1FJGO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1fjgO00
4X64O 4LF6O 1XMQO 1DK1A 3F5TA 1YZBA 4YHHO 2UUCO 5IT9N 1AB3A 2ZM6O 5LL6Y 5LMUO 4DUYO 4B3MO 4JI1O 4DV5O 4A5UB 4DV6O 1HNZO 1XEQA 4KHPO 4LFAO 5BXZA 1FKAO 3T1HO 4NXMO 4B3SO 1G1XB 4LF4O 1R1BA 1A32A 1F7YA 1IBLO 5IWAO 4X65O 1HNWO 4NXNO 2UXDO 3JAMN 4OPHA 4GKKO 2HHHO 4LF9O 4B3RO 1N33O 1D2DA 3M8AA 2VQEO 4DV7O 4DR5O 5A2QN 4DR3O 1IBKO 1XNRO 4X62O 2VQFO 4DR7O 2UUAO 3SDLA 3J80N 4JI7O 4OPAA 4JI3O 1R6TA 3O65A 4DR1O 5H5NA 3RT3C 1FYJA 4JI5O 4OX9O 1NS1A 4LF8O 5BY1A 5FLXN 2E5LO 3J7AU 4LF5O 2LW7A 1KUQA 2DOSA 4DV1O 4DV3O 1N32O 1AILA 1XMOO 1I94O 4GKJO 4DR4O 4LFBO 3R66A 1N36O 2Z0AA 4LFCO 4B3TO 4K0KO 2UXBO 2N74A 4AQYO 1IBMO 4JI4O 4DV0O 1X59A 2UU9O 4X66O 1FJGO 4DV2O 1N34O 4DR6O 4JYAO 2F4VO 1HR0O 4JI6O 2JRIA 4DR2O 5LMNO 4JV5O 3J81N 4JI0O 2UXCO 1J5EO 4LF7O 2ZKOA 4JI8O 4DUZO 2UUBO 4JI2O 2FKXA 2DJVA 3T1YO 4DV4O 1XNQO 2AGAA 5BR8O 3OTOO 1HNXO 4YY3O
chains in the Genus database with same CATH superfamily
2YC0A 4I9WA 5DEDA 4K3AA 5D5PA 3M99B 2CK3G 1YEWA 2QM8A 4TV8A 1KP2A 5CB4B 2KG7B 1JFFB 2W0XA 3EVKA 4UVBA 1EZVH 4OXSA 5LGUA 1MA1A 3QNEA 1BSMA 1X4TA 2RDCA 1R1BA 1NTZH 1K7DA 2LP7A 3ASOC 2ZE5A 2PTMA 4X65O 2FTKA 1XNRB 1G6UA 1BS3A 5L3DA 5LHHA 4DR7B 2ZNJA 4BIUA 1BMFG 1RM1B 4PDVA 3ZEDA 3CCQV 2HFEC 2ZXWB 1W59A 1JVMA 2P7TC 2KB1A 2YIDA 3CCVV 1N34B 3HKDB 4EB6A 2BOBC 4QE9A 3CCRV 4F6EA 4U3FH 1THZA 3TJTA 2WLLB 3K0GA 1SERA 1MOFA 2BTQB 1FS0G 5J2UA 1IBMB 4DV3O 1QVFU 2EILC 3RYIA 4X66B 3OR7C 2Q7GA 1Q5OA 1VP7A 2HJFC 3G80A 4JTAB 2AHZA 1L0NH 1OCCB 2YXHA 3E8HA 1Z2GA 4E2LA 2YI9A 4LF7B 4PA9A 1HP8A 2PY5A 1HR0O 2WLIA 4MTOA 5CA1A 4YY3B 4PELA 3CC4V 4OGQB 5KAFZ 4X89A 4DUZO 1S3JA 1JPXA 4D7TA 3MD0A 2YUAA 3JASA 1GN3A 3L71H 4B3SB 5LMUO 5LGTA 1PP9H 1V55B 3WB0A 4JZGA 4JI5B 2ARHA 4NTYA 4GLXA 1EM1A 4B3RB 2CAZC 4DR5B 4FPPA 2UXDO 1B06A 3SYCA 2YIBD 1TUBA 3ZBHA 3R65A 2VQEO 1L0LH 3FYIB 4HZ3A 5CBGA 3ASNB 2OIGA 4FZ1A 1Y6XA 4GX1A 3CRCA 1NH2D 1GN6A 4C7UA 4JI3O 5LA6B 3JD4A 4JYYA 3IFXA 3BPZA 1FD9A 4PHZA 1Q8IA 2BSKA 1AJPA 2AZ0A 3CB2A 5CMUA 5JJEB 3JAWA 2DOSA 2HEPA 4LWSA 5IJ9B 4GKJO 2JVDA 1ZTEA 5J2UB 3ZRXA 4F6RA 5KUKA 4JV5B 3RYIB 2UXCB 4FJCC 3ZHQA 1RM1C 5BR8B 1ZLZA 4P9OA 4B08A 3E89A 2ZXWC 2QWOB 5CA0A 3BAAA 2WLIB 4UCVA 1P84F 4X1IB 4DV4O 2GUZA 3OTOO 4W4KA 4DUYB 3K08A 3AK1A 1G4YB 4X62B 4LFAB 1K4CC 5IDJA 2W0FC 2ZM6O 2F95B 3ZHSA 3WB1A 3DC5A 3T4ZA 2OTLV 1XEQA 3H1JH 3C3SA 5BXZA 2VRZA 2NLJC 3OD4A 3S3WA 4F4LA 4MVSA 1OCCC 3K5MA 1F7YA 3B8NA 1FXKA 2YXLA 4J80A 1FAFA 5KHKA 2ITCC 3OMIB 3ZCCA 2LFSA 4YXWG 4L8JA 4DR1B 4MVZA 1QCEA 1TUBB 2QWQB 2IM9A 3CRRA 3AG7A 5EIBD 4RO2A 1LNQA 3ZHUA 3ABLB 1NQTA 1DF4A 4KUMA 3O65A 3RT3C 3RYHB 3TGUH 4IYHA 3TXSA 1WJZA 4H13B 2EIKB 1BQ0A 3CCSV 4QGPA 4LFBB 2GTSA 4UB8Z 1LR1A 1V55C 1AI7A 5H6RA 4MTGA 1BZKA 2EINB 2BSKB 2B1IA 3IC9A 3S3XA 5KA6A 1YITV 2Z0AA 4YIOA 3CE2A 4K0KO 1VQ4V 2UXBO 1K73W 5LP6B 3A8TA 1EZJA 4LWSB 1MABG 2JJ1G 3MHSC 5BMVA 1YVWA 3HB3B 4F6RB 4JYAO 1M90W 1WPBA 3THOA 3ASNC 1J5EO 5IWAB 2ZKOA 1I08A 2WWWA 1N4CA 2UUBO 1F51A 4I7ZB 1VMGA 1OHHG 1VQ9V 1M57B 2IU3A 4B7EA 3FB7C 1YHQV 5CA0B 3N27A 2B1GA 1FFXA 2GUZB 2A3QA 5C93A 1XREA 5EBWC 3ABTA 3T4DA 2FL4A 1IURA 1W2BU 1NU1H 4PA3A 4N21A 3O9OA 4OX9B 1VQOV 3B77A 4I4TA 2QEXV 1QQCA 1YXBA 1U96A 1KD1W 1O9GA 2JEUA 3HPLC 1M1KW 1D5AA 1YTFD 1R6KA 1OCOB 3UO2A 5B5EZ 2UUAB 1P4RA 1I5YA 3ETDA 1FXKB 2Y4UA 2UXXA 3G6EV 3JD1A 4UV8A 5A2QN 2QA4V 3OT7A 4DK0A 3FX7A 5JH7A 1XNRO 2HJDA 4GX0A 4K8ZA 4DR7O 3CXHF 5FNVA 3ABUA 1H2MA 1SC5B 2CGOA 4QPJA 1N0NA 2NN4A 1ZUQA 4BW9A 1S5JA 3EFFK 1NTMH 1FYJA 4I55A 2L6LA 2XT9A 5BY1A 4EFEA 3K57A 4LF5O 2Q5ZA 4IIJA 3CCJV 2EIJB 4O4IB 1AJQA 4BAYA 2OCCB 2A9HA 4CH6A 1JA8A 1SRYA 5LOVA 3Q4HA 4DV5B 1IBMO 5CN0A 4JI0B 5LYJA 1JOYA 4X66O 5EC2C 1ZAUA 3I55V 2WLNA 3AG4B 1ZWIC 5BMVB 2QTOA 4I50A 3UCSC 4LF7O 3C90A 2A7WA 3C3TA 1GM9A 4MVOA 5AG2A 3HKBA 2IBZH 4HYOA 2AGAA 5E1AC 4YY3O 2M7WA 3ABLC 3FKSG 1SZXA 1KQSU 4J7KA 1LUVA 1GK9A 2Y4TA 1XOUA 1JQ0A 2EIKC 2EZOA 3U10A 5L3GA 1S77D 2OIEA 4IGGA 1AB3A 1K4DC 4CH3A 1M9NA 1PL4A 2ITDC 3QO8A 1YDXA 2EINC 5J2TB 3H1LH 4B3SO 3OUFA 1PNKA 1IVSA 5LP6C 4FZ0A 4DR3B 4PI2A 4I4TB 3JALB 4KXRA 2DE0X 2OT5A 1K92A 4LP8A 4B3RO 2UXNA 3P32A 2Z5UA 2ADQB 4GX2A 4DR5O 3GB7C 2VQFO 1RP3B 4LF8B 2DYSB 3J80N 1M57C 