KFFA 3H5UA 3D67A 4MK9A 2WRMA 5KFGA 2ZH7A 2XHCA 3PEJA 1W7WA 3TQEA 4CQ1A 4ELUA 4QWEA 2KFZA 2AEJA 1U1QA 1K73T 2XULA 3IO1A 1BWEA 2VG5B 4ZVUB 2VKZG 3EXCX 3MM9A 4DPYA 1BC6A 3CCJS 2DIVA 4O44B 1FO1A 5HMYA 1JXLA 2M70A 4CYUA 2QE5A 3OXGA 4NZ7A 3MCNA 2CQ3A 3LAMA 3L4BC 2B4VA 4R0EA 1FWPA 3CMAS 3T1HF 4NXMF 4YR3A 3KLGA 2HHHF 4TLRA 2GS8A 2VFRA 2A2CA 1WNEA 3GYGA 4BC7A 1Q8BA 2Q79A 3SBMA 1VQ8S 2KFNA 2CJXB 3L7OA 2V4JB 5J1NA 5GADI 1ITPA 3HF5A 4KSEB 1I94J 4KPYA 1KLNA 4LF7F 3HX9A 1CQMA 4LFCF 3DLGB 1JKHA 1REGX 1UMJA 4WU3A 2MLXA 4NLWA 3UNGC 2EXUA 4F25A 2RRAA 1DTQA 2WSEC 1W2BR 1G2EA 4C3KA 2O5DA 4IRCA 5KFZA 1H2TZ 1RAOA 1H3DA 2C3OA 2HAIA 3I31A 1NSQA 1H2UX 2MGZA 3DLLQ 1C1CB 2XSJA 2CPJA 4TKTA 3VR1A 4GVBB 3UN2A 4DQRA 1X5TA 1IWAA 1S49A 2M7SA 3LUYA 3D3BJ 5ETQA 1B4SA 3R5BA 5KFXA 1N5TA 3IGVA 3TZZA 5IT0A 3FBCA 4C97A 1NK0A 1J5EJ 4M5KA 4R5PB 5F8JA 3WZ0A 1NHUA 3R5CA 2C2ZB 1F1BB 1HMVB 9RUBA 3SYZA 4B3SJ 2YH1A 3OL9A 4IFVA 2HVIA 2XNQA 1HNVB 4RW7B 3OT9A 4PG6A 1X4DA 2YY3A 3H59A 1RACB 5BR8J 4C8OA 4CCHA 2X1FA 2VQFF 2VV5A 2Z57B 1X0PA 4PAAA 2R7RA 4UZBA 2PI4A 2YWFA 2HWHA 4WIQA 4ZCKA 1KWMA 5H9EK 1S6QA 1Z2ZA 5F0WA 2M2BA 4CRJA 3BKUA 3FEXB 5B0BA 2A0FB 2AW0A 2CNKB 1S7IA 2L9WA 2WHOA 3CTRA 4O3PA 3MEEB 1YIJS 4V19X 4Q43A 2V34A 2I9SA 4OI0A 4USMA 3OFGA 3DLKA 4FNHA 3C6UA 3GB0A 3BQ1A 3EGWB 2UP1A 4BS2A 3UVJB 4ZN1A 4W98A 5HJXA 1GTEA 3R8YA 1HNWF 2MSTA 4P6QA 2KG1A 1LW0B 2Y1JA 1N33F 1RWPB 1WC3A 4ZLNA 1T11A 5C25B 3UW1A 5FDLB 1IKYA 4PQUB 3QRQA 3MMAA 4WU2A 2NS1B 5SZTA 2PMWA 3TUPA 3DYAB 4NLRA 2BV3A 1RWWB 5CHCB 2QLWA 5K14B 3TJ9A 1RWOB 3QGIA 1GMUA 1NSPA 4KYZA 1AUDA 4FYVB 1LW2A 2DEIA 1X4FA 2VH7A 3CD5A 2RKIB 3MCSA 4LJMA 3AD7C 2KH9A 4NE9C 2IRUA 4OQJA 1RHJB 4C6AA 5C7PA 2JC0A 4DFKA 1I94F 3FFIA 5J2NB 1YJ9S 2VHGA 4D3HA 5AXKA 3W60A 1QVFR 4ZPVR 1U49A 4Z37A 2X1AA 2AJ2A 4F04B 3SQGB 3W7BA 2RDDA 3DRSB 4ZVQB 5U47A 3HSGA 2ZBQA 4X4TA 4FS1A 2KZZA 3GFXA 3QNWB 1VQOS 2HVEA 2AYMA 1JQGA 2XY5A 3UNYA 3D0GE 3HPOA 4NYOA 3UWTA 2V5HG 2VQEJ 2CQHA 3NRBA 1VRUB 3Q8VA 3CCWA 4CO3A 5HVHA 4K4WA 2LXFA 2LQ9A 2J0WA 3S7RA 2HRYA 3S01A 3W9HA 1U09A 3EVOA 1RWMB 2Y1RI 5KFCA 3KHGA 3BJYA 5HLFA 1HI1A 1X4CA 3MPVA 4A4JA 2HPUA 2JX2A 3Q8YA 1HFEL 4DZ6A 2MQOA 2YWGA 4CLZA 3KLEB 4DUZJ 4DSJA 4LRFA 2HG4A 3ENVA 1IJEB 2JLEA 5K8OA 4LRCA 4LF9F 4AL6A 1H72C 2EC2A 1IKXB 1HBNB 2EEYA 4CLFA 3GILA 2RMLA 4DSIA 4LVOP 3W2WB 3DLBA 1YBTA 3AA9A 1AB8A 4LBPA 1ZTWA 1XJWB 3HFKA 2M8DB 3TA1A 3CPWR 2XEXA 2HQCA 2CZVC 1RT1A 1S7HA 2QG9B 4OJ3A 3VAGA 1S0OA 4DFMA 3SSQA 2R42A 2J6UA 5K14A 4JI0F 1M5KC 3NCRA 2ZM6J 3QLHA 1HNZF 3KLGB 1BD6A 4WXOA 3HXMA 2UV8G 4C3LA 2KHDA 4WYLA 4PWDA 5A6PA 1JNZB 3D68A 1BMQB 2LYVA 4DUZF 4KGKA 4UT4A 1I1GA 2YNGB 1CG2A 3I5AA 4DL7A 3LOUA 1KSPA 1MWZA 1HW8A 1RE1B 1K1QA 2J5AA 3POTB 4HH0A 3MEGB 5LXYA 3N5BA 5M2PA 4DLEA 5KG2A 1D9DA 3ILLA 2QN6B 3V4MA 2W8KA 1WHYA 1QE1A 2XYHB 4KB7A 2C2RA 3BB5A 4Y2MA 2QLFB 5LOQA 1P1LA 5KFQA 2BKPA 1HL6A 2XB2D 2W9CA 2BJ1A 2IHR1 4O4RA 3I0SA 3UN3A 3BM7A 2KJVA 1GXLA 1N5YB 4OHYA 2OKQA 2AEMA 5IT9Y 1DZ5A 3M30B 3ZO7A 4IFYA 2WBMA 4TY8B 4IH6A 4J9RA 4X4SA 1AFJA 1F60B 2V69A 3DM2B 1RTDB 1IM4A 1EP4A 4LSZB 2NLWA 1RTHB 1WSVA 4B9UA 2KI2A 4OIXA 2Y1IA 2ZWOA 3CCUS 3NMRA 2HW3A 5J2PA 4FZVA 4Y2AA 3K8WA 1WEXA 2DCLA 1VBYA 3L3CA 2OH2A 5I4MA 2IYIA 2QA2A 5D78A 3ITHB 3I4HX 2HHTA 5DQHA 1KTQA 1WOOA 4EI2A 4IG0B 3A8JA 5KFHA 2N7YA 4U7UD 1TL3A 2H48B 3BQ0A 1B70B 4B9TA 2RHQB 4L3NA 3FQLA 3G87A 2IM2A 2HZCA 3JTOA 2AU0A 3QT7A 3M8RA 1YBUA 4R25A 3VCDA 1NKEA 1CS4B 2HNYA 1QSSA 5JJBA 2QLBB 2D1CA 3SCKE 4DQQA 2BUNA 2D3ZA 1XEZA 2WTFA 4F50A 1ZZNA 1RT5B 4WPAA 4P52A 5DLGA 2D41A 3HP6A 1L3VA 1KVKA 1VHIA 2M88A 2X1BA 3WX4A 1RAJA 3J7YI 4DN9A 2JWNA 2I1RA 2OGUA 3QGGA 2AP6A 2MKHA 3DGPB 3MURP 1R8HA 1RSCA 2ZH5A 1SKSA 1AUSL 2KB2A 4CTAB 4KH0B 2MPUA 1FD2A 3BS9A 3BEGB 4AYBD 1S6UA 3OR1B 4NASA 1F3VA 3PJWA 5G0RA 1TUWA 3VTIA 4JI6F 2MZ1A 1X4GA 4YB6A 1TKTB 2ZH4A 4AQYJ 3MZIA 4MT1A 4PCQA 4BWJA 3ENWA 3DLEB 2KM8C 4NCAA 3ZZOA 1FTRA 2CG8A 4NZ0A 5K8PA 2JZ5A 1CJUA 1RK8A 3BR8A 4M8LA 3DLHA 4ILLA 4F7VA 1LWCA 3IBWA 3CD6S 2AHOB 3GJRB 4NI2A 4WXWA 3T41A 3RW6A 2FTRA 2LEBA 2DBBA 5DQIA 3F56A 1LNQA 2V9KA 3MAHA 1ZAWA 3M2RA 4PPDA 3QO9A 4RO0A 5KFNA 1H38A 3ZZZA 5C42B 3MR2A 3QLHB 5HQ8A 3OPKA 2J76E 2HNYB 3GYNA 3HCXA 2FHJD 1REVA 2E5JA 4NOHA 2VZ9A 3RZAA 3EM1A 2R4FA 3SDEA 3W5ZA 1X4HA 3D0HE 4PQAA 4I2QB 2J6TA 1OQ6A 3QJJA 2FVPA 1UP1A 4ZS6A 1JJ4A 4B3RF 1WTFA 3T6BA 1T7PA 4JI6J 1VQ6S 2YKAA 1IR0A 2AYEA 4ZKAA 3EDRB 3TVYA 3J81U 2HSEB 2WBRA 3P4UB 2YQ3A 2AJ1A 2DISA 2CNNB 5KG0A 1CS4A 3GQCA 5LMNF 1APSA 4OL8A 3EICA 3RRKA 1PAUB 1FRJA 4KC5A 2HS4A 1MG7A 1SC4B 3LGMA 4LREA 5DZ7A 4Q45A 1S1UA 1SL0A 3R2CJ 1LK7A 1TKXB 4QPXA 4IG3A 3SI8A 4OFZA 2XZWA 1KLMB 1Y5IB 2DGUA 1LKZA 3CT9A 1HA1A 1HIYA 4B9MA 4KHRA 5EHHA 4QW9A 3AFGA 1R31A 2PMHA 3Q0AA 4C3MA 3PX0A 1NUEA 4WFNQ 1ZYQA 2RH3A 2QFJA 1TKDA 2DO0A 2O3DA 2AGQA 4NEZA 2DRBA 3MTJA 1NLKL 1EZZB 1S97A 2IVFB 1OMSA 3KG1A 5IQQA 1NDLA 3QWPA 3JSYA 1Q4RA 4F2SA 1YQHA 1DY3A 2EKYA 3CJ0A 5GAEI 3EPGA 1NJIT 1Q7LB 3TWZA 1TFWA 3IRWP 2W4PA 1XQIA 5KFRA 5HJYA 1NHKL 2F3JA 1KN6A 1R27B 4ZLPA 2JLGA 4K4TA 2C3UA 1WELA 1S10A 4UY85 3L95X 3KMQA 3PFEA 5T7LA 2N7CA 2ZH3A 4PRFA 5FLXY 1VIOA 4QQBA 3MEKA 5I3UB 4WFXA 3E01B 2HMIB 2CA9A 2JVRA 1ZA1B 3A3OB 4IDKB 4OYMA 2J0XA 3W3SA 4K0KF 1FJCA 3CMQA 3TZWA 5A6WA 3QT5A 2DGWA 3HHLC 2F7VA 3NS7B 3JYTB 4K4YA 1OIAA 3MPDA 4ZLLA 2FGOA 2GV1A 4DMZA 4JI3F 1JLAA 1UETA 3H2LA 1JX4A 2M9KA 1VQLS 4I56A 1LWXA 4JYAF 2HHXA 4RW6B 4P7VA 2DH9A 3MM6A 4RKUC 1U24A 1AXQA 4TN2A 4URQU 3WC0A 2E5LJ 3H25A 1P6TA 1YRTA 3AJ1A 2HBZB 4BBYA 5DGBA 5K9FA 2BBEA 3CXCR 2HQFA 4OMFG 2F4VJ 1DQ8A 2BW2A 2WCXA 3T5JA 3RR8A 3GCWP 4RBTA 2O66A 2PFFB 1UVLA 2DNGA 2B5JB 2J9CA 1HNVA 3AHPA 4MKVA 1MROB 1V3RA 2F40A 2JOQA 3OXFA 4OZLA 4RW7A 4IO9Q 3FSXA 3NBPA 1PILA 3NP5A 4DL0C 3J81j 1D0EA 1MSWD 4ALZA 1HD0A 1NKBA 5MLCV 5EGYA 3C15B 2R8KA 1RKIA 3MHYA 4I1TA 3GG1A 3ENAA 3UCUP 2QV6A 4PXBA 1SUQA 3RTVA 7AT1B 4FF4A 1Z2LA 2OAUA 4KHMA 4P2SA 1HMVA 1F5BA 3CNQP 4PXCA 3UQSA 2ZKTA 2XGQA 2XWXA 5FD1A 2DHXA 3M2UB 1VQPS 4DSLA 1RT4A 2CQ1A 1H2VZ 5D4OA 2VJUA 2CYYA 1KNZA 1VYAA 2XSFA 3OHBA 3PFOA 2IAJA 4CWBA 1RLCL 2OPQB 3LP1A 3J7A1 1GMWD 3G6YA 3OXLA 3FVYA 4RR5A 2WVBA 5HBMB 4ECRA 1EAYC 2DNKA 5HROA 3FFIB 1JJHA 1YJUA 2EFGA 3OTBA 1WORA 2GC8A 4K2JA 1LFPA 3IWNC 1CC7A 3G4SS 2BJ7A 1V3ZA 1SQFA 3F0NA 4YEAA 3VGVA 3R5AA 5FIIA 3BO4A 2E9RX 2FZCB 4KHPF 3HZEA 3SDEB 1S77D 2K8GA 1QE1B 4FXVA 4KBIA 4NZ6A 4PEOA 4DI6A 3QJPA 1OQ3A 1RTZA 2CADA 2G0IA 4J90A 4QIEA 2E5GA 2YNFA 5IQ6A 3OL7A 3H4DA 1N34J 2UXDJ 3QAUA 2KT5A 2HFNA 4LR7A 4J5OA 3OBIA 4DPXA 4WK3A 4CO2A 3FBEA 2DCUB 3LANA 4NMLA 4I67A 5D6GA 2B3TB 1M5VC 1C2PA 1TL7B 3LPYA 1GMVA 3WIUA 4KR0B 4X66F 2A10A 1ZPVA 2P9EA 5HAOA 4IKAA 4YOEA 4WBFA 2DT9A 2BA9A 2G1HA 4L72B 2R7OA 3NGDA 3G6ES 4ED5A 3DRPB 4CLPA 4X64J 1YRXA 1IKVB 2HLTA 2Z2ZA 3H5XA 2R7TA 2PE8A 3HD1A 4NYPA 2BJDA 4F0KA 5AE3A 5F8IA 2CQPA 2E1AA 1JLQB 4YB1P 2GIRA 2KXNB 1FXRA 4QWCA 2X51A 1K8AT 1R43A 1S1XA 2CPHA 2DGSA 3OFHA 3HJVA 3CDUA 3PEHA 4YY3J 1RZMA 1YJWS 4EUVA 2MKYA 2LDIA 1XC9A 4IFVB 4A8YA 2CKWA 2IC3B 3G2XA 1HR0J 2B6AA 4QIGA 3C14A 4UQGA 3LP1B 2ZD1A 3CCRS 3R27A 5DG8A 3K58A 2WONA 1VQ9S 4FN5A 1D8ZA 4LQ9A 2CPZA 3RBDA 4DFJA 3TOQA 1X4EA 3UDVA 4A8MP 4LF5F 4USUA 4FXWA 1FERA 2JDJA 3OHAA 3KJNB 3KWMA 4KGZB 5KFIA 3QT6A 3T5KA 1XNRJ 1NPPA 1NXIA 3PYDA 3QGPA 4LFBF 4IOAQ 3MM7A 3R7BB 1KEKA 1IKWA 1QSYA 1OYDA 3C8YA 4DV6F 3IG1B 5A0YB 1V5VA 3BSCA 1VHFA 3HVTB 4L6V3 2CWKA 2MEWA 4CIOA 3ZTPA 1TAUA 1PJ5A 4CZCA 2Z30B 3PHTA 2B9EA 5KFKA 3C46A 2E9ZA 1KONA 2AGOA 2Y0BB 2VPZB 2DITA 4MAKA 1GXUA 3US5A 3CJ4A 4URSA 2VJVA 3WC2A 1NK6A 3H0PA 4ANEA 3DYAA 2HWIA 4FYWB 1Q53A 2X3GA 5LXRA 2JEGA 4H4OB 3T9ZA 4EK2A 1RAAB 3NCPA 3KNGA 1R8AA 3KDNA 4UUXA 3UD4P 1UA0A 1T0TV 1CJUB 5DETA 3KLHB 2V2QA 4NLTA 4PZVA 5B0FA 1GQEA 1QAYA 2VG5A 4KHPJ 2YNIB 1XMQF 4JOUA 2D9OA 4CLLA 2AD9A 4JI5J 1XMOJ 3DLKB 