1FJKA

Nmr solution structure of phospholamban (c41f)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILIFLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIAC PHOSPHOLAMBAN
publication title NMR Solution Structure of Phospholamban
pubmed rcsb
molecule tags Membrane protein
total genus 14
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fjkA00
2HYNA 2KYVA 1FJKA 2KB7P 1ZLLA 2M3BA 1N7LA 1FJPA
chains in the Genus database with same CATH superfamily
1YTZT 3IF4A 1HBWA 1R8EA 5H2FH 3H1LD 2YNYA 2WPSA 1NTMG 3L74E 2WPQA 1PP9E 2E76D 4HB1A 3FGAD 2KOGA 4NPFX 1NTKD 1MKMA 1JCDA 1G2CB 5KLVD 3GMAA 2KZJA 1CI6B 4K3AA 2NPSC 3E7KA 3B5NA 1FDOA 1N8RQ 1OVUA 2BCCG 2OYIB 1RF1A 5KLVG 4I7ZC 1SQQE 1BE3E 4EOTA 3HRNA 4UB6E 2HLOA 4WY4C 1NTKJ 3P8CE 3H1HD 3PHLA 3B8EB 4L75A 4DCKA 1SQBK 3CX5H 3L71D 2M3BA 3IN6A 1SQVK 4BWNA 1S72P 3L70E 1FDMA 5E79H 1NTZJ 2N9BA 2B88A 2LXCB 3CX5I 2XNDH 1VQ4P 1X0TA 2E5TA 1JM0A 1SQPK 1RQVA 4BRYA 1NH4A 4Z1MH 2E75D 2WSEH 3WUVA 4A7PA 1N7SC 1L0LE 3GF7A 1EZVD 1OW7A 4DOJA 2JJLA 1ZRTE 1FDIA 1IK9A 3AE1C 1TU3F 1U7MA 1GL2C 4RESB 1GW4A 2QJPC 3V4QA 1P84H 1JY3N 1ZOYC 1NHLA 2BEQD 3T97B 1LT9C 2WSSH 2JP3A 4DJGA 1GU4A 1FBMA 1IFIA 5KAFE 2IBZD 1LWUA 1P84I 1CW5A 3AEGC 1L0NE 2P10A 1S2EA 2IBZG 2R5BA 1URQB 1RF1C 4QMAA 1LTIC 1Q7YQ 3K5BA 3OW2O 2CPSA 1FZBA 3PH0A 3G3ZA 3A0HH 1L4AA 3II6A 1LP1B 2HPCB 4XA4A 5CCHD 1Y9BA 3RGUA 2M5AB 3H1ID 3JSVC 5AVUB 2FBWC 2FXPA 3H1IG 3HE4B 2A45G 4ZNCA 3L72G 2C0XA 3VMYA 2AXTE 3M9BA 3BCCG 3NMDA 5AW4B 1T8ZA 3OAKA 2NPSB 3WU2E 2BEZF 1M8OB 2KP8A 4KJMA 1L2PA 2H7HA 4I7ZB 4K35A 3B71A 5KAIH 1QVFO 2E75C 1VQ6P 3CCUP 1N73A 3RK3D 1JY2O 3G71P 1Q82Q 4IL6H 2GM4A 2ITAA 3L75D 5AW9B 1Q86Q 1NU1J 4PD4H 2YKOA 1Y47A 1LWUC 2PP6A 3Q1MA 2Y0EA 3QWOC 2GUVA 4ASVA 2W83C 2K9JB 3PRJA 1S9KD 1KTMA 4PD4I 3TNUB 4I2LC 3M91A 4L73A 4YTPC 2J5UA 1N7SB 3L75J 1RQUA 5KJ7A 2YO2A 1SLQA 1FS0E 1GL2B 1S5LX 3L74D 3CL3D 1IO4A 3H1KD 2QJPB 1VDFA 2HG5D 1LT9B 3WMM0 2WSFJ 4UB8E 2R44A 2FYUJ 2WPRA 1NWQA 5CCHC 2VRSA 2IYOA 2KZIA 1EZVI 2OGUA 3TGUE 1VF5C 2OYHA 1BDCA 2ZXEB 5APWA 2BCCE 1N7LA 1HGZA 2MJZA 3L74J 1PP9J 1T3UA 1FZEA 3TYYA 2AEMA 3IFMA 2Y0DA 3AEDC 3WUUA 2E43A 2H43A 4N78D 2KLVA 3V2QA 4ZKUA 1LGHB 2P67A 4D6TG 1SQXD 1JMMA 3FX0A 1FOSE 2ZT9D 5DJTB 1K05A 2IYPA 1SQBE 1BCCE 5AVVB 1SQQJ 4AUWA 1SQVE 1KILE 1VQMP 1D7MA 1BE3J 1OVVA 2YIUC 3GHGC 1JNMA 2Q6QA 1IFPA 2WITA 2W6AA 1SQPE 1L0LD 3BVHA 1ZRTD 1LTJA 3L70J 5KJ7C 1YQ3C 3VMAA 2E75B 2O1JA 3HE5A 2Q5UA 2FXOA 4EDFA 3CPWO 2KYVA 1L0LJ 1M1JC 1BGYD 2FKWB 1LWUB 1JMBA 3D70A 3AEFC 1KB9E 1LTAC 2XDJA 1EDJA 3JC22 5AVRB 3M9HA 2FFDC 4IOIH 3VP9A 1IJDB 4RKUJ 1JB0J 1M57D 1NYHA 1UIIA 3I55P 2K1AA 2P7JA 4U3FE 1L0NJ 2WSFH 1QX8A 1YYCA 1OXZA 1J1EB 5CBNA 2JDIH 3A0BE 3A3YB 2PFXA 3CWBG 4WY4D 3TSIA 1AV1A 2KB7P 1P84D 1WMKA 4JYBA 3AE7C 2ZT9C 3D6YA 4R4LA 3CCQP 2LKMA 2QM8A 3CMEP 4JQ0D 2YO3A 4HKZH 1LTJC 1EDKA 3QH9A 3IAOA 4IFMA 2YKQA 2RH0A 3CCMP 1OMIA 1N7SD 5M1BA 3KQGA 4UB6H 3N4XA 4HYTB 1QGKB 1BSNA 1OIPA 1QL2A 2BASA 2PRRA 3RK3B 2KUBA 1HUCA 2G8YA 2YIUB 4GOEA 1M56D 4W7ZA 3BASA 3GHGB 3HUSA 1RE4A 2QE7H 3AE9C 2KSJA 3AEEC 3JCUE 3H1LG 3B5ND 5AW5B 1OW8A 1RY3A 4RO0A 1NO4A 2KSEA 3AE2C 4H44D 1X22A 3S4RA 3D6ZA 1USDA 3OA7A 5KLVK 3AEAC 1QL1A 5TISE 2IFNA 3L35A 1FU1A 1NTKG 3V2PA 1HTLC 3V5BA 3RL0D 1J1DC 1M1JB 5AVWB 3TF5A 1NTZD 1XTGB 2K3RA 1HWTC 4YXDC 1NTMJ 3VOPA 1NTZG 1FZFA 2C0WA 4PD4D 5KAFH 2QIWA 2Z5IA 2FFDB 3SWFA 2P1JA 3HTKA 4OGQD 3H32A 4DT0A 2N1TA 3H1HG 4D6TE 5CMZA 3L71G 1KQGB 4YXWH 2O01J 2XZRA 2QA4P 3TGUJ 1PGJA 5K5GB 2BCCJ 2HODA 1K04A 3TDKA 5CHXA 2IZ0A 1S4XA 1LNQA 3L73E 1Q90D 3MZWB 4U7JA 5AW7B 5BU8B 