1FJGO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1fjgO00
1IBMO 4JI5O 1J5EO 4LF4O 2DOSA 1R6TA 4DV5O 4B3MO 4AQYO 4JI2O 1HNZO 4GKKO 2Z0AA 4LFBO 4B3TO 1KUQA 1XNRO 1HNWO 4DV3O 3M8AA 2UXCO 2LW7A 4JI3O 1FYJA 2JRIA 4YHHO 2UUCO 1HNXO 3SDLA 4B3RO 1AB3A 4X66O 4KHPO 1XEQA 4JV5O 4JI6O 4X65O 2N74A 5LL6Y 5IWAO 3R66A 4LF9O 4DV0O 5A2QN 1XNQO 4LF6O 4DV7O 4DR6O 2FKXA 1X59A 2UU9O 4B3SO 1FJGO 4LF5O 1FKAO 1IBKO 1N34O 4DR4O 1A32A 4DUYO 5BY1A 4JI1O 1HR0O 1AILA 5BXZA 4OPAA 3F5TA 4JI0O 3T1HO 4DV2O 5IT9N 5FLXN 1N36O 4A5UB 2E5LO 1D2DA 4DR2O 4NXMO 3J81N 4JYAO 2VQFO 5H5NA 4DR1O 4X62O 1YZBA 1DK1A 2AGAA 2ZKOA 2UXDO 4DV1O 4JI7O 5LMUO 1I94O 3O65A 4X64O 4DR5O 1N33O 1N32O 2ZM6O 4LF7O 1G1XB 4DV4O 1XMOO 4JI4O 4K0KO 1NS1A 2VQEO 5BR8O 1XMQO 3JAMN 4LF8O 4GKJO 2UUBO 4LFCO 3RT3C 3J7AU 4LFAO 4OX9O 4JI8O 3OTOO 3J80N 2UXBO 1R1BA 4OPHA 4YY3O 4DV6O 2F4VO 4NXNO 4DR7O 2UUAO 2HHHO 2DJVA 4DR3O 4DUZO 1F7YA 3T1YO 5LMNO 1IBLO
chains in the Genus database with same CATH superfamily
1N4CA 4H0LB 4PDMA 5KHKA 2AZ2A 4BIUA 1Q5OA 2JGUA 3ML0A 1XQ8A 3CP1A 4UCRA 1ZL8A 2Z0AA 2XUMA 5EK0A 4JI3B 2GTSA 3DGEA 5KAIZ 2CK3G 1HNWO 2UUCB 2LW7A 1D5NA 1HNXO 3CJHB 5JCOC 5IWAB 5CN0A 4J9YB 2ADPA 1WB7A 2QKAA 4DR6B 2FL4A 3M7MX 1XNQO 2IW5A 2BSKA 1NQTA 3ABUA 5BY1A 3BA9A 5LYJA 3N2GA 4JI1O 1K33A 2WLIB 5FLXN 1KP2A 3CS5A 1ZSPA 3T4ZA 4UVCA 1I08A 3SGIA 5CA3A 3ZMZA 4CS3A 4FVMA 2EBOA 1KB9F 4CH4A 1N32O 2ILMA 3L9DA 1L0NH 4H13B 1SKVA 5L3FA 1M93A 1KQSU 4K0KO 2C2AA 5BR8O 1SETA 4GKJO 5LHGA 3JATA 3S3WA 1COWG 4UB8Z 4J11A 1SA0B 2W6JG 4O4IA 3FB5C 3WB0A 4YY3B 1FXKC 4TOIA 3HKDA 4DR7B 3QG5A 1TUBA 2HHHO 3SPCA 4Q20A 2F95B 3K03A 3ABTA 4ZHQB 1DLBA 4CS4A 4JZGA 3LDEA 3CCEV 5C93A 1RPOA 4JI5O 4CC6A 5IDJA 2IU3A 4AQYB 3D8CA 4MTFA 1F4NA 2IH1C 1SQQH 2XOKG 4N23A 4R8CA 2AXTZ 4B3TB 1I0HA 1G8MA 3RN4A 3JD1A 1NI8A 1ZL8B 3M8AA 2CGOA 2H8PC 1Q7YW 2M6YA 2RCVA 2MW2B 1KD1W 2R72A 5A2QN 2D3OW 3VQYA 2QM7A 5EZYA 4I4TB 3SPIA 1IBKO 2Y0IA 4B7EA 1H2LA 3GVMA 2RQ6A 2VWJA 1AP6A 1TAEA 5TISZ 4JI0O 5IJ0A 5LYJB 2O57A 2ZE5A 5CB4A 3G6EV 3DSQA 2R70A 5CA1B 4DR2B 5L3EA 4JYAO 3D36C 3K06A 2VQFO 1Y6XA 5E1AC 5LP6C 5IY5C 2JDIG 2HVKC 1DK1A 2ZKOA 2XTAA 4DK0A 2FTKA 4EB6B 4PA3A 4UVAA 5B66Z 1N33B 5F2VO 3G80A 5EYPB 4PA7A 4QGPA 3OMIB 4G2KA 3BABA 2YC0A 3W7XA 1KU9A 3CWBH 2VQEB 1YJWV 1NS1A 3K79A 1R6NA 5BMVB 4I0XB 2P67A 2Z3YA 4MTXA 3P32A 3IAYA 2NN4A 1ZTEA 3OTOO 4MVQA 2UXBO 2EJ7A 1GH6A 3JATB 2VWKA 1S77D 4DV6O 3CPWU 2F4VO 1AI5A 1L0LH 2L6LA 3HKDB 3JASA 2ITCC 1TUBB 4DO2A 1EFRG 1XUQA 3UKMA 3OFNG 4LF4B 1XREA 3ZHSA 2ATKC 3CRCA 3RGBA 1R6TA 4B3MO 1ZWIC 2FB5A 2OCCB 2P22C 3MHSC 4JAAA 3ASOB 4KL1A 4X65B 1PNLA 1SC5B 2N74A 4LF6B 2UU9B 4K8ZA 5L3BA 4LF5O 3ABKB 3OW2U 3K5NA 4FLYA 3CSXA 4IHJB 2EIMC 3TK1A 3AG2B 2H3OA 4O2BA 4UV8A 4UV9A 1N36O 2E5LO 1F4MA 1K4DC 1Z2GA 5IJ0B 2CGNA 3B8MA 3ZRWB 5CB4B 2HFEC 3ETGA 5A9GA 3G4SV 1OCZC 1GM9A 4GX2A 2UXDO 1I94B 2HJFC 3LSSA 5EBMC 5LMUO 4QE7A 2Y4UA 1RSOB 1HW7A 2F93B 4LH7A 2IU0A 4RUEA 4Z1MG 4ICGA 2OTJV 1S3JA 2XNDG 2P06A 3SYAA 3ZRVA 1THZA 1M56C 4LFCB 2FYUH 1VQOV 1R1BA 4GLXA 4W4KA 1H38A 2M7WA 4MT8A 2XAJA 1QR8A 2ZXWC 1NR1A 2LFSA 1WPXA 2WPDG 1KP3A 3ASNB 4PI0A 2OIGA 2NNUA 3VQXA 1OJHA 1YXBA 1BT8A 1SQPH 4DV5O 3AEIA 3WG7B 3K57A 3F7YC 2QWOB 3AG4B 3OTFA 4O4JA 4ZI7A 4TWKA 2UXCB 1XNRO 3X2QC 3BEHA 1M90W 4J7KA 5KMGA 4X1IA 4B3RO 1H8HG 2QM8A 5LBQA 1EN4A 4HAMA 2A0LA 1TUEB 4I9WA 1K97A 3U0ZA 2JK5C 3K08A 2JJ1G 3SJAC 2WLLB 2DYSB 1K5QA 1U97A 2RDCA 2AW9A 3HKEA 4CH3A 4P9PA 2PGGA 1URFA 3T1HO 3EFFK 3OR7C 2CH7B 5FPOA 3NR7A 2HKOA 1OCOB 3T2MA 3JAKA 4O2BB 3CMEV 2ETNA 4QJFB 2QWNB 2WAMA 2EILC 2K9PA 4DV1O 4X64B 3ZEDA 2XASA 1KBHA 1P7BA 1QVGU 4UCSA 4H37A 3K5OA 2YICA 2F43G 4QPJA 1QLNA 4EFBA 1VMGA 4XBFA 5HFMA 1XMQO 4PA9A 1OCRB 3AG7A 1MZFA 3ZHVA 1V55B 4E4EA 3FAVB 2PZSA 3J80N 1IVSA 1BGYH 4CH6A 4NXNO 2UUAB 5J2UB 1ROPA 3DTUB 4JYCA 1JFFA 3BVOA 3T1YO 4C7UA 4N21A 1IBMO 3K59A 3QO8A 2GUZA 2QKCA 5EC1C 2EINB 4MTGA 4J80A 3CRRA 3M99B 3HKBA 1M9NA 3ABMB 3A0HZ 3N27A 1O9GA 4LFBO 1HNWB 2QWPB 3JARA 1CXZB 4DV3O 2YUAA 4X88A 1HNXB 1FYJA 1DF5A 4ZI7B 2PY5A 1VQ9V 3QNEA 1BZKA 3B77A 1YEWA 4X1IB 4UFZA 1I5YA 1XNQB 4DK1A 3SYQA 2EIJB 4JYYA 4KFMA 1P4RA 1WP8A 4TV8B 2P90A 3IC7A 3JYCA 1FJGO 1VQMV 2ODMA 1FKAO 2D2CB 5B1OA 1BCCH 4JI1B 3ZRSA 2PUSA 1FS0G 