2DJWA 2E7WA 2P6TA 2ZVSA 3GLJA 4K5RA 5RUBA 1KQSR 3E2EA 2RHSB 3UO0A 1C4AA 2E29A 2U1AA 3ZTRA 2PEBA 3CCSS 2PGCA 3HVWA 3H5SA 4C8MA 2CQCA 5AXMA 5JXSA 5KT3A 3MUVP 2UVRA 1YZ7A 4NLPA 4DV2F 4QCLA 3HVTA 1OPIA 2BE2B 3B78A 4M5HA 4PABA 4M5MA 3QT8A 3F73A 1RT5A 1FRHA 3M8ZA 5HATA 2NCKL 3SSRA 4G3IA 1RT6A 2YH0A 4I6YA 3BR9A 4USJC 5CZXA 4WF9Q 2UU9F 4XPCA 2F8EX 2OIHA 2BRLA 3TO8A 1JLFA 1TTHB 3D6HB 1NM2A 4ZPCA 5EX0A 1RCOB 1CJVA 3GWCA 3V4IA 4OJ1A 4X4UA 2F8MA 2LQJA 2RS8A 3N9UC 3KJQB 4ELVA 4HVZA 1HQEB 2OFGX 1OY6A 3BSAA 3KLIB 4KGMA 4O4GB 1SKUB 3PNIA 4CP5A 4DR1F 2AMCB 2EG1A 1HBMB 1HQUA 1OO0B 1X5SA 3B4DA 3R6GB 4ZHRA 1KC8T 4LF8F 2FDNA 2ZH9A 3MMJA 3G86A 2YNHA 3MPWA 3F44A 4HL9A 3CJKA 2JEFA 1IBKF 5D15A 3M9NB 3GIIA 3V6HA 3TRGA 2PA3A 1L3SA 1JLQA 2U2FA 1L3KA 2IBKA 1O5JA 4OHXA 5J2QA 3ZNUA 1EARA 3CGIA 1G7CB 3E3XA 4ED7A 2ZZNA 3GPAA 1J27A 1GAOA 4DEZA 5HSPA 1UPPA 3IAS9 4IQXA 1ZPWX 5HMXA 3W2VA 2V8HA 3K5OA 4QW8A 2BE2A 4HTJA 2OPRB 1CJKB 4UZCA 1OS5A 4LF6J 2BACA 2MQQA 4I2QA 1F3FA 1ZM4A 3I32A 4USHA 4N8NA 3UE2A 3ZTSA 4V19J 4C4WA 1C0TA 5HK4A 2ZEJA 4LR8A 5D4LA 2UVWA 4HH1A 4DV4F 1VR6A 4F3OA 1KS2A 1BHNA 3HFVA 2HS3A 1NJWA 1S76D 1K0TA 2H3EB 1FXDA 1YTYA 4KGXB 4ZITA 3HSZA 4WFZA 4Z7CA 3OLAA 4F4XA 2HBRB 5I3UA 2W25A 2HMIA 4ELTA 3QQCD 3KHRA 5I42B 2GJFA 3JAMY 1LWCB 3JYTA 3RAMA 1NMEB 1RTJB 3MMCA 1M1GA 4BCAA 1VQ4S 4A8QA 2B4PA 3FMWA 3DC2A 3FEZA 2OPSB 3I0RA 3QO9B 4J9VA 3C6UB 4Q44A 1MMLA 3MAAB 4L76A 1NZAA 1U47A 1FX2A 3GE9A 1TELA 4CO5A 5LSRA 2F4VF 2FLPA 1LW0A 3C66A 4OI2A 4F26A 5DLFA 2R8GA 4QWDA 2AYGA 2DHHA 4ILMA 4KPCA 3AJ2A 1HI0P 1CLFA 4A47A 4HTIA 4NX9A 5EDWA 4UOCA 2LEPA 3CCMS 3HHDA 1RHMB 3M8SA 5GMKa 1RWXB 2RQKA 1TL3B 5JUMA 4DR2F 3MM7B 1WD6A 3V81A 1D8YA 5FJ4A 3JSRA 1DARA 2GQCA 2OPPA 2WVDA 1P9QC 4M5IA 2BVZA 2XYPB 4FYYB 4DU7A 4OV6A 3MUMP 1VMBA 2V50A 5KT5A 5DDOC 1QUPA 2XTJP 2L48A 3CC2S 5E3QA 1G3OA 4DR4F 2OMLA 4RZRA 4ILRA 2K3IA 5ETSA 3RUBL 4ECSA 2AYBA 1VISA 1ZM9A 1MNEA 2VONA 3MAQA 1UKUA 5L9NA 1ZM3A 3C19A 3I5CA 3JQKA 2MHEA 3SV4A 3CD7A 4F3QA 2HQ3A 4CO4A 1YSJA 2ASLA 3EVWA 2EFNA 2CFXA 4J7CA 2NXNA 2XI3A 4ZVPB 1DTTB 4DR5J 4F02A 4NLGA 1WC0A 2MZRA 1BUXA 3BKTA 2MLYA 3FBFA 3L7PA 2EFPA 5IM0A 2Q6BA 2WW8A 4XO0A 1VC6A 1O8BA 3G8TA 2VFUA 2KU7A 2RDJA 4FF2A 1F5CA 3P45B 1TP7A 3KNAA 1LWFA 3AB2B 2OUGA 4MMOA 4CT8A 3RAXA 2JEIA 1KOHA 2CDQA 4P2FA 1IQZA 2MY7A 3UCGA 4IOCQ 4P74A 1T3NA 3T5HA 4DV7F 2EBGA 1FK9B 1WF2A 6FDRA 4Y6IA 1TAQA 5B7WA 2YX4A 2AZ3A 4RUBA 1VBXA 5GAGI 4B3MF 3QIPB 1ACMB 3T19A 2J7KA 2MKCA 4Y2IA 6FD1A 4PQUA 1VRTB 3SSSA 3TUJC 1N88A 3KOAA 1FDAA 2ZOMA 4LSNB 4OYZA 2OEJA 4QIVA 3BO3A 2I2YA 2GVDB 2KT3A 3V6DB 4PYAA 4JYAJ 2BZ2A 2J0QD 3O8WA 3DOLB 3OVSA 3VF0B 4UOGA 3FSYA 5L1JA 3CIZA 1RHRB 2EFQA 3H2UB 5ETLA 1RYSA 1HBUA 1RHQB 1TV6A 1M90T 1J5EF 3PO5A 4DJBA 3M8QB 4ZVSB 4YY3F 3KK3A 1XK8A 1H0HB 2OPQA 5J2MA 1CJKA 4DX8H 2HZVA 2ILYA 2O1PA 1PKUA 5L38A 3D2WA 3K2YA 5K20B 4B3MJ 4YUDA 5IS2A 5HROB 2DB1A 1S1TB 4PXDA 1N34F 3HI9A 1OSCA 2ATCB 4M5NA 3ULHA 2G9OA 4F8RA 4F4WA 3TANA 1IVZA 3GZ7A 1NHVA 2HEKA 1EB0A 3DN9A 4I4BA 2NQPA 1PBUA 2F8HA 1SUQB 2LVWA 5A0YA 5BYRA 1UWBB 5J2PB 4CH7A 3VALA 1S4EA 4P10A 4J9LA 3JS9A 5F9NA 3N5FA 4QZVB 1U45A 3RG6A 4O0IA 2MGZB 2Y8WA 3M2UA 3VVTA 1EP4B 2MY8A 2QIFA 2QX0A 3EVMA 2R7WA 4K4XA 5BYQA 4Q5VA 2DD8S 4EEYA 2XG8A 2ZFHA 1A9NB 4X64F 1DTQB 4F36A 3W8GA 2AQ4A 3BGRA 3TEHB 1U2FA 1S1UB 4KIAA 5CYQB 3NY0A 3AAWB 2MKKA 4I2PB 3OL6A 1K44A 3K57A 3HHNB 5JMNA 4XDDA 5KT6A 1UAWA 3K5PA 1QTMA 1FESA 1HD1A 2V8PA 5B0AA 2XLKA 4JI1F 3LP0B 4BHQA 3CD0A 3SFGA 4DV1F 1NJXA 2HHWA 1DQAA 4EFAC 2ZJRQ 4ED2A 2ILZA 4DV3F 1M5PC 1UZHA 1AW0A 3GIKA 3GV7B 2ALZA 2CJBA 1ZETA 1NBEB 4DBQA 2HKEA 5LT5A 1DRZA 3L7UA 2ZH1A 3DRPA 4OLOA 3DLEA 1HNXF 3HHKA 3MM6B 4H4MA 3GJSB 2MKJA 1KR4A 2P6SA 4ED1A 5B0CA 4NI2B 4Q0BB 1U7LA 5L8RC 1TL7A 4X84A 4CTAA 1PAEX 2R2RA 5EX3A 4DV0F 2E7XA 3P5TL 1SC3B 3C16A 3W64A 1N32F 4RU2A 4LT6A 3GP9A 3FUYA 1TKTA 1D1UA 1RWVB 2KO1A 1S1VA 2QEXS 2BOPA 2MTLA 2ZOGA 4DV5F 2C28A 3CC7S 2HHVA 5C25A 2VG7A 4DCPB 2ZM6F 2OJ3A 3HO1A 2FB0A 2DXDA 1DURA 1HLWA 4F4AA 2YBVA 1B3TA 5J1PA 1FKAF 1RB0A 1UFWA 3RJMB 3M32B 4DL5A
chains in the Genus database with same CATH topology
5LMNJ 1FJGJ 4JI8J 4NEYA 4X65J 1XMQJ 4AQYJ 4DV2J 4DR2J 5LM7E 1N32J 2KVQE 1N36J 3IMQJ 4X62J 4LF4J 4DR7J 4DV0J 2VQEJ 2UU9J 4DV1J 4LFBJ 1IBMJ 3JAMU 2UUCJ 1IBLJ 4LF9J 1IBKJ 5IWAJ 4B3SJ 4K0KJ 4DUZJ 4JYAJ 3OTOJ 4JI6J 4PWWA 3J81U 4JI1J 2UXDJ 4GKKJ 1N34J 4JI7J 4DV3J 4DUYJ 4B3TJ 4B3MJ 3R2CJ 2ZM6J 4X66J 4LF6J 2KL8A 4LFAJ 1I94J 4X64J 4KY3A 3J7AN 4NEZA 3J80U 4DR3J 4NXNJ 5FLXU 4LF8J 4YY3J 4OX9J 1XNQJ 3D3BJ 1HR0J 1J5EJ 1N33J 1HNZJ 4LF5J 5BR8J 2HHHJ 3T1HJ 4HHUA 2UUAJ 4JI3J 1XNRJ 4B3RJ 4JI2J 3R2DJ 5A2QU 3D3CJ 1HNXJ 4DV6J 2VQFJ 4LF7J 2MEWA 2UUBJ 4GKJJ 4DV7J 4NXMJ 2UXBJ 4JI0J 2E5LJ 4RJVA 3T1YJ 4DR4J 4YHHJ 4DR6J 2F4VJ 4JV5J 2MQ8A 5AJ3J 4LFCJ 1HNWJ 4DR1J 4JI4J 2MTLA 5IT9U 4DV5J 4DV4J 4KHPJ 3W1YC 4KYZA 4V1Ak 4DR5J 4JI5J 5LMUJ 1XMOJ 2UXCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN J;  1FJG J;  4JI8 J;  4NEY A;  4X65 J;  1XMQ J;  4AQY J;  4DV2 J;  4DR2 J;  5LM7 E;  1N32 J;  2KVQ E;  1N36 J;  3IMQ J;  4X62 J;  4LF4 J;  4DR7 J;  4DV0 J;  2VQE J;  2UU9 J;  4DV1 J;  4LFB J;  1IBM J;  3JAM U;  2UUC J;  1IBL J;  4LF9 J;  1IBK J;  5IWA J;  4B3S J;  4K0K J;  4DUZ J;  4JYA J;  3OTO J;  4JI6 J;  4PWW A;  3J81 U;  4JI1 J;  2UXD J;  4GKK J;  1N34 J;  4JI7 J;  4DV3 J;  4DUY J;  4B3T J;  4B3M J;  3R2C J;  2ZM6 J;  4X66 J;  4LF6 J;  2KL8 A;  4LFA J;  1I94 J;  4X64 J;  4KY3 A;  3J7A N;  4NEZ A;  3J80 U;  4DR3 J;  4NXN J;  5FLX U;  4LF8 J;  4YY3 J;  4OX9 J;  1XNQ J;  3D3B J;  1HR0 J;  1J5E J;  1N33 J;  1HNZ J;  4LF5 J;  5BR8 J;  2HHH J;  3T1H J;  4HHU A;  2UUA J;  4JI3 J;  1XNR J;  4B3R J;  4JI2 J;  3R2D J;  5A2Q U;  3D3C J;  1HNX J;  4DV6 J;  2VQF J;  4LF7 J;  2MEW A;  2UUB J;  4GKJ J;  4DV7 J;  4NXM J;  2UXB J;  4JI0 J;  2E5L J;  4RJV A;  3T1Y J;  4DR4 J;  4YHH J;  4DR6 J;  2F4V J;  4JV5 J;  2MQ8 A;  5AJ3 J;  4LFC J;  1HNW J;  4DR1 J;  4JI4 J;  2MTL A;  5IT9 U;  4DV5 J;  4DV4 J;  4KHP J;  3W1Y C;  4KYZ A;  4V1A k;  4DR5 J;  4JI5 J;  5LMU J;  1XMO J;  2UXC J; 
#chains in the Genus database with same CATH topology
 1YGY A;  1LFW A;  1U1N A;  2YWW A;  3MR5 A;  4KKO B;  3BZQ A;  4QIW D;  3EGZ A;  2W2M P;  1XMQ J;  2ZD1 B;  1QAX A;  2W24 A;  1TVR A;  4MIW A;  4H4K A;  3OTO F;  2KTQ A;  5JVG Q;  3ITH A;  5E33 A;  1L3T A;  4UQT A;  2D3O 1;  4JV2 A;  5KT7 A;  1U6F A;  3PW5 A;  1MN9 A;  1VRU A;  3ZZR A;  4Y2C A;  4ECV A;  3NKY A;  3CDB A;  4PUO B;  4RPF A;  2EW9 A;  1RT2 B;  1GH8 A;  3PXG a;  2LA4 A;  1BE4 A;  1VIX A;  2CQB A;  1S1T A;  3PX6 A;  2YX7 A;  3ETM A;  3KJV B;  2PSZ A;  4PUO A;  3ZZY A;  4IG3 B;  5ETK A;  4AL7 A;  2DIU A;  3K5N A;  5DG7 A;  1S1V B;  4ECT A;  2VF3 A;  3QMQ A;  4KV8 A;  2DNP A;  3PRB A;  4FPI A;  3SXL A;  1X4B A;  2WVC A;  3THP A;  3M8Q A;  1JWW A;  5C2G A;  1YJ7 A;  2RS2 A;  2WB4 A;  4CI0 B;  4OJH A;  3OTO J;  5L1I A;  3A12 A;  1QSL A;  1S12 A;  3JQJ A;  1TL1 B;  3EXY A;  1U8S A;  3OV7 A;  2VUG A;  3PV8 A;  3DOL A;  2Z56 B;  2V68 A;  3G96 A;  3MFH A;  4JBC A;  2C2N A;  3GR1 A;  4ZVO B;  2XMJ A;  4JI7 J;  2E9T A;  1JLA B;  2UUA F;  5G4D A;  4QJV A;  2VIC A;  1EIY B;  2ZNZ A;  3IS9 A;  1RDR A;  1WWH A;  1JLG B;  2QA1 A;  3CJ3 A;  1CPZ A;  3RGI A;  4Y0F A;  1Q82 T;  5KG1 A;  4G1P A;  1GTH A;  5IOL A;  4D3G A;  2KL8 A;  2VC0 A;  3MMA B;  2HRT A;  4DLG A;  1WOS A;  1KVI A;  1VLO A;  4ZPD A;  2ZWP A;  2BQU A;  4CNY A;  3ADA C;  4ZVH A;  4TNO A;  3QRR A;  3AH6 A;  2XYG B;  1BLU A;  2BAB A;  3KK1 A;  4WII A;  4ECU A;  4NLO A;  2P8I A;  2R8H A;  1L5U A;  4IR1 A;  2KN4 A;  2VB6 A;  3R5D A;  2C2M B;  3IG1 A;  2GHP A;  3MM8 A;  3BF4 A;  5AJ3 F;  3EZ5 A;  2UUB F;  4OX9 J;  3UFC X;  3AY0 A;  3OR2 A;  2XC9 A;  3EGV A;  3HD2 A;  