5C39A 3V2NA 5BVZA 2XU6A 1YQ4C 4NPEA 1YITP 2ZT9B 4JPZB 1EZVG 3BRTB 3C1LA 1J2JB 3AE8C 2AXTH 2C9NY 1KILA 3MGNA 2Q3IA 3RK2D 1SQBJ 3KPEA 2A06D 1BCCJ 1YJNP 1SQVJ 5AW3B 3WU2H 4ASWA 3LW5J 2R3CA 2P2UA 4ZKPA 1KZUB 2XKMA 3KHUA 2DW3A 3N7NA 1W2BO 3W68A 3B5NC 2ZYDA 1SQPJ 1GTWA 2IZ1A 1YIJP 1L4AD 2H8PD 3PLNA 2B87B 5TJHA 2Y9YA 1H0TA 4H44C 3MUDA 2JKVA 1JY3O 1MV8A 3FWNA 2QG4A 3U1CA 4BXLA 1ZN5A 2QJYC 3RL0C 3Q5PA 2HYNA 1PPJE 2N1TC 1VF5D 3NFQA 4U3FD 3F89A 3M0DA 2KS1B 3S1KA 3L36A 4OGQC 5CBOA 3RBZA 1H8AA 3CWBE 5CJ4A 1R5LA 1X9VA 3IR9A 1NU1D 2QVAA 1J1DB 2KIKA 1JY3P 2B89A 1IZNB 4U3FJ 4PJ0E 4UB8H 3E1RA 2CPBA 1KILC 2QM7A 5AVYB 2O01H 3USSA 4WY4B 2WZ7A 1GMJA 2V7QJ 3H1JE 1HVVA 1EXJA 2ZVOB 3CXHE 1NAYA 2PAJA 1OWAA 2OTJP 1NGMB 2SPZA 3L75G 3RK2C 4Y99C 1R5SA 5KJ7D 1S5LE 2IFMA 3ZDMA 1AVOA 2WT7B 2JR8A 4CPGA 4WWIA 2OTLP 1M7LA 2E42A 2FYUD 4IFDK 3CCJP 5GTHE 3R2PA 1U57A 1KV4A 3AE3C 1L4AC 1AJYA 1NTME 1RE3A 1PP9D 3LW5H 1JY2P 3FXDA 1IK7A 3CCEP 4LC1A 3L74G 1SS1A 2W27A 3H1KG 2K88A 1FZAA 3M0DC 2WVRA 5KKZC 1H89A 1DD3A 1YBKA 5AW1B 3Q2YA 1SP4A 4W7YA 1YHQP 1G2CA 3PP5A 1W2EA 3B5NB 1X8YA 1FJKA 5KLVE 2O3JA 1RF1B 5APYA 1SQQD 1IFJA 3U1AA 4H44B 3M9QA 4GOFA 1BE3D 5GTIE 1SQXK 1ZR4A 1N73C 1FE6A 3P8CD 1CSBA 3AE5C 1DEBA 1OZHA 3RL0B 1VL2A 1PZQA 3H1HE 1SQXG 3L71E 3H32B 1JOCA 4H0LC 1KB9H 3L70D 3HD7A 3O8ZA 3B4SA 2L5GB 2PGDA 3VN0A 2V4HA 4BRYB 1PL5A 3L73D 4OGQB 2LR2A 2M8RA 3KYQA 1L0LK 1LJ2A 1ZR2A 1KQFB 2YMYA 1WRGA 4D6TJ 1L0LG 4GDOA 5B5EE 5CCGA 4TT3H 1K9MQ 2V7QH 3A0BH 2Z5HA 1DEEG 4KT0J 3UIAA 4LGDE 1RE3C 1A02J 2N9YB 3BATA 3L73J 1VQNP 1AA0A 2ZVNB 3T97A 3WUTA 3CCRP 1JCCA 1UIXA 5KLIC 2KXPB 4HH2A 3MD0A 1RF0A 4WB4A 1L0ND 2OYHC 2IBZE 4L74A 3RK2B 4Y99B 1HJBA 3VMXA 1A02F 2J59M 1BGYG 1URQA 2IPPA 2XV5A 1GK4A 3MP7B 2ZXXA 1KC8Q 3KZIE 2ZYGA 4GIFA 1GW3A 2IX7C 1ZLLA 5APXA 1L4AB 2Q7CA 1LP1A 2HPCA 1YJWP 1PPJD 2M5AA 2K37A 3MTUE 1DX7A 3HD7C 5AVQB 3V6IA 3H1IE 3G4SP 1KORA 3L72E 1ZXGA 3ITKA 2M3EA 3HE4A 1EDIA 3CC2P 2UWJE 1PFIA 1KN7A 3BCCE 3JCUH 1AVYA 1U7JA 5KKZB 4I6MC 1VF5B 1RH5B 3EQ2A 3C9IA 2AXCA 2QEXP 1T2KC 2NPSA 1M90Q 2W6BA 4OVNF 4YPCA 5CCGC 5TISH 2W6JH 1WT6A 1AFOA 1N73B 2K9YA 1LT1A 2WQYC 1JEKA 3RK3E 1KQLA 3CWBJ 3H1JD 1EC5A 1LTBC 5B66E 2P58A 1JUNA 1RF0C 3AE6C 2HFED 4KHXA 4C7NA 2FXMA 1GU5A 3LIDA 1NJIQ 1URQC 3AE4C 2NZ2A 2K9JA 2QSIA 2CK3H 4I1LA 3TNUA 1S9KE 2I8DA 1KYOE 3H1JJ 1Z56A 3BRVB 1NTMD 1VPCA 2MKVA 4ZMDA 1NTKK 3VTPC 1T3JA 1EQ7A 2QJKC 1GL2A 2ZAEB 3H1KE 2D2CC 2YMKA 1LT9A 4EIJA 1DD4A 2O01N 1VQ8P 1NTZK 5KLIB 3TGUD 1MFZA 1OFCX 3EFGA 1Q81Q 5EFWB 3CC4P 1OW6A 4OH8B 2N1TD 2BCCD 5APSA 3H25A 2OYHB 5AW0B 3TGUG 1FJPA 3H1LJ 1LTSC 2E74D 2WWWA 1Y8AA 1G1IA 3EFFK 2ZJSE 2KNCA 4N78E 1N86A 1FAVA 1SQXE 1HH0A 1IFNA 2YKPA 2Y0CA 5KLVJ 1SQBD 3HD7B 1BCCD 3GG2A 1XTCC 1SQVD 1KILD 1FZCA 1SQBG 1K73Q 5AVTB 2JO1A 1BCCG 5H2FE 1IFMA 3PTZA 1SQVG 2RKLA 5KTBA 3A2AA 3AEBC 3HUSC 1PGOA 2WSCJ 1RE4C 3SWKA 3CCLP 1SQPD 2W8ZA 2KLUA 3R4YA 2WPVB 4JYCA 3H1HJ 1YI2P 1MZ9A 3L71J 1CZQA 1VQKP 1ZP0C 1SQPG 1LTJB 3P32A 3VMZA 2A06G 1EXIA 3OJAB 1GDTA 3HE5B 3M06A 1NKNA 1GK6A 2WTYA 1FOSF 4PJ0H 1MFTA 4O9BA 2Y9ZA 1RHZB 4XFJA 3V4WA 1AQTA 3ABVC 1VQPP 1ZMEC 3CX5E 1BGYE 4C7RA 2E76C 2FYNC 1KB9D 3CXHH 4PV1D 1JO5A 3EWKA 1IFDA 3CD6P 3NTNA 1T6AA 5E79E 2G3AA 1PV3A 2O1KA 2I1KA 3E1IA 1S5LH 5AW8B 3CXHI 2H89C 1SFCD 1PGQA 2QRXA 1G1JA 3M0AA 1LTTC 2E74C 3GW6A 2QJKB 4U3FG 2ZFCA 5GTHH 3L72D 3GLMA 2D2CB 1VQ7P 1FZCC 1NU1K 3CCSP 1SFCA 3LIEA 3O6QA 1JY2N 3BCCD 5CCHA 3C8VA 1P84E 1OX3A 1NU1G 4H0LD 5L8RJ 5AW2B 3H6PA 3H1IJ 3L72J 4H13D 1KFMA 5BU5A 1DH3A 4NPDA 1N2DC 1MUUA 2M0BA 3SWYA 4W80A 3BCCJ 1YTZI 1JTHA 1QLED 1FZGA 