3RFRA 5JH7B 3E35A 4UCOA 3CD6V 4JAUA 4QIWF 2XASA 2JS5A 1SQBH 1IDSA 5FNVB 1Q82W 1N32B 1MZEA 3ABKB 3MDSA 3CCMV 3QG5A 5KMGA 3G71V 4ZHQB 5EZYA 3BY6A 4I55B 2EULA 4BW5A 3ZHRA 1RPOA 1FJGB 1M5IA 5IYDO 1S5LZ 1VF5B 2RNBA 1FXVA 1HDJA 1MZFA 2OTJV 3AEIA 2XNDG 3T1HB 5LOVB 1OCOC 1QHTA 2P6JA 2X6AA 1PKXA 1HNXB 1FXKC 1IXBA 4Z1VA 5LYJB 5ITZB 4JV5O 2JJ2G 2HVKC 2UXCO 4LF6B 1Y4MA 5DM6V 1BT8A 4H0LB 4JASA 5BR8O 1EN6A 4I50B 3PN1A 2H8PC 1AI5A 2X6BA 4DYLA 1NI8A 1DK1A 2ZINA 1KP3A 5L3FA 3HKBB 4X20A 2YEVA 2VS0A 3IC7A 2N04A 4DUYO 3DSQA 3K59A 2EIJC 2XAJA 4O4LB 1MNGA 3LSUA 2LFRA 4QE7A 4LFAO 2OCCC 4JTDB 2QJ1A 1PV0A 5B1AB 3B4SA 1R73A 4X8AA 5EBMC 1HNWO 4UV9A 2A79B 4GZRB 3H1KH 4FLTA 3AG4C 3L72H 1HWYA 3CPWU 1SQQH 2F66C 2P22C 1Y76A 2Q7EA 3VBBA 2W6IG 3JSNA 2XUMA 2Y48A 3ETEA 3N2GA 3SDLA 1CPYA 4OPAA 4FM2A 1TGOA 2Q67A 4DR1O 5H5NA 3RW0A 3SYOA 4JI2B 2DQ3A 3ZJZA 1S0VA 3HKCA 4ZOLA 4DR4B 3DGEA 1B3QA 4O2BB 2LO1A 4B3TB 4W4LA 4O2AA 2HG5C 1MSDA 5KMGB 3OAAG 3ZRWA 4LFBO 1P7BA 5EZYB 2DWDC 4LH7A 1F4MA 4I5SA 1DGSA 3NXSA 3K5LA 3T2MA 5IJ0B 1OJHA 4JI6O 4DR2O 2Q9LA 4X64B 1NTKH 3STZC 4I9QA 2WLJA 2FKXA 5EBLC 3X2QC 4ASUG 1QBZA 2DYSC 2Q8VA 2QM4A 3L74H 5IYBO 3ABKC 3UQ8A 1NZ6A 2ATKC 4HAMA 1E79G 3DXRA 2E76B 3OE7G 3CRMA 4X20B 1KYOF 4RUEA 2YEVB 4O4HB 1IBLB 3B8MA 2GBOA 4NXNB 1TVKB 3F7VC 2ZDIA 4BWAA 4DV7B 3QVNA 3E8BA 3SYAA 1S5HC 2QM7A 1M56B 3JATA 4X1KA 3JAMN 3LSSA 4LFCB 3OGIB 4AQYB 4J9ZB 2EIMB 1QU7A 1NKDA 4PDRA 1R6NA 1E1RG 5A9GA 2R9IA 4R8CA 4JYCA 1WPXA 3SR2C 2UUAO 4FM0A 1MG1A 5KA5A 2PZSA 4TV8B 3LDEA 1WB8A 2ZD9A 4CH4A 3N2GB 1VQLV 5KX5A 3KCYA 3HKEA 3H01A 1T5EA 1AR5A 4DW1A 4FIPC 1V54B 3F7YC 2W6JG 4JI4B 5H9CA 1Q6HA 4ZOLB 2AHYA 2F43G 5B1AC 1S72V 4JI1B 2LGQA 2MK3A 2IH3C 3BEHA 3D36A 4ICGA 2DN9A 4HNAA 1CP9A 4EB6B 1SQGA 4MT8A 4LH6A 4NR1A 1Q90D 4JI0O 2VWJA 4D6TH 2YXYA 1GM8A 4B3MB 1SQVH 3SJCC 1IBKB 1WP7A 3E8GA 1AP6A 4FMTA 4FK5C 4H33A 1GRJA 2KKWA 4UCRA 3JD3A 4JGSA 4LF4B 1P7GA 3E8FA 2WA3A 5JWPA 1NJIW 3MAQA 4XDJA 3LSQA 2Q0OC 1G1XB 4MVUA 5CA1B 4YJ3A 2CE4A 4TSFG 2RCVA 3OM3B 4UVAA 2JDIG 4LF9O 2ZR3A 4DO2A 3JASB 1XHZA 3AG2B 3CJHA 3H1HH 3D3IA 3JATB 4DR3O 2QE7G 3ML0A 4G28B 5GTHZ 4Q20A 3DC6A 4J41A 5JCOA 2CTQA 2YICA 3ZMVA 4UB6Z 1Q81W 3WU2Z 5HFMA 1AI4A 1IZ3A 5KUMA 4LF8O 3K58A 3A2FA 5CBHA 4FLWA 5KLVH 1VQ5V 1K97A 4TT3G 3JARA 1RSOA 5DN6G 3HKEB 1N32O 2DQ0A 3ZN1A 2Z3YA 3EHBB 3ZS8C 1SESA 4DR6B 1N8RW 2HVJC 2F4VB 4PJ0Z 5D5QA 1ZX3A 1X59A 3B09A 1M56C 1GAXA 3RVZA 1VQPV 1FJGO 3UT5A 3ZN0A 3G6BA 2EIMC 1XMQB 4DK1A 1KU9A 1W0KG 4WBNA 2AZ2A 3ETGA 1HNXO 2R9AA 4FFKA 3K5OA 1QLEB 3JAWB 3OFNG 3OW2U 4LF6O 4DV6B 4FLXA 4KHPB 2ZQMA 2Q68A 4NXMB 1CXZB 1BQZA 4PDLA 3SJBC 4AHCA 1V54C 1U97A 2QGNA 4AILC 1I0HA 3L75H 3SYQA 4U7NA 2GSMB 1BE3H 4WFFA 4QJFB 5JJJB 1N33B 3BA9A 1GN4A 5EK0A 1N0JA 3N2KA 4H44B 4LNUA 2FYUH 4J7ZA 4YJ3B 3IAYA 2K9PA 1K3EA 2CH7A 1PD3A 5B1OA 3CS5A 2A06H 2YIBA 3CJHB 4WFEA 3BABA 3GWOA 3BVOA 3OTFA 1PPJH 4DUZB 1WNSA 4PA7A 1VEWA 1K33A 3JAKA 4TQDA 1QR8A 3CCLV 5KHGA 2B9ZA 1DLBA 3RVYA 5LMUB 4DR4O 4NKGB 2PF4E 4B3TO 1RSOB 5EYPA 1SQFA 2AXTZ 3L70H 1JMKC 4Z1MG 4CH5A 4PA6A 1SQPH 2Q0AA 1N34O 2WLHA 3APQA 2IJJA 4J9YB 4N23A 3FB6C 2E75B 2JRIA 3AG2C 4PDMA 3J81N 4GT1A 2UXDB 4G27B 2YIAA 2UUCB 4JPRA 1ORQC 2OCHA 3TXQA 3ZMZA 4J11A 2QWNB 4X64O 3ABMB 4TUYA 2PGGA 1HNZB 4IHJA 4WBNB 4I0XA 2WLMA 2Q69A 1KKCA 3ZMUA 3SJQC 1NR1A 4YJ2A 3P3NA 4IT5A 2HHHB 1MSWD 2DW4A 1PNMA 1FPOA 5K1PA 1NR7A 5LBQA 1IBLO 4NXNO 1EN5A 2EBOA 1VARA 3A0BZ 2Q4PA 3ETQA 3BA8A 4JI7B 1I7FA 3W7SA 4J10A 3ZRSA 4DV7O 4X1YA 3N2KB 4TV9A 1FFXB 1AP5A 2E3CA 4G2KA 1F4NA 4QNHB 2CH7B 1QLEC 2YI8A 3ZRVA 1L8DA 3CMEV 1GN2A 2HP8A 5CA3A 2FB5A 4JI5O 4K8XA 2BCCH 3JCUZ 2N05A 5FPOA 1XMOB 1I94B 4YIPA 2PUSA 1K9MW 2PYLA 2R70A 1N36B 1Z5WA 2LW7A 1KUQA 3ZX6A 2QTSA 2JIZG 4LCUC 3JAKB 1AILA 3E83A 4ABMA 2UU9B 1NH2B 1XDCA 2G38A 2X0LA 2BTOA 4UCTA 3G4SV 4P9PA 3LUTB 3TK1A 4B7KA 2ZR2A 4JI4O 5GONA 3IJ4A 3P30A 4EFBA 3SPHA 1R3KC 3T1YB 2KG7A 2RN9A 5EYPB 5KAIZ 1XNQB 4NYKA 2F23A 1XBLA 4J7JA 3P3PA 1Q7YW 4PA4A 2P06A 2CTWA 4UCUA 4YHHB 3EXAA 3KG2A 1GMGA 4JZ2A 4IIJB 1SKVA 2K1EA 3JCZA 1QLNA 4U7OA 5JCOC 1H38A 1WB7A 3K3WA 4CC5A 2QR4A 3Q4HB 4TUYB 4B3MO 2GV9A 4IHJB 4MW3A 4I0XB 1KMIZ 3W7UA 2H3OA 4EKWA 4HBNA 4RUFA 2CUGA 4ZKIA 4LF4O 1YIJV 4RQFA 2XTAA 4WFHA 2ADPA 1QNMA 4GUNA 