3LA0 A;  5IFM A;  2W9A A;  8RUC A;  2OEK A;  4A8F A;  1CUL A;  1VK8 A;  4WZQ A;  5C2C A;  3FJ2 A;  1Q8I A;  2WK4 A;  3W66 A;  4FNI A;  2FZG B;  4ZIW A;  2RT3 A;  1IBM F;  3QJL A;  1VS3 A;  1FKP B;  2K2P A;  2CG4 A;  1IR1 A;  3DCA A;  2OMO A;  1RT7 B;  4HEA 9;  2RVJ A;  4F4Y A;  1T05 B;  5DQG A;  3IAM 9;  3FZ2 A;  2R2S A;  3LGH A;  3B8H A;  2C3P A;  1UCN A;  1ELO A;  1YKW A;  3M6U A;  3MMB A;  4Y65 A;  5B09 A;  5KFE A;  3S6E A;  3M05 A;  3LWM A;  2W1B A;  2IA6 A;  1JIH A;  2OEM A;  2VQF J;  3JTN A;  1GK8 A;  2OI2 A;  5L1L A;  3VAK A;  1HI8 A;  2R7Q A;  2IC3 A;  3OVA A;  1E6V B;  2BAN A;  2XI2 A;  4G1Q A;  4LR9 A;  5KFP A;  2Z8Q A;  4P75 A;  1NK4 A;  4NA2 A;  4AT1 B;  2VA2 A;  3BYR A;  3W9I A;  4YHH J;  4P2X A;  1S5Z A;  2EG2 A;  4CT9 A;  4JV5 J;  9ATC B;  1U0H A;  1NK9 A;  3GJT B;  1HNW J;  3DDI A;  2MB0 B;  3UPF A;  3R1H A;  2OD6 A;  2XCP A;  3N4W A;  5CYM A;  2D69 A;  4A8S A;  3AXM A;  2FVC A;  2B4O A;  3QBC A;  1RTI A;  1WJ9 A;  4MKA A;  5D3G A;  1X4A A;  3P49 B;  2QLJ B;  1T9W A;  1OPZ A;  1S6P A;  4KO0 B;  4JI8 J;  4ID8 A;  3PIO Q;  2ZH2 A;  4E2F B;  1RAB B;  2G1D A;  4N47 A;  3EZU A;  4DX6 A;  4YQW A;  2E1C A;  1UEK A;  4WYW A;  5LJ3 Y;  2C2D A;  3DRY A;  3OFF A;  4C98 A;  4RNO A;  3NAH A;  2RF2 B;  2NPI A;  3GSD A;  2HND A;  1LOU A;  2VDI A;  2K06 A;  3A8I A;  4P7T A;  1Y3K A;  4CLY A;  4ECQ A;  1UA1 A;  1FKO B;  4WE1 A;  2XNR A;  2ZZM A;  3R3T A;  3IMQ J;  1SXL A;  3UVJ A;  2FHJ A;  4RX6 A;  2FLO A;  2C2O B;  4ZJO A;  3LWL A;  3FQK A;  5L46 A;  2Q43 A;  2DH7 A;  2G4B A;  3R7S B;  2FJB B;  4NYZ A;  2ZC3 A;  3DRR A;  4B08 A;  4DDF A;  4QWA A;  3HT3 A;  3W2V B;  4DWI A;  3IRX A;  5IM0 B;  1XBW A;  2GO8 A;  1VQK S;  2APO A;  1FRM A;  3KJF B;  1R0C B;  3BPD A;  1R89 A;  4UOF A;  3IXQ A;  3TA0 A;  3PVX A;  4A8O A;  2WOM A;  3QZ8 A;  3MD3 A;  3BPS P;  3ISN C;  4DF8 A;  1RAG B;  2HK2 A;  3MDF A;  2LLZ A;  4OX9 F;  1GEH A;  3VAF A;  3ZFV A;  3BV8 A;  1VC0 A;  4DPU A;  4G6V B;  3Q8P B;  1RAI B;  1UWB A;  4LRA A;  1CSJ A;  5A8K B;  4M1K A;  2WON B;  3KHL A;  3U1N A;  1N6Q A;  2ZVI A;  2AJ4 A;  2GQ2 A;  1NSA A;  4I68 A;  4ZP8 A;  2DTJ A;  1FRK A;  1UEV A;  1U2C A;  3I4P A;  2XO7 A;  1U1K A;  1M1K T;  2PN6 A;  5ETO A;  3M4X A;  2DNN A;  4LSL B;  1OY9 A;  3TUZ C;  3MD1 A;  4CH1 A;  4FBU A;  3PKM A;  2DY9 A;  2BJ3 A;  3V4I B;  1Q5V A;  1D9A A;  2GFF A;  2L9N A;  1TK5 A;  2DPI A;  5LMU F;  4XAK A;  5F8H A;  2LU2 A;  3C14 B;  4Q7A A;  4O23 A;  2QYC A;  3J7Z T;  4HDG A;  1KOO A;  2Q1L A;  2LU1 A;  3SEO A;  2FJA B;  3V6K A;  1NSK L;  4I6W A;  4WK1 A;  2FZK B;  3MEC B;  1PJ7 A;  3MM8 B;  2BQ3 A;  1JKH B;  2CNL B;  3DRR B;  4G65 A;  1FD8 A;  1MN7 A;  1JLC A;  1UL3 A;  1VBK A;  1IJF B;  1F9E B;  2VL1 A;  2UXD F;  3J80 U;  1Q79 A;  1RWU A;  3BDE A;  2WAQ D;  3CO0 P;  5CQG A;  5THW A;  2NYH A;  5C24 B;  3R1L A;  4NXN J;  3NNA A;  1VFJ A;  3TVZ A;  1W26 A;  4ZP7 A;  4BWM A;  3DXS X;  2H51 B;  4OZ5 A;  3M7V A;  4WE1 B;  2KJW A;  1JMT A;  2J9D E;  3NG8 A;  2IM0 A;  3CJ8 A;  1WF0 A;  4RWW A;  5K5M A;  4K2X A;  4RNM A;  1U1O A;  2J7W A;  1HWJ A;  2E5H A;  2GJI A;  2EBE A;  4L75 A;  2GHV C;  4WKY A;  3J7Z 5;  3RRG A;  1U2R A;  2MKI A;  3RBX A;  5IV3 A;  4N77 A;  2V67 A;  2E66 A;  3UD5 A;  3VGU A;  4KTQ A;  3BSO A;  1BQM A;  3HFZ B;  5ADZ A;  2EI5 A;  2ZZT A;  4N5S A;  1FNX H;  2P2C B;  4LMZ A;  2ACY A;  2G2Z A;  4C8N A;  2Q6C A;  4OZ2 A;  1SBR A;  2YKM B;  3BKF A;  1I51 B;  3NGR A;  5CYM B;  2R8I A;  2CJY B;  2C22 A;  2BJE A;  1R0A B;  4DX5 A;  2ZUG A;  2OP5 A;  1DFD A;  2MZQ A;  2OSQ A;  3IC1 A;  1YZ6 A;  3DOM B;  1TL4 A;  2G0J A;  1RT3 A;  3EUN A;  3LGN A;  4B3O B;  2MZT A;  2OTJ S;  1RAH B;  2G13 A;  1JLB B;  4JV0 A;  2N3O A;  2R7V A;  3CC4 S;  1R6Y A;  3IM8 A;  3JSM B;  3GCX P;  1XWL A;  4OYO A;  1X5P A;  2UV8 A;  2W9B A;  3CDE A;  1Y5N B;  1RT2 A;  1F2G A;  4KRW A;  4J9M A;  2ZJP Q;  3FBB A;  4Z2X A;  3MFI A;  2COL A;  1ZTT A;  4I2P A;  2HYI B;  3NGK A;  2J7U A;  2P9G A;  3D1H A;  2XMW A;  4NWB A;  3DDN A;  1TKX A;  1WI6 A;  2EPI A;  1WTB A;  2IY5 B;  3OTD A;  2QL7 B;  1UJ5 A;  3C15 A;  2B9X A;  3GR0 A;  4JUZ A;  2VFT A;  1VQY A;  2IVY A;  2DPJ A;  3OTC A;  4FF3 A;  4X4N A;  4X4P A;  1YWX A;  2V9W A;  3NOG A;  1RXO B;  2DNL A;  1PC5 A;  2DR6 A;  5AE2 A;  3DI6 B;  2MSS A;  2NZC A;  2QJ3 A;  1MU2 B;  4HT5 A;  1Y3J A;  3I82 A;  4KJI A;  2AIR B;  1K9M T;  5KFV A;  1N32 J;  2V8D A;  5A76 A;  1X60 A;  2IYG A;  1UFK A;  3IA0 A;  4TY8 A;  2VG7 B;  2YWE A;  4B02 A;  4ES1 A;  1VJQ A;  4MTP A;  4ED6 A;  2FJW A;  4JI2 F;  4QYZ J;  2H4W B;  1Y4Z B;  1NK8 A;  2OPS A;  2EK1 A;  3RB3 A;  1JLE A;  4EZ9 A;  1NO8 A;  2WSF C;  2NXE A;  3T9N A;  4YS2 A;  2UUC F;  4LBI A;  5IXU A;  3W62 A;  1JNR B;  1HAR A;  3FMB A;  4OX7 A;  1VQ7 S;  4PWD B;  2XO6 A;  1R8B A;  3DU6 A;  3E01 A;  5GAH U;  4HHJ A;  3IP0 A;  4PG7 A;  3CF5 Q;  2KVI A;  2FYX A;  2A3J A;  3M1V A;  4C9D A;  1Q5Y A;  4RW4 A;  3EX7 B;  1NJZ A;  4ZVR B;  4JI1 J;  2HGN A;  3DGP A;  4RNN A;  1S72 S;  2HHQ A;  5B0D A;  2FC9 A;  4GKK F;  1JXE A;  2DGV A;  4P2M A;  4DV3 J;  2UVV A;  4FBT A;  3M2V A;  3R5J B;  2YPZ A;  5G0R B;  4DUY J;  2ZKU A;  1FFW B;  2XCA A;  3TR5 A;  2YNF B;  2CNO B;  3N6M A;  1NU4 A;  2QGF B;  4DSF A;  4EZ6 A;  2EK6 A;  2B9W A;  1RT1 B;  1SH3 A;  3O44 A;  4ZK7 M;  1NDP A;  8AT1 B;  4QR1 A;  2AF6 A;  4U67 Q;  1T9U A;  1JLC B;  2FPH X;  1FA0 A;  2RQ4 A;  1T9V A;  2YQ1 A;  3L9Z A;  3BQ2 A;  4KY3 A;  3KJV A;  3H42 A;  3Q2T C;  2M0G B;  5HP1 A;  3HKZ D;  1UZD A;  5H1S V;  1H98 A;  2J9E A;  3CCT A;  1NKC A;  3VGS A;  2XWY A;  4C11 B;  5FLX U;  3X3U A;  3H5Y A;  1HBO A;  3MI7 X;  3V6J A;  3M8P A;  4TU9 A;  2IM3 A;  1X8D A;  4M5G A;  1TQL A;  2OPP B;  1HR0 F;  2H4Y B;  1FNO A;  4HKQ A;  3LO3 A;  3TNV A;  4U6P A;  2DGQ A;  1CBK A;  2MZJ A;  2DGT A;  2L08 A;  3SQG A;  1SJ3 P;  3DRS A;  1Q81 T;  4L3K A;  2HBY B;  4JI5 F;  4EBD A;  1FDN A;  2DHG A;  2OFH X;  1H7W A;  2ZBI A;  3M6X A;  3PX4 A;  3VV2 B;  3CUN A;  1W25 A;  1XNR F;  3KUH A;  4N41 A;  1RWN B;  3S8S A;  1F5A A;  4ZCL A;  2NUH A;  5J2N A;  1FHT A;  2X1G A;  2YWH A;  4USI A;  2DH8 A;  2YKN A;  4K8R A;  5A8W B;  4HDH A;  3M32 A;  4A46 A;  4J9N A;  3QAE A;  4P73 A;  2BQR A;  2B8P A;  4YN3 B;  1AA1 B;  2AEF A;  2GVD A;  2UXB J;  3NGU A;  4QU6 A;  2HHS A;  4ZOS A;  2R2U A;  3F41 A;  3KKF A;  4JB8 B;  2V2V A;  1RA7 A;  1J5O B;  4EO8 A;  2R7S A;  2XMT A;  1U26 A;  1JJ2 R;  4WKR A;  4EO6 A;  3MR3 A;  2FJV A;  3QZ7 A;  4DR3 F;  2DR8 A;  2QL9 B;  2B7B B;  2MQ8 A;  1JJC B;  2YNI A;  2H1Y A;  1Q7Y T;  3LH2 S;  2GMJ A;  4TYB A;  4DU8 A;  4J37 A;  1FWL A;  5DM7 Q;  1KTV A;  2VOD A;  3ILO A;  1G6B A;  1S79 A;  3PCO B;  2AWZ A;  4V1A k;  3C3L A;  2XZT B;  4NLV A;  4P9S A;  2GO9 A;  4C8L A;  1TU0 B;  3Q89 A;  1R0B G;  1Z1Z A;  2HZA A;  4WFA Q;  5LMN J;  4JI7 F;  2RRB A;  3UR3 C;  1VOM A;  2ZHA A;  3DU5 A;  5A8R A;  3T6J A;  3CCE S;  3T5L A;  2BE7 D;  1NPR A;  2JFK A;  4QR2 A;  4DOZ A;  2VD3 A;  2UXB F;  3TW0 A;  3AA8 A;  1AZS B;  4WTO B;  1U02 A;  1WHW A;  5L1K A;  1QD1 A;  3FKB A;  5E0O A;  1N36 F;  4LF6 F;  1WUU A;  2DO4 A;  4MK7 A;  1XR6 A;  1FWK A;  1O51 A;  4DHV A;  3OUY B;  3HVA A;  4X62 J;  3GIM A;  4OHZ A;  2CJ9 A;  3NGT A;  3TEG A;  1LEO A;  4JV1 A;  3CJR A;  2B6A B;  2IM1 A;  4K59 A;  2HLU A;  4LRB A;  2DVI A;  4KFB A;  3NLC A;  2UU9 J;  1AFI A;  2A6O A;  5KTQ A;  3I9V 9;  4ICL A;  3B82 A;  4MIB A;  3ZTO A;  1ZBT A;  4CNZ A;  2ZDO A;  2K3K A;  4HT7 A;  5KFM A;  1BWV A;  2CJA A;  2KHC A;  3TUI C;  4YDD B;  3EWG A;  3HDS A;  2FC8 A;  5IWA J;  3FGV A;  4TVA B;  2B8Q A;  5CXT A;  4PPZ A;  1PSD A;  3SZ2 A;  1MRO A;  1UJ4 A;  3HSJ A;  2MQL A;  3K5M A;  4ZJL