4N6JA 1HGVA 5GTIH 1KFNA 1QVGO 3CI9A 3KXDA 4GODA 3SFEC 2FYUK 2WSCH 4B86A 3MUDC 3A0HE 5AVXB 2YXQB 1H88A 4C7NB 3SFDC 1NAFA 2FYUG 3HUSB 3GHGA 2JWAA 1KYOD 3Q5RA 4R4MA 3H1LE 1FC2C 4PV1C 1PP9G 3P8MC 3TK1A 5AW6B 2OYOA 3G9RA 2FYZA 1W5CE 2W90A 5CJ0A 5B5EH 1J1EC 1VQOP 1NTKE 2AEJA 1YJ9P 4L76A 3Q5SA 2HR3A 1CI6A 1SFCC 5KAIE 2RN0A 1SQQK 3F5HA 3L37A 2OYIA 1M1JA 2AEFA 5AVZB 1HF9A 4IL6E 3HD7D 1NTZE 5DJUB 1SQQG 2E76B 2FYNB 2KI7B 4GT1A 1BE3G 3L4FA 2QJYB 1HJ0A 3H1KJ 4PD4E 3VP8A 2E5YA 2FFDA 3CC7P 1AQ5A 1X79B 2H88C 3HTKB 4D6TD 1VQ5P 1Q2NA 2N1TB 2Q1KA 2KNCB 3D71A 4IL6X 1KMIZ 1T2KD 2OARA 1S3JA 2RMZA 3L70G 3KZIH 2E74B 1OVRA 2IBZI 2GUSA 2HODB 5CCGD 4H13C 2Q9IA 2IDBA 1KB9I 2Q3EA 4N3YB 3SSUA 3S9OA 3U59A 1USEA 2NRGA 2XNXA 1FZCB 3L73G 1NVOA 1NKZB 3RK3C 2WMMA 3A5TA 1EZVE 4C46A 2A45H 1SVFA 3FXEA 3V2RA 1SQXJ 4RJTA 2I1JA 1KILB 1ZV8A 3MIWA 1BSHA 1URQD 2A45I 4LLHA 2A06E 5APUA 4WVZA 1M1KQ 1L0NK 3CMAP 2B9BA 4IFFA 3I56P 2Z4EA 4DZOA 1IC2A 3AECC 1PIXA 1L0NG 2JWDA 4XE5B 2OYIC 2B87A 2FY8A 1H0TB 3VYIA 4HJGH 4JBZA 3CLQA 2JEEA 3CX5D 4AQRD 3PJSK 5B66H 1ZW0A 4GKGA 2D2CD 4EI2A 4AYCA 3KDPB 2R5DA 1LTGC 4EYYQ 5APVA 1NOHA 3I5CA 2YXRB 1GZLA 4TLFA 3G6EP 3NXSA 1PPJG 4PV1B 2NPSD 1BGYJ 1KYOH 1S1CX 1K8AQ 2KS1A 2R3SA 3Q3DA 2POHA 3W67A 2J58A 3CWBD 5APTA 3MHVA 3FWLA 1E5WA 3CCVP 1SFCB 3RBXA 1VQ9P 1KYOI 1E79H 3O6QB 1NU1E 1KD1Q 1EDLA 4WBAA 2WSEJ 1GD2E 2LXBA 4WY4A 3RL0g 3CXHD 4Y28J 4H0LB 3A7OA 3L75E 3H1JG 2C9LY 4JF7A 5AVSB 1KQSO 3GF3A 4M3LA 1JTHB 2OTKE 1BDDA 1VQLP 4H13B 1QEXA 1DIPA 2R32A 1GL2D 3P7KA 2WT7A 2KK7A 4MN4C 1N7SA 2OQQA 4OWFA 2FYUE 2L91A 2ZYAA 1NTMK 1PGPA 2GA1A 5APQA
chains in the Genus database with same CATH topology
4O9BA 3R2PA 2KYVA 1YTZT 1L4AC 1HBWA 3V4WA 1M1JC 1RE3A 2YNYA 2WPSA 3LW5H 2FKWB 1JY2P 1LWUB 2WPQA 4C7RA 4LC1A 1JO5A 2W27A 1IFDA 1LTAC 2XDJA 1FZAA 3NTNA 3M0DC 5AVRB 3M9HA 2FFDC 3VP9A 2KOGA 2O1KA 2I1KA 1H89A 1IJDB 3E1IA 5AW1B 1SP4A 1JCDA 5AW8B 4W7YA 1G2CB 1G2CA 3PP5A 1CI6B 1W2EA 3B5NB 2NPSC 1SFCD 1X8YA 1FJKA 3B5NA 1G1JA 3M0AA 2P7JA 1LTTC 1RF1B 2OYIB 2WSFH 1RF1A 5APYA 1IFJA 3U1AA 2ZFCA 1YYCA 3M9QA 1OXZA 1J1EB 1SQXK 1ZR4A 1N73C 1FZCC 1NU1K 4EOTA 3HRNA 3P8CD 1SFCA 3LIEA 3A3YB 1CSBA 4WY4D 1DEBA 2HLOA 4WY4C 3TSIA 3P8CE 3RL0B 1JY2N 3B8EB 2KB7P 1SQBK 2M3BA 5CCHA 4JYBA 3H32B 1JOCA 1SQVK 2LKMA 3HD7A 2QM8A 1FDMA 3O8ZA 5AW2B 2L5GB 2N9BA 2YO3A 3VN0A 1LTJC 3H6PA 1KFMA 1SQPK 4IFMA 2YKQA 2M8RA 1NH4A 5BU5A 3KYQA 1DH3A 1L0LK 1ZR2A 1N2DC 1MUUA 2WSEH 3SWYA 4W80A 2YMYA 1WRGA 1N7SD 1N7SC 1YTZI 1JTHA 4DOJA 1FZGA 2JJLA 4N6JA 1HGVA 3KQGA 1IK9A 1KFNA 5CCGA 3CI9A 2Z5HA 3N4XA 3UIAA 2FYUK 2WSCH 1RE3C 1GL2C 4LGDE 4B86A 4HYTB 1A02J 4RESB 1GW4A 5AVXB 1QL2A 2BASA 3RK3B 3BATA 1H88A 3V4QA 1JY3N 4C7NB 1NHLA 1HUCA 1LT9C 1NAFA 3T97A 4W7ZA 3HUSB 3BASA 3GHGB 3HUSA 3GHGA 1GU4A 1FBMA 1JCCA 1IFIA 1RE4A 4HH2A 3MD0A 1RF0A 4WB4A 2KSJA 1LWUA 2OYHC 1CW5A 3RK2B 4Y99B 1HJBA 3VMXA 1A02F 3B5ND 2J59M 5AW5B 3P8MC 2R5BA 1URQB 3TK1A 1URQA 1RY3A 2IPPA 5AW6B 2XV5A 1RF1C 1NO4A 1GK4A 1LTIC 2FYZA 3OA7A 5KLVK 5CJ0A 1QL1A 1J1EC 4GIFA 1GW3A 2IFNA 2IX7C 2CPSA 3L35A 1FU1A 1ZLLA 1CI6A 1FZBA 1SFCC 3V2PA 3G3ZA 1HTLC 1SQQK 5APXA 3V5BA 1L4AB 3RL0D 1L4AA 1J1DC 3L37A 2OYIA 3II6A 1M1JB 2HPCB 2Q7CA 1M1JA 4XA4A 5CCHD 2HPCA 5AVWB 1XTGB 5AVZB 3MTUE 1DX7A 5AVUB 3HD7D 1HWTC 3HD7C 5AVQB 3VOPA 1FZFA 3HE4B 4GT1A 2C0WA 3HE4A 2A45G 3L4FA 3VMYA 2C0XA 2Z5IA 3VP8A 2FFDB 3SWFA 2P1JA 3M9BA 2FFDA 1AQ5A 1PFIA 1X79B 3HTKB 3HTKA 2N1TB 3H32A 2N1TA 4I6MC 5CMZA 3NMDA 3EQ2A 5AW4B 1T8ZA 3OAKA 3C9IA 2XZRA 1T2KD 2NPSB 1T2KC 2NPSA 2OARA 2W6BA 2KP8A 2GUSA 2HODB 5CCGD 5CCGC 2H7HA 2HODA 