1SS3A 3E22A 5CBFA 2UXBB 1EBOA 4MTFA 4NTXA 3CRQA 1FXHA 2Q73A 1YJWV 2BOCC 5IY5B 4X62O 2JEXA 2MW2B 4JYAB 2Y0PA 3ZHVA 2E5LB 5JQGA 2HKOA 4X1YB 3FB5C 3OEHG 3ABMC 4TV9B 2F93B 3VQYA 1J5EB 4U3JA 2ZNIA 3A0HZ 1OCRB 5H6QA 1AJNA 5GW7A 4RAIA 2EJ7A 2HR3A 3HR0A 4NTWA 2WAMA 4GX5A 3RYCA 3F5WC 1Z5VA 4DV2B 1H2SB 3NR7A 3L9DA 5KHHA 2EX3A 3CC7V 2GTAA 3K06A 4JI8B 3FAVA 4DR6O 2F4VO 5GONB 3CHXA 2D2CB 2HLDG 3W7XA 1UPGA 2V4DA 4PV1B 3ZIAG 1XMQO 2ODMA 1GH6A 3UM7A 5IYZA 1YI2V 5IT9N 3GVMA 4RWUA 4BR6A 5DECA 4ZI7A 1H2LA 4Z2WA 1H2GA 3WG7B 5LHIA 4DV6O 4KHPO 3KCXA 4KFMA 2V1DA 5LA6A 3VOUA 3CRAA 5L3CA 2R9RB 4NXMO 1SQXH 2GHYA 3E86A 3U0ZA 4LF5B 3QO7A 2XAFA 5IWAO 3VQXA 1OCZB 2P4KA 1M93A 5IJ9A 1XILA 4R50A 1H2KA 1XL6A 4R7CA 1P49A 2DWEC 4DRXA 4K35A 1N33O 3M8AA 3SPCA 3W7TA 5KHJA 1K8AW 3OGCC 3E22B 3RGBA 3QTCA 4WFGA 4LC1A 4PI0A 3BCCH 3CYOA 5J9PC 5B3SB 3AG3B 4MW8A 4LBEC 3WB2A 2WA4A 4FLYA 2D3OW 1AVMA 4DV1B 1YTFB 4OX9O 5JQGB 1JCHA 1KKDA 2AW9A 1VIBA 1BL8A 4P2ZA 4X1IA 5E79Z 4U3JB 4DV0B 2P67A 3PJSK 1MMMA 3R66A 1HW7A 3AK2A 3RYCB 1Y76B 4UFZA 3OR6C 5EC1C 2YS8A 2H94A 3JD2A 2XAGA 4GYCB 1OV9A 4JAVA 1BHBA 4JF3A 2QKCA 5IY5C 1S76D 3ZMTA 1BHAA 3FAVB 3UKMA 4ZBMA 3APOA 2DYRB 3HKCB 2CGNA 2WPDG 3RN4A 2P4VA 3CP1A 1VF7A 4O2AB 3ZMSA 1AR4A 1NVPB 2XAQA 2UUCO 2VQFB 3ZRWB 1OCRC 2F1MA 1WAZA 3SPGA 5KHIA 1Q6IA 4DV5O 4A5UB 5IYZB 4FLUA 1HNZO 5FPRA 3M7MX 5EIBC 1YF2A 3RWRD 3H9VA 3KKYA 3RYHA 1J95A 4GKKB 4ZI7B 4E4EA 3STLC 1L1FA 1W0JG 1AI6A 2X7RB 3CX5F 1ZSPA 1WLEA 3FB8C 2HHHO 4UXNA 5LGNA 2PI5A 1RPRA 4JAAA 3K9AA 1WP8A 2JK5C 3B2EE 4MVRA 3BHPA 1UJWB 5LP6A 1ROPA 3QF7A 4X88A 1PL0A 1R3IC 2XAHA 4H37A 1O9HA 4DRXB 3DXRB 4XDKA 1YJNV 2KSDA 1NBMG 1WA8A 4JI7O 2ETNA 2OWOA 2B5UA 5K1XA 1R6TA 4WFAV 1TA8A 3BRCA 2P5OA 1NS1A 1XUQA 2VWKA 3FFQA 3WG7C 3SYPA 4X1KB 2C2AA 2ZIMA 1VQMV 1XMOO 1I94O 3AG1B 4CZZA 1N36O 4WF9V 3SPIA 1Y74A 5LMNB 1OCZC 1VF6A 2UU9O 1PNLA 2NR5A 3JSLA 2X6CA 4X9QA 4JTCB 1VQKV 1RFYA 2E74B 2OYQA 1Q6UA 2A0LA 1XL4A 1LUWA 3VQWA 4GCZA 1HNWB 4CBCA 5KX5B 1GKFA 3T1YO 1FFTB 1BCCH 4PD4F 3VQVA 1XNQO 5B3SC 2KQXA 4MVQA 3AG3C 1NT2B 4BIZA 3TETA 5TISZ 4YHHO 4NVPA 1YCIA 1F23A 1SA0A 1XI1A 5JVDA 5IE9A 3K04A 4HNAB 3SGIA 4X65B 2EJRA 1FKAO 3FYEB 3T1HO 1WN7A 4CC6A 2RJZA 1A32A 5L3BA 4O4IA 2ZT9B 1EN4A 3OMAB 3U11A 2QWPB 5LXTA 4TQFA 2PYJA 1QR9A 3ICXA 1D2DA 2JS3A 2WLKA 2ZE6A 4IYIA 3CCEV 4MSWC 2DYRC 4BIOA 2RMKB 5C8YA 4JI6B 3GWKC 4DR2B 3CMAV 3CWBH 4UVCA 4CS3A 4DV3B 1WA8B 5FLXN 2E5LO 4ZIBA 4TOIA 2EZPA 4MS2A 3E2EA 4FLZA 3OEEG 5B1BB 4JYBA 2IJKA 5GTIZ 1HR0B 1DTOA 3JD0A 4R6ZA 4EEQA 3H1IH 5J2TA 4DV2O 2Q6AA 4NB5A 5L3EA 1Y74B 2L35A 2Y69B 4MVMA 4XBFA 1TAEA 1KC8W 2IJIA 4JI8O 5H2FZ 1Q86W 4JI2O 2ZIOA 3JALA 2LGWA 3AK3A 3SPJA 3JARB 4J42A 1GTOA 3D3QA 1I5XA 2JGDA 2R72A 4WFBV 1PM9A 2CDYA 1XQ8A 2ZDIC 3FD9A 1B04A 4KL1A 1JX9A 1US6A 2QKAA 3AG1C 3UT5B 5LHGA 3K5NA 1SA0B 5JVDB 1KBHA 2VQEB 4UUJC 4IL6Z 4P30A 4ZHQA 5HFLA 2FMLA 4OPHA 1M4UA 3I56V 1V9PA 3OMNB 3RYFA 1EFRG 2RQ6A 4JI3B 1YJ9V 5LXTB 3RBZA 4O4JA 1VQ6V 2WSSG 1VQNV 1AROP 3A0RA 1COWG 5ITZA 1NVPD 3I5DA 4LR3A 5C8YB 3D8CA 3W7WA 1ENVA 1K5QA 4DXWA 1E1QG 2LJ2A 1B6QA 4GKJB 1CEZA 3UO3A 1SZTA 3D36C 1VQ7V 5IYCO 1K34A 4DV1O 2Y0IA 1R3LC 4LNUB 1IX9A 5BZBA 2XHBA 1ZL8A 2XOKG 3K9SA 4LFCO 4AQYO 1Y66A 3TCUA 1SETA 4DV0O 1KB9F 3ASOB 4O4LA 3G67A 4QPKA 2IU0A 4CS4A 1QVGU 4FVMA 5FL7G 2LW1A 4DV4B 3OTOB 3CC2V 3WFVA 1IXMA 2IJHA 4WCEV 4FFBA 3K0DA 3MHHC 3K79A 4XDLA 2NNUA 5B66Z 4CS2A 4LF9B 2ZCEA 1GM7A 3DTUB 3K03A 2ZM6B 1D5NA 3BFRA 1BGYH 2P90A 1GO3F 3F5TA 1YZBA 1Q43A 2BE3A 1K5SA 4DW0A 5LL6Y 5CB4A 1JFFA 1DF5A 4JI1O 2JGDB 3CCUV 2Q7HA 3X2QB 3ZHTA 4D7SA 2EILB 2O57A 5B1BC 1URFA 4O2BA 1KECA 1JJOA 4L87A 1JR9A 4RQEA 2QKSA 3KZIZ 4GKKO 3CSXA 2LQTA 3CXCU 2Y69C 3L73H 1VF6C 2IW5A 3HKDA 1IBKO 3CEIA 4KP4A 1YSCA 4AI8A 1R3JC 2ILMA 2QDOA 5F2VO 3RYFB 3LDDA 2WLLA 1H8EG 5IJ0A 4YJ2B 1Y67A 2CTRA 4FLVA 2BTQA 1G8MA 1XHXA 1UFIA 2PI4A 4O4JB 2GDSA 5JJNB 3JYCA 5B1NA 3LNNA 3J7AU 2V7QG 4K0KB 1SF9A 2QWRB 1Q3EA 2JGUA 3QO5A 2M6YA 2ZE7A 1H8HG 2YSUB 1JJ2U 1VQ8V 3LNMB 2N74A 3SJAC 4MTXA 2ZE8A 1H2NA 4UCSA 1ZL8B 3B40A 4TWKA 4O4HA 3LDCA 2UUBB 4Q6GA 1OZ0A 1TUEB 1TVKA 5LMNO 2DMXA 3IGAC 2QSAA 3OUSA 2DJVA 4FM1A 1AR1B 2IH1C 3T1CA 4FFBB 2CTPA 2YDEA
chains in the Genus database with same CATH topology