A;  4EWT A;  2KXH A;  4B9L A;  1WDT A;  1F2H A;  5GME A;  2RD5 C;  1UPM B;  2VDH A;  1W2I A;  1B7F A;  1AYE A;  2FHK A;  1HQ2 A;  2RU3 A;  3BO2 A;  2XHW A;  3EJM A;  1XTZ A;  4IFY B;  2F65 A;  2ZUA A;  3EZO A;  4Q0B A;  1TFY A;  3IWL A;  3BN7 A;  3M2V B;  1PO6 A;  2HND B;  1RLD A;  3TAR A;  4ETZ A;  2ZIT A;  3IFE A;  3ZC4 A;  4I64 A;  3ZTQ A;  1JB0 C;  2W9C B;  1HW9 A;  3CO9 A;  1KP6 A;  2ZBP A;  2ZE2 A;  4I0W A;  3U1M A;  2XM3 A;  2JSX A;  2BM1 A;  2ZNY A;  3KLH A;  4PWU A;  5E2Q A;  1GT8 A;  2ZHB A;  2E5L F;  1H7X A;  5I42 A;  5C5J A;  2ZHO A;  1LWF B;  4ZP6 A;  1HPZ B;  3JTP A;  1AT1 B;  1YX2 A;  1D09 B;  1HHQ A;  1S57 A;  1UWA A;  2UZA A;  3LF0 A;  3CCZ A;  1M0S A;  4MYU A;  4GKJ F;  3PRD A;  5GAH I;  2JFD A;  1S9F A;  3A3P B;  4X4R A;  4NCB A;  1SCJ B;  4OI4 A;  2BE9 B;  2UUW A;  2NXU A;  3G82 B;  3QIP A;  4F67 A;  2Q66 A;  2W7A A;  1URN A;  3D66 A;  3P8B B;  4OZJ A;  3RYL A;  1K1S A;  3IM9 A;  3T1H J;  1GX5 A;  5MAO A;  3Q8Q B;  2FLN A;  2GNK A;  5EWE A;  1U0H B;  1WDD A;  5KFU A;  2CQG A;  2N4C A;  1Q8L A;  3MPY A;  2W8L A;  4FS2 A;  4DL4 A;  1SVD A;  4RUH A;  4QR0 A;  4TQS A;  3PIP Q;  1IBC B;  4MFB B;  2X3D A;  1KHW A;  2HFS A;  3GJQ B;  3Q2S C;  1VJW A;  4NL5 A;  1BQX A;  2B9Y A;  1HWL A;  2CQ2 A;  1UW4 A;  3M6V A;  3MED B;  3SFU A;  4M5J A;  4AD6 A;  3PKY A;  4GKJ J;  1RAD B;  2RUS A;  2MXY A;  2HUR A;  2BDP A;  2JLF A;  2QL5 B;  2X7I A;  3D6T B;  1B0T A;  1YJR A;  2V8G A;  5CYJ A;  4O3S A;  2IMO A;  1N5Q A;  5F8G A;  2HQD A;  3CJK B;  2E1P A;  4L74 A;  5KG4 A;  3TX0 A;  4F4K A;  4ENO A;  1PJ6 A;  3DLJ A;  4M5L A;  2XY7 A;  4PKD B;  2ROP A;  3T1A A;  1RTD A;  1M1H A;  1MMD A;  4DCJ B;  3J80 Y;  1T05 A;  3U02 A;  1PYO B;  4OHW A;  2K7J A;  4OI1 A;  4RW8 A;  4E0D A;  5DDP C;  3KXD A;  4YDX A;  2PA8 D;  3OUY A;  1N5Y A;  2GW8 A;  1WG4 A;  5D0R A;  2DY1 A;  3U1L A;  2ROE A;  3DOM A;  1ULR A;  1RT3 B;  4RBV A;  2V4J A;  3IGN A;  2UXC J;  4CLK A;  3BGF A;  4LVN P;  2OTL S;  2ALY B;  2LEA A;  3AOC A;  1FJG J;  1UVN A;  5HL7 Q;  2MDA A;  4FYX B;  3Q22 A;  1FNM A;  2RF2 A;  2YKM A;  3ISZ A;  1R0A A;  1J2V A;  1SB6 A;  4I6A A;  4ERD A;  3H40 A;  1P1T A;  2DGO A;  5H9F K;  3GON A;  4TU7 A;  1WF1 A;  3NCQ A;  5F3Z A;  4H4M B;  1IKY B;  5ETV A;  1FK9 A;  1FFS B;  2A1B A;  3VVU A;  3H2V E;  4UUW A;  1KBR A;  4YP3 A;  4RW4 B;  4NLQ A;  1RTJ A;  2UVU A;  4DPO A;  1HKA A;  1WC5 A;  3M6W A;  4DUT A;  4E98 A;  2KZM A;  2H54 B;  4DR7 J;  3OQ2 A;  2FJE B;  1R6V A;  2C1E B;  2D74 B;  1S9E A;  1UW9 A;  2QSW A;  5CD4 H;  3Q8S B;  2VBZ A;  4NRU A;  3JSB A;  1IUJ A;  1IBL J;  2FY1 A;  1WHV A;  2CQ4 A;  4KO0 A;  4RU9 A;  2BJ8 A;  3HM9 A;  4N8O A;  2J9D A;  3WHI A;  3PHE A;  3TVK A;  4A8W A;  2R7U A;  1SJR A;  3H90 A;  1IKX A;  1HBN A;  1YLX A;  1Z4U A;  5B0G A;  1OJ4 A;  1WG5 A;  2CWX A;  3FCV A;  2D9P A;  3JAM U;  3MEE A;  4J9O A;  3ET6 B;  4BC9 A;  3D0I E;  4UST A;  4ZDN A;  5EWF A;  3A4T A;  5IZH A;  1SQE A;  4H54 A;  4EU0 A;  2KG0 A;  4OYA A;  4ATN A;  4AUK A;  2MZS A;  1TK0 A;  2NRE A;  2Y8Y A;  4OZ3 A;  4EYI B;  3TAQ A;  1SJ4 P;  1T94 A;  3DI6 A;  1L3U A;  4GO5 X;  3IR7 B;  4ZP9 A;  1T9X A;  5K8M A;  2SXL A;  3PW4 A;  1FJ7 A;  4X66 J;  3KK2 B;  4DG1 B;  5F9L A;  2A6M A;  3PYE A;  2C3Y A;  4RNH A;  4FKY A;  3TAM B;  1FRL A;  3KLE A;  1C0U A;  3ZZT A;  2XMA A;  3VQT A;  4A48 A;  2W7P A;  2ACM A;  2CQD A;  1FKP A;  2NPF A;  1N52 B;  2RE1 A;  3KDO A;  1S1X B;  4Y34 A;  3TA2 A;  1JLF B;  1FVS A;  2B7C B;  1SI9 A;  2WVF A;  4J9U E;  3CCL S;  4USW A;  4RL1 A;  4CLT A;  3A13 A;  1WI8 A;  4M5D A;  1T3O A;  3NBP B;  4IYQ A;  5AT1 B;  3V5R A;  3HVR A;  1S1W B;  1HQE A;  1ZH5 A;  3FDS A;  4J9S A;  2DNR A;  3I0S B;  4ECW A;  1UVM A;  2KRR A;  3ILJ A;  1H74 A;  2F5G A;  5CAA A;  4CO1 A;  1SL2 A;  4B3O A;  3PW7 A;  5D4P A;  1V3S A;  2I38 A;  3AOA A;  1SPB P;  1GMW A;  2AV5 A;  4ZPA A;  4ZN3 A;  5ETP A;  3M9O B;  3CUL A;  4IH7 A;  3I5B A;  1WOP A;  4DXL A;  1XN9 A;  1S0M A;  1TUV A;  1ZOT A;  3Q8U A;  2RIJ A;  4J9K A;  4E8U A;  5IT4 A;  2AT1 B;  4JI2 J;  2B56 A;  2J0S D;  1QJH A;  1DQ9 A;  2ZH6 A;  1N5S A;  4QPT A;  2HVZ A;  3C6T B;  5DGA A;  1KQK A;  1HHS A;  4OZ0 A;  4DN0 A;  3THV A;  2RDI A;  2QMU B;  3I9Z A;  2ZC4 A;  3B6B A;  3HHL A;  4AND A;  4N56 A;  3O5T B;  2UUB J;  3M9M B;  1RTI B;  2CDR B;  1T9Y A;  2BJ9 A;  4J9Q A;  5ETM A;  4R0J A;  1R7I A;  1TKZ A;  2QMW A;  3BDP A;  4IRK A;  4JI0 J;  2R7X A;  1FE4 A;  1RGV A;  4RW8 B;  2M5Y A;  4W4M A;  4HHH A;  4H4K C;  2BXJ A;  1GNK A;  3K59 A;  4B17 A;  4YB7 A;  1RAE B;  4FKX A;  2HAF A;  1BXN A;  4X62 F;  2CJK A;  2VBY A;  3VQS A;  4WP9 A;  4DR1 J;  1TK8 A;  4B3S F;  3NMA A;  2ZBR A;  2Z58 B;  4ITS A;  1CJT B;  1YK9 A;  2HWT A;  2HQG A;  2R8J A;  5KAK A;  4HI2 A;  1IQT A;  4Z7Y A;  4JV5 F;  3ELH A;  1SC1 B;  2L9D A;  3UDE A;  2YQ0 A;  1DLO A;  3P3D A;  4M5D B;  1WC6 A;  5KFS A;  1GFW B;  4MKY A;  3NEK A;  5IWA F;  3AD9 C;  1FDB A;  5D0E A;  4QWB A;  2ADB A;  1QLN A;  4X2B A;  2QLX A;  5IV4 A;  2DRA A;  4U7C A;  2MQM A;  1FEE A;  3CJT A;  2XZD B;  2LXI A;  2WVE A;  2KFY A;  1EQ0 A;  1HQU B;  2KYZ A;  4ZHR B;  4OV1 A;  4XK8 C;  4DR5 F;  4DV2 J;  2C2E A;  4F2R A;  2JC1 A;  5LM7 E;  4OX8 A;  1KQF B;  4O3N A;  5HN0 A;  2FIU A;  3H7H B;  1S9G B;  1VI7 A;  1RBO B;  2B5J A;  3PG9 A;  4KKO A;  4X4Q A;  1CJV B;  1ICE B;  3BGU A;  2W7O A;  2DHS A;  3RB6 A;  2DNO A;  2BM0 A;  4OZN A;  2AJ0 A;  1R8P A;  4S0M A;  4ZIV A;  5KOX A;  1PC4 A;  1NAQ A;  4IOB A;  2C3M A;  3Q23 A;  5J1E A;  1PG5 B;  2NYI A;  3RU0 A;  4LFB J;  1IKV A;  1IBM J;  3Q24 A;  3MXH P;  3HT0 A;  3M30 A;  2FUG 9;  2NUU G;  5A8R B;  3OJS A;  4LFA F;  1CC8 A;  1UEU A;  3R97 A;  1VLY A;  3MEG A;  4F4Z A;  1NZ8 A;  3QPI A;  3M2R B;  2FQQ B;  4K0K J;  1Q8K A;  2H65 B;  3EGN A;  1BQM B;  3LPE A;  5F0U A;  1LXN A;  1YIT S;  2WB1 D;  4USK A;  2LMI A;  1JLG A;  3GTY X;  2HIQ A;  2G2Y A;  2V2K A;  1U0S A;  3MCM A;  2ZOF A;  3MM9 B;  5CCM A;  4CO0 A;  3GV8 B;  4QOT A;  1HPZ A;  2D7S A;  2JRS A;  3AB4 B;  1RKJ A;  2RRN A;  4MKB A;  1Y11 A;  4EGL A;  2O67 A;  2LFV A;  4C8Y A;  3UR0 A;  1T8E A;  3BH6 B;  1S59 A;  3VZI A;  2OEL A;  3QSI A;  2Z2Y B;  1FXL A;  1FRX A;  3D1O A;  5AXL A;  2GML A;  3D6M B;  5D3G B;  4C2M A;  1X31 C;  2IAJ B;  1VGY A;  4UW2 A;  2RAQ A;  1S48 A;  3PYF A;  1FT8 A;  3EMT A;  3OSP A;  4TLQ A;  1WEZ A;  7FDR A;  4W90 B;  3DMJ A;  3OJU A;  2ADC A;  4WZM A;  2PD1 A;  5HBM A;  4I7F B;  1C0T B;  4RNF A;  1RUS A;  3M8W A;  4ZCM A;  2I5J B;  4GMK A;  4DR3 J;  2CPF A;  2VPX B;  2XGP A;  3BSN A;  4YHH F;  3WIV A;  1S9G A;  2Q3P A;  2GVZ B;  3CED A;  5E7O B;  4C48 A;  1BQN B;  2LQ5 A;  3FZB A;  4ECZ A;  1S1W A;  2AJF E;  3OD2 A;  4KFB B;  4PR6 A;  3T1Y F;  2B43 A;  2QRR A;  3PZP A;  2C42 A;  3DGV A;  2QA4 G;  4IR9 A;  4QU7 A;  1ZAV A;  2R9L A;  2HIY A;  1U1M A;  2CAJ A;  1KRP A;  1H6K X;  3SMZ A;  2E7V A;  1K47 A;  3N79 A;  2H5E A;  4HHU A;  1ZS6 A;  3RB0 A;  3NNC A;  5E41 A;  4B3R J;  3CJQ A;  4JI8 F;  1TR0 A;  1HNI A;  1D3W A;  1RT6 B;  3TJ8 A;  5GAG U;  3ZNJ 1;  5M2U A;  2IDL A;  3H4B A;  5A2Q U;  5H9E J;  2BMB A;  1NH7 A;  3GSI A;  1Q16 B;  5KFO A;  2XQC A;  1SV5 A;  2PC6 A;  1XMB A;  4JP8 A;  4NLU A;  4QYR A;  4K7Q A;  4DV7 J;  3KK3 B;  4F0M A;  3G82 A;  3ZZ0 A;  4MH8 A;  2V94 A;  4DCO B;  1T02 A;  3CE8 A;  4LUB A;  1RBL A;  5AXN A;  4I7F A;  3LP2 A;  4X65 F;  2A2D A;  3RBZ A;  3I6P A;  3VHQ A;  4RBU A;  4O44 A;  4LIW A;  5DS7 A;  4OYW A;  2XLJ A;  4DR4 J;  1CJT A;  1KVJ A;  5C42 A;  1Q78 A;  1RQ0 A;  4WWS A;  2G0C A;  3AT1 B;  1N0U A;  5E3P A;  5D0H A;  3W5X A;  3UCZ P;  3KHH A;  3HKW A;  4B3T J;  4JI4 J;  1REV B;  1LV5 A;  3HMJ G;  2NSC A;  