2Q9IA 5CHXA 4N3YB 3U59A 1WT6A 2XNXA 1AFOA 1N73B 1N73A 1FZCB 5AW7B 5BU8B 3RK3D 1JY2O 1NKZB 3RK3C 3V2NA 5BVZA 3A5TA 1KQLA 2GM4A 2XU6A 4C46A 1LTBC 2A45H 1SVFA 3BRTB 3V2RA 5AW9B 1JUNA 2I1JA 1J2JB 1RF0C 1KILB 2C9NY 1KILA 2YKOA 2HFED 1LWUC 2PP6A 3MGNA 2Q3IA 1ZV8A 3MIWA 4KHXA 3RK2D 4C7NA 2FXMA 1GU5A 3KPEA 3LIDA 1URQD 1URQC 2A45I 2GUVA 4LLHA 5APUA 5AW3B 1S9KD 1L0NK 3TNUB 4I1LA 2R3CA 4I2LC 3TNUA 3M91A 2P2UA 4IFFA 1S9KE 2Z4EA 4ZKPA 1KZUB 1N7SB 2XKMA 4DZOA 3N7NA 1IC2A 3B5NC 5KJ7A 1Z56A 2YO2A 3BRVB 1GTWA 1L4AD 2H8PD 1SLQA 1VPCA 4XE5B 2OYIC 1NTKK 3VTPC 1GL2B 1T3JA 1EQ7A 3CL3D 3VYIA 1GL2A 1IO4A 3CLQA 3MUDA 2JEEA 4AQRD 1JY3O 1MV8A 4GKGA 3U1CA 1VDFA 4AYCA 2HG5D 1LT9B 3KDPB 3WMM0 1LT9A 2R5DA 1ZN5A 1LTGC 4EIJA 5APVA 3RL0C 1NTZK 2WPRA 1NWQA 5CCHC 1NOHA 2VRSA 2HYNA 1MFZA 3EFGA 3I5CA 4OH8B 2N1TD 1GZLA 2N1TC 5APSA 2OYHB 2OYHA 2ZXEB 3NXSA 5AW0B 5APWA 1N7LA 1HGZA 1FJPA 2MJZA 2NPSD 3NFQA 1LTSC 1T3UA 3M0DA 1FZEA 2WWWA 3TYYA 3IFMA 3L36A 2POHA 2E43A 2H43A 1G1IA 4N78D 2J58A 5APTA 2KLVA 3V2QA 4ZKUA 1H8AA 1LGHB 2P67A 4N78E 5CJ4A 1E5WA 1X9VA 1N86A 1SFCB 1FAVA 3IR9A 1J1DB 1JMMA 1HH0A 1IFNA 2YKPA 1FOSE 4WBAA 1JY3P 3HD7B 1GD2E 1XTCC 2CPBA 1KILD 1KILC 5AVVB 2QM7A 1FZCA 5AVYB 4AUWA 2O01H 4WY4B 5AVTB 4WY4A 2WZ7A 1IFMA 5KTBA 3A2AA 3HUSC 3GHGC 1HVVA 1JNMA 1RE4C 2PAJA 1OWAA 3A7OA 4JYCA 2WITA 2C9LY 2W6AA 1MZ9A 4JF7A 5AVSB 1CZQA 3BVHA 4M3LA 3RK2C 1LTJB 1JTHB 4Y99C 1LTJA 5KJ7D 5KJ7C 3P32A 3VMZA 2R32A 2IFMA 2WT7B 1GL2D 3P7KA 2WT7A 3OJAB 1M7LA 1GDTA 2E42A 3HE5B 2O1JA 1N7SA 3HE5A 3M06A 1NKNA 2Q5UA 1GK6A 4IFDK 2WTYA 1FOSF 1NTMK 5APQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYN A;  2KYV A;  1FJK A;  2KB7 P;  1ZLL A;  2M3B A;  1N7L A;  1FJP A; 
#chains in the Genus database with same CATH topology
 1YTZ T;  3IF4 A;  1HBW A;  1R8E A;  5H2F H;  3H1L D;  2YNY A;  2WPS A;  1NTM G;  3L74 E;  2WPQ A;  1PP9 E;  2E76 D;  4HB1 A;  3FGA D;  2KOG A;  4NPF X;  1NTK D;  1MKM A;  1JCD A;  1G2C B;  5KLV D;  3GMA A;  2KZJ A;  1CI6 B;  4K3A A;  2NPS C;  3E7K A;  3B5N A;  1FDO A;  1N8R Q;  1OVU A;  2BCC G;  2OYI B;  1RF1 A;  5KLV G;  4I7Z C;  1SQQ E;  1BE3 E;  4EOT A;  3HRN A;  4UB6 E;  2HLO A;  4WY4 C;  1NTK J;  3P8C E;  3H1H D;  3PHL A;  3B8E B;  4L75 A;  4DCK A;  1SQB K;  3CX5 H;  3L71 D;  2M3B A;  3IN6 A;  1SQV K;  4BWN A;  1S72 P;  3L70 E;  1FDM A;  5E79 H;  1NTZ J;  2N9B A;  2B88 A;  2LXC B;  3CX5 I;  2XND H;  1VQ4 P;  1X0T A;  2E5T A;  1JM0 A;  1SQP K;  1RQV A;  4BRY A;  1NH4 A;  4Z1M H;  2E75 D;  2WSE H;  3WUV A;  4A7P A;  1N7S C;  1L0L E;  3GF7 A;  1EZV D;  1OW7 A;  4DOJ A;  2JJL A;  1ZRT E;  1FDI A;  1IK9 A;  3AE1 C;  1TU3 F;  1U7M A;  1GL2 C;  4RES B;  1GW4 A;  2QJP C;  3V4Q A;  1P84 H;  1JY3 N;  1ZOY C;  1NHL A;  2BEQ D;  3T97 B;  1LT9 C;  2WSS H;  2JP3 A;  4DJG A;  1GU4 A;  1FBM A;  1IFI A;  5KAF E;  2IBZ D;  1LWU A;  1P84 I;  1CW5 A;  3AEG C;  1L0N E;  2P10 A;  1S2E A;  2IBZ G;  2R5B A;  1URQ B;  1RF1 C;  4QMA A;  1LTI C;  1Q7Y Q;  3K5B A;  3OW2 O;  2CPS A;  1FZB A;  3PH0 A;  3G3Z A;  3A0H H;  1L4A A;  3II6 A;  1LP1 B;  2HPC B;  4XA4 A;  5CCH D;  1Y9B A;  3RGU A;  2M5A B;  3H1I D;  3JSV C;  5AVU B;  2FBW C;  2FXP A;  3H1I G;  3HE4 B;  2A45 G;  4ZNC A;  3L72 G;  2C0X A;  3VMY A;  2AXT E;  3M9B A;  3BCC G;  3NMD A;  5AW4 B;  1T8Z A;  3OAK A;  2NPS B;  3WU2 E;  2BEZ F;  1M8O B;  2KP8 A;  4KJM A;  1L2P A;  2H7H A;  4I7Z B;  4K35 A;  3B71 A;  5KAI H;  1QVF O;  2E75 C;  1VQ6 P;  3CCU P;  1N73 A;  3RK3 D;  1JY2 O;  3G71 P;  1Q82 Q;  4IL6 H;  2GM4 A;  2ITA A;  3L75 D;  5AW9 B;  1Q86 Q;  