3CEIA 2QSAA 2N05A 2QWRB 4BR6A 4NYKA 4DXWA 3TJTA 3CCQV 3E8HA 2XAFA 5DN6G 3BRCA 2V1DA 3FYEB 1W0JG 3RWRD 3JAKB 4X62O 5B1BB 5IYDO 1OV9A 3L75H 1WNSA 3K5LA 2WLIA 3RYHA 5K1XA 2Y69C 1RFYA 1LUVA 2IH3C 3JD2A 2LW1A 4FLUA 4MVZA 2CTQA 4K0KB 1GK9A 5BR8B 2CTPA 4RQFA 4W4LA 4GKJB 2GTAA 5GTIZ 1M57C 2DYRC 4DW0A 3TXSA 4J7JA 4BW5A 3ZN1A 2IM9A 2HHHB 2KG7A 1WAZA 3APQA 1K9MW 1LR1A 4F6RB 4CH5A 4JI5B 5CMUA 3CCSV 4G28B 2DOSA 1SA0A 1VARA 4F6EA 2Q7GA 3RVYA 5L3GA 5EBWC 4U3JB 4FPPA 4RAIA 4BIOA 4JI2O 5B1NA 1GKFA 5KHJA 2WSSG 2YXHA 1IZ3A 3OGIB 3IFXA 5EIBD 4FFBB 3W7SA 1K8AW 1GN3A 3JARB 2WLKA 2QR4A 3JD3A 4FZ0A 4LF9O 1H2KA 1RPRA 1G4YB 4J10A 4J9ZB 1Q6UA 2R9AA 5KHGA 2FKXA 1IBKB 3UT5B 4HYOA 3FX7A 3U11A 3OT7A 1Q82W 4YXWG 5KLVH 4JI0B 1Q90D 4RWUA 3DC5A 3W7WA 1AR4A 4ZIBA 1D2DA 1WA8A 4JYAB 2VQFB 2ZD9A 3E8FA 4I4TA 2YI9A 3Q4HB 3ZHUA 5LXTA 1YZBA 2HG5C 1B6QA 2OWOA 3QF7A 1SZTA 1X4TA 5LA6A 1V54B 1WLEA 4P9OA 3SPHA 2RJZA 3ZMSA 5JJJB 5CA1A 4MW8A 3RYHB 1GN6A 1DGSA 1SQVH 5B1AB 3JALA 4LF8O 2QWQB 2UUBO 1FAFA 3FB8C 2CUGA 4EB6A 3OTOB 5LOVA 2UXBB 5EYPA 4DV6B 2F4VB 3IJ4A 4MVOA 2DJVA 4DR3O 2ZR2A 1F7YA 1K7DA 1JA8A 3KCYA 2YEVB 4ZOLB 5LMNO 1US6A 5GTHZ 1PL4A 5BMVA 4I0XA 2WLNA 2PI5A 2Q0AA 1RM1B 2KG7B 4U7OA 2GDSA 1YITV 4B3MB 1JMKC 3RW0A 3EHBB 3FD9A 1HNZO 3AG3B 1O9HA 4X1KB 1OCCB 1VF7A 1NVPD 3GWKC 1ZX3A 1YJNV 2Y48A 3WB2A 4KHPO 3HKCA 3I5DA 2EIKC 3A0BZ 2IJIA 1JCHA 3OUSA 4XDJA 2A9HA 4LF5B 4CC5A 4PA4A 1SF9A 4WFBV 1PM9A 5KHHA 4J41A 4AI8A 4L8JA 1N36B 2E5LB 1NTMH 2IJJA 1Q43A 4FM1A 3ABLB 4R50A 1VF5B 3ZCCA 3IC9A 4DRXA 1WA8B 5LHHA 2IJKA 2DQ0A 4IHJA 2UXDB 2AGAA 5JJNB 5LMUB 1BSMA 2YIBD 3PN1A 1VF6A 3AG1B 3O65A 5LXTB 5GONA 3S3XA 5LA6B 3QVNA 2ZIMA 3SJCC 4NR1A 1XMOO 3D3QA 5JQGA 3ZRWA 1BS3A 3A2FA 4P2ZA 3JCUZ 1K34A 4UB6Z 1H2NA 5LGTA 3JALB 4OX9O 5FL7G 4IGGA 2LP7A 1RSOA 4LBEC 2FMLA 2YI8A 5LOVB 1Y4MA 1EBOA 2BTQB 1FD9A 4Z2WA 2IJHA 3OMNB 1JVMA 2Q7HA 1NU1H 1IBLO 1S72V 1MSDA 3EVKA 4GYCB 1PL0A 4WCEV 1OCZB 1LUWA 1J5EO 1IDSA 4DV5B 1IURA 3CCRV 2EZPA 4X1YB 1XNRB 4OGQB 3LDCA 4B08A 2Q5ZA 1Q8IA 5KAFZ 4FLTA 4B3RB 3RYFA 3ZN0A 2JVDA 4UUJC 4WFHA 4GCZA 4DV0O 3OAAG 3HKCB 3RBZA 4O2AB 2YIBA 1K4CC 1QBZA 4EEQA 4K35A 4NTXA 2Q4PA 4UCTA 3CB2A 3H1JH 5FNVA 3ZHRA 4DUYO 1H2GA 3T1HB 1K5SA 4WF9V 1SQXH 3A0RA 1KC8W 2GSMB 2H94A 2X0LA 3LDDA 2QTSA 3E89A 1M1KW 3CRAA 4JPRA 4DR1O 2WLLA 1KMIZ 4QPKA 4PDLA 4DV1B 3MDSA 4DRXB 3ZBHA 4FJCC 2CH7A 2ZM6O 4DV4O 1XL4A 1JJ2U 2HEPA 2ZR3A 4JF3A 1Y66A 1XMQB 5GONB 4KP4A 3F7VC 1Q3EA 5JQGB 4MVSA 4GX1A 3RT3C 3J7AU 4YIOA 4JI8O 3OR6C 5EC2C 1VQ7V 4NXNB 1SQBH 4GZRB 1QCEA 1ENVA 1NVPB 3T1YB 4GX5A 1W0KG 4JAUA 1IBMB 2A7WA 1IXMA 3FAVA 4MVMA 2DW4A 1GTOA 1JR9A 4LFBB 4O4LA 5J2UA 1NJIW 1PD3A 1XILA 4FM0A 3E2EA 1U96A 3BHPA 1QVFU 5CA0B 3K0DA 2EX3A 3RYFB 2LGQA 3E8BA 4YIPA 4B7KA 3VQWA 4FMTA 2EJRA 1AR5A 1YSCA 4JGSA 1FJGB 2AHZA 2BE3A 3E83A 2A06H 4RUFA 4HZ3A 2OCCC 1HR0O 2P6JA 5BXZA 5FNVB 3ZMTA 1WPBA 3CYOA 1S5LZ 1VIBA 4QNHB 3ASOC 4TV8A 3CXCU 1YIJV 4NXMO 3C3TA 3BCCH 4HNAA 4MSWC 3MD0A 4X62B 1R3KC 1KECA 4NVPA 3EXAA 4PA6A 2X6CA 2ZNJA 3ZJZA 3ABKC 1AJNA 4JTDB 2QDOA 2BCCH 1I7FA 4JZ2A 3UCSC 4LF7O 2QTOA 1MNGA 3AG2C 1HDJA 1JPXA 2XAGA 5J2TA 1FFXA 1CP9A 4QIWF 5C8YA 4I5SA 4LFAO 1IXBA 5JCOA 4X9QA 3OEEG 5DM6V 3OD4A 5KA5A 2Y0PA 4YJ2A 3JAWB 2XHBA 1PNMA 3L73H 1QLEC 1VP7A 3OM3B 5KX5A 4O4HB 4TT3G 3ZMVA 5DECA 1GN4A 4NTWA 3WFVA 1EZVH 2HJDA 5H2FZ 4JI2B 3RFRA 2RMKB 4PV1B 5D5QA 2E74B 1MSWD 3G67A 1KUQA 3LNMB 2K1EA 4FIPC 4O4LB 4F6RA 4UXNA 1YF2A 4X66O 4LF9B 4JI6O 3ASNC 5H6RA 4ABMA 2BTOA 4U3JA 1VQ4V 1NTKH 2W0XA 3UQ8A 4X89A 2OCHA 2LGWA 1MMMA 4B3SO 4Z1VA 4F4LA 4DR4O 3WG7C 1R6KA 4FFBA 1IX9A 5CBFA 3AG4C 1SERA 4DV2O 4TV9A 1M5IA 1Q81W 4LC1A 1FXKA 5IYZA 3RVZA 3MHHC 3UT5A 1GM7A 1P84F 2DE0X 2YIAA 4L87A 1VQLV 4IIJA 3CC4V 4HNAB 4WFFA 5B3SB 5DEDA 3AK2A 4TSFG 3TGUH 3O9OA 3E22A 2DYSC 1R3JC 1MABG 3B4SA 4WFEA 2OTLV 1KYOF 2QJ1A 5AG2A 2UXXA 4LNUB 3VQVA 1CEZA 3Q4HA 4LF8B 1VQNV 2UUBB 2YXYA 2QM4A 1OCOC 3LSQA 5J2TB 1FFXB 3ZHQA 5C8YB 1B06A 1MG1A 3CCVV 4DR3B 2E75B 4LWSB 1N32B 4DUZO 4IT5A 4YJ2B 4J7ZA 1AI4A 4ASUG 1M4UA 4HBNA 1AI7A 5LMNB 1S5HC 2JEXA 3JSNA 4D7TA 5D5PA 5KX5B 2EULA 3LSUA 3L74H 3UO2A 2E3CA 2JEUA 5K1PA 1HNZB 1OCRC 1V55C 4GKKO 1H2MA 3ZRXA 1K73W 5ITZB 1AR1B 3H1LH 3D36A 3APOA 1S0VA 2YEVA 4CBCA 1PV0A 4ZOLA 