4X64O 4LF6O 1XMQO 1DK1A 3F5TA 1YZBA 4YHHO 2UUCO 5IT9N 1AB3A 2ZM6O 5LL6Y 5LMUO 4DUYO 4B3MO 4JI1O 4DV5O 4A5UB 4DV6O 1HNZO 1XEQA 4KHPO 4LFAO 5BXZA 1FKAO 3T1HO 4NXMO 4B3SO 1G1XB 4LF4O 1R1BA 1A32A 1F7YA 1IBLO 5IWAO 4X65O 1HNWO 4NXNO 2UXDO 3JAMN 4OPHA 4GKKO 2HHHO 4LF9O 4B3RO 1N33O 1D2DA 3M8AA 2VQEO 4DV7O 4DR5O 5A2QN 4DR3O 1IBKO 1XNRO 4X62O 2VQFO 4DR7O 2UUAO 3SDLA 3J80N 4JI7O 4OPAA 4JI3O 1R6TA 3O65A 4DR1O 5H5NA 3RT3C 1FYJA 4JI5O 4OX9O 1NS1A 4LF8O 5BY1A 5FLXN 2E5LO 3J7AU 4LF5O 2LW7A 1KUQA 2DOSA 4DV1O 4DV3O 1N32O 1AILA 1XMOO 1I94O 4GKJO 4DR4O 4LFBO 3R66A 1N36O 2Z0AA 4LFCO 4B3TO 4K0KO 2UXBO 2N74A 4AQYO 1IBMO 4JI4O 4DV0O 1X59A 2UU9O 4X66O 1FJGO 4DV2O 1N34O 4DR6O 4JYAO 2F4VO 1HR0O 4JI6O 2JRIA 4DR2O 5LMNO 4JV5O 3J81N 4JI0O 2UXCO 1J5EO 4LF7O 2ZKOA 4JI8O 4DUZO 2UUBO 4JI2O 2FKXA 2DJVA 3T1YO 4DV4O 1XNQO 2AGAA 5BR8O 3OTOO 1HNXO 4YY3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 O;  4LF6 O;  1XMQ O;  1DK1 A;  3F5T A;  1YZB A;  4YHH O;  2UUC O;  5IT9 N;  1AB3 A;  2ZM6 O;  5LL6 Y;  5LMU O;  4DUY O;  4B3M O;  4JI1 O;  4DV5 O;  4A5U B;  4DV6 O;  1HNZ O;  1XEQ A;  4KHP O;  4LFA O;  5BXZ A;  1FKA O;  3T1H O;  4NXM O;  4B3S O;  1G1X B;  4LF4 O;  1R1B A;  1A32 A;  1F7Y A;  1IBL O;  5IWA O;  4X65 O;  1HNW O;  4NXN O;  2UXD O;  3JAM N;  4OPH A;  4GKK O;  2HHH O;  4LF9 O;  4B3R O;  1N33 O;  1D2D A;  3M8A A;  2VQE O;  4DV7 O;  4DR5 O;  5A2Q N;  4DR3 O;  1IBK O;  1XNR O;  4X62 O;  2VQF O;  4DR7 O;  2UUA O;  3SDL A;  3J80 N;  4JI7 O;  4OPA A;  4JI3 O;  1R6T A;  3O65 A;  4DR1 O;  5H5N A;  3RT3 C;  1FYJ A;  4JI5 O;  4OX9 O;  1NS1 A;  4LF8 O;  5BY1 A;  5FLX N;  2E5L O;  3J7A U;  4LF5 O;  2LW7 A;  1KUQ A;  2DOS A;  4DV1 O;  4DV3 O;  1N32 O;  1AIL A;  1XMO O;  1I94 O;  4GKJ O;  4DR4 O;  4LFB O;  3R66 A;  1N36 O;  2Z0A A;  4LFC O;  4B3T O;  4K0K O;  2UXB O;  2N74 A;  4AQY O;  1IBM O;  4JI4 O;  4DV0 O;  1X59 A;  2UU9 O;  4X66 O;  1FJG O;  4DV2 O;  1N34 O;  4DR6 O;  4JYA O;  2F4V O;  1HR0 O;  4JI6 O;  2JRI A;  4DR2 O;  5LMN O;  4JV5 O;  3J81 N;  4JI0 O;  2UXC O;  1J5E O;  4LF7 O;  2ZKO A;  4JI8 O;  4DUZ O;  2UUB O;  4JI2 O;  2FKX A;  2DJV A;  3T1Y O;  4DV4 O;  1XNQ O;  2AGA A;  5BR8 O;  3OTO O;  1HNX O;  4YY3 O; 
#chains in the Genus database with same CATH topology
 2YC0 A;  4I9W A;  5DED A;  4K3A A;  5D5P A;  3M99 B;  2CK3 G;  1YEW A;  2QM8 A;  4TV8 A;  1KP2 A;  5CB4 B;  2KG7 B;  1JFF B;  2W0X A;  3EVK A;  4UVB A;  1EZV H;  4OXS A;  5LGU A;  1MA1 A;  3QNE A;  1BSM A;  1X4T A;  2RDC A;  1R1B A;  1NTZ H;  1K7D A;  2LP7 A;  3ASO C;  2ZE5 A;  2PTM A;  4X65 O;  2FTK A;  1XNR B;  1G6U A;  1BS3 A;  5L3D A;  5LHH A;  4DR7 B;  2ZNJ A;  4BIU A;  1BMF G;  1RM1 B;  4PDV A;  3ZED A;  3CCQ V;  2HFE C;  2ZXW B;  1W59 A;  1JVM A;  2P7T C;  2KB1 A;  2YID A;  3CCV V;  1N34 B;  3HKD B;  4EB6 A;  2BOB C;  4QE9 A;  3CCR V;  4F6E A;  4U3F H;  1THZ A;  3TJT A;  2WLL B;  3K0G A;  1SER A;  1MOF A;  2BTQ B;  1FS0 G;  5J2U A;  1IBM B;  4DV3 O;  1QVF U;  2EIL C;  3RYI A;  4X66 B;  3OR7 C;  2Q7G A;  1Q5O A;  1VP7 A;  2HJF C;  3G80 A;  4JTA B;  2AHZ A;  1L0N H;  1OCC B;  2YXH A;  3E8H A;  1Z2G A;  4E2L A;  2YI9 A;  4LF7 B;  4PA9 A;  1HP8 A;  2PY5 A;  1HR0 O;  2WLI A;  4MTO A;  5CA1 A;  4YY3 B;  4PEL A;  3CC4 V;  4OGQ B;  5KAF Z;  4X89 A;  4DUZ O;  1S3J A;  1JPX A;  4D7T A;  3MD0 A;  2YUA A;  3JAS A;  1GN3 A;  3L71 H;  4B3S B;  5LMU O;  5LGT A;  1PP9 H;  1V55 B;  3WB0 A;  4JZG A;  4JI5 B;  2ARH A;  4NTY A;  4GLX A;  1EM1 A;  4B3R B;  2CAZ C;  4DR5 B;  4FPP A;  2UXD O;  1B06 A;  3SYC A;  2YIB D;  1TUB A;  3ZBH A;  3R65 A;  2VQE O;  1L0L H;  3FYI B;  4HZ3 A;  5CBG A;  3ASN B;  2OIG A;  4FZ1 A;  1Y6X A;  4GX1 A;  3CRC A;  1NH2 D;  1GN6 A;  4C7U A;  4JI3 O;  5LA6 B;  3JD4 A;  4JYY A;  3IFX A;  3BPZ A;  1FD9 A;  4PHZ A;  1Q8I A;  2BSK A;  1AJP A;  2AZ0 A;  3CB2 A;  5CMU A;  5JJE B;  3JAW A;  2DOS A;  2HEP A;  4LWS A;  5IJ9 B;  4GKJ O;  2JVD A;  1ZTE A;  5J2U B;  3ZRX A;  4F6R A;  5KUK A;  4JV5 B;  3RYI B;  2UXC B;  4FJC C;  3ZHQ A;  1RM1 C;  5BR8 B;  1ZLZ A;  4P9O A;  4B08 A;  3E89 A;  2ZXW C;  2QWO B;  5CA0 A;  3BAA A;  2WLI B;  4UCV A;  1P84 F;  4X1I B;  4DV4 O;  2GUZ A;  3OTO O;  4W4K A;  4DUY B;  3K08 A;  