1NU1 J;  4PD4 H;  2YKO A;  1Y47 A;  1LWU C;  2PP6 A;  3Q1M A;  2Y0E A;  3QWO C;  2GUV A;  4ASV A;  2W83 C;  2K9J B;  3PRJ A;  1S9K D;  1KTM A;  4PD4 I;  3TNU B;  4I2L C;  3M91 A;  4L73 A;  4YTP C;  2J5U A;  1N7S B;  3L75 J;  1RQU A;  5KJ7 A;  2YO2 A;  1SLQ A;  1FS0 E;  1GL2 B;  1S5L X;  3L74 D;  3CL3 D;  1IO4 A;  3H1K D;  2QJP B;  1VDF A;  2HG5 D;  1LT9 B;  3WMM 0;  2WSF J;  4UB8 E;  2R44 A;  2FYU J;  2WPR A;  1NWQ A;  5CCH C;  2VRS A;  2IYO A;  2KZI A;  1EZV I;  2OGU A;  3TGU E;  1VF5 C;  2OYH A;  1BDC A;  2ZXE B;  5APW A;  2BCC E;  1N7L A;  1HGZ A;  2MJZ A;  3L74 J;  1PP9 J;  1T3U A;  1FZE A;  3TYY A;  2AEM A;  3IFM A;  2Y0D A;  3AED C;  3WUU A;  2E43 A;  2H43 A;  4N78 D;  2KLV A;  3V2Q A;  4ZKU A;  1LGH B;  2P67 A;  4D6T G;  1SQX D;  1JMM A;  3FX0 A;  1FOS E;  2ZT9 D;  5DJT B;  1K05 A;  2IYP A;  1SQB E;  1BCC E;  5AVV B;  1SQQ J;  4AUW A;  1SQV E;  1KIL E;  1VQM P;  1D7M A;  1BE3 J;  1OVV A;  2YIU C;  3GHG C;  1JNM A;  2Q6Q A;  1IFP A;  2WIT A;  2W6A A;  1SQP E;  1L0L D;  3BVH A;  1ZRT D;  1LTJ A;  3L70 J;  5KJ7 C;  1YQ3 C;  3VMA A;  2E75 B;  2O1J A;  3HE5 A;  2Q5U A;  2FXO A;  4EDF A;  3CPW O;  2KYV A;  1L0L J;  1M1J C;  1BGY D;  2FKW B;  1LWU B;  1JMB A;  3D70 A;  3AEF C;  1KB9 E;  1LTA C;  2XDJ A;  1EDJ A;  3JC2 2;  5AVR B;  3M9H A;  2FFD C;  4IOI H;  3VP9 A;  1IJD B;  4RKU J;  1JB0 J;  1M57 D;  1NYH A;  1UII A;  3I55 P;  2K1A A;  2P7J A;  4U3F E;  1L0N J;  2WSF H;  1QX8 A;  1YYC A;  1OXZ A;  1J1E B;  5CBN A;  2JDI H;  3A0B E;  3A3Y B;  2PFX A;  3CWB G;  4WY4 D;  3TSI A;  1AV1 A;  2KB7 P;  1P84 D;  1WMK A;  4JYB A;  3AE7 C;  2ZT9 C;  3D6Y A;  4R4L A;  3CCQ P;  2LKM A;  2QM8 A;  3CME P;  4JQ0 D;  2YO3 A;  4HKZ H;  1LTJ C;  1EDK A;  3QH9 A;  3IAO A;  4IFM A;  2YKQ A;  2RH0 A;  3CCM P;  1OMI A;  1N7S D;  5M1B A;  3KQG A;  4UB6 H;  3N4X A;  4HYT B;  1QGK B;  1BSN A;  1OIP A;  1QL2 A;  2BAS A;  2PRR A;  3RK3 B;  2KUB A;  1HUC A;  2G8Y A;  2YIU B;  4GOE A;  1M56 D;  4W7Z A;  3BAS A;  3GHG B;  3HUS A;  1RE4 A;  2QE7 H;  3AE9 C;  2KSJ A;  3AEE C;  3JCU E;  3H1L G;  3B5N D;  5AW5 B;  1OW8 A;  1RY3 A;  4RO0 A;  1NO4 A;  2KSE A;  3AE2 C;  4H44 D;  1X22 A;  3S4R A;  3D6Z A;  1USD A;  3OA7 A;  5KLV K;  3AEA C;  1QL1 A;  5TIS E;  2IFN A;  3L35 A;  1FU1 A;  1NTK G;  3V2P A;  1HTL C;  3V5B A;  3RL0 D;  1J1D C;  1M1J B;  5AVW B;  3TF5 A;  1NTZ D;  1XTG B;  2K3R A;  1HWT C;  4YXD C;  1NTM J;  3VOP A;  1NTZ G;  1FZF A;  2C0W A;  4PD4 D;  5KAF H;  2QIW A;  2Z5I A;  2FFD B;  3SWF A;  2P1J A;  3HTK A;  4OGQ D;  3H32 A;  4DT0 A;  2N1T A;  3H1H G;  4D6T E;  5CMZ A;  3L71 G;  1KQG B;  4YXW H;  2O01 J;  2XZR A;  2QA4 P;  3TGU J;  1PGJ A;  5K5G B;  2BCC J;  2HOD A;  1K04 A;  3TDK A;  5CHX A;  2IZ0 A;  1S4X A;  1LNQ A;  3L73 E;  1Q90 D;  3MZW B;  4U7J A;  5AW7 B;  5BU8 B;  5C39 A;  3V2N A;  5BVZ A;  2XU6 A;  1YQ4 C;  4NPE A;  1YIT P;  2ZT9 B;  4JPZ B;  1EZV G;  3BRT B;  3C1L A;  1J2J B;  3AE8 C;  2AXT H;  2C9N Y;  1KIL A;  3MGN A;  2Q3I A;  3RK2 D;  1SQB J;  3KPE A;  2A06 D;  1BCC J;  1YJN P;  1SQV J;  5AW3 B;  3WU2 H;  4ASW A;  3LW5 J;  2R3C A;  2P2U A;  4ZKP A;  1KZU B;  2XKM A;  3KHU A;  2DW3 A;  3N7N A;  1W2B O;  3W68 A;  3B5N C;  2ZYD A;  1SQP J;  1GTW A;  2IZ1 A;  1YIJ P;  1L4A D;  2H8P D;  3PLN A;  2B87 B;  5TJH A;  2Y9Y A;  1H0T A;  4H44 C;  3MUD A;  2JKV A;  1JY3 O;  1MV8 A;  3FWN A;  2QG4 A;  3U1C A;  4BXL A;  1ZN5 A;  2QJY C;  3RL0 C;  3Q5P A;  2HYN A;  1PPJ E;  2N1T C;  1VF5 D;  3NFQ A;  4U3F D;  3F89 A;  3M0D A;  2KS1 B;  3S1K A;  3L36 A;  4OGQ C;  