4YHHO 1G6UA 5LP6A 4KHPB 1P49A 1GM8A 2DQ3A 3OEHG 4CZZA 1E1QG 1VQ6V 4UCOA 1LNQA 2DWDC 2ZT9B 4X1KA 4DV7O 1EZJA 1ORQC 2EINC 1L8DA 4NKGB 4TQFA 3ZS8C 1N34O 1A32A 5H9CA 3L70H 1AILA 3ABMC 2LFRA 2XT9A 1VQ5V 4MS2A 3SJQC 4WBNA 1DTOA 4AILC 4X20A 4J42A 2GHYA 1JOYA 4TV9B 1BQ0A 4DYLA 3KCXA 1FXKB 4JTCB 2OT5A 1ZLZA 2F66C 2EIJC 2GBOA 2PTMA 5IYZB 2RN9A 1BQZA 1TVKB 1T5EA 4JI7O 4I9QA 2ITDC 2Q67A 4IIJB 4MVRA 2A79B 1YVWA 2B1GA 1XMOB 4DW1A 3SPGA 3DC6A 3E22B 4JI4O 3LNNA 3AK1A 3SR2C 5CBHA 1AVMA 1I5XA 2V4DA 1H8EG 4OX9B 2Q68A 1MOFA 3TXQA 1GN2A 2GV9A 3B09A 3OMAB 4UCVA 3F5WC 4D6TH 5B1BC 3ICXA 2KKWA 2WLJA 2F23A 1EN5A 1OZ0A 1GAXA 1IBLB 5E79Z 2Q7EA 1Q6IA 1BMFG 1J5EB 1WN7A 2YXLA 3L72H 1Q6HA 4NB5A 4IYIA 1JQ0A 1WB8A 2QE7G 3T4DA 4XDLA 2BTQA 2VRZA 4XDKA 2ZDIA 1XI1A 3B8NA 2YSUB 5H6QA 4NTYA 2Q8VA 1N0JA 4JV5O 4DV0B 5LP6B 3R66A 3OGCC 5IY5B 4AHCA 5KHIA 4YJ3B 4GX0A 1NZ6A 3K3WA 4X1YA 3SPJA 5L3CA 1Q86W 3FB7C 4DUYB 4FM2A 4I50A 3HR0A 2AHYA 3CRQA 1F23A 1PNKA 1Z5WA 3F5TA 1XBLA 4BAYA 1Y74B 1AJQA 1MA1A 3BFRA 4JAVA 3H01A 3NXSA 4O2AA 4TQDA 1H2SB 3J81N 4WBNB 2YS8A 4DR1B 4K8XA 2YIDA 2MK3A 4X20B 3U10A 1BL8A 2F1MA 2R9IA 2AZ0A 1PKXA 3CCUV 3AK3A 4BIZA 2BOCC 4FFKA 4DR5O 4LCUC 1UFIA 2ZM6B 1JJOA 4H44B 5B5EZ 5LHIA 4DV4B 1B04A 5JJEB 2WLHA 3CRMA 3N2KB 1P7GA 2QA4V 4PDRA 4JI8B 1QR9A 1VQ8V 2V7QG 2HR3A 4OPHA 2DN9A 1GO3F 1SQFA 1N8RW 2PYLA 4LH6A 1V54C 1UJWB 5KUMA 4BWAA 2KQXA 3CMAV 5B1AC 1GMGA 5IJ9A 2EIMB 5KA6A 3QTCA 1AP5A 1ZUQA 2BSKB 2CTWA 3CD6V 1YCIA 3GWOA 4JI3O 3CE2A 3N2GB 2UUCO 4PHZA 3STLC 1Y67A 3TCUA 4R6ZA 2X6AA 2ZIOA 5IWAO 2WA4A 5HFLA 2RNBA 2PI4A 2EZOA 1RM1C 3WU2Z 4DR6O 2X7RB 1TA8A 5L3DA 2P4KA 1HR0B 4CS2A 3AG3C 1HP8A 4I50B 1OCCC 5CA0A 1BHBA 5IT9N 1M56B 3DXRA 1VQKV 1YTFD 4A5UB 3BAAA 3E86A 4NXMB 2W0FC 3D3IA 3BPZA 2G38A 1FXHA 2ZQMA 3SJBC 4IL6Z 1J95A 3ETQA 3T1CA 3G71V 1R3LC 4ZKIA 2ZXWB 1FFTB 4U7NA 1NBMG 5IE9A 4O4IB 1SRYA 2P5OA 3SYPA 4LF7B 2XAQA 3K5MA 4RO2A 1SQGA 1Z5VA 5IYBO 2HP8A 4H33A 3ABLC 4LFAB 1JX9A 4BW9A 4UCUA 5LGNA 3X2QB 4FZ1A 4KXRA 4YY3O 1XHZA 5IYCO 1N0NA 4DR7O 3CC7V 2N04A 3AG1C 4FLZA 4JASA 2YDEA 1V9PA 3K9SA 1YHQV 2ARHA 1F51A 2R9RB 4EKWA 4AQYO 3JAWA 1VEWA 3UO3A 1OHHG 2ZINA 5EZYB 4D7SA 2CTRA 2ZE6A 2ZE8A 4B3TO 5IJ9B 3KG2A 1D5AA 4O4HA 2NLJC 4FLVA 1DF4A 4X66B 3SDLA 3ZX6A 1AJPA 3RYCA 4JI6B 5EIBC 2W6IG 3RYIA 3FKSG 5LL6Y 2ZDIC 3CCJV 3P30A 2ZNIA 2P7TC 2EILB 4B3SB 1X59A 4EFEA 1XL6A 1QLEB 4DR4B 1XHXA 5JVDA 4PJ0Z 2CDYA 3VBBA 3SYCA 4DV3B 2QKSA 3B40A 4DV2B 2HVJC 4PI2A 2B5UA 3CX5F 1FPOA 3H9VA 3E35A 4X8AA 1KKCA 1MZEA 4DR2O 3DXRB 3FB6C 4U3FH 4K3AA 5H5NA 3LUTB 1NH2D 3L71H 2A3QA 2Q9LA 4E2LA 3TETA 2HLDG 1N33O 2Q69A 2LQTA 3CCMV 3ZMUA 3JASB 2ADQB 1XDCA 2CAZC 4ZBMA 1AROP 2VQEO 4TUYA 3JAMN 4RQEA 4LP8A 3K04A 1WJZA 5KUKA 4G27B 5GW7A 4FLXA 3ETDA 2UXNA 3JD4A 1QU7A 3R65A 1NT2B 3OE7G 3GB7C 4DUZB 3W7UA 2JGDA 5EBLC 4LNUA 2PYJA 5J9PC 3VOUA 3ETEA 1VF6C 1ZAUA 2JS3A 4LF4O 3JCZA 4FLWA 4GKKB 1VQPV 4LWSA 3B2EE 1FXVA 3KZIZ 3A8TA 2OYQA 4YHHB 1PP9H 2JRIA 2LO1A 3ZIAG 3G6BA 3JD0A 4P30A 1YTFB 1QQCA 2Q73A 2X6BA 3C3SA 4X65O 4GUNA 1B3QA 3RYCB 3H1IH 2KB1A 4DV7B 3RYIB 4LF6O 5ITZA 2UU9O 2XAHA 1N34B 1KKDA 2Y69B 2WWWA 1EM1A 1K3EA 1W59A 3ZHTA 3K0GA 4OPAA 5JVDB 3QO7A 4FK5C 4PDVA 3K9AA 3E8GA 1M57B 2DYRB 1GRJA 3I56V 1EN6A 1Y76A 4JI7B 3W7TA 2JS5A 3SYOA 1I94O 4PD4F 3STZC 4MVUA 5JH7A 1YI2V 4JI4B 3P3NA 4JTAB 4I55A 3THOA 2NR5A 4LFCO 3WB1A 1NKDA 1TVKA 2IBZH 4TUYB 2E76B 2Q6AA 1WP7A 2L35A 2JIZG 2P4VA 4JYBA 2JJ2G 3CC2V 4O4JB 4WFGA 3IGAC 2QEXV 2JGDB 5KMGB 4I7ZB 4MW3A 4R7CA 3I55V 2DWEC 2OIEA 3H1KH 1K92A 3OUFA 3CJHA 5JWPA 2BOBC 2KSDA 2UXCO 2WLMA 4PELA 1TGOA 2DMXA 3FYIB 2PF4E 3HKEB 1AB3A 4JV5B 1XEQA 1UPGA 4GT1A 1YDXA 2CE4A 3FFQA 3CXHF 4MTOA 1YJ9V 4Q6GA 3BY6A 2ZE7A 1NH2B 1HWYA 1QHTA 1W2BU 3CHXA 4OXSA 2VS0A 2B1IA 2Z5UA 4KUMA 2Q0OC 4QE9A 4UVBA 1QNMA 4YJ3A 1SZXA 3BA8A 1R73A 2LJ2A 4LR3A 3QO5A 3P3PA 3UM7A 1BE3H 3C90A 4DR5B 4WFAV 4X64O 1Y76B 1Y74A 1CPYA 1RP3B 3CCLV 3HB3B 2WA3A 5BZBA 3K58A 1G1XB 2QGNA 5FPRA 3H1HH 1E1RG 5JH7B 1JFFB 1AI6A 1R3IC 1NTZH 1PPJH 1NR7A 2GUZB 1S76D 4I55B 1SS3A 1L1FA 3JSLA 1BHAA 3HKBB 4ZHQA 5B3SC 5CBGA 2UUAO 1SESA 3PJSK 1XOUA 3HPLC 2B9ZA 3KKYA 4IYHA 2ZCEA 1E79G 2EIKB 3N2KA 2Y4TA 3MAQA 1S5JA 5LGUA
chains in the Genus database with same CATH topology