3AK1 A;  1G4Y B;  4X62 B;  4LFA B;  1K4C C;  5IDJ A;  2W0F C;  2ZM6 O;  2F95 B;  3ZHS A;  3WB1 A;  3DC5 A;  3T4Z A;  2OTL V;  1XEQ A;  3H1J H;  3C3S A;  5BXZ A;  2VRZ A;  2NLJ C;  3OD4 A;  3S3W A;  4F4L A;  4MVS A;  1OCC C;  3K5M A;  1F7Y A;  3B8N A;  1FXK A;  2YXL A;  4J80 A;  1FAF A;  5KHK A;  2ITC C;  3OMI B;  3ZCC A;  2LFS A;  4YXW G;  4L8J A;  4DR1 B;  4MVZ A;  1QCE A;  1TUB B;  2QWQ B;  2IM9 A;  3CRR A;  3AG7 A;  5EIB D;  4RO2 A;  1LNQ A;  3ZHU A;  3ABL B;  1NQT A;  1DF4 A;  4KUM A;  3O65 A;  3RT3 C;  3RYH B;  3TGU H;  4IYH A;  3TXS A;  1WJZ A;  4H13 B;  2EIK B;  1BQ0 A;  3CCS V;  4QGP A;  4LFB B;  2GTS A;  4UB8 Z;  1LR1 A;  1V55 C;  1AI7 A;  5H6R A;  4MTG A;  1BZK A;  2EIN B;  2BSK B;  2B1I A;  3IC9 A;  3S3X A;  5KA6 A;  1YIT V;  2Z0A A;  4YIO A;  3CE2 A;  4K0K O;  1VQ4 V;  2UXB O;  1K73 W;  5LP6 B;  3A8T A;  1EZJ A;  4LWS B;  1MAB G;  2JJ1 G;  3MHS C;  5BMV A;  1YVW A;  3HB3 B;  4F6R B;  4JYA O;  1M90 W;  1WPB A;  3THO A;  3ASN C;  1J5E O;  5IWA B;  2ZKO A;  1I08 A;  2WWW A;  1N4C A;  2UUB O;  1F51 A;  4I7Z B;  1VMG A;  1OHH G;  1VQ9 V;  1M57 B;  2IU3 A;  4B7E A;  3FB7 C;  1YHQ V;  5CA0 B;  3N27 A;  2B1G A;  1FFX A;  2GUZ B;  2A3Q A;  5C93 A;  1XRE A;  5EBW C;  3ABT A;  3T4D A;  2FL4 A;  1IUR A;  1W2B U;  1NU1 H;  4PA3 A;  4N21 A;  3O9O A;  4OX9 B;  1VQO V;  3B77 A;  4I4T A;  2QEX V;  1QQC A;  1YXB A;  1U96 A;  1KD1 W;  1O9G A;  2JEU A;  3HPL C;  1M1K W;  1D5A A;  1YTF D;  1R6K A;  1OCO B;  3UO2 A;  5B5E Z;  2UUA B;  1P4R A;  1I5Y A;  3ETD A;  1FXK B;  2Y4U A;  2UXX A;  3G6E V;  3JD1 A;  4UV8 A;  5A2Q N;  2QA4 V;  3OT7 A;  4DK0 A;  3FX7 A;  5JH7 A;  1XNR O;  2HJD A;  4GX0 A;  4K8Z A;  4DR7 O;  3CXH F;  5FNV A;  3ABU A;  1H2M A;  1SC5 B;  2CGO A;  4QPJ A;  1N0N A;  2NN4 A;  1ZUQ A;  4BW9 A;  1S5J A;  3EFF K;  1NTM H;  1FYJ A;  4I55 A;  2L6L A;  2XT9 A;  5BY1 A;  4EFE A;  3K57 A;  4LF5 O;  2Q5Z A;  4IIJ A;  3CCJ V;  2EIJ B;  4O4I B;  1AJQ A;  4BAY A;  2OCC B;  2A9H A;  4CH6 A;  1JA8 A;  1SRY A;  5LOV A;  3Q4H A;  4DV5 B;  1IBM O;  5CN0 A;  4JI0 B;  5LYJ A;  1JOY A;  4X66 O;  5EC2 C;  1ZAU A;  3I55 V;  2WLN A;  3AG4 B;  1ZWI C;  5BMV B;  2QTO A;  4I50 A;  3UCS C;  4LF7 O;  3C90 A;  2A7W A;  3C3T A;  1GM9 A;  4MVO A;  5AG2 A;  3HKB A;  2IBZ H;  4HYO A;  2AGA A;  5E1A C;  4YY3 O;  2M7W A;  3ABL C;  3FKS G;  1SZX A;  1KQS U;  4J7K A;  1LUV A;  1GK9 A;  2Y4T A;  1XOU A;  1JQ0 A;  2EIK C;  2EZO A;  3U10 A;  5L3G A;  1S77 D;  2OIE A;  4IGG A;  1AB3 A;  1K4D C;  4CH3 A;  1M9N A;  1PL4 A;  2ITD C;  3QO8 A;  1YDX A;  2EIN C;  5J2T B;  3H1L H;  4B3S O;  3OUF A;  1PNK A;  1IVS A;  5LP6 C;  4FZ0 A;  4DR3 B;  4PI2 A;  4I4T B;  3JAL B;  4KXR A;  2DE0 X;  2OT5 A;  1K92 A;  4LP8 A;  4B3R O;  2UXN A;  3P32 A;  2Z5U A;  2ADQ B;  4GX2 A;  4DR5 O;  3GB7 C;  2VQF O;  1RP3 B;  4LF8 B;  2DYS B;  3J80 N;  1M57 C;  3RFR A;  5JH7 B;  3E35 A;  4UCO A;  3CD6 V;  4JAU A;  4QIW F;  2XAS A;  2JS5 A;  1SQB H;  1IDS A;  5FNV B;  1Q82 W;  1N32 B;  1MZE A;  3ABK B;  3MDS A;  3CCM V;  3QG5 A;  5KMG A;  3G71 V;  4ZHQ B;  5EZY A;  3BY6 A;  4I55 B;  2EUL A;  4BW5 A;  3ZHR A;  1RPO A;  1FJG B;  1M5I A;  5IYD O;  1S5L Z;  1VF5 B;  2RNB A;  1FXV A;  1HDJ A;  1MZF A;  2OTJ V;  3AEI A;  2XND G;  3T1H B;  5LOV B;  1OCO C;  1QHT A;  2P6J A;  2X6A A;  1PKX A;  1HNX B;  1FXK C;  1IXB A;  4Z1V A;  5LYJ B;  5ITZ B;  4JV5 O;  2JJ2 G;  2HVK C;  2UXC O;  4LF6 B;  1Y4M A;  5DM6 V;  1BT8 A;  4H0L B;  4JAS A;  5BR8 O;  1EN6 A;  4I50 B;  3PN1 A;  2H8P C;  1AI5 A;  2X6B A;  4DYL A;  1NI8 A;  1DK1 A;  2ZIN A;  1KP3 A;  5L3F A;  3HKB B;  4X20 A;  2YEV A;  2VS0 A;  3IC7 A;  2N04 A;  4DUY O;  3DSQ A;  3K59 A;  2EIJ C;  2XAJ A;  4O4L B;  1MNG A;  3LSU A;  2LFR A;  4QE7 A;  4LFA O;  2OCC C;  4JTD B;  2QJ1 A;  1PV0 A;  5B1A B;  3B4S A;  1R73 A;  4X8A A;  5EBM C;  1HNW O;  4UV9 A;  2A79 B;  4GZR B;  3H1K H;  4FLT A;  3AG4 C;  3L72 H;  1HWY A;  3CPW U;  1SQQ H;  2F66 C;  2P22 C;  1Y76 A;  2Q7E A;  3VBB A;  2W6I G;  3JSN A;  2XUM A;  2Y48 A;  3ETE A;  3N2G A;  3SDL A;  1CPY A;  4OPA A;  4FM2 A;  1TGO A;  2Q67 A;  4DR1 O;  5H5N A;  3RW0 A;  3SYO A;  4JI2 B;  2DQ3 A;  3ZJZ A;  1S0V A;  3HKC A;  4ZOL