3ONQ A;  5JVH Q;  2CQI A;  2YNG A;  4DF4 A;  3LW5 C;  1S6P B;  3DHX A;  2E44 A;  3JXO A;  4ED8 A;  1VC5 A;  2H5J B;  3LAL A;  3M1V B;  5HVF A;  2EVZ A;  5BR8 F;  2HK3 A;  1U1L A;  2GJ2 A;  1VQ5 S;  1VCT A;  5KFJ A;  1HYS B;  4LSN A;  3TI0 A;  3DXB A;  1KFS A;  4RWX A;  2VIH A;  2BKO A;  2G2O A;  4ED3 A;  1PIE A;  1YRU A;  1YJT A;  2M8H A;  1FFG B;  3KUG A;  4H4O A;  5HMW A;  2FY8 A;  5KFA A;  3A8E A;  4C8Z A;  1DJ0 A;  1SV5 B;  3FRZ A;  2CQ0 A;  5GMD A;  3UI3 A;  3W5Y A;  5K8N A;  4OX6 A;  1X9M A;  1N48 A;  4JI4 F;  5GAE U;  3PRV A;  3LP2 B;  2ZH8 A;  4IQM A;  3TAM A;  2MJN A;  4ID5 A;  4R5P A;  1P8G A;  1UJ6 A;  5J2Q B;  4K4S A;  4QYZ K;  3Q8R B;  2AZ1 A;  3AD8 C;  4DSE A;  4DSK A;  3PJX A;  2W4C A;  4YME A;  2K1R B;  3MTK A;  3N6N A;  3OVB A;  3HLU A;  4NCG B;  1WKJ A;  1RP5 A;  4AFF A;  2UXC F;  4G1I A;  1U1R A;  2JEJ A;  5F8N A;  4DPT A;  5HO4 A;  1X5O A;  3L09 A;  1N6Q B;  2OD4 A;  1DBD A;  1QM9 A;  4WP8 A;  3KLV A;  4EBC A;  3IBC B;  4USV A;  2HFO A;  5HQM A;  1LXJ A;  3BBB A;  4B9S A;  3D54 A;  3GMG A;  4PWW A;  2A18 A;  2WSC C;  1VDH A;  1WC1 A;  4O3Q A;  4PG8 A;  1EET A;  2HNZ A;  4NA3 A;  2ROG A;  5D4N A;  3RAQ A;  2NXJ A;  2OLW A;  1RYR A;  1FF2 A;  4GVL A;  1FI4 A;  2E5I A;  4DS4 A;  1D9F A;  2HVD A;  3QID A;  3NL0 A;  1FRI A;  3DOK A;  2IBO A;  1BQN A;  4WJB A;  5GVQ A;  3TP2 A;  2VOO A;  6AT1 B;  3G6V A;  3QYY A;  5L9X A;  4C7Q A;  4J91 A;  2M3D A;  4RLE A;  5DRK A;  1SH2 A;  3D1Q A;  2KDO A;  2ERR A;  3CJS A;  3KFW X;  3K89 A;  4R8U A;  1SKW A;  2HVH A;  1MWQ A;  2J6S A;  2K7K A;  4ZLJ A;  2BKN A;  3PAC A;  3V81 B;  4XTT A;  2VQE F;  3ET6 A;  3H98 A;  1V9O A;  3U27 A;  3IR5 B;  1GXT A;  1TUG B;  4U9R A;  3J7Y U;  5KT4 A;  2ABY A;  3ZZP A;  3D28 A;  4WTY A;  2P9C A;  3PYG A;  4ER8 A;  5M2R A;  3R9L A;  3CDA A;  2Z4P A;  2WW4 A;  2ZDP A;  5CD4 A;  1SKR A;  4TYA A;  3FEY B;  1V5I B;  5KOW A;  4OHV A;  5BYS A;  2D3O R;  2AGP A;  1S0N A;  4XPE A;  1QVG R;  1TL5 A;  1K0V A;  2DK2 A;  2YX1 A;  1SH0 A;  3RB4 A;  1I6J A;  2HHP A;  4OZ1 A;  1C1B B;  1EX8 A;  2PFD A;  2POK A;  4NLS A;  1H73 A;  2CPI A;  3NWR A;  3IS9 B;  4Y2K A;  4P72 A;  1DTT A;  2RSQ A;  4JI3 J;  1JK9 B;  3P6Y C;  3GFH A;  2IJR A;  2OPR A;  3KLF A;  4ES2 A;  3GFZ A;  4DQP A;  3MGJ A;  2RQM A;  3K5L A;  5KG6 A;  1Y7P A;  5KFT A;  1Y0H A;  3D3C J;  2Z0G A;  1TL1 A;  3N6L A;  1HNX J;  2MYF A;  4DV6 J;  3GIR A;  2WZ1 A;  3NXZ A;  3W63 A;  4NA1 A;  1TZ0 A;  2R2T A;  3T3F A;  1RHU B;  2DR7 A;  4ECX A;  3G8Q A;  2AX0 A;  3AQP A;  5AE1 A;  2F9D A;  2FJX A;  3ICL A;  3MM5 A;  4RJV A;  4C0B A;  2VOP A;  1N5V A;  4C11 A;  4DR6 J;  4TU8 A;  1YHQ S;  2FVR A;  4KH1 B;  4PG5 A;  4UF4 A;  1EKR A;  2HRU A;  1WC4 A;  3A1Y G;  5T41 A;  4MYT A;  4LF4 F;  1U6B A;  2CUY A;  2FGC A;  2MJU A;  2Z2M A;  3JSM A;  2BEF A;  1R8C A;  4U8Y A;  3R5G A;  2PT0 A;  4OI3 A;  3N01 A;  4OYB A;  1NB2 A;  4LQ3 A;  3MR6 A;  1NK7 A;  5KFW A;  2GGP A;  2B51 A;  1TVR B;  2IVM A;  1X0F A;  2FJD B;  1HBU B;  2DGX A;  2N82 B;  1PCA A;  4U96 A;  4DX7 A;  3ENQ A;  4NRT A;  4FF1 A;  2F4F A;  2EC0 A;  3MAA A;  1NK5 A;  4FXD A;  3V6D A;  3I87 A;  1SJQ A;  3D7S B;  3WBZ A;  3MOZ A;  1RAF B;  4ID5 B;  2QZ8 A;  3HHL B;  2IJF A;  1SIZ A;  1B99 A;  1F9F A;  1YDL A;  2ZBC A;  3RW7 A;  3TJA A;  3KYL A;  1QAI A;  5GAD U;  1TKZ B;  3VAH A;  2FVQ A;  3C2P A;  1RIS A;  1S9E B;  1SC6 A;  4TY9 A;  2L3M A;  2B0G A;  4CDI A;  4DV0 J;  4ZJQ A;  2IMW P;  2RKI A;  3MPU B;  1P9Y A;  1BGX T;  2XMV A;  2EFV A;  3CCV S;  3PR4 A;  2CIM A;  1CEZ A;  1YVF A;  2ASD A;  2W4D A;  1XER A;  4OJG A;  1CQN A;  2GQQ A;  2V2Z A;  3AOD A;  2VBW A;  4BLG A;  1NEE A;  1RCX B;  1RU1 A;  1N0V C;  4R8U B;  1SJ1 A;  2LCW A;  4ZPT R;  5ETR A;  4HR2 A;  3E51 A;  3E8O A;  3JB9 k;  2DXE A;  2FHO B;  4NLD A;  1FVQ A;  1IM6 A;  1X7V A;  3BYP A;  5CCL A;  1J5O A;  4C8K A;  1CVJ A;  5L39 A;  2PII A;  2J8S A;  4M95 A;  2DNH A;  2XMM A;  4GC7 A;  2IIH A;  2QO3 A;  2AJQ A;  5D77 A;  3MR7 A;  1OWX A;  4W92 B;  3H8Y A;  2OHD A;  1M5O C;  1NRK A;  3P96 A;  4TXS A;  2HBQ B;  1G4C A;  3FC9 A;  1C0U B;  1HNI B;  3QFH A;  3MF5 A;  3KTQ A;  3D5M A;  3KLI A;  2QYG A;  1XR5 A;  2BW7 A;  1OY8 A;  1MW7 A;  1NDC A;  4FVM A;  4O4G A;  4GC6 A;  4A8K A;  3W61 A;  1KLM A;  2QA4 S;  4K4Z A;  1U1P A;  4ICL B;  1KD1 T;  1OYE A;  5HQL A;  4K4U A;  3OSN A;  2VA3 A;  4URG A;  2YKP A;  3ISN D;  4EBE A;  1C4C A;  1AZS A;  2DNY A;  2MHN A;  3AQO A;  4ED4 A;  3NAI A;  3HJF A;  4O3O A;  4DR6 F;  1U25 A;  2LQ8 A;  4NMX A;  1B7Y B;  2MMY A;  2W2P P;  2F1F A;  5ETN A;  2HGM A;  1XNQ J;  1HHT P;  2RIL A;  2LDY A;  2Y3Y A;  2VPW B;  2PDA A;  3N28 A;  1M5H A;  1Y5L B;  2VG6 A;  3SCI E;  1N56 A;  4UTG A;  3DMJ B;  2W01 A;  1VBZ A;  4IRD A;  1LQ9 A;  1T95 A;  1RA6 A;  3ILI A;  3A8K A;  2HGL A;  2H5I B;  3CDW A;  3CCQ S;  4X4V A;  2I5J A;  2RB7 A;  1SL1 A;  3BGL A;  3PO4 A;  3G9C A;  3RRH A;  1TV6 B;  3IN5 A;  2XS5 A;  2BX6 A;  4C0O C;  4ZCI A;  1Q1K A;  1UVJ A;  2DKO B;  2CRL A;  2DRD A;  2IRY A;  2FVS A;  2YPY A;  5KG5 A;  4LF7 J;  3TQ1 A;  3GG0 A;  3UN5 A;  2I6W A;  4NXM J;  3I0R B;  3SV3 A;  4AE5 A;  4XIU A;  3QSY B;  1WHX A;  5DM6 Q;  2I8E A;  1RU2 A;  3WQP A;  2JNJ A;  3AJD A;  2QMX A;  3V2U C;  3T1Y J;  1YG0 A;  1S0V A;  3CME S;  3VAM A;  3QRP A;  5E3C A;  2GMH A;  3CIM A;  3NNH A;  2N3L A;  2VFV A;  3O3L A;  1TMM A;  4P71 A;  5IC6 B;  3EYZ A;  1EKS A;  2I0X A;  3CSK A;  4WFB Q;  2M4M A;  1T03 B;  4LFC J;  1N54 B;  2YWK A;  5FDL A;  5IT9 U;  2DYA A;  3BGO P;  2KKH A;  5KT2 A;  4I69 A;  3FK4 A;  4AXJ A;  2KM8 B;  5EN1 A;  4O3R A;  1IR2 A;  2VG6 B;  3GIJ A;  1O6X A;  3U7J A;  5J1E B;  5D8H B;  2Y0S D;  4Y3C A;  4ZVG A;  5LMU J;  3HK2 A;  2XLI A;  2JH3 A;  2FLL A;  5F3T A;  3BGR B;  3QWU A;  4YR2 A;  1RWK B;  2D3U A;  5CYQ A;  5LL6 d;  1A6L A;  1ARO P;  2FHM A;  1RT4 B;  2FD2 A;  3FNN A;  4NEY A;  4ZVE A;  3NS6 A;  3TX8 A;  4X65 J;  3D9B A;  5KG3 A;  1NB7 A;  1JXV A;  3CJ5 A;  1KDN A;  2KXF A;  3PJ9 A;  4KAI A;  3KK2 A;  4FVC A;  4NXN F;  3K0J A;  2MLZ A;  1VQM S;  1N36 J;  1HBO B;  3THT A;  2IA0 A;  4GVB A;  5E5N A;  2L41 A;  4EYH B;  1S4F A;  2PO4 A;  1VRQ C;  2VFS A;  1I5O B;  3FRY A;  2UUT A;  3X1L B;  1FEH A;  2DHA A;  2DNZ A;  3HSD A;  5D0G A;  4DV1 J;  2Y1L B;  5CH7 B;  3PDN A;  3GFY A;  5DG9 A;  4KGV B;  2XS7 A;  2DR5 A;  3HHE A;  2YVS A;  2LKZ A;  1T03 A;  1IBK J;  1C1C A;  2XSJ B;  2IRX A;  2YKO A;  2XMK A;  2DNQ A;  2Y9H A;  5B0E A;  4IUF A;  1XNQ F;  1IXK A;  3GYX B;  5CAB A;  1F0X A;  2C2K B;  3IWX A;  3ETO A;  3NWG A;  1HWU A;  3OR2 B;  3CVK A;  4RW9 A;  4CM0 A;  2MQN A;  3BRE A;  4MIA A;  5I3P A;  1R3N A;  1X9S A;  5HAN A;  2PMZ D;  4O0N A;  3POT A;  3AOB A;  3OTE A;  4IH5 A;  2NXC A;  4MK8 A;  4GRS A;  5KFB A;  4HYK A;  3AXK A;  3MOJ B;  1XIQ A;  1VRT A;  2ZE2 B;  5EWG A;  5HI7 A;  1VK3 A;  4IDK A;  3K17 A;  3TZY A;  4WCE Q;  3DFE A;  3BN4 A;  1Q0N A;  2RU9 A;  4FP9 A;  2JVO A;  3MCO A;  4ECY A;  3NGS A;  5KFD A;  1KFD A;  1U48 A;  3O2I A;  4CYU B;  1RHK B;  4NLY A;  1JLE B;  1UFL A;  3RR7 A;  3Q86 A;  5E3R A;  2DXF A;  2GAG C;  4KV8 B;  3W2W A;  1FTC A;  3OFE A;  2CVE A;  2ATL A;  3SCJ E;  1E6Y A;  5DJB A;  3D6F B;  4HI1 A;  1WSR A;  1YI2 S;  3I55 S;  5E3A A;  1X9W A;  3DDK A;  4ETX A;  2QC3 A;  5C24 A;  3HHL D;  1N33 J;  8ATC B;  3JQM A;  2V0N A;  5B08 A;  3OW2 R;  3DRX A;  2QFI A;  3K7R A;  2DEJ A;  1EET B;  3D4J A;  4M63 A;  5F8M A;  5DDR C;  1F9H A;  1ZZF A;  2ZJQ Q;  4LF5 J;  3NS5 A;  5DO2 A;  3TYT A;  4DS5 A;  1IKW B;  3SCL E;  2CZ4 A;  1TMJ A;  2BR0 A;  3DOK B;  4DR7 F;  3PW0 A;  3W8P A;  3N0V A;  3OLB A;  2V4Q A;  2XBP A;  1QTN B;  2EKN A;  4UOH A;  3ZZU A;  3I56 