5CBO A;  3RBZ A;  1H8A A;  3CWB E;  5CJ4 A;  1R5L A;  1X9V A;  3IR9 A;  1NU1 D;  2QVA A;  1J1D B;  2KIK A;  1JY3 P;  2B89 A;  1IZN B;  4U3F J;  4PJ0 E;  4UB8 H;  3E1R A;  2CPB A;  1KIL C;  2QM7 A;  5AVY B;  2O01 H;  3USS A;  4WY4 B;  2WZ7 A;  1GMJ A;  2V7Q J;  3H1J E;  1HVV A;  1EXJ A;  2ZVO B;  3CXH E;  1NAY A;  2PAJ A;  1OWA A;  2OTJ P;  1NGM B;  2SPZ A;  3L75 G;  3RK2 C;  4Y99 C;  1R5S A;  5KJ7 D;  1S5L E;  2IFM A;  3ZDM A;  1AVO A;  2WT7 B;  2JR8 A;  4CPG A;  4WWI A;  2OTL P;  1M7L A;  2E42 A;  2FYU D;  4IFD K;  3CCJ P;  5GTH E;  3R2P A;  1U57 A;  1KV4 A;  3AE3 C;  1L4A C;  1AJY A;  1NTM E;  1RE3 A;  1PP9 D;  3LW5 H;  1JY2 P;  3FXD A;  1IK7 A;  3CCE P;  4LC1 A;  3L74 G;  1SS1 A;  2W27 A;  3H1K G;  2K88 A;  1FZA A;  3M0D C;  2WVR A;  5KKZ C;  1H89 A;  1DD3 A;  1YBK A;  5AW1 B;  3Q2Y A;  1SP4 A;  4W7Y A;  1YHQ P;  1G2C A;  3PP5 A;  1W2E A;  3B5N B;  1X8Y A;  1FJK A;  5KLV E;  2O3J A;  1RF1 B;  5APY A;  1SQQ D;  1IFJ A;  3U1A A;  4H44 B;  3M9Q A;  4GOF A;  1BE3 D;  5GTI E;  1SQX K;  1ZR4 A;  1N73 C;  1FE6 A;  3P8C D;  1CSB A;  3AE5 C;  1DEB A;  1OZH A;  3RL0 B;  1VL2 A;  1PZQ A;  3H1H E;  1SQX G;  3L71 E;  3H32 B;  1JOC A;  4H0L C;  1KB9 H;  3L70 D;  3HD7 A;  3O8Z A;  3B4S A;  2L5G B;  2PGD A;  3VN0 A;  2V4H A;  4BRY B;  1PL5 A;  3L73 D;  4OGQ B;  2LR2 A;  2M8R A;  3KYQ A;  1L0L K;  1LJ2 A;  1ZR2 A;  1KQF B;  2YMY A;  1WRG A;  4D6T J;  1L0L G;  4GDO A;  5B5E E;  5CCG A;  4TT3 H;  1K9M Q;  2V7Q H;  3A0B H;  2Z5H A;  1DEE G;  4KT0 J;  3UIA A;  4LGD E;  1RE3 C;  1A02 J;  2N9Y B;  3BAT A;  3L73 J;  1VQN P;  1AA0 A;  2ZVN B;  3T97 A;  3WUT A;  3CCR P;  1JCC A;  1UIX A;  5KLI C;  2KXP B;  4HH2 A;  3MD0 A;  1RF0 A;  4WB4 A;  1L0N D;  2OYH C;  2IBZ E;  4L74 A;  3RK2 B;  4Y99 B;  1HJB A;  3VMX A;  1A02 F;  2J59 M;  1BGY G;  1URQ A;  2IPP A;  2XV5 A;  1GK4 A;  3MP7 B;  2ZXX A;  1KC8 Q;  3KZI E;  2ZYG A;  4GIF A;  1GW3 A;  2IX7 C;  1ZLL A;  5APX A;  1L4A B;  2Q7C A;  1LP1 A;  2HPC A;  1YJW P;  1PPJ D;  2M5A A;  2K37 A;  3MTU E;  1DX7 A;  3HD7 C;  5AVQ B;  3V6I A;  3H1I E;  3G4S P;  1KOR A;  3L72 E;  1ZXG A;  3ITK A;  2M3E A;  3HE4 A;  1EDI A;  3CC2 P;  2UWJ E;  1PFI A;  1KN7 A;  3BCC E;  3JCU H;  1AVY A;  1U7J A;  5KKZ B;  4I6M C;  1VF5 B;  1RH5 B;  3EQ2 A;  3C9I A;  2AXC A;  2QEX P;  1T2K C;  2NPS A;  1M90 Q;  2W6B A;  4OVN F;  4YPC A;  5CCG C;  5TIS H;  2W6J H;  1WT6 A;  1AFO A;  1N73 B;  2K9Y A;  1LT1 A;  2WQY C;  1JEK A;  3RK3 E;  1KQL A;  3CWB J;  3H1J D;  1EC5 A;  1LTB C;  5B66 E;  2P58 A;  1JUN A;  1RF0 C;  3AE6 C;  2HFE D;  4KHX A;  4C7N A;  2FXM A;  1GU5 A;  3LID A;  1NJI Q;  1URQ C;  3AE4 C;  2NZ2 A;  2K9J A;  2QSI A;  2CK3 H;  4I1L A;  3TNU A;  1S9K E;  2I8D A;  1KYO E;  3H1J J;  1Z56 A;  3BRV B;  1NTM D;  1VPC A;  2MKV A;  4ZMD A;  1NTK K;  3VTP C;  1T3J A;  1EQ7 A;  2QJK C;  1GL2 A;  2ZAE B;  3H1K E;  2D2C C;  2YMK A;  1LT9 A;  4EIJ A;  1DD4 A;  2O01 N;  1VQ8 P;  1NTZ K;  5KLI B;  3TGU D;  1MFZ A;  1OFC X;  3EFG A;  1Q81 Q;  5EFW B;  3CC4 P;  1OW6 A;  4OH8 B;  2N1T D;  2BCC D;  5APS A;  3H25 A;  2OYH B;  5AW0 B;  3TGU G;  1FJP A;  3H1L J;  1LTS C;  2E74 D;  2WWW A;  1Y8A A;  1G1I A;  3EFF K;  2ZJS E;  2KNC A;  4N78 E;  1N86 A;  1FAV A;  1SQX E;  1HH0 A;  1IFN A;  2YKP A;  2Y0C A;  5KLV J;  1SQB D;  3HD7 B;  1BCC D;  3GG2 A;  1XTC C;  1SQV D;  1KIL D;  1FZC A;  1SQB G;  1K73 Q;  5AVT B;  2JO1 A;  1BCC G;  5H2F E;  1IFM A;  3PTZ A;  1SQV G;  2RKL A;  5KTB A;  3A2A A;  3AEB C;  3HUS C;  1PGO A;  2WSC J;  1RE4 C;  3SWK A;  3CCL P;  1SQP D;  