A;  4DR4 B;  3DGE A;  1B3Q A;  4O2B B;  2LO1 A;  4B3T B;  4W4L A;  4O2A A;  2HG5 C;  1MSD A;  5KMG B;  3OAA G;  3ZRW A;  4LFB O;  1P7B A;  5EZY B;  2DWD C;  4LH7 A;  1F4M A;  4I5S A;  1DGS A;  3NXS A;  3K5L A;  3T2M A;  5IJ0 B;  1OJH A;  4JI6 O;  4DR2 O;  2Q9L A;  4X64 B;  1NTK H;  3STZ C;  4I9Q A;  2WLJ A;  2FKX A;  5EBL C;  3X2Q C;  4ASU G;  1QBZ A;  2DYS C;  2Q8V A;  2QM4 A;  3L74 H;  5IYB O;  3ABK C;  3UQ8 A;  1NZ6 A;  2ATK C;  4HAM A;  1E79 G;  3DXR A;  2E76 B;  3OE7 G;  3CRM A;  4X20 B;  1KYO F;  4RUE A;  2YEV B;  4O4H B;  1IBL B;  3B8M A;  2GBO A;  4NXN B;  1TVK B;  3F7V C;  2ZDI A;  4BWA A;  4DV7 B;  3QVN A;  3E8B A;  3SYA A;  1S5H C;  2QM7 A;  1M56 B;  3JAT A;  4X1K A;  3JAM N;  3LSS A;  4LFC B;  3OGI B;  4AQY B;  4J9Z B;  2EIM B;  1QU7 A;  1NKD A;  4PDR A;  1R6N A;  1E1R G;  5A9G A;  2R9I A;  4R8C A;  4JYC A;  1WPX A;  3SR2 C;  2UUA O;  4FM0 A;  1MG1 A;  5KA5 A;  2PZS A;  4TV8 B;  3LDE A;  1WB8 A;  2ZD9 A;  4CH4 A;  3N2G B;  1VQL V;  5KX5 A;  3KCY A;  3HKE A;  3H01 A;  1T5E A;  1AR5 A;  4DW1 A;  4FIP C;  1V54 B;  3F7Y C;  2W6J G;  4JI4 B;  5H9C A;  1Q6H A;  4ZOL B;  2AHY A;  2F43 G;  5B1A C;  1S72 V;  4JI1 B;  2LGQ A;  2MK3 A;  2IH3 C;  3BEH A;  3D36 A;  4ICG A;  2DN9 A;  4HNA A;  1CP9 A;  4EB6 B;  1SQG A;  4MT8 A;  4LH6 A;  4NR1 A;  1Q90 D;  4JI0 O;  2VWJ A;  4D6T H;  2YXY A;  1GM8 A;  4B3M B;  1SQV H;  3SJC C;  1IBK B;  1WP7 A;  3E8G A;  1AP6 A;  4FMT A;  4FK5 C;  4H33 A;  1GRJ A;  2KKW A;  4UCR A;  3JD3 A;  4JGS A;  4LF4 B;  1P7G A;  3E8F A;  2WA3 A;  5JWP A;  1NJI W;  3MAQ A;  4XDJ A;  3LSQ A;  2Q0O C;  1G1X B;  4MVU A;  5CA1 B;  4YJ3 A;  2CE4 A;  4TSF G;  2RCV A;  3OM3 B;  4UVA A;  2JDI G;  4LF9 O;  2ZR3 A;  4DO2 A;  3JAS B;  1XHZ A;  3AG2 B;  3CJH A;  3H1H H;  3D3I A;  3JAT B;  4DR3 O;  2QE7 G;  3ML0 A;  4G28 B;  5GTH Z;  4Q20 A;  3DC6 A;  4J41 A;  5JCO A;  2CTQ A;  2YIC A;  3ZMV A;  4UB6 Z;  1Q81 W;  3WU2 Z;  5HFM A;  1AI4 A;  1IZ3 A;  5KUM A;  4LF8 O;  3K58 A;  3A2F A;  5CBH A;  4FLW A;  5KLV H;  1VQ5 V;  1K97 A;  4TT3 G;  3JAR A;  1RSO A;  5DN6 G;  3HKE B;  1N32 O;  2DQ0 A;  3ZN1 A;  2Z3Y A;  3EHB B;  3ZS8 C;  1SES A;  4DR6 B;  1N8R W;  2HVJ C;  2F4V B;  4PJ0 Z;  5D5Q A;  1ZX3 A;  1X59 A;  3B09 A;  1M56 C;  1GAX A;  3RVZ A;  1VQP V;  1FJG O;  3UT5 A;  3ZN0 A;  3G6B A;  2EIM C;  1XMQ B;  4DK1 A;  1KU9 A;  1W0K G;  4WBN A;  2AZ2 A;  3ETG A;  1HNX O;  2R9A A;  4FFK A;  3K5O A;  1QLE B;  3JAW B;  3OFN G;  3OW2 U;  4LF6 O;  4DV6 B;  4FLX A;  4KHP B;  2ZQM A;  2Q68 A;  4NXM B;  1CXZ B;  1BQZ A;  4PDL A;  3SJB C;  4AHC A;  1V54 C;  1U97 A;  2QGN A;  4AIL C;  1I0H A;  3L75 H;  3SYQ A;  4U7N A;  2GSM B;  1BE3 H;  4WFF A;  4QJF B;  5JJJ B;  1N33 B;  3BA9 A;  1GN4 A;  5EK0 A;  1N0J A;  3N2K A;  4H44 B;  4LNU A;  2FYU H;  4J7Z A;  4YJ3 B;  3IAY A;  2K9P A;  1K3E A;  2CH7 A;  1PD3 A;  5B1O A;  3CS5 A;  2A06 H;  2YIB A;  3CJH B;  4WFE A;  3BAB A;  3GWO A;  3BVO A;  3OTF A;  1PPJ H;  4DUZ B;  1WNS A;  4PA7 A;  1VEW A;  1K33 A;  3JAK A;  4TQD A;  1QR8 A;  3CCL V;  5KHG A;  2B9Z A;  1DLB A;  3RVY A;  5LMU B;  4DR4 O;  4NKG B;  2PF4 E;  4B3T O;  1RSO B;  5EYP A;  1SQF A;  2AXT Z;  3L70 H;  1JMK C;  4Z1M G;  4CH5 A;  4PA6 A;  1SQP H;  2Q0A A;  1N34 O;  2WLH A;  3APQ A;  2IJJ A;  4J9Y B;  4N23 A;  3FB6 C;  2E75 B;  2JRI A;  3AG2 C;  4PDM A;  3J81 N;  4GT1 A;  2UXD B;  4G27 B;  2YIA A;  2UUC B;  4JPR A;  1ORQ C;  2OCH A;  3TXQ A;  3ZMZ A;  4J11 A;  2QWN B;  4X64 O;  3ABM B;  4TUY A;  2PGG A;  1HNZ B;  4IHJ A;  4WBN B;  4I0X A;  2WLM A;  2Q69 A;  1KKC A;  3ZMU A;  3SJQ C;  1NR1 A;  4YJ2 A;  3P3N A;  4IT5 A;  2HHH B;  1MSW D;  2DW4 A;  1PNM A;  1FPO A;  5K1P A;  1NR7 A;  5LBQ A;  1IBL O;  4NXN O;  1EN5 A;  2EBO A;  1VAR A;  3A0B Z;  2Q4P A;  3ETQ A;  3BA8 A;  4JI7 B;  1I7F A;  3W7S A;  4J10 A;  3ZRS A;  4DV7 O;  4X1Y A;  3N2K B;  4TV9 A;  1FFX B;  1AP5 A;  2E3C A;  4G2K A;  1F4N A;  4QNH B;  2CH7 B;  1QLE C;  2YI8 A;  3ZRV A;  1L8D A;  3CME V;  1GN2 A;  2HP8 A;  5CA3 A;  2FB5 A;  4JI5 O;  4K8X A;  2BCC H;  3JCU Z;  2N05 A;  5FPO A;  1XMO B;  1I94 B;  4YIP A;  2PUS A;  1K9M W;  2PYL A;  2R70 A;  1N36 B;  1Z5W A;  2LW7 A;  1KUQ A;  3ZX6 A;  2QTS