S;  3G71 S;  3OL8 A;  1I3O B;  2LXU A;  3MED A;  2GIF A;  4ZPW R;  3GU0 A;  1IBL F;  3SIP B;  5CA5 A;  5DDQ C;  4MJK A;  3VAJ A;  1B64 A;  4DZD A;  1KHV A;  3LAK A;  1DLO B;  5LSO A;  1MMN A;  2W9B B;  1WKK A;  2MKS A;  2WOM B;  3PTW A;  2M52 A;  4NLX A;  3G8S A;  4N7T A;  2P5V A;  4CLW A;  4LF2 A;  2VBX A;  3TAP A;  2IJN A;  1QAJ A;  2BRK A;  2GA7 A;  4PXE A;  2V63 A;  2BOA A;  2F9J A;  2YTC A;  3BH7 B;  4IO1 A;  4ANC A;  3TZX A;  4K50 A;  1ZA2 B;  3DM2 A;  5J2M B;  4DQS A;  1B0P A;  4YFU A;  4DV5 J;  4DPW A;  1FKO A;  1FX4 A;  2KRB A;  2OO4 A;  2QT7 A;  4XDC A;  4CH0 S;  3UD3 P;  1IN0 A;  1B0V A;  3W1Y C;  3DHW C;  2H9Z A;  1XMO F;  3R7N B;  3NOC A;  4FDF A;  4Q8F A;  2HFZ A;  2VU5 A;  3KUE A;  3QFW A;  4KE5 A;  3P5B P;  1G1X A;  1FJG F;  2GHW A;  3DNC A;  4B3T F;  3PM9 A;  3UDC A;  5HMZ A;  3VAI A;  4CLU A;  3SQO P;  2DNM A;  1V6H A;  2LA6 A;  2Z2L A;  4LBH A;  1Y00 A;  4Q2M A;  4ZVF A;  2YKN B;  3FCW A;  4Q2L A;  5SUH A;  3CJ2 A;  4LF1 A;  5T7L B;  5CZV A;  3VGT A;  4X4O A;  2MQP A;  4N76 A;  1Y10 A;  2V8V A;  3A3N B;  1PGZ A;  2YXL A;  2AKW B;  4HAC B;  4LF4 J;  2F63 A;  2E1M C;  1SIW B;  4M94 A;  1NH8 A;  1PYS B;  2HFV A;  4BDP A;  3PR5 B;  2JL9 A;  2W2Q P;  1SJF A;  4QBU A;  3MEC A;  3R6L B;  2UUC J;  4LSL A;  2QTW A;  3LP0 A;  2GX8 A;  4RW9 B;  3UDL A;  4LF9 J;  4TQR A;  2NZ4 A;  1LWE B;  1WKL A;  2GAH C;  1NDK A;  2PI5 A;  3Q83 A;  1UVI A;  4OYX A;  2CPY A;  2VPY B;  1WG1 A;  3LQV A;  1FE0 A;  2HNZ B;  3I96 A;  5KFL A;  3ZXW A;  3RBE A;  2GZO A;  3BBC A;  4GKK J;  3K8V A;  1DHM A;  4AL5 A;  1VQN S;  3PY8 A;  1DAX A;  2XMU A;  1GX6 A;  3WX8 A;  3W65 A;  2V6A A;  1UTA A;  2VKR A;  2RQC A;  4DUY F;  2LEC A;  3PW2 A;  4DG1 A;  1SQG A;  4CLS A;  3M8P B;  2HFU A;  2ASY A;  2CVI A;  3IRX B;  4GO7 X;  3W9J A;  4C0H A;  5HLF B;  4AQY F;  4OLP A;  2BYC A;  3DLG A;  1QDU B;  3H20 A;  1UVK A;  2EFO A;  2VAS A;  3VWS A;  1KKH A;  4LFA J;  2JHE A;  1M5S A;  2EWH A;  2LP4 A;  5T14 A;  5HP1 B;  4UY8 T;  4HAC A;  1HWI A;  1QY7 A;  2CXE A;  1C1B A;  2J8A A;  1HWK A;  5A8K A;  1WEY A;  4U7U K;  3MWB A;  3J7A N;  4CM2 A;  2DR9 A;  5F8L A;  3KLF B;  4EMD A;  2KYX A;  5EUH A;  1NND A;  1URR A;  3WDO A;  2V4R A;  4B9V A;  1RTH A;  4L73 A;  5IC4 B;  3C16 B;  1N8R T;  1LWE A;  1EHW A;  4ZPB A;  2IFX A;  3KK1 B;  4OI6 A;  2VC1 A;  4LF8 J;  3O1L A;  2RJZ A;  5H9F J;  5BXI A;  1HYS A;  1MWY A;  4PG4 A;  1E6Y B;  1Q86 T;  2XS2 A;  4RW6 A;  2OSR A;  4OYP A;  2HHU A;  1Q95 G;  5A2Q Y;  4PYD A;  2HS0 A;  1PYT A;  2W2O P;  2KT2 A;  1HNZ J;  3MMC B;  5BJR A;  1P27 B;  4DFP A;  4DL2 A;  1XR7 A;  1NJY A;  1NCL A;  2YKQ A;  2QSF A;  4NPO A;  3LTO A;  4WFY A;  4ES3 A;  2HHH J;  3CWJ A;  5ETT A;  3IBF B;  3C6T A;  4RUC A;  1N4L A;  2HQI A;  2UUA J;  1WAC A;  2B4U A;  4LRD A;  3MUT P;  5F41 A;  5A8W A;  1BY9 A;  3FCH A;  5KG7 A;  1OSD A;  3OR1 A;  4FPR A;  2E1R A;  3R2D J;  1LK5 A;  3KMS A;  4OYI A;  2IPO B;  3CW2 C;  2BAN B;  3BBF A;  3M8Y A;  4HLB A;  5I3Q A;  1U4B A;  1ROF A;  2GGP B;  2CJQ A;  1KQG B;  1S6Q B;  2PEH A;  3EE3 A;  4F0H A;  5HVG A;  4B9N A;  4DQI A;  3EDQ B;  3QAT A;  3G6X A;  4FYD A;  2NR0 A;  3J81 Y;  1T9T A;  2YNH B;  4WP3 A;  5DZ6 A;  2CPX A;  4Y28 C;  2CZ9 A;  4DL3 A;  1S6O A;  4KQZ A;  3O6Q A;  2NSB A;  3QGH A;  4AXI A;  4Q8E A;  1E6V A;  4G1Q B;  4F3M A;  2IDE A;  1MLA A;  1MU2 A;  4K5S A;  1RT7 A;  5LJ5 Y;  4RUA A;  5AJ3 J;  4J9P A;  3DKD A;  4NCG A;  3HZG A;  1O0P A;  1U8W A;  3B54 A;  5KFY A;  2XY6 A;  4DV4 J;  3MMB B;  5ITH A;  1YJN S;  3IR6 B;  4U8V A;  1IWG A;  1HBM A;  1ZAX A;  1A0O B;  2AX1 A;  3VZH A;  4DL6 A;  4A8X A;  4IG0 A;  4U95 A;  2CPD A;  1RBA A;  1EQM A;  1NPK A;  1PBA A;  1RI7 A;  1YJV A;  2RUG A;  3B4M A;  3GV5 B;  3EPI A;  2K1R A;  1VQS A;  1FDD A;  2GVZ A;  2JJ4 D;  3MM5 B;  4KT0 C;  4K4V A;  2GIQ A;  1RJJ A;  4MFB A;  3HUL A;  4ZA1 A;  2W2N P;  1QUV A;  2LQB A;  3KG0 A;  1ZM2 A;  2O01 C;  4DR2 J;  7FD1 A;  4YB5 A;  4YR0 A;  2GCF A;  3KG4 A;  1FJE B;  1Y9O A;  1EJ7 L;  5LSL A;  2KVQ E;  1JLB A;  2RNE A;  1S99 A;  2CPE A;  4LIR A;  4ZVT B;  1YBA A;  3FSI A;  4ED0 A;  1U6Z A;  1FCA A;  1F6T A;  4QIF A;  3S1T A;  2ASJ A;  2N4D A;  1A7G E;  3CB4 A;  1LW2 B;  1CUL B;  2R3V A;  4Y00 A;  4ZMM A;  5KFF A;  3H5U A;  3D67 A;  4MK9 A;  2WRM A;  5KFG A;  2ZH7 A;  2XHC A;  3PEJ A;  1W7W A;  3TQE A;  4CQ1 A;  4ELU A;  4QWE A;  2KFZ A;  2AEJ A;  1U1Q A;  1K73 T;  2XUL A;  3IO1 A;  1BWE A;  2VG5 B;  4ZVU B;  2VKZ G;  3EXC X;  3MM9 A;  4DPY A;  1BC6 A;  3CCJ S;  2DIV A;  4O44 B;  1FO1 A;  5HMY A;  1JXL A;  2M70 A;  4CYU A;  2QE5 A;  3OXG A;  4NZ7 A;  3MCN A;  2CQ3 A;  3LAM A;  3L4B C;  2B4V A;  4R0E A;  1FWP A;  3CMA S;  3T1H F;  4NXM F;  4YR3 A;  3KLG A;  2HHH F;  4TLR A;  2GS8 A;  2VFR A;  2A2C A;  1WNE A;  3GYG A;  4BC7 A;  1Q8B A;  2Q79 A;  3SBM A;  1VQ8 S;  2KFN A;  2CJX B;  3L7O A;  2V4J B;  5J1N A;  5GAD I;  1ITP A;  3HF5 A;  4KSE B;  1I94 J;  4KPY A;  1KLN A;  4LF7 F;  3HX9 A;  1CQM A;  4LFC F;  3DLG B;  1JKH A;  1REG X;  1UMJ A;  4WU3 A;  2MLX A;  4NLW A;  3UNG C;  2EXU A;  4F25 A;  2RRA A;  1DTQ A;  2WSE C;  1W2B R;  1G2E A;  4C3K A;  2O5D A;  4IRC A;  5KFZ A;  1H2T Z;  1RAO A;  1H3D A;  2C3O A;  2HAI A;  3I31 A;  1NSQ A;  1H2U X;  2MGZ A;  3DLL Q;  1C1C B;  2XSJ A;  2CPJ A;  4TKT A;  3VR1 A;  4GVB B;  3UN2 A;  4DQR A;  1X5T A;  1IWA A;  1S49 A;  2M7S A;  3LUY A;  3D3B J;  5ETQ A;  1B4S A;  3R5B A;  5KFX A;  1N5T A;  3IGV A;  3TZZ A;  5IT0 A;  3FBC A;  4C97 A;  1NK0 A;  1J5E J;  4M5K A;  4R5P B;  5F8J A;  3WZ0 A;  1NHU A;  3R5C A;  2C2Z B;  1F1B B;  1HMV B;  9RUB A;  3SYZ A;  4B3S J;  2YH1 A;  3OL9 A;  4IFV A;  2HVI A;  2XNQ A;  1HNV B;  4RW7 B;  3OT9 A;  4PG6 A;  1X4D A;  2YY3 A;  3H59 A;  1RAC B;  5BR8 J;  4C8O A;  4CCH A;  2X1F A;  2VQF F;  2VV5 A;  2Z57 B;  1X0P A;  4PAA A;  2R7R A;  4UZB A;  2PI4 A;  2YWF A;  2HWH A;  4WIQ A;  4ZCK A;  1KWM A;  5H9E K;  1S6Q A;  1Z2Z A;  5F0W A;  2M2B A;  4CRJ A;  3BKU A;  3FEX B;  5B0B A;  2A0F B;  2AW0 A;  2CNK B;  1S7I A;  2L9W A;  2WHO A;  3CTR A;  4O3P A;  3MEE B;  1YIJ S;  4V19 X;  4Q43 A;  2V34 A;  2I9S A;  4OI0 A;  4USM A;  3OFG A;  3DLK A;  4FNH A;  3C6U A;  3GB0 A;  3BQ1 A;  3EGW B;  2UP1 A;  4BS2 A;  3UVJ B;  4ZN1 A;  4W98 A;  5HJX A;  1GTE A;  3R8Y A;  1HNW F;  2MST A;  4P6Q A;  2KG1 A;  1LW0 B;  2Y1J A;  1N33 F;  1RWP B;  1WC3 A;  4ZLN A;  1T11 A;  5C25 B;  3UW1 A;  5FDL B;  1IKY A;  4PQU B;  3QRQ A;  3MMA A;  4WU2 A;  2NS1 B;  5SZT A;  2PMW A;  3TUP A;  3DYA B;  4NLR A;  2BV3 A;  1RWW B;  5CHC B;  2QLW A;  5K14 B;  3TJ9 A;  1RWO B;  3QGI A;  1GMU A;  1NSP A;  4KYZ A;  1AUD A;  4FYV B;  1LW2 A;  2DEI A;  1X4F A;  2VH7 A;  3CD5 A;  2RKI B;  3MCS A;  4LJM A;  3AD7 C;  2KH9 A;  4NE9 C;  2IRU A;  4OQJ A;  1RHJ B;  4C6A A;  5C7P A;  2JC0 A;  4DFK A;  1I94 F;  3FFI A;  5J2N B;  1YJ9 S;  2VHG A;  4D3H A;  5AXK A;  3W60 A;  1QVF R;  4ZPV R;  1U49 A;  4Z37 A;  2X1A A;  2AJ2 A;  4F04 B;  3SQG B;  3W7B A;  2RDD A;  3DRS B;  4ZVQ B;  5U47 A;  3HSG A;  2ZBQ A;  4X4T A;  4FS1 A;  2KZZ A;  3GFX A;  3QNW B;  1VQO S;  2HVE A;  2AYM A;  1JQG A;  2XY5 A;  3UNY A;  3D0G E;  3HPO A;  4NYO A;  3UWT A;  2V5H G;  2VQE J;  2CQH A;  3NRB A;  1VRU B;  3Q8V A;  3CCW A;  4CO3 A;  5HVH A;  4K4W A;  2LXF A;  2LQ9 A;  2J0W A;  3S7R A;  2HRY A;  3S01 A;  3W9H A;  1U09 A;  3EVO A;  1RWM B;  2Y1R I;  5KFC A;  3KHG A;  3BJY A;  5HLF A;  1HI1 A;  1X4C A;  3MPV A;  4A4J A;  2HPU A;  2JX2 A;  3Q8Y A;  1HFE L;  4DZ6 A;  2MQO A;  2YWG A;  4CLZ A;  3KLE B;  4DUZ J;  4DSJ A;  4LRF A;  2HG4 A;  3ENV A;  1IJE B;  2JLE A;  5K8O A;  4LRC A;  4LF9 F;  4AL6 A;  1H72 C;  2EC2 A;  1IKX B;  1HBN B;  2EEY A;  4CLF A;  