1IBMO 4JI5O 1J5EO 4LF4O 2DOSA 1R6TA 4DV5O 4B3MO 4AQYO 4JI2O 1HNZO 4GKKO 2Z0AA 4LFBO 4B3TO 1KUQA 1XNRO 1HNWO 4DV3O 3M8AA 2UXCO 2LW7A 4JI3O 1FYJA 2JRIA 4YHHO 2UUCO 1HNXO 3SDLA 4B3RO 1AB3A 4X66O 4KHPO 1XEQA 4JV5O 4JI6O 4X65O 2N74A 5LL6Y 5IWAO 3R66A 4LF9O 4DV0O 5A2QN 1XNQO 4LF6O 4DV7O 4DR6O 2FKXA 1X59A 2UU9O 4B3SO 1FJGO 4LF5O 1FKAO 1IBKO 1N34O 4DR4O 1A32A 4DUYO 5BY1A 4JI1O 1HR0O 1AILA 5BXZA 4OPAA 3F5TA 4JI0O 3T1HO 4DV2O 5IT9N 5FLXN 1N36O 4A5UB 2E5LO 1D2DA 4DR2O 4NXMO 3J81N 4JYAO 2VQFO 5H5NA 4DR1O 4X62O 1YZBA 1DK1A 2AGAA 2ZKOA 2UXDO 4DV1O 4JI7O 5LMUO 1I94O 3O65A 4X64O 4DR5O 1N33O 1N32O 2ZM6O 4LF7O 1G1XB 4DV4O 1XMOO 4JI4O 4K0KO 1NS1A 2VQEO 5BR8O 1XMQO 3JAMN 4LF8O 4GKJO 2UUBO 4LFCO 3RT3C 3J7AU 4LFAO 4OX9O 4JI8O 3OTOO 3J80N 2UXBO 1R1BA 4OPHA 4YY3O 4DV6O 2F4VO 4NXNO 4DR7O 2UUAO 2HHHO 2DJVA 4DR3O 4DUZO 1F7YA 3T1YO 5LMNO 1IBLO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM O;  4JI5 O;  1J5E O;  4LF4 O;  2DOS A;  1R6T A;  4DV5 O;  4B3M O;  4AQY O;  4JI2 O;  1HNZ O;  4GKK O;  2Z0A A;  4LFB O;  4B3T O;  1KUQ A;  1XNR O;  1HNW O;  4DV3 O;  3M8A A;  2UXC O;  2LW7 A;  4JI3 O;  1FYJ A;  2JRI A;  4YHH O;  2UUC O;  1HNX O;  3SDL A;  4B3R O;  1AB3 A;  4X66 O;  4KHP O;  1XEQ A;  4JV5 O;  4JI6 O;  4X65 O;  2N74 A;  5LL6 Y;  5IWA O;  3R66 A;  4LF9 O;  4DV0 O;  5A2Q N;  1XNQ O;  4LF6 O;  4DV7 O;  4DR6 O;  2FKX A;  1X59 A;  2UU9 O;  4B3S O;  1FJG O;  4LF5 O;  1FKA O;  1IBK O;  1N34 O;  4DR4 O;  1A32 A;  4DUY O;  5BY1 A;  4JI1 O;  1HR0 O;  1AIL A;  5BXZ A;  4OPA A;  3F5T A;  4JI0 O;  3T1H O;  4DV2 O;  5IT9 N;  5FLX N;  1N36 O;  4A5U B;  2E5L O;  1D2D A;  4DR2 O;  4NXM O;  3J81 N;  4JYA O;  2VQF O;  5H5N A;  4DR1 O;  4X62 O;  1YZB A;  1DK1 A;  2AGA A;  2ZKO A;  2UXD O;  4DV1 O;  4JI7 O;  5LMU O;  1I94 O;  3O65 A;  4X64 O;  4DR5 O;  1N33 O;  1N32 O;  2ZM6 O;  4LF7 O;  1G1X B;  4DV4 O;  1XMO O;  4JI4 O;  4K0K O;  1NS1 A;  2VQE O;  5BR8 O;  1XMQ O;  3JAM N;  4LF8 O;  4GKJ O;  2UUB O;  4LFC O;  3RT3 C;  3J7A U;  4LFA O;  4OX9 O;  4JI8 O;  3OTO O;  3J80 N;  2UXB O;  1R1B A;  4OPH A;  4YY3 O;  4DV6 O;  2F4V O;  4NXN O;  4DR7 O;  2UUA O;  2HHH O;  2DJV A;  4DR3 O;  4DUZ O;  1F7Y A;  3T1Y O;  5LMN O;  1IBL O; 
#chains in the Genus database with same CATH topology
 1N4C A;  4H0L B;  4PDM A;  5KHK A;  2AZ2 A;  4BIU A;  1Q5O A;  2JGU A;  3ML0 A;  1XQ8 A;  3CP1 A;  4UCR A;  1ZL8 A;  2Z0A A;  2XUM A;  5EK0 A;  4JI3 B;  2GTS A;  3DGE A;  5KAI Z;  2CK3 G;  1HNW O;  2UUC B;  2LW7 A;  1D5N A;  1HNX O;  3CJH B;  5JCO C;  5IWA B;  5CN0 A;  4J9Y B;  2ADP A;  1WB7 A;  2QKA A;  4DR6 B;  2FL4 A;  3M7M X;  1XNQ O;  2IW5 A;  2BSK A;  1NQT A;  3ABU A;  5BY1 A;  3BA9 A;  5LYJ A;  3N2G A;  4JI1 O;  1K33 A;  2WLI B;  5FLX N;  1KP2 A;  3CS5 A;  1ZSP A;  3T4Z A;  4UVC A;  1I08 A;  3SGI A;  5CA3 A;  3ZMZ A;  4CS3 A;  4FVM A;  2EBO A;  1KB9 F;  4CH4 A;  1N32 O;  2ILM A;  3L9D A;  1L0N H;  4H13 B;  1SKV A;  5L3F A;  1M93 A;  1KQS U;  4K0K O;  2C2A A;  5BR8 O;  1SET A;  4GKJ O;  5LHG A;  3JAT A;  3S3W A;  1COW G;  4UB8 Z;  4J11 A;  1SA0 B;  2W6J G;  4O4I A;  3FB5 C;  3WB0 A;  4YY3 B;  1FXK C;  4TOI A;  3HKD A;  4DR7 B;  3QG5 A;  1TUB A;  2HHH O;  3SPC A;  4Q20 A;  2F95 B;  3K03 A;  3ABT A;  4ZHQ B;  1DLB A;  4CS4 A;  4JZG A;  3LDE A;  3CCE V;  5C93 A;  1RPO A;  4JI5 O;  4CC6 A;  5IDJ A;  2IU3 A;  4AQY B;  3D8C A;  4MTF A;  1F4N A;  2IH1 C;  1SQQ H;  2XOK G;  4N23 A;  4R8C A;  2AXT Z;  4B3T B;  1I0H A;  1G8M A;  3RN4 A;  3JD1 A;  1NI8 A;  1ZL8 B;  3M8A A;  2CGO A;  2H8P C;  1Q7Y W;  2M6Y A;  2RCV A;  2MW2 B;  1KD1 W;  2R72 A;  5A2Q N;  2D3O W;  3VQY A;  2QM7 A;  5EZY A;  4I4T B;  3SPI A;  1IBK O;  2Y0I A;  4B7E A;  1H2L A;  3GVM A;  2RQ6 A;  2VWJ A;  1AP6 A;  1TAE A;  5TIS Z;  4JI0 O;  5IJ0 A;  5LYJ B;  2O57 A;  2ZE5 A;  5CB4 A;  3G6E V;  3DSQ A;  2R70 A;  5CA1 B;  4DR2 B;  5L3E A;  4JYA O;  3D36 C;  3K06 A;  2VQF O;  1Y6X A;  5E1A C;  5LP6 C;  5IY5 C;  2JDI G;  2HVK C;  1DK1 A;  2ZKO A;  2XTA A;  4DK0 A;  2FTK A;  4EB6 B;  4PA3 A;  4UVA A;  5B66 Z;  1N33 B;  5F2V O;  3G80 A;  5EYP B;  4PA7 A;  4QGP A;  3OMI B;  4G2K A;  3BAB A;  2YC0 A;  3W7X A;  1KU9 A;  3CWB H;  2VQE B;  1YJW V;  1NS1 A;  3K79 A;  