A;  2JIZ G;  4LCU C;  3JAK B;  1AIL A;  3E83 A;  4ABM A;  2UU9 B;  1NH2 B;  1XDC A;  2G38 A;  2X0L A;  2BTO A;  4UCT A;  3G4S V;  4P9P A;  3LUT B;  3TK1 A;  4B7K A;  2ZR2 A;  4JI4 O;  5GON A;  3IJ4 A;  3P30 A;  4EFB A;  3SPH A;  1R3K C;  3T1Y B;  2KG7 A;  2RN9 A;  5EYP B;  5KAI Z;  1XNQ B;  4NYK A;  2F23 A;  1XBL A;  4J7J A;  3P3P A;  1Q7Y W;  4PA4 A;  2P06 A;  2CTW A;  4UCU A;  4YHH B;  3EXA A;  3KG2 A;  1GMG A;  4JZ2 A;  4IIJ B;  1SKV A;  2K1E A;  3JCZ A;  1QLN A;  4U7O A;  5JCO C;  1H38 A;  1WB7 A;  3K3W A;  4CC5 A;  2QR4 A;  3Q4H B;  4TUY B;  4B3M O;  2GV9 A;  4IHJ B;  4MW3 A;  4I0X B;  1KMI Z;  3W7U A;  2H3O A;  4EKW A;  4HBN A;  4RUF A;  2CUG A;  4ZKI A;  4LF4 O;  1YIJ V;  4RQF A;  2XTA A;  4WFH A;  2ADP A;  1QNM A;  4GUN A;  1SS3 A;  3E22 A;  5CBF A;  2UXB B;  1EBO A;  4MTF A;  4NTX A;  3CRQ A;  1FXH A;  2Q73 A;  1YJW V;  2BOC C;  5IY5 B;  4X62 O;  2JEX A;  2MW2 B;  4JYA B;  2Y0P A;  3ZHV A;  2E5L B;  5JQG A;  2HKO A;  4X1Y B;  3FB5 C;  3OEH G;  3ABM C;  4TV9 B;  2F93 B;  3VQY A;  1J5E B;  4U3J A;  2ZNI A;  3A0H Z;  1OCR B;  5H6Q A;  1AJN A;  5GW7 A;  4RAI A;  2EJ7 A;  2HR3 A;  3HR0 A;  4NTW A;  2WAM A;  4GX5 A;  3RYC A;  3F5W C;  1Z5V A;  4DV2 B;  1H2S B;  3NR7 A;  3L9D A;  5KHH A;  2EX3 A;  3CC7 V;  2GTA A;  3K06 A;  4JI8 B;  3FAV A;  4DR6 O;  2F4V O;  5GON B;  3CHX A;  2D2C B;  2HLD G;  3W7X A;  1UPG A;  2V4D A;  4PV1 B;  3ZIA G;  1XMQ O;  2ODM A;  1GH6 A;  3UM7 A;  5IYZ A;  1YI2 V;  5IT9 N;  3GVM A;  4RWU A;  4BR6 A;  5DEC A;  4ZI7 A;  1H2L A;  4Z2W A;  1H2G A;  3WG7 B;  5LHI A;  4DV6 O;  4KHP O;  3KCX A;  4KFM A;  2V1D A;  5LA6 A;  3VOU A;  3CRA A;  5L3C A;  2R9R B;  4NXM O;  1SQX H;  2GHY A;  3E86 A;  3U0Z A;  4LF5 B;  3QO7 A;  2XAF A;  5IWA O;  3VQX A;  1OCZ B;  2P4K A;  1M93 A;  5IJ9 A;  1XIL A;  4R50 A;  1H2K A;  1XL6 A;  4R7C A;  1P49 A;  2DWE C;  4DRX A;  4K35 A;  1N33 O;  3M8A A;  3SPC A;  3W7T A;  5KHJ A;  1K8A W;  3OGC C;  3E22 B;  3RGB A;  3QTC A;  4WFG A;  4LC1 A;  4PI0 A;  3BCC H;  3CYO A;  5J9P C;  5B3S B;  3AG3 B;  4MW8 A;  4LBE C;  3WB2 A;  2WA4 A;  4FLY A;  2D3O W;  1AVM A;  4DV1 B;  1YTF B;  4OX9 O;  5JQG B;  1JCH A;  1KKD A;  2AW9 A;  1VIB A;  1BL8 A;  4P2Z A;  4X1I A;  5E79 Z;  4U3J B;  4DV0 B;  2P67 A;  3PJS K;  1MMM A;  3R66 A;  1HW7 A;  3AK2 A;  3RYC B;  1Y76 B;  4UFZ A;  3OR6 C;  5EC1 C;  2YS8 A;  2H94 A;  3JD2 A;  2XAG A;  4GYC B;  1OV9 A;  4JAV A;  1BHB A;  4JF3 A;  2QKC A;  5IY5 C;  1S76 D;  3ZMT A;  1BHA A;  3FAV B;  3UKM A;  4ZBM A;  3APO A;  2DYR B;  3HKC B;  2CGN A;  2WPD G;  3RN4 A;  2P4V A;  3CP1 A;  1VF7 A;  4O2A B;  3ZMS A;  1AR4 A;  1NVP B;  2XAQ A;  2UUC O;  2VQF B;  3ZRW B;  1OCR C;  2F1M A;  1WAZ A;  3SPG A;  5KHI A;  1Q6I A;  4DV5 O;  4A5U B;  5IYZ B;  4FLU A;  1HNZ O;  5FPR A;  3M7M X;  5EIB C;  1YF2 A;  3RWR D;  3H9V A;  3KKY A;  3RYH A;  1J95 A;  4GKK B;  4ZI7 B;  4E4E A;  3STL C;  1L1F A;  1W0J G;  1AI6 A;  2X7R B;  3CX5 F;  1ZSP A;  1WLE A;  3FB8 C;  2HHH O;  4UXN A;  5LGN A;  2PI5 A;  1RPR A;  4JAA A;  3K9A A;  1WP8 A;  2JK5 C;  3B2E E;  4MVR A;  3BHP A;  1UJW B;  5LP6 A;  1ROP A;  3QF7 A;  4X88 A;  1PL0 A;  1R3I C;  2XAH A;  4H37 A;  1O9H A;  4DRX B;  3DXR B;  4XDK A;  1YJN V;  2KSD A;  1NBM G;  1WA8 A;  4JI7 O;  2ETN A;  2OWO A;  2B5U A;  5K1X A;  1R6T A;  4WFA V;  1TA8 A;  3BRC A;  2P5O A;  1NS1 A;  1XUQ A;  2VWK A;  3FFQ A;  3WG7 C;  3SYP A;  4X1K B;  2C2A A;  2ZIM A;  1VQM V;  1XMO O;  1I94 O;  3AG1 B;  4CZZ A;  1N36 O;  4WF9 V;  3SPI A;  1Y74 A;  5LMN B;  1OCZ C;  1VF6 A;  2UU9 O;  1PNL A;  2NR5 A;  3JSL A;  2X6C A;  4X9Q A;  4JTC B;  1VQK V;  1RFY A;  2E74 B;  2OYQ A;  1Q6U A;  2A0L A;  1XL4 A;  1LUW A;  3VQW A;  4GCZ A;  1HNW B;  4CBC A;  5KX5 B;  1GKF A;  3T1Y O;  1FFT B;  1BCC H;  4PD4 F;  3VQV A;  1XNQ O;  5B3S C;  2KQX A;  4MVQ A;  3AG3 C;  1NT2 B;  4BIZ A;  3TET A;  5TIS Z;  4YHH O;  4NVP A;  1YCI A;  1F23 A;  1SA0 A;  1XI1 A;  5JVD A;  5IE9 A;  3K04 A;  4HNA B;  3SGI A;  4X65 B;  2EJR A;  1FKA O;  3FYE B;  3T1H O;  1WN7 A;  4CC6 A;  2RJZ A;  1A32 A;  5L3B A;  4O4I A;  2ZT9 B;  1EN4 A;  3OMA B;  3U11 A;  2QWP B;  5LXT A;  4TQF A;  2PYJ A;  1QR9 A;  3ICX A;  1D2D A;  