3GIL A;  2RML A;  4DSI A;  4LVO P;  3W2W B;  3DLB A;  1YBT A;  3AA9 A;  1AB8 A;  4LBP A;  1ZTW A;  1XJW B;  3HFK A;  2M8D B;  3TA1 A;  3CPW R;  2XEX A;  2HQC A;  2CZV C;  1RT1 A;  1S7H A;  2QG9 B;  4OJ3 A;  3VAG A;  1S0O A;  4DFM A;  3SSQ A;  2R42 A;  2J6U A;  5K14 A;  4JI0 F;  1M5K C;  3NCR A;  2ZM6 J;  3QLH A;  1HNZ F;  3KLG B;  1BD6 A;  4WXO A;  3HXM A;  2UV8 G;  4C3L A;  2KHD A;  4WYL A;  4PWD A;  5A6P A;  1JNZ B;  3D68 A;  1BMQ B;  2LYV A;  4DUZ F;  4KGK A;  4UT4 A;  1I1G A;  2YNG B;  1CG2 A;  3I5A A;  4DL7 A;  3LOU A;  1KSP A;  1MWZ A;  1HW8 A;  1RE1 B;  1K1Q A;  2J5A A;  3POT B;  4HH0 A;  3MEG B;  5LXY A;  3N5B A;  5M2P A;  4DLE A;  5KG2 A;  1D9D A;  3ILL A;  2QN6 B;  3V4M A;  2W8K A;  1WHY A;  1QE1 A;  2XYH B;  4KB7 A;  2C2R A;  3BB5 A;  4Y2M A;  2QLF B;  5LOQ A;  1P1L A;  5KFQ A;  2BKP A;  1HL6 A;  2XB2 D;  2W9C A;  2BJ1 A;  2IHR 1;  4O4R A;  3I0S A;  3UN3 A;  3BM7 A;  2KJV A;  1GXL A;  1N5Y B;  4OHY A;  2OKQ A;  2AEM A;  5IT9 Y;  1DZ5 A;  3M30 B;  3ZO7 A;  4IFY A;  2WBM A;  4TY8 B;  4IH6 A;  4J9R A;  4X4S A;  1AFJ A;  1F60 B;  2V69 A;  3DM2 B;  1RTD B;  1IM4 A;  1EP4 A;  4LSZ B;  2NLW A;  1RTH B;  1WSV A;  4B9U A;  2KI2 A;  4OIX A;  2Y1I A;  2ZWO A;  3CCU S;  3NMR A;  2HW3 A;  5J2P A;  4FZV A;  4Y2A A;  3K8W A;  1WEX A;  2DCL A;  1VBY A;  3L3C A;  2OH2 A;  5I4M A;  2IYI A;  2QA2 A;  5D78 A;  3ITH B;  3I4H X;  2HHT A;  5DQH A;  1KTQ A;  1WOO A;  4EI2 A;  4IG0 B;  3A8J A;  5KFH A;  2N7Y A;  4U7U D;  1TL3 A;  2H48 B;  3BQ0 A;  1B70 B;  4B9T A;  2RHQ B;  4L3N A;  3FQL A;  3G87 A;  2IM2 A;  2HZC A;  3JTO A;  2AU0 A;  3QT7 A;  3M8R A;  1YBU A;  4R25 A;  3VCD A;  1NKE A;  1CS4 B;  2HNY A;  1QSS A;  5JJB A;  2QLB B;  2D1C A;  3SCK E;  4DQQ A;  2BUN A;  2D3Z A;  1XEZ A;  2WTF A;  4F50 A;  1ZZN A;  1RT5 B;  4WPA A;  4P52 A;  5DLG A;  2D41 A;  3HP6 A;  1L3V A;  1KVK A;  1VHI A;  2M88 A;  2X1B A;  3WX4 A;  1RAJ A;  3J7Y I;  4DN9 A;  2JWN A;  2I1R A;  2OGU A;  3QGG A;  2AP6 A;  2MKH A;  3DGP B;  3MUR P;  1R8H A;  1RSC A;  2ZH5 A;  1SKS A;  1AUS L;  2KB2 A;  4CTA B;  4KH0 B;  2MPU A;  1FD2 A;  3BS9 A;  3BEG B;  4AYB D;  1S6U A;  3OR1 B;  4NAS A;  1F3V A;  3PJW A;  5G0R A;  1TUW A;  3VTI A;  4JI6 F;  2MZ1 A;  1X4G A;  4YB6 A;  1TKT B;  2ZH4 A;  4AQY J;  3MZI A;  4MT1 A;  4PCQ A;  4BWJ A;  3ENW A;  3DLE B;  2KM8 C;  4NCA A;  3ZZO A;  1FTR A;  2CG8 A;  4NZ0 A;  5K8P A;  2JZ5 A;  1CJU A;  1RK8 A;  3BR8 A;  4M8L A;  3DLH A;  4ILL A;  4F7V A;  1LWC A;  3IBW A;  3CD6 S;  2AHO B;  3GJR B;  4NI2 A;  4WXW A;  3T41 A;  3RW6 A;  2FTR A;  2LEB A;  2DBB A;  5DQI A;  3F56 A;  1LNQ A;  2V9K A;  3MAH A;  1ZAW A;  3M2R A;  4PPD A;  3QO9 A;  4RO0 A;  5KFN A;  1H38 A;  3ZZZ A;  5C42 B;  3MR2 A;  3QLH B;  5HQ8 A;  3OPK A;  2J76 E;  2HNY B;  3GYN A;  3HCX A;  2FHJ D;  1REV A;  2E5J A;  4NOH A;  2VZ9 A;  3RZA A;  3EM1 A;  2R4F A;  3SDE A;  3W5Z A;  1X4H A;  3D0H E;  4PQA A;  4I2Q B;  2J6T A;  1OQ6 A;  3QJJ A;  2FVP A;  1UP1 A;  4ZS6 A;  1JJ4 A;  4B3R F;  1WTF A;  3T6B A;  1T7P A;  4JI6 J;  1VQ6 S;  2YKA A;  1IR0 A;  2AYE A;  4ZKA A;  3EDR B;  3TVY A;  3J81 U;  2HSE B;  2WBR A;  3P4U B;  2YQ3 A;  2AJ1 A;  2DIS A;  2CNN B;  5KG0 A;  1CS4 A;  3GQC A;  5LMN F;  1APS A;  4OL8 A;  3EIC A;  3RRK A;  1PAU B;  1FRJ A;  4KC5 A;  2HS4 A;  1MG7 A;  1SC4 B;  3LGM A;  4LRE A;  5DZ7 A;  4Q45 A;  1S1U A;  1SL0 A;  3R2C J;  1LK7 A;  1TKX B;  4QPX A;  4IG3 A;  3SI8 A;  4OFZ A;  2XZW A;  1KLM B;  1Y5I B;  2DGU A;  1LKZ A;  3CT9 A;  1HA1 A;  1HIY A;  4B9M A;  4KHR A;  5EHH A;  4QW9 A;  3AFG A;  1R31 A;  2PMH A;  3Q0A A;  4C3M A;  3PX0 A;  1NUE A;  4WFN Q;  1ZYQ A;  2RH3 A;  2QFJ A;  1TKD A;  2DO0 A;  2O3D A;  2AGQ A;  4NEZ A;  2DRB A;  3MTJ A;  1NLK L;  1EZZ B;  1S97 A;  2IVF B;  1OMS A;  3KG1 A;  5IQQ A;  1NDL A;  3QWP A;  3JSY A;  1Q4R A;  4F2S A;  1YQH A;  1DY3 A;  2EKY A;  3CJ0 A;  5GAE I;  3EPG A;  1NJI T;  1Q7L B;  3TWZ A;  1TFW A;  3IRW P;  2W4P A;  1XQI A;  5KFR A;  5HJY A;  1NHK L;  2F3J A;  1KN6 A;  1R27 B;  4ZLP A;  2JLG A;  4K4T A;  2C3U A;  1WEL A;  1S10 A;  4UY8 5;  3L95 X;  3KMQ A;  3PFE A;  5T7L A;  2N7C A;  2ZH3 A;  4PRF A;  5FLX Y;  1VIO A;  4QQB A;  3MEK A;  5I3U B;  4WFX A;  3E01 B;  2HMI B;  2CA9 A;  2JVR A;  1ZA1 B;  3A3O B;  4IDK B;  4OYM A;  2J0X A;  3W3S A;  4K0K F;  1FJC A;  3CMQ A;  3TZW A;  5A6W A;  3QT5 A;  2DGW A;  3HHL C;  2F7V A;  3NS7 B;  3JYT B;  4K4Y A;  1OIA A;  3MPD A;  4ZLL A;  2FGO A;  2GV1 A;  4DMZ A;  4JI3 F;  1JLA A;  1UET A;  3H2L A;  1JX4 A;  2M9K A;  1VQL S;  4I56 A;  1LWX A;  4JYA F;  2HHX A;  4RW6 B;  4P7V A;  2DH9 A;  3MM6 A;  4RKU C;  1U24 A;  1AXQ A;  4TN2 A;  4URQ U;  3WC0 A;  2E5L J;  3H25 A;  1P6T A;  1YRT A;  3AJ1 A;  2HBZ B;  4BBY A;  5DGB A;  5K9F A;  2BBE A;  3CXC R;  2HQF A;  4OMF G;  2F4V J;  1DQ8 A;  2BW2 A;  2WCX A;  3T5J A;  3RR8 A;  3GCW P;  4RBT A;  2O66 A;  2PFF B;  1UVL A;  2DNG A;  2B5J B;  2J9C A;  1HNV A;  3AHP A;  4MKV A;  1MRO B;  1V3R A;  2F40 A;  2JOQ A;  3OXF A;  4OZL A;  4RW7 A;  4IO9 Q;  3FSX A;  3NBP A;  1PIL A;  3NP5 A;  4DL0 C;  3J81 j;  1D0E A;  1MSW D;  4ALZ A;  1HD0 A;  1NKB A;  5MLC V;  5EGY A;  3C15 B;  2R8K A;  1RKI A;  3MHY A;  4I1T A;  3GG1 A;  3ENA A;  3UCU P;  2QV6 A;  4PXB A;  1SUQ A;  3RTV A;  7AT1 B;  4FF4 A;  1Z2L A;  2OAU A;  4KHM A;  4P2S A;  1HMV A;  1F5B A;  3CNQ P;  4PXC A;  3UQS A;  2ZKT A;  2XGQ A;  2XWX A;  5FD1 A;  2DHX A;  3M2U B;  1VQP S;  4DSL A;  1RT4 A;  2CQ1 A;  1H2V Z;  5D4O A;  2VJU A;  2CYY A;  1KNZ A;  1VYA A;  2XSF A;  3OHB A;  3PFO A;  2IAJ A;  4CWB A;  1RLC L;  2OPQ B;  3LP1 A;  3J7A 1;  1GMW D;  3G6Y A;  3OXL A;  3FVY A;  4RR5 A;  2WVB A;  5HBM B;  4ECR A;  1EAY C;  2DNK A;  5HRO A;  3FFI B;  1JJH A;  1YJU A;  2EFG A;  3OTB A;  1WOR A;  2GC8 A;  4K2J A;  1LFP A;  3IWN C;  1CC7 A;  3G4S S;  2BJ7 A;  1V3Z A;  1SQF A;  3F0N A;  4YEA A;  3VGV A;  3R5A A;  5FII A;  3BO4 A;  2E9R X;  2FZC B;  4KHP F;  3HZE A;  3SDE B;  1S77 D;  2K8G A;  1QE1 B;  4FXV A;  4KBI A;  4NZ6 A;  4PEO A;  4DI6 A;  3QJP A;  1OQ3 A;  1RTZ A;  2CAD A;  2G0I A;  4J90 A;  4QIE A;  2E5G A;  2YNF A;  5IQ6 A;  3OL7 A;  3H4D A;  1N34 J;  2UXD J;  3QAU A;  2KT5 A;  2HFN A;  4LR7 A;  4J5O A;  3OBI A;  4DPX A;  4WK3 A;  4CO2 A;  3FBE A;  2DCU B;  3LAN A;  4NML A;  4I67 A;  5D6G A;  2B3T B;  1M5V C;  1C2P A;  1TL7 B;  3LPY A;  1GMV A;  3WIU A;  4KR0 B;  4X66 F;  2A10 A;  1ZPV A;  2P9E A;  5HAO A;  4IKA A;  4YOE A;  4WBF A;  2DT9 A;  2BA9 A;  2G1H A;  4L72 B;  2R7O A;  3NGD A;  3G6E S;  4ED5 A;  3DRP B;  4CLP A;  4X64 J;  1YRX A;  1IKV B;  2HLT A;  2Z2Z A;  3H5X A;  2R7T A;  2PE8 A;  3HD1 A;  4NYP A;  2BJD A;  4F0K A;  5AE3 A;  5F8I A;  2CQP A;  2E1A A;  1JLQ B;  4YB1 P;  2GIR A;  2KXN B;  1FXR A;  4QWC A;  2X51 A;  1K8A T;  1R43 A;  1S1X A;  2CPH A;  2DGS A;  3OFH A;  3HJV A;  3CDU A;  3PEH A;  4YY3 J;  1RZM A;  1YJW S;  4EUV A;  2MKY A;  2LDI A;  1XC9 A;  4IFV B;  4A8Y A;  2CKW A;  2IC3 B;  3G2X A;  1HR0 J;  2B6A A;  4QIG A;  3C14 A;  4UQG A;  3LP1 B;  2ZD1 A;  3CCR S;  3R27 A;  5DG8 A;  3K58 A;  2WON A;  1VQ9 S;  4FN5 A;  1D8Z A;  4LQ9 A;  2CPZ A;  3RBD A;  4DFJ A;  3TOQ A;  1X4E A;  3UDV A;  4A8M P;  4LF5 F;  4USU A;  4FXW A;  1FER A;  2JDJ A;  3OHA A;  3KJN B;  3KWM A;  4KGZ B;  5KFI A;  3QT6 A;  3T5K A;  1XNR J;  1NPP A;  1NXI A;  3PYD A;  3QGP A;  4LFB F;  4IOA Q;  3MM7 A;  3R7B B;  1KEK A;  1IKW A;  1QSY A;  1OYD A;  3C8Y A;  4DV6 F;  3IG1 B;  5A0Y B;  1V5V A;  3BSC A;  1VHF A;  3HVT B;  4L6V 3;  2CWK A;  2MEW A;  4CIO A;  3ZTP A;  1TAU A;  1PJ5 A;  4CZC A;  2Z30 B;  3PHT A;  2B9E A;  5KFK A;  3C46 A;  2E9Z A;  1KON A;  2AGO A;  2Y0B B;  2VPZ B;  2DIT A;  4MAK A;  1GXU A;  3US5 A;  3CJ4 A;  4URS