2W8Z A;  2KLU A;  3R4Y A;  2WPV B;  4JYC A;  3H1H J;  1YI2 P;  1MZ9 A;  3L71 J;  1CZQ A;  1VQK P;  1ZP0 C;  1SQP G;  1LTJ B;  3P32 A;  3VMZ A;  2A06 G;  1EXI A;  3OJA B;  1GDT A;  3HE5 B;  3M06 A;  1NKN A;  1GK6 A;  2WTY A;  1FOS F;  4PJ0 H;  1MFT A;  4O9B A;  2Y9Z A;  1RHZ B;  4XFJ A;  3V4W A;  1AQT A;  3ABV C;  1VQP P;  1ZME C;  3CX5 E;  1BGY E;  4C7R A;  2E76 C;  2FYN C;  1KB9 D;  3CXH H;  4PV1 D;  1JO5 A;  3EWK A;  1IFD A;  3CD6 P;  3NTN A;  1T6A A;  5E79 E;  2G3A A;  1PV3 A;  2O1K A;  2I1K A;  3E1I A;  1S5L H;  5AW8 B;  3CXH I;  2H89 C;  1SFC D;  1PGQ A;  2QRX A;  1G1J A;  3M0A A;  1LTT C;  2E74 C;  3GW6 A;  2QJK B;  4U3F G;  2ZFC A;  5GTH H;  3L72 D;  3GLM A;  2D2C B;  1VQ7 P;  1FZC C;  1NU1 K;  3CCS P;  1SFC A;  3LIE A;  3O6Q A;  1JY2 N;  3BCC D;  5CCH A;  3C8V A;  1P84 E;  1OX3 A;  1NU1 G;  4H0L D;  5L8R J;  5AW2 B;  3H6P A;  3H1I J;  3L72 J;  4H13 D;  1KFM A;  5BU5 A;  1DH3 A;  4NPD A;  1N2D C;  1MUU A;  2M0B A;  3SWY A;  4W80 A;  3BCC J;  1YTZ I;  1JTH A;  1QLE D;  1FZG A;  4N6J A;  1HGV A;  5GTI H;  1KFN A;  1QVG O;  3CI9 A;  3KXD A;  4GOD A;  3SFE C;  2FYU K;  2WSC H;  4B86 A;  3MUD C;  3A0H E;  5AVX B;  2YXQ B;  1H88 A;  4C7N B;  3SFD C;  1NAF A;  2FYU G;  3HUS B;  3GHG A;  2JWA A;  1KYO D;  3Q5R A;  4R4M A;  3H1L E;  1FC2 C;  4PV1 C;  1PP9 G;  3P8M C;  3TK1 A;  5AW6 B;  2OYO A;  3G9R A;  2FYZ A;  1W5C E;  2W90 A;  5CJ0 A;  5B5E H;  1J1E C;  1VQO P;  1NTK E;  2AEJ A;  1YJ9 P;  4L76 A;  3Q5S A;  2HR3 A;  1CI6 A;  1SFC C;  5KAI E;  2RN0 A;  1SQQ K;  3F5H A;  3L37 A;  2OYI A;  1M1J A;  2AEF A;  5AVZ B;  1HF9 A;  4IL6 E;  3HD7 D;  1NTZ E;  5DJU B;  1SQQ G;  2E76 B;  2FYN B;  2KI7 B;  4GT1 A;  1BE3 G;  3L4F A;  2QJY B;  1HJ0 A;  3H1K J;  4PD4 E;  3VP8 A;  2E5Y A;  2FFD A;  3CC7 P;  1AQ5 A;  1X79 B;  2H88 C;  3HTK B;  4D6T D;  1VQ5 P;  1Q2N A;  2N1T B;  2Q1K A;  2KNC B;  3D71 A;  4IL6 X;  1KMI Z;  1T2K D;  2OAR A;  1S3J A;  2RMZ A;  3L70 G;  3KZI H;  2E74 B;  1OVR A;  2IBZ I;  2GUS A;  2HOD B;  5CCG D;  4H13 C;  2Q9I A;  2IDB A;  1KB9 I;  2Q3E A;  4N3Y B;  3SSU A;  3S9O A;  3U59 A;  1USE A;  2NRG A;  2XNX A;  1FZC B;  3L73 G;  1NVO A;  1NKZ B;  3RK3 C;  2WMM A;  3A5T A;  1EZV E;  4C46 A;  2A45 H;  1SVF A;  3FXE A;  3V2R A;  1SQX J;  4RJT A;  2I1J A;  1KIL B;  1ZV8 A;  3MIW A;  1BSH A;  1URQ D;  2A45 I;  4LLH A;  2A06 E;  5APU A;  4WVZ A;  1M1K Q;  1L0N K;  3CMA P;  2B9B A;  4IFF A;  3I56 P;  2Z4E A;  4DZO A;  1IC2 A;  3AEC C;  1PIX A;  1L0N G;  2JWD A;  4XE5 B;  2OYI C;  2B87 A;  2FY8 A;  1H0T B;  3VYI A;  4HJG H;  4JBZ A;  3CLQ A;  2JEE A;  3CX5 D;  4AQR D;  3PJS K;  5B66 H;  1ZW0 A;  4GKG A;  2D2C D;  4EI2 A;  4AYC A;  3KDP B;  2R5D A;  1LTG C;  4EYY Q;  5APV A;  1NOH A;  3I5C A;  2YXR B;  1GZL A;  4TLF A;  3G6E P;  3NXS A;  1PPJ G;  4PV1 B;  2NPS D;  1BGY J;  1KYO H;  1S1C X;  1K8A Q;  2KS1 A;  2R3S A;  3Q3D A;  2POH A;  3W67 A;  2J58 A;  3CWB D;  5APT A;  3MHV A;  3FWL A;  1E5W A;  3CCV P;  1SFC B;  3RBX A;  1VQ9 P;  1KYO I;  1E79 H;  3O6Q B;  1NU1 E;  1KD1 Q;  1EDL A;  4WBA A;  2WSE J;  1GD2 E;  2LXB A;  4WY4 A;  3RL0 g;  3CXH D;  4Y28 J;  4H0L B;  3A7O A;  3L75 E;  3H1J G;  2C9L Y;  4JF7 A;  5AVS B;  1KQS O;  3GF3 A;  4M3L A;  1JTH B;  2OTK E;  1BDD A;  1VQL P;  4H13 B;  1QEX A;  1DIP A;  2R32 A;  1GL2 D;  3P7K A;  2WT7 A;  2KK7 A;  4MN4 C;  1N7S A;  2OQQ A;  4OWF A;  2FYU E;  2L91 A;  2ZYA A;  1NTM K;  1PGP A;  2GA1 A;  5APQ A; 
#chains in the Genus database with same CATH homology