1R6N A;  5BMV B;  4I0X B;  2P67 A;  2Z3Y A;  4MTX A;  3P32 A;  3IAY A;  2NN4 A;  1ZTE A;  3OTO O;  4MVQ A;  2UXB O;  2EJ7 A;  1GH6 A;  3JAT B;  2VWK A;  1S77 D;  4DV6 O;  3CPW U;  2F4V O;  1AI5 A;  1L0L H;  2L6L A;  3HKD B;  3JAS A;  2ITC C;  1TUB B;  4DO2 A;  1EFR G;  1XUQ A;  3UKM A;  3OFN G;  4LF4 B;  1XRE A;  3ZHS A;  2ATK C;  3CRC A;  3RGB A;  1R6T A;  4B3M O;  1ZWI C;  2FB5 A;  2OCC B;  2P22 C;  3MHS C;  4JAA A;  3ASO B;  4KL1 A;  4X65 B;  1PNL A;  1SC5 B;  2N74 A;  4LF6 B;  2UU9 B;  4K8Z A;  5L3B A;  4LF5 O;  3ABK B;  3OW2 U;  3K5N A;  4FLY A;  3CSX A;  4IHJ B;  2EIM C;  3TK1 A;  3AG2 B;  2H3O A;  4O2B A;  4UV8 A;  4UV9 A;  1N36 O;  2E5L O;  1F4M A;  1K4D C;  1Z2G A;  5IJ0 B;  2CGN A;  3B8M A;  3ZRW B;  5CB4 B;  2HFE C;  3ETG A;  5A9G A;  3G4S V;  1OCZ C;  1GM9 A;  4GX2 A;  2UXD O;  1I94 B;  2HJF C;  3LSS A;  5EBM C;  5LMU O;  4QE7 A;  2Y4U A;  1RSO B;  1HW7 A;  2F93 B;  4LH7 A;  2IU0 A;  4RUE A;  4Z1M G;  4ICG A;  2OTJ V;  1S3J A;  2XND G;  2P06 A;  3SYA A;  3ZRV A;  1THZ A;  1M56 C;  4LFC B;  2FYU H;  1VQO V;  1R1B A;  4GLX A;  4W4K A;  1H38 A;  2M7W A;  4MT8 A;  2XAJ A;  1QR8 A;  2ZXW C;  1NR1 A;  2LFS A;  1WPX A;  2WPD G;  1KP3 A;  3ASN B;  4PI0 A;  2OIG A;  2NNU A;  3VQX A;  1OJH A;  1YXB A;  1BT8 A;  1SQP H;  4DV5 O;  3AEI A;  3WG7 B;  3K57 A;  3F7Y C;  2QWO B;  3AG4 B;  3OTF A;  4O4J A;  4ZI7 A;  4TWK A;  2UXC B;  1XNR O;  3X2Q C;  3BEH A;  1M90 W;  4J7K A;  5KMG A;  4X1I A;  4B3R O;  1H8H G;  2QM8 A;  5LBQ A;  1EN4 A;  4HAM A;  2A0L A;  1TUE B;  4I9W A;  1K97 A;  3U0Z A;  2JK5 C;  3K08 A;  2JJ1 G;  3SJA C;  2WLL B;  2DYS B;  1K5Q A;  1U97 A;  2RDC A;  2AW9 A;  3HKE A;  4CH3 A;  4P9P A;  2PGG A;  1URF A;  3T1H O;  3EFF K;  3OR7 C;  2CH7 B;  5FPO A;  3NR7 A;  2HKO A;  1OCO B;  3T2M A;  3JAK A;  4O2B B;  3CME V;  2ETN A;  4QJF B;  2QWN B;  2WAM A;  2EIL C;  2K9P A;  4DV1 O;  4X64 B;  3ZED A;  2XAS A;  1KBH A;  1P7B A;  1QVG U;  4UCS A;  4H37 A;  3K5O A;  2YIC A;  2F43 G;  4QPJ A;  1QLN A;  4EFB A;  1VMG A;  4XBF A;  5HFM A;  1XMQ O;  4PA9 A;  1OCR B;  3AG7 A;  1MZF A;  3ZHV A;  1V55 B;  4E4E A;  3FAV B;  2PZS A;  3J80 N;  1IVS A;  1BGY H;  4CH6 A;  4NXN O;  2UUA B;  5J2U B;  1ROP A;  3DTU B;  4JYC A;  1JFF A;  3BVO A;  3T1Y O;  4C7U A;  4N21 A;  1IBM O;  3K59 A;  3QO8 A;  2GUZ A;  2QKC A;  5EC1 C;  2EIN B;  4MTG A;  4J80 A;  3CRR A;  3M99 B;  3HKB A;  1M9N A;  3ABM B;  3A0H Z;  3N27 A;  1O9G A;  4LFB O;  1HNW B;  2QWP B;  3JAR A;  1CXZ B;  4DV3 O;  2YUA A;  4X88 A;  1HNX B;  1FYJ A;  1DF5 A;  4ZI7 B;  2PY5 A;  1VQ9 V;  3QNE A;  1BZK A;  3B77 A;  1YEW A;  4X1I B;  4UFZ A;  1I5Y A;  1XNQ B;  4DK1 A;  3SYQ A;  2EIJ B;  4JYY A;  4KFM A;  1P4R A;  1WP8 A;  4TV8 B;  2P90 A;  3IC7 A;  3JYC A;  1FJG O;  1VQM V;  2ODM A;  1FKA O;  2D2C B;  5B1O A;  1BCC H;  4JI1 B;  3ZRS A;  2PUS A;  1FS0 G;  3CEI A;  2QSA A;  2N05 A;  2QWR B;  4BR6 A;  4NYK A;  4DXW A;  3TJT A;  3CCQ V;  3E8H A;  2XAF A;  5DN6 G;  3BRC A;  2V1D A;  3FYE B;  1W0J G;  3RWR D;  3JAK B;  4X62 O;  5B1B B;  5IYD O;  1OV9 A;  3L75 H;  1WNS A;  3K5L A;  2WLI A;  3RYH A;  5K1X A;  2Y69 C;  1RFY A;  1LUV A;  2IH3 C;  3JD2 A;  2LW1 A;  4FLU A;  4MVZ A;  2CTQ A;  4K0K B;  1GK9 A;  5BR8 B;  2CTP A;  4RQF A;  4W4L A;  4GKJ B;  2GTA A;  5GTI Z;  1M57 C;  2DYR C;  4DW0 A;  3TXS A;  4J7J A;  4BW5 A;  3ZN1 A;  2IM9 A;  2HHH B;  2KG7 A;  1WAZ A;  3APQ A;  1K9M W;  1LR1 A;  4F6R B;  4CH5 A;  4JI5 B;  5CMU A;  3CCS V;  4G28 B;  2DOS A;  1SA0 A;  1VAR A;  4F6E A;  2Q7G A;  3RVY A;  5L3G A;  5EBW C;  4U3J B;  4FPP A;  4RAI A;  4BIO A;  4JI2 O;  5B1N A;  1GKF A;  5KHJ A;  2WSS G;  2YXH A;  1IZ3 A;  3OGI B;  3IFX A;  5EIB D;  4FFB B;  3W7S A;  1K8A W;  1GN3 A;  3JAR B;  2WLK A;  2QR4 A;  3JD3 A;  4FZ0 A;  4LF9 O;  1H2K A;  1RPR A;  1G4Y B;  4J10 A;  4J9Z B;  1Q6U A;  2R9A A;  5KHG A;  2FKX A;  1IBK B;  3UT5 B;  4HYO A;  3FX7 A;  3U11 A;  3OT7 A;  1Q82 W;  4YXW G;  5KLV H;  4JI0 B;  1Q90 D;  4RWU A;  3DC5 A;  3W7W A;  1AR4 A;  4ZIB A;  1D2D A;  1WA8 A;  4JYA B;  2VQF B;  2ZD9 A;  3E8F A;  4I4T A;  2YI9 A;  3Q4H B;  3ZHU A;  5LXT A;  1YZB A;  2HG5 C;  1B6Q A;  2OWO A;  3QF7 A;  1SZT A;  1X4T