2JS3 A;  2WLK A;  2ZE6 A;  4IYI A;  3CCE V;  4MSW C;  2DYR C;  4BIO A;  2RMK B;  5C8Y A;  4JI6 B;  3GWK C;  4DR2 B;  3CMA V;  3CWB H;  4UVC A;  4CS3 A;  4DV3 B;  1WA8 B;  5FLX N;  2E5L O;  4ZIB A;  4TOI A;  2EZP A;  4MS2 A;  3E2E A;  4FLZ A;  3OEE G;  5B1B B;  4JYB A;  2IJK A;  5GTI Z;  1HR0 B;  1DTO A;  3JD0 A;  4R6Z A;  4EEQ A;  3H1I H;  5J2T A;  4DV2 O;  2Q6A A;  4NB5 A;  5L3E A;  1Y74 B;  2L35 A;  2Y69 B;  4MVM A;  4XBF A;  1TAE A;  1KC8 W;  2IJI A;  4JI8 O;  5H2F Z;  1Q86 W;  4JI2 O;  2ZIO A;  3JAL A;  2LGW A;  3AK3 A;  3SPJ A;  3JAR B;  4J42 A;  1GTO A;  3D3Q A;  1I5X A;  2JGD A;  2R72 A;  4WFB V;  1PM9 A;  2CDY A;  1XQ8 A;  2ZDI C;  3FD9 A;  1B04 A;  4KL1 A;  1JX9 A;  1US6 A;  2QKA A;  3AG1 C;  3UT5 B;  5LHG A;  3K5N A;  1SA0 B;  5JVD B;  1KBH A;  2VQE B;  4UUJ C;  4IL6 Z;  4P30 A;  4ZHQ A;  5HFL A;  2FML A;  4OPH A;  1M4U A;  3I56 V;  1V9P A;  3OMN B;  3RYF A;  1EFR G;  2RQ6 A;  4JI3 B;  1YJ9 V;  5LXT B;  3RBZ A;  4O4J A;  1VQ6 V;  2WSS G;  1VQN V;  1ARO P;  3A0R A;  1COW G;  5ITZ A;  1NVP D;  3I5D A;  4LR3 A;  5C8Y B;  3D8C A;  3W7W A;  1ENV A;  1K5Q A;  4DXW A;  1E1Q G;  2LJ2 A;  1B6Q A;  4GKJ B;  1CEZ A;  3UO3 A;  1SZT A;  3D36 C;  1VQ7 V;  5IYC O;  1K34 A;  4DV1 O;  2Y0I A;  1R3L C;  4LNU B;  1IX9 A;  5BZB A;  2XHB A;  1ZL8 A;  2XOK G;  3K9S A;  4LFC O;  4AQY O;  1Y66 A;  3TCU A;  1SET A;  4DV0 O;  1KB9 F;  3ASO B;  4O4L A;  3G67 A;  4QPK A;  2IU0 A;  4CS4 A;  1QVG U;  4FVM A;  5FL7 G;  2LW1 A;  4DV4 B;  3OTO B;  3CC2 V;  3WFV A;  1IXM A;  2IJH A;  4WCE V;  4FFB A;  3K0D A;  3MHH C;  3K79 A;  4XDL A;  2NNU A;  5B66 Z;  4CS2 A;  4LF9 B;  2ZCE A;  1GM7 A;  3DTU B;  3K03 A;  2ZM6 B;  1D5N A;  3BFR A;  1BGY H;  2P90 A;  1GO3 F;  3F5T A;  1YZB A;  1Q43 A;  2BE3 A;  1K5S A;  4DW0 A;  5LL6 Y;  5CB4 A;  1JFF A;  1DF5 A;  4JI1 O;  2JGD B;  3CCU V;  2Q7H A;  3X2Q B;  3ZHT A;  4D7S A;  2EIL B;  2O57 A;  5B1B C;  1URF A;  4O2B A;  1KEC A;  1JJO A;  4L87 A;  1JR9 A;  4RQE A;  2QKS A;  3KZI Z;  4GKK O;  3CSX A;  2LQT A;  3CXC U;  2Y69 C;  3L73 H;  1VF6 C;  2IW5 A;  3HKD A;  1IBK O;  3CEI A;  4KP4 A;  1YSC A;  4AI8 A;  1R3J C;  2ILM A;  2QDO A;  5F2V O;  3RYF B;  3LDD A;  2WLL A;  1H8E G;  5IJ0 A;  4YJ2 B;  1Y67 A;  2CTR A;  4FLV A;  2BTQ A;  1G8M A;  1XHX A;  1UFI A;  2PI4 A;  4O4J B;  2GDS A;  5JJN B;  3JYC A;  5B1N A;  3LNN A;  3J7A U;  2V7Q G;  4K0K B;  1SF9 A;  2QWR B;  1Q3E A;  2JGU A;  3QO5 A;  2M6Y A;  2ZE7 A;  1H8H G;  2YSU B;  1JJ2 U;  1VQ8 V;  3LNM B;  2N74 A;  3SJA C;  4MTX A;  2ZE8 A;  1H2N A;  4UCS A;  1ZL8 B;  3B40 A;  4TWK A;  4O4H A;  3LDC A;  2UUB B;  4Q6G A;  1OZ0 A;  1TUE B;  1TVK A;  5LMN O;  2DMX A;  3IGA C;  2QSA A;  3OUS A;  2DJV A;  4FM1 A;  1AR1 B;  2IH1 C;  3T1C A;  4FFB B;  2CTP A;  2YDE A; 
#chains in the Genus database with same CATH homology
 4X64 O;  4LF6 O;  1XMQ O;  1DK1 A;  3F5T A;  1YZB A;  4YHH O;  2UUC O;  5IT9 N;  1AB3 A;  2ZM6 O;  5LL6 Y;  5LMU O;  4DUY O;  4B3M O;  4JI1 O;  4DV5 O;  4A5U B;  4DV6 O;  1HNZ O;  1XEQ A;  4KHP O;  4LFA O;  5BXZ A;  1FKA O;  3T1H O;  4NXM O;  4B3S O;  1G1X B;  4LF4 O;  1R1B A;  1A32 A;  1F7Y A;  1IBL O;  5IWA O;  4X65 O;  1HNW O;  4NXN O;  2UXD O;  3JAM N;  4OPH A;  4GKK O;  2HHH O;  4LF9 O;  4B3R O;  1N33 O;  1D2D A;  3M8A A;  2VQE O;  4DV7 O;  4DR5 O;  5A2Q N;  4DR3 O;  1IBK O;  1XNR O;  4X62 O;  2VQF O;  4DR7 O;  2UUA O;  3SDL A;  3J80 N;  4JI7 O;  4OPA A;  4JI3 O;  1R6T A;  3O65 A;  4DR1 O;  5H5N A;  3RT3 C;  1FYJ A;  4JI5 O;  4OX9 O;  1NS1 A;  4LF8 O;  5BY1 A;  5FLX N;  2E5L O;  3J7A U;  4LF5 O;  2LW7 A;  1KUQ A;  2DOS A;  4DV1 O;  4DV3 O;  1N32 O;  1AIL A;  1XMO O;  1I94 O;  4GKJ O;  4DR4 O;  4LFB O;  3R66 A;  1N36 O;  2Z0A A;  4LFC O;  4B3T O;  4K0K O;  2UXB O;  2N74 A;  4AQY O;  1IBM O;  4JI4 O;  4DV0 O;  1X59 A;  2UU9 O;  4X66 O;  1FJG O;  4DV2 O;  1N34 O;  4DR6 O;  4JYA O;  2F4V O;  1HR0 O;  4JI6 O;  2JRI A;  4DR2 O;  5LMN O;  4JV5 O;  3J81 N;  4JI0 O;  2UXC O;  1J5E O;  4LF7 O;  2ZKO A;  4JI8 O;  4DUZ O;  2UUB O;  4JI2 O;  2FKX A;  2DJV A;  3T1Y O;  4DV4 O;  1XNQ O;  2AGA A;  5BR8 O;  3OTO O;  1HNX O;  4YY3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...