A;  2VJV A;  3WC2 A;  1NK6 A;  3H0P A;  4ANE A;  3DYA A;  2HWI A;  4FYW B;  1Q53 A;  2X3G A;  5LXR A;  2JEG A;  4H4O B;  3T9Z A;  4EK2 A;  1RAA B;  3NCP A;  3KNG A;  1R8A A;  3KDN A;  4UUX A;  3UD4 P;  1UA0 A;  1T0T V;  1CJU B;  5DET A;  3KLH B;  2V2Q A;  4NLT A;  4PZV A;  5B0F A;  1GQE A;  1QAY A;  2VG5 A;  4KHP J;  2YNI B;  1XMQ F;  4JOU A;  2D9O A;  4CLL A;  2AD9 A;  4JI5 J;  1XMO J;  3DLK B;  2DJW A;  2E7W A;  2P6T A;  2ZVS A;  3GLJ A;  4K5R A;  5RUB A;  1KQS R;  3E2E A;  2RHS B;  3UO0 A;  1C4A A;  2E29 A;  2U1A A;  3ZTR A;  2PEB A;  3CCS S;  2PGC A;  3HVW A;  3H5S A;  4C8M A;  2CQC A;  5AXM A;  5JXS A;  5KT3 A;  3MUV P;  2UVR A;  1YZ7 A;  4NLP A;  4DV2 F;  4QCL A;  3HVT A;  1OPI A;  2BE2 B;  3B78 A;  4M5H A;  4PAB A;  4M5M A;  3QT8 A;  3F73 A;  1RT5 A;  1FRH A;  3M8Z A;  5HAT A;  2NCK L;  3SSR A;  4G3I A;  1RT6 A;  2YH0 A;  4I6Y A;  3BR9 A;  4USJ C;  5CZX A;  4WF9 Q;  2UU9 F;  4XPC A;  2F8E X;  2OIH A;  2BRL A;  3TO8 A;  1JLF A;  1TTH B;  3D6H B;  1NM2 A;  4ZPC A;  5EX0 A;  1RCO B;  1CJV A;  3GWC A;  3V4I A;  4OJ1 A;  4X4U A;  2F8M A;  2LQJ A;  2RS8 A;  3N9U C;  3KJQ B;  4ELV A;  4HVZ A;  1HQE B;  2OFG X;  1OY6 A;  3BSA A;  3KLI B;  4KGM A;  4O4G B;  1SKU B;  3PNI A;  4CP5 A;  4DR1 F;  2AMC B;  2EG1 A;  1HBM B;  1HQU A;  1OO0 B;  1X5S A;  3B4D A;  3R6G B;  4ZHR A;  1KC8 T;  4LF8 F;  2FDN A;  2ZH9 A;  3MMJ A;  3G86 A;  2YNH A;  3MPW A;  3F44 A;  4HL9 A;  3CJK A;  2JEF A;  1IBK F;  5D15 A;  3M9N B;  3GII A;  3V6H A;  3TRG A;  2PA3 A;  1L3S A;  1JLQ A;  2U2F A;  1L3K A;  2IBK A;  1O5J A;  4OHX A;  5J2Q A;  3ZNU A;  1EAR A;  3CGI A;  1G7C B;  3E3X A;  4ED7 A;  2ZZN A;  3GPA A;  1J27 A;  1GAO A;  4DEZ A;  5HSP A;  1UPP A;  3IAS 9;  4IQX A;  1ZPW X;  5HMX A;  3W2V A;  2V8H A;  3K5O A;  4QW8 A;  2BE2 A;  4HTJ A;  2OPR B;  1CJK B;  4UZC A;  1OS5 A;  4LF6 J;  2BAC A;  2MQQ A;  4I2Q A;  1F3F A;  1ZM4 A;  3I32 A;  4USH A;  4N8N A;  3UE2 A;  3ZTS A;  4V19 J;  4C4W A;  1C0T A;  5HK4 A;  2ZEJ A;  4LR8 A;  5D4L A;  2UVW A;  4HH1 A;  4DV4 F;  1VR6 A;  4F3O A;  1KS2 A;  1BHN A;  3HFV A;  2HS3 A;  1NJW A;  1S76 D;  1K0T A;  2H3E B;  1FXD A;  1YTY A;  4KGX B;  4ZIT A;  3HSZ A;  4WFZ A;  4Z7C A;  3OLA A;  4F4X A;  2HBR B;  5I3U A;  2W25 A;  2HMI A;  4ELT A;  3QQC D;  3KHR A;  5I42 B;  2GJF A;  3JAM Y;  1LWC B;  3JYT A;  3RAM A;  1NME B;  1RTJ B;  3MMC A;  1M1G A;  4BCA A;  1VQ4 S;  4A8Q A;  2B4P A;  3FMW A;  3DC2 A;  3FEZ A;  2OPS B;  3I0R A;  3QO9 B;  4J9V A;  3C6U B;  4Q44 A;  1MML A;  3MAA B;  4L76 A;  1NZA A;  1U47 A;  1FX2 A;  3GE9 A;  1TEL A;  4CO5 A;  5LSR A;  2F4V F;  2FLP A;  1LW0 A;  3C66 A;  4OI2 A;  4F26 A;  5DLF A;  2R8G A;  4QWD A;  2AYG A;  2DHH A;  4ILM A;  4KPC A;  3AJ2 A;  1HI0 P;  1CLF A;  4A47 A;  4HTI A;  4NX9 A;  5EDW A;  4UOC A;  2LEP A;  3CCM S;  3HHD A;  1RHM B;  3M8S A;  5GMK a;  1RWX B;  2RQK A;  1TL3 B;  5JUM A;  4DR2 F;  3MM7 B;  1WD6 A;  3V81 A;  1D8Y A;  5FJ4 A;  3JSR A;  1DAR A;  2GQC A;  2OPP A;  2WVD A;  1P9Q C;  4M5I A;  2BVZ A;  2XYP B;  4FYY B;  4DU7 A;  4OV6 A;  3MUM P;  1VMB A;  2V50 A;  5KT5 A;  5DDO C;  1QUP A;  2XTJ P;  2L48 A;  3CC2 S;  5E3Q A;  1G3O A;  4DR4 F;  2OML A;  4RZR A;  4ILR A;  2K3I A;  5ETS A;  3RUB L;  4ECS A;  2AYB A;  1VIS A;  1ZM9 A;  1MNE A;  2VON A;  3MAQ A;  1UKU A;  5L9N A;  1ZM3 A;  3C19 A;  3I5C A;  3JQK A;  2MHE A;  3SV4 A;  3CD7 A;  4F3Q A;  2HQ3 A;  4CO4 A;  1YSJ A;  2ASL A;  3EVW A;  2EFN A;  2CFX A;  4J7C A;  2NXN A;  2XI3 A;  4ZVP B;  1DTT B;  4DR5 J;  4F02 A;  4NLG A;  1WC0 A;  2MZR A;  1BUX A;  3BKT A;  2MLY A;  3FBF A;  3L7P A;  2EFP A;  5IM0 A;  2Q6B A;  2WW8 A;  4XO0 A;  1VC6 A;  1O8B A;  3G8T A;  2VFU A;  2KU7 A;  2RDJ A;  4FF2 A;  1F5C A;  3P45 B;  1TP7 A;  3KNA A;  1LWF A;  3AB2 B;  2OUG A;  4MMO A;  4CT8 A;  3RAX A;  2JEI A;  1KOH A;  2CDQ A;  4P2F A;  1IQZ A;  2MY7 A;  3UCG A;  4IOC Q;  4P74 A;  1T3N A;  3T5H A;  4DV7 F;  2EBG A;  1FK9 B;  1WF2 A;  6FDR A;  4Y6I A;  1TAQ A;  5B7W A;  2YX4 A;  2AZ3 A;  4RUB A;  1VBX A;  5GAG I;  4B3M F;  3QIP B;  1ACM B;  3T19 A;  2J7K A;  2MKC A;  4Y2I A;  6FD1 A;  4PQU A;  1VRT B;  3SSS A;  3TUJ C;  1N88 A;  3KOA A;  1FDA A;  2ZOM A;  4LSN B;  4OYZ A;  2OEJ A;  4QIV A;  3BO3 A;  2I2Y A;  2GVD B;  2KT3 A;  3V6D B;  4PYA A;  4JYA J;  2BZ2 A;  2J0Q D;  3O8W A;  3DOL B;  3OVS A;  3VF0 B;  4UOG A;  3FSY A;  5L1J A;  3CIZ A;  1RHR B;  2EFQ A;  3H2U B;  5ETL A;  1RYS A;  1HBU A;  1RHQ B;  1TV6 A;  1M90 T;  1J5E F;  3PO5 A;  4DJB A;  3M8Q B;  4ZVS B;  4YY3 F;  3KK3 A;  1XK8 A;  1H0H B;  2OPQ A;  5J2M A;  1CJK A;  4DX8 H;  2HZV A;  2ILY A;  2O1P A;  1PKU A;  5L38 A;  3D2W A;  3K2Y A;  5K20 B;  4B3M J;  4YUD A;  5IS2 A;  5HRO B;  2DB1 A;  1S1T B;  4PXD A;  1N34 F;  3HI9 A;  1OSC A;  2ATC B;  4M5N A;  3ULH A;  2G9O A;  4F8R A;  4F4W A;  3TAN A;  1IVZ A;  3GZ7 A;  1NHV A;  2HEK A;  1EB0 A;  3DN9 A;  4I4B A;  2NQP A;  1PBU A;  2F8H A;  1SUQ B;  2LVW A;  5A0Y A;  5BYR A;  1UWB B;  5J2P B;  4CH7 A;  3VAL A;  1S4E A;  4P10 A;  4J9L A;  3JS9 A;  5F9N A;  3N5F A;  4QZV B;  1U45 A;  3RG6 A;  4O0I A;  2MGZ B;  2Y8W A;  3M2U A;  3VVT A;  1EP4 B;  2MY8 A;  2QIF A;  2QX0 A;  3EVM A;  2R7W A;  4K4X A;  5BYQ A;  4Q5V A;  2DD8 S;  4EEY A;  2XG8 A;  2ZFH A;  1A9N B;  4X64 F;  1DTQ B;  4F36 A;  3W8G A;  2AQ4 A;  3BGR A;  3TEH B;  1U2F A;  1S1U B;  4KIA A;  5CYQ B;  3NY0 A;  3AAW B;  2MKK A;  4I2P B;  3OL6 A;  1K44 A;  3K57 A;  3HHN B;  5JMN A;  4XDD A;  5KT6 A;  1UAW A;  3K5P A;  1QTM A;  1FES A;  1HD1 A;  2V8P A;  5B0A A;  2XLK A;  4JI1 F;  3LP0 B;  4BHQ A;  3CD0 A;  3SFG A;  4DV1 F;  1NJX A;  2HHW A;  1DQA A;  4EFA C;  2ZJR Q;  4ED2 A;  2ILZ A;  4DV3 F;  1M5P C;  1UZH A;  1AW0 A;  3GIK A;  3GV7 B;  2ALZ A;  2CJB A;  1ZET A;  1NBE B;  4DBQ A;  2HKE A;  5LT5 A;  1DRZ A;  3L7U A;  2ZH1 A;  3DRP A;  4OLO A;  3DLE A;  1HNX F;  3HHK A;  3MM6 B;  4H4M A;  3GJS B;  2MKJ A;  1KR4 A;  2P6S A;  4ED1 A;  5B0C A;  4NI2 B;  4Q0B B;  1U7L A;  5L8R C;  1TL7 A;  4X84 A;  4CTA A;  1PAE X;  2R2R A;  5EX3 A;  4DV0 F;  2E7X A;  3P5T L;  1SC3 B;  3C16 A;  3W64 A;  1N32 F;  4RU2 A;  4LT6 A;  3GP9 A;  3FUY A;  1TKT A;  1D1U A;  1RWV B;  2KO1 A;  1S1V A;  2QEX S;  2BOP A;  2MTL A;  2ZOG A;  4DV5 F;  2C28 A;  3CC7 S;  2HHV A;  5C25 A;  2VG7 A;  4DCP B;  2ZM6 F;  2OJ3 A;  3HO1 A;  2FB0 A;  2DXD A;  1DUR A;  1HLW A;  4F4A A;  2YBV A;  1B3T A;  5J1P A;  1FKA F;  1RB0 A;  1UFW A;  3RJM B;  3M32 B;  4DL5 A; 
#chains in the Genus database with same CATH homology
 5LMN J;  1FJG J;  4JI8 J;  4NEY A;  4X65 J;  1XMQ J;  4AQY J;  4DV2 J;  4DR2 J;  5LM7 E;  1N32 J;  2KVQ E;  1N36 J;  3IMQ J;  4X62 J;  4LF4 J;  4DR7 J;  4DV0 J;  2VQE J;  2UU9 J;  4DV1 J;  4LFB J;  1IBM J;  3JAM U;  2UUC J;  1IBL J;  4LF9 J;  1IBK J;  5IWA J;  4B3S J;  4K0K J;  4DUZ J;  4JYA J;  3OTO J;  4JI6 J;  4PWW A;  3J81 U;  4JI1 J;  2UXD J;  4GKK J;  1N34 J;  4JI7 J;  4DV3 J;  4DUY J;  4B3T J;  4B3M J;  3R2C J;  2ZM6 J;  4X66 J;  4LF6 J;  2KL8 A;  4LFA J;  1I94 J;  4X64 J;  4KY3 A;  3J7A N;  4NEZ A;  3J80 U;  4DR3 J;  4NXN J;  5FLX U;  4LF8 J;  4YY3 J;  4OX9 J;  1XNQ J;  3D3B J;  1HR0 J;  1J5E J;  1N33 J;  1HNZ J;  4LF5 J;  5BR8 J;  2HHH J;  3T1H J;  4HHU A;  2UUA J;  4JI3 J;  1XNR J;  4B3R J;  4JI2 J;  3R2D J;  5A2Q U;  3D3C J;  1HNX J;  4DV6 J;  2VQF J;  4LF7 J;  2MEW A;  2UUB J;  4GKJ J;  4DV7 J;  4NXM J;  2UXB J;  4JI0 J;  2E5L J;  4RJV A;  3T1Y J;  4DR4 J;  4YHH J;  4DR6 J;  2F4V J;  4JV5 J;  2MQ8 A;  5AJ3 J;  4LFC J;  1HNW J;  4DR1 J;  4JI4 J;  2MTL A;  5IT9 U;  4DV5 J;  4DV4 J;  4KHP J;  3W1Y C;  4KYZ A;  4V1A k;  4DR5 J;  4JI5 J;  5LMU J;  1XMO J;  2UXC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...