A;  5LA6 A;  1V54 B;  1WLE A;  4P9O A;  3SPH A;  2RJZ A;  3ZMS A;  5JJJ B;  5CA1 A;  4MW8 A;  3RYH B;  1GN6 A;  1DGS A;  1SQV H;  5B1A B;  3JAL A;  4LF8 O;  2QWQ B;  2UUB O;  1FAF A;  3FB8 C;  2CUG A;  4EB6 A;  3OTO B;  5LOV A;  2UXB B;  5EYP A;  4DV6 B;  2F4V B;  3IJ4 A;  4MVO A;  2DJV A;  4DR3 O;  2ZR2 A;  1F7Y A;  1K7D A;  1JA8 A;  3KCY A;  2YEV B;  4ZOL B;  5LMN O;  1US6 A;  5GTH Z;  1PL4 A;  5BMV A;  4I0X A;  2WLN A;  2PI5 A;  2Q0A A;  1RM1 B;  2KG7 B;  4U7O A;  2GDS A;  1YIT V;  4B3M B;  1JMK C;  3RW0 A;  3EHB B;  3FD9 A;  1HNZ O;  3AG3 B;  1O9H A;  4X1K B;  1OCC B;  1VF7 A;  1NVP D;  3GWK C;  1ZX3 A;  1YJN V;  2Y48 A;  3WB2 A;  4KHP O;  3HKC A;  3I5D A;  2EIK C;  3A0B Z;  2IJI A;  1JCH A;  3OUS A;  4XDJ A;  2A9H A;  4LF5 B;  4CC5 A;  4PA4 A;  1SF9 A;  4WFB V;  1PM9 A;  5KHH A;  4J41 A;  4AI8 A;  4L8J A;  1N36 B;  2E5L B;  1NTM H;  2IJJ A;  1Q43 A;  4FM1 A;  3ABL B;  4R50 A;  1VF5 B;  3ZCC A;  3IC9 A;  4DRX A;  1WA8 B;  5LHH A;  2IJK A;  2DQ0 A;  4IHJ A;  2UXD B;  2AGA A;  5JJN B;  5LMU B;  1BSM A;  2YIB D;  3PN1 A;  1VF6 A;  3AG1 B;  3O65 A;  5LXT B;  5GON A;  3S3X A;  5LA6 B;  3QVN A;  2ZIM A;  3SJC C;  4NR1 A;  1XMO O;  3D3Q A;  5JQG A;  3ZRW A;  1BS3 A;  3A2F A;  4P2Z A;  3JCU Z;  1K34 A;  4UB6 Z;  1H2N A;  5LGT A;  3JAL B;  4OX9 O;  5FL7 G;  4IGG A;  2LP7 A;  1RSO A;  4LBE C;  2FML A;  2YI8 A;  5LOV B;  1Y4M A;  1EBO A;  2BTQ B;  1FD9 A;  4Z2W A;  2IJH A;  3OMN B;  1JVM A;  2Q7H A;  1NU1 H;  1IBL O;  1S72 V;  1MSD A;  3EVK A;  4GYC B;  1PL0 A;  4WCE V;  1OCZ B;  1LUW A;  1J5E O;  1IDS A;  4DV5 B;  1IUR A;  3CCR V;  2EZP A;  4X1Y B;  1XNR B;  4OGQ B;  3LDC A;  4B08 A;  2Q5Z A;  1Q8I A;  5KAF Z;  4FLT A;  4B3R B;  3RYF A;  3ZN0 A;  2JVD A;  4UUJ C;  4WFH A;  4GCZ A;  4DV0 O;  3OAA G;  3HKC B;  3RBZ A;  4O2A B;  2YIB A;  1K4C C;  1QBZ A;  4EEQ A;  4K35 A;  4NTX A;  2Q4P A;  4UCT A;  3CB2 A;  3H1J H;  5FNV A;  3ZHR A;  4DUY O;  1H2G A;  3T1H B;  1K5S A;  4WF9 V;  1SQX H;  3A0R A;  1KC8 W;  2GSM B;  2H94 A;  2X0L A;  3LDD A;  2QTS A;  3E89 A;  1M1K W;  3CRA A;  4JPR A;  4DR1 O;  2WLL A;  1KMI Z;  4QPK A;  4PDL A;  4DV1 B;  3MDS A;  4DRX B;  3ZBH A;  4FJC C;  2CH7 A;  2ZM6 O;  4DV4 O;  1XL4 A;  1JJ2 U;  2HEP A;  2ZR3 A;  4JF3 A;  1Y66 A;  1XMQ B;  5GON B;  4KP4 A;  3F7V C;  1Q3E A;  5JQG B;  4MVS A;  4GX1 A;  3RT3 C;  3J7A U;  4YIO A;  4JI8 O;  3OR6 C;  5EC2 C;  1VQ7 V;  4NXN B;  1SQB H;  4GZR B;  1QCE A;  1ENV A;  1NVP B;  3T1Y B;  4GX5 A;  1W0K G;  4JAU A;  1IBM B;  2A7W A;  1IXM A;  3FAV A;  4MVM A;  2DW4 A;  1GTO A;  1JR9 A;  4LFB B;  4O4L A;  5J2U A;  1NJI W;  1PD3 A;  1XIL A;  4FM0 A;  3E2E A;  1U96 A;  3BHP A;  1QVF U;  5CA0 B;  3K0D A;  2EX3 A;  3RYF B;  2LGQ A;  3E8B A;  4YIP A;  4B7K A;  3VQW A;  4FMT A;  2EJR A;  1AR5 A;  1YSC A;  4JGS A;  1FJG B;  2AHZ A;  2BE3 A;  3E83 A;  2A06 H;  4RUF A;  4HZ3 A;  2OCC C;  1HR0 O;  2P6J A;  5BXZ A;  5FNV B;  3ZMT A;  1WPB A;  3CYO A;  1S5L Z;  1VIB A;  4QNH B;  3ASO C;  4TV8 A;  3CXC U;  1YIJ V;  4NXM O;  3C3T A;  3BCC H;  4HNA A;  4MSW C;  3MD0 A;  4X62 B;  1R3K C;  1KEC A;  4NVP A;  3EXA A;  4PA6 A;  2X6C A;  2ZNJ A;  3ZJZ A;  3ABK C;  1AJN A;  4JTD B;  2QDO A;  2BCC H;  1I7F A;  4JZ2 A;  3UCS C;  4LF7 O;  2QTO A;  1MNG A;  3AG2 C;  1HDJ A;  1JPX A;  2XAG A;  5J2T A;  1FFX A;  1CP9 A;  4QIW F;  5C8Y A;  4I5S A;  4LFA O;  1IXB A;  5JCO A;  4X9Q A;  3OEE G;  5DM6 V;  3OD4 A;  5KA5 A;  2Y0P A;  4YJ2 A;  3JAW B;  2XHB A;  1PNM A;  3L73 H;  1QLE C;  1VP7 A;  3OM3 B;  5KX5 A;  4O4H B;  4TT3 G;  3ZMV A;  5DEC A;  1GN4 A;  4NTW A;  3WFV A;  1EZV H;  2HJD A;  5H2F Z;  4JI2 B;  3RFR A;  2RMK B;  4PV1 B;  5D5Q A;  2E74 B;  1MSW D;  3G67 A;  1KUQ A;  3LNM B;  2K1E A;  4FIP C;  4O4L B;  4F6R A;  4UXN A;  1YF2 A;  4X66 O;  4LF9 B;  4JI6 O;  3ASN C;  5H6R A;  4ABM A;  2BTO A;  4U3J A;  1VQ4 V;  1NTK H;  2W0X A;  3UQ8 A;  4X89 A;  2OCH A;  2LGW A;  1MMM A;  4B3S O;  4Z1V A;  4F4L A;  4DR4 O;  3WG7 C;  1R6K A;  4FFB A;  1IX9 A;  5CBF A;  3AG4 C;  1SER A;  4DV2 O;  4TV9 A;  1M5I A;  1Q81 W;  4LC1 A;  1FXK A;  5IYZ A;  3RVZ A;  3MHH C;  3UT5 A;  1GM7 A;  1P84 F;  2DE0 X;  2YIA A;  4L87 A;  1VQL V;  4IIJ A;  3CC4 V;  4HNA B;  4WFF A;  5B3S B;  5DED A;  3AK2 A;  4TSF G;  3TGU H;  3O9O A;  3E22 A;  2DYS C;  1R3J C;  1MAB G;  3B4S A;  4WFE A;  2OTL V;  1KYO F;  2QJ1 A;  5AG2 A;  2UXX A;  4LNU B;  3VQV A;  1CEZ A;  3Q4H A;  4LF8 B;  1VQN V;  2UUB B;  2YXY A;  2QM4 A;  1OCO C;  3LSQ A;  5J2T B;  1FFX B;  3ZHQ A;  5C8Y B;  1B06 A;  1MG1 A;  3CCV V;  4DR3 B;  2E75 B;  4LWS B;  1N32 B;  4DUZ O;  4IT5 A;  4YJ2 B;  4J7Z A;  1AI4 A;  4ASU G;  1M4U A;  4HBN A;  1AI7 A;  5LMN B;  1S5H C;  2JEX A;  3JSN A;  4D7T A;  5D5P A;  5KX5 B;  2EUL A;  3LSU A;  3L74 H;  3UO2 A;  2E3C A;  2JEU A;  5K1P A;  1HNZ B;  1OCR C;  1V55 C;  4GKK O;  1H2M A;  3ZRX A;  1K73 W;  5ITZ B;  1AR1 B;  3H1L H;  3D36 A;  3APO A;  1S0V A;  2YEV A;  4CBC A;  1PV0 A;  4ZOL A;  4YHH O;  1G6U A;  5LP6 A;  4KHP B;  1P49 A;  1GM8 A;  2DQ3 A;  3OEH G;  4CZZ A;  1E1Q G;  1VQ6 V;  4UCO A;  1LNQ A;  2DWD C;  2ZT9 B;  4X1K A;  4DV7 O;  1EZJ A;  1ORQ C;  2EIN C;  1L8D A;  4NKG B;  4TQF A;  3ZS8 C;  1N34 O;  1A32 A;  5H9C A;  3L70 H;  1AIL A;  3ABM C;  2LFR A;  2XT9 A;  1VQ5 V;  4MS2 A;  3SJQ C;  4WBN A;  1DTO A;  4AIL C;  4X20 A;  4J42 A;  2GHY A;  1JOY A;  4TV9 B;  1BQ0 A;  4DYL A;  3KCX A;  1FXK B;  4JTC B;  2OT5 A;  1ZLZ A;  2F66 C;  2EIJ C;  2GBO A;  2PTM A;  5IYZ B;  2RN9 A;  1BQZ A;  1TVK B;  1T5E A;  4JI7 O;  4I9Q A;  2ITD C;  2Q67 A;  4IIJ B;  4MVR A;  2A79 B;  1YVW A;  2B1G A;  1XMO B;  4DW1 A;  3SPG A;  3DC6 A;  3E22 B;  4JI4 O;  3LNN A;  3AK1 A;  3SR2 C;  5CBH A;  1AVM A;  1I5X A;  2V4D A;  1H8E G;  4OX9 B;  2Q68 A;  1MOF A;  3TXQ A;  1GN2 A;  2GV9 A;  3B09 A;  3OMA B;  4UCV A;  3F5W C;  4D6T H;  5B1B C;  3ICX A;  2KKW A;  2WLJ A;  2F23 A;  1EN5 A;  1OZ0 A;  1GAX A;  1IBL B;  5E79 Z;  2Q7E A;  1Q6I A;  1BMF G;  1J5E B;  1WN7 A;  2YXL A;  3L72 H;  1Q6H A;  4NB5 A;  4IYI A;  1JQ0 A;  1WB8 A;  2QE7 G;  3T4D A;  4XDL A;  2BTQ A;  2VRZ A;  4XDK A;  2ZDI A;  1XI1 A;  3B8N A;  2YSU B;  5H6Q A;  4NTY A;  2Q8V A;  1N0J A;  4JV5 O;  4DV0 B;  5LP6 B;  3R66 A;  3OGC C;  5IY5 B;  4AHC A;  5KHI A;  4YJ3 B;  4GX0 A;  1NZ6 A;  3K3W A;  4X1Y A;  3SPJ A;  5L3C A;  1Q86 W;  3FB7 C;  4DUY B;  4FM2 A;  4I50 A;  3HR0 A;  2AHY A;  3CRQ A;  1F23 A;  1PNK A;  1Z5W A;  3F5T A;  1XBL A;  4BAY A;  1Y74 B;  1AJQ A;  1MA1 A;  3BFR A;  4JAV A;  3H01 A;  3NXS A;  4O2A A;  4TQD A;  1H2S B;  3J81 N;  4WBN B;  2YS8 A;  4DR1 B;  4K8X A;  2YID A;  2MK3 A;  4X20 B;  3U10 A;  1BL8 A;  2F1M A;  2R9I A;  2AZ0 A;  1PKX A;  3CCU V;  3AK3 A;  4BIZ A;  2BOC C;  4FFK A;  4DR5 O;  4LCU C;  1UFI A;  2ZM6 B;  1JJO A;  4H44 B;  5B5E Z;  5LHI A;  4DV4 B;  1B04 A;  5JJE B;  2WLH A;  3CRM A;  3N2K B;  1P7G A;  2QA4 V;  4PDR A;  4JI8 B;  1QR9 A;  1VQ8 V;  2V7Q G;  2HR3 A;  4OPH A;  2DN9 A;  1GO3 F;  1SQF A;  1N8R W;  2PYL A;  4LH6 A;  1V54 C;  1UJW B;  5KUM A;  4BWA A;  2KQX A;  3CMA V;  5B1A C;  1GMG A;  5IJ9 A;  2EIM B;  5KA6 A;  3QTC A;  1AP5 A;  1ZUQ A;  2BSK B;  2CTW A;  3CD6 V;  1YCI A;  3GWO A;  4JI3 O;  3CE2 A;  3N2G B;  2UUC O;  4PHZ A;  3STL C;  1Y67 A;  3TCU A;  4R6Z A;  2X6A A;  2ZIO A;  5IWA O;  2WA4 A;  5HFL A;  2RNB A;  2PI4 A;  2EZO A;  1RM1 C;  3WU2 Z;  4DR6 O;  2X7R B;  1TA8 A;  5L3D A;  2P4K A;  1HR0 B;  4CS2 A;  3AG3 C;  1HP8 A;  4I50 B;  1OCC C;  5CA0 A;  1BHB A;  5IT9 N;  1M56 B;  3DXR A;  1VQK V;  1YTF D;  4A5U B;  3BAA A;  3E86 A;  4NXM B;  2W0F C;  3D3I A;  3BPZ A;  2G38 A;  1FXH A;  2ZQM A;  3SJB C;  4IL6 Z;  1J95 A;  3ETQ A;  3T1C A;  3G71 V;  1R3L C;  4ZKI A;  2ZXW B;  1FFT B;  4U7N A;  1NBM G;  5IE9 A;  4O4I B;  1SRY A;  2P5O A;  3SYP A;  4LF7 B;  2XAQ A;  3K5M A;  4RO2 A;  1SQG A;  1Z5V A;  5IYB O;  2HP8 A;  4H33 A;  3ABL C;  4LFA B;  1JX9 A;  4BW9 A;  4UCU A;  5LGN A;  3X2Q B;  4FZ1 A;  4KXR A;  4YY3 O;  1XHZ A;  5IYC O;  1N0N A;  4DR7 O;  3CC7 V;  2N04 A;  3AG1 C;  4FLZ A;  4JAS A;  2YDE A;  1V9P A;  3K9S A;  1YHQ V;  2ARH A;  1F51 A;  2R9R B;  4EKW A;  4AQY O;  3JAW A;  1VEW A;  3UO3 A;  1OHH G;  2ZIN A;  5EZY B;  4D7S A;  2CTR A;  2ZE6 A;  2ZE8 A;  4B3T O;  5IJ9 B;  3KG2 A;  1D5A A;  4O4H A;  2NLJ C;  4FLV A;  1DF4 A;  4X66 B;  3SDL A;  3ZX6 A;  1AJP A;  3RYC A;  4JI6 B;  5EIB C;  2W6I G;  3RYI A;  3FKS G;  5LL6 Y;  2ZDI C;  3CCJ V;  3P30 A;  2ZNI A;  2P7T C;  2EIL B;  4B3S B;  1X59 A;  4EFE A;  1XL6 A;  1QLE B;  4DR4 B;  1XHX A;  5JVD A;  4PJ0 Z;  2CDY A;  3VBB A;  3SYC A;  4DV3 B;  2QKS A;  3B40 A;  4DV2 B;  2HVJ C;  4PI2 A;  2B5U A;  3CX5 F;  1FPO A;  3H9V A;  3E35 A;  4X8A A;  1KKC A;  1MZE A;  4DR2 O;  3DXR B;  3FB6 C;  4U3F H;  4K3A A;  5H5N A;  3LUT B;  1NH2 D;  3L71 H;  2A3Q A;  2Q9L A;  4E2L A;  3TET A;  2HLD G;  1N33 O;  2Q69 A;  2LQT A;  3CCM V;  3ZMU A;  3JAS B;  2ADQ B;  1XDC A;  2CAZ C;  4ZBM A;  1ARO P;  2VQE O;  4TUY A;  3JAM N;  4RQE A;  4LP8 A;  3K04 A;  1WJZ A;  5KUK A;  4G27 B;  5GW7 A;  4FLX A;  3ETD A;  2UXN A;  3JD4 A;  1QU7 A;  3R65 A;  1NT2 B;  3OE7 G;  3GB7 C;  4DUZ B;  3W7U A;  2JGD A;  5EBL C;  4LNU A;  2PYJ A;  5J9P C;  3VOU A;  3ETE A;  1VF6 C;  1ZAU A;  2JS3 A;  4LF4 O;  3JCZ A;  4FLW A;  4GKK B;  1VQP V;  4LWS A;  3B2E E;  1FXV A;  3KZI Z;  3A8T A;  2OYQ A;  4YHH B;  1PP9 H;  2JRI A;  2LO1 A;  3ZIA G;  3G6B A;  3JD0 A;  4P30 A;  1YTF B;  1QQC A;  2Q73 A;  2X6B A;  3C3S A;  4X65 O;  4GUN A;  1B3Q A;  3RYC B;  3H1I H;  2KB1 A;  4DV7 B;  3RYI B;  4LF6 O;  5ITZ A;  2UU9 O;  2XAH A;  1N34 B;  1KKD A;  2Y69 B;  2WWW A;  1EM1 A;  1K3E A;  1W59 A;  3ZHT A;  3K0G A;  4OPA A;  5JVD B;  3QO7 A;  4FK5 C;  4PDV A;  3K9A A;  3E8G A;  1M57 B;  2DYR B;  1GRJ A;  3I56 V;  1EN6 A;  1Y76 A;  4JI7 B;  3W7T A;  2JS5 A;  3SYO A;  1I94 O;  4PD4 F;  3STZ C;  4MVU A;  5JH7 A;  1YI2 V;  4JI4 B;  3P3N A;  4JTA B;  4I55 A;  3THO A;  2NR5 A;  4LFC O;  3WB1 A;  1NKD A;  1TVK A;  2IBZ H;  4TUY B;  2E76 B;  2Q6A A;  1WP7 A;  2L35 A;  2JIZ G;  2P4V A;  4JYB A;  2JJ2 G;  3CC2 V;  4O4J B;  4WFG A;  3IGA C;  2QEX V;  2JGD B;  5KMG B;  4I7Z B;  4MW3 A;  4R7C A;  3I55 V;  2DWE C;  2OIE A;  3H1K H;  1K92 A;  3OUF A;  3CJH A;  5JWP A;  2BOB C;  2KSD A;  2UXC O;  2WLM A;  4PEL A;  1TGO A;  2DMX A;  3FYI B;  2PF4 E;  3HKE B;  1AB3 A;  4JV5 B;  1XEQ A;  1UPG A;  4GT1 A;  1YDX A;  2CE4 A;  3FFQ A;  3CXH F;  4MTO A;  1YJ9 V;  4Q6G A;  3BY6 A;  2ZE7 A;  1NH2 B;  1HWY A;  1QHT A;  1W2B U;  3CHX A;  4OXS A;  2VS0 A;  2B1I A;  2Z5U A;  4KUM A;  2Q0O C;  4QE9 A;  4UVB A;  1QNM A;  4YJ3 A;  1SZX A;  3BA8 A;  1R73 A;  2LJ2 A;  4LR3 A;  3QO5 A;  3P3P A;  3UM7 A;  1BE3 H;  3C90 A;  4DR5 B;  4WFA V;  4X64 O;  1Y76 B;  1Y74 A;  1CPY A;  1RP3 B;  3CCL V;  3HB3 B;  2WA3 A;  5BZB A;  3K58 A;  1G1X B;  2QGN A;  5FPR A;  3H1H H;  1E1R G;  5JH7 B;  1JFF B;  1AI6 A;  1R3I C;  1NTZ H;  1PPJ H;  1NR7 A;  2GUZ B;  1S76 D;  4I55 B;  1SS3 A;  1L1F A;  3JSL A;  1BHA A;  3HKB B;  4ZHQ A;  5B3S C;  5CBG A;  2UUA O;  1SES A;  3PJS K;  1XOU A;  3HPL C;  2B9Z A;  3KKY A;  4IYH A;  2ZCE A;  1E79 G;  2EIK B;  3N2K A;  2Y4T A;  3MAQ A;  1S5J A;  5LGU A; 
#chains in the Genus database with same CATH homology
 1IBM O;  4JI5 O;  1J5E O;  4LF4 O;  2DOS A;  1R6T A;  4DV5 O;  4B3M O;  4AQY O;  4JI2 O;  1HNZ O;  4GKK O;  2Z0A A;  4LFB O;  4B3T O;  1KUQ A;  1XNR O;  1HNW O;  4DV3 O;  3M8A A;  2UXC O;  2LW7 A;  4JI3 O;  1FYJ A;  2JRI A;  4YHH O;  2UUC O;  1HNX O;  3SDL A;  4B3R O;  1AB3 A;  4X66 O;  4KHP O;  1XEQ A;  4JV5 O;  4JI6 O;  4X65 O;  2N74 A;  5LL6 Y;  5IWA O;  3R66 A;  4LF9 O;  4DV0 O;  5A2Q N;  1XNQ O;  4LF6 O;  4DV7 O;  4DR6 O;  2FKX A;  1X59 A;  2UU9 O;  4B3S O;  1FJG O;  4LF5 O;  1FKA O;  1IBK O;  1N34 O;  4DR4 O;  1A32 A;  4DUY O;  5BY1 A;  4JI1 O;  1HR0 O;  1AIL A;  5BXZ A;  4OPA A;  3F5T A;  4JI0 O;  3T1H O;  4DV2 O;  5IT9 N;  5FLX N;  1N36 O;  4A5U B;  2E5L O;  1D2D A;  4DR2 O;  4NXM O;  3J81 N;  4JYA O;  2VQF O;  5H5N A;  4DR1 O;  4X62 O;  1YZB A;  1DK1 A;  2AGA A;  2ZKO A;  2UXD O;  4DV1 O;  4JI7 O;  5LMU O;  1I94 O;  3O65 A;  4X64 O;  4DR5 O;  1N33 O;  1N32 O;  2ZM6 O;  4LF7 O;  1G1X B;  4DV4 O;  1XMO O;  4JI4 O;  4K0K O;  1NS1 A;  2VQE O;  5BR8 O;  1XMQ O;  3JAM N;  4LF8 O;  4GKJ O;  2UUB O;  4LFC O;  3RT3 C;  3J7A U;  4LFA O;  4OX9 O;  4JI8 O;  3OTO O;  3J80 N;  2UXB O;  1R1B A;  4OPH A;  4YY3 O;  4DV6 O;  2F4V O;  4NXN O;  4DR7 O;  2UUA O;  2HHH O;  2DJV A;  4DR3 O;  4DUZ O;  1F7Y A;  3T1Y O;  5LMN O;  1IBL O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...