 4O9B A;  3R2P A;  2KYV A;  1YTZ T;  1L4A C;  1HBW A;  3V4W A;  1M1J C;  1RE3 A;  2YNY A;  2WPS A;  3LW5 H;  2FKW B;  1JY2 P;  1LWU B;  2WPQ A;  4C7R A;  4LC1 A;  1JO5 A;  2W27 A;  1IFD A;  1LTA C;  2XDJ A;  1FZA A;  3NTN A;  3M0D C;  5AVR B;  3M9H A;  2FFD C;  3VP9 A;  2KOG A;  2O1K A;  2I1K A;  1H89 A;  1IJD B;  3E1I A;  5AW1 B;  1SP4 A;  1JCD A;  5AW8 B;  4W7Y A;  1G2C B;  1G2C A;  3PP5 A;  1CI6 B;  1W2E A;  3B5N B;  2NPS C;  1SFC D;  1X8Y A;  1FJK A;  3B5N A;  1G1J A;  3M0A A;  2P7J A;  1LTT C;  1RF1 B;  2OYI B;  2WSF H;  1RF1 A;  5APY A;  1IFJ A;  3U1A A;  2ZFC A;  1YYC A;  3M9Q A;  1OXZ A;  1J1E B;  1SQX K;  1ZR4 A;  1N73 C;  1FZC C;  1NU1 K;  4EOT A;  3HRN A;  3P8C D;  1SFC A;  3LIE A;  3A3Y B;  1CSB A;  4WY4 D;  1DEB A;  2HLO A;  4WY4 C;  3TSI A;  3P8C E;  3RL0 B;  1JY2 N;  3B8E B;  2KB7 P;  1SQB K;  2M3B A;  5CCH A;  4JYB A;  3H32 B;  1JOC A;  1SQV K;  2LKM A;  3HD7 A;  2QM8 A;  1FDM A;  3O8Z A;  5AW2 B;  2L5G B;  2N9B A;  2YO3 A;  3VN0 A;  1LTJ C;  3H6P A;  1KFM A;  1SQP K;  4IFM A;  2YKQ A;  2M8R A;  1NH4 A;  5BU5 A;  3KYQ A;  1DH3 A;  1L0L K;  1ZR2 A;  1N2D C;  1MUU A;  2WSE H;  3SWY A;  4W80 A;  2YMY A;  1WRG A;  1N7S D;  1N7S C;  1YTZ I;  1JTH A;  4DOJ A;  1FZG A;  2JJL A;  4N6J A;  1HGV A;  3KQG A;  1IK9 A;  1KFN A;  5CCG A;  3CI9 A;  2Z5H A;  3N4X A;  3UIA A;  2FYU K;  2WSC H;  1RE3 C;  1GL2 C;  4LGD E;  4B86 A;  4HYT B;  1A02 J;  4RES B;  1GW4 A;  5AVX B;  1QL2 A;  2BAS A;  3RK3 B;  3BAT A;  1H88 A;  3V4Q A;  1JY3 N;  4C7N B;  1NHL A;  1HUC A;  1LT9 C;  1NAF A;  3T97 A;  4W7Z A;  3HUS B;  3BAS A;  3GHG B;  3HUS A;  3GHG A;  1GU4 A;  1FBM A;  1JCC A;  1IFI A;  1RE4 A;  4HH2 A;  3MD0 A;  1RF0 A;  4WB4 A;  2KSJ A;  1LWU A;  2OYH C;  1CW5 A;  3RK2 B;  4Y99 B;  1HJB A;  3VMX A;  1A02 F;  3B5N D;  2J59 M;  5AW5 B;  3P8M C;  2R5B A;  1URQ B;  3TK1 A;  1URQ A;  1RY3 A;  2IPP A;  5AW6 B;  2XV5 A;  1RF1 C;  1NO4 A;  1GK4 A;  1LTI C;  2FYZ A;  3OA7 A;  5KLV K;  5CJ0 A;  1QL1 A;  1J1E C;  4GIF A;  1GW3 A;  2IFN A;  2IX7 C;  2CPS A;  3L35 A;  1FU1 A;  1ZLL A;  1CI6 A;  1FZB A;  1SFC C;  3V2P A;  3G3Z A;  1HTL C;  1SQQ K;  5APX A;  3V5B A;  1L4A B;  3RL0 D;  1L4A A;  1J1D C;  3L37 A;  2OYI A;  3II6 A;  1M1J B;  2HPC B;  2Q7C A;  1M1J A;  4XA4 A;  5CCH D;  2HPC A;  5AVW B;  1XTG B;  5AVZ B;  3MTU E;  1DX7 A;  5AVU B;  3HD7 D;  1HWT C;  3HD7 C;  5AVQ B;  3VOP A;  1FZF A;  3HE4 B;  4GT1 A;  2C0W A;  3HE4 A;  2A45 G;  3L4F A;  3VMY A;  2C0X A;  2Z5I A;  3VP8 A;  2FFD B;  3SWF A;  2P1J A;  3M9B A;  2FFD A;  1AQ5 A;  1PFI A;  1X79 B;  3HTK B;  3HTK A;  2N1T B;  3H32 A;  2N1T A;  4I6M C;  5CMZ A;  3NMD A;  3EQ2 A;  5AW4 B;  1T8Z A;  3OAK A;  3C9I A;  2XZR A;  1T2K D;  2NPS B;  1T2K C;  2NPS A;  2OAR A;  2W6B A;  2KP8 A;  2GUS A;  2HOD B;  5CCG D;  5CCG C;  2H7H A;  2HOD A;  2Q9I A;  5CHX A;  4N3Y B;  3U59 A;  1WT6 A;  2XNX A;  1AFO A;  1N73 B;  1N73 A;  1FZC B;  5AW7 B;  5BU8 B;  3RK3 D;  1JY2 O;  1NKZ B;  3RK3 C;  3V2N A;  5BVZ A;  3A5T A;  1KQL A;  2GM4 A;  2XU6 A;  4C46 A;  1LTB C;  2A45 H;  1SVF A;  3BRT B;  3V2R A;  5AW9 B;  1JUN A;  2I1J A;  1J2J B;  1RF0 C;  1KIL B;  2C9N Y;  1KIL A;  2YKO A;  2HFE D;  1LWU C;  2PP6 A;  3MGN A;  2Q3I A;  1ZV8 A;  3MIW A;  4KHX A;  3RK2 D;  4C7N A;  2FXM A;  1GU5 A;  3KPE A;  3LID A;  1URQ D;  1URQ C;  2A45 I;  2GUV A;  4LLH A;  5APU A;  5AW3 B;  1S9K D;  1L0N K;  3TNU B;  4I1L A;  2R3C A;  4I2L C;  3TNU A;  3M91 A;  2P2U A;  4IFF A;  1S9K E;  2Z4E A;  4ZKP A;  1KZU B;  1N7S B;  2XKM A;  4DZO A;  3N7N A;  1IC2 A;  3B5N C;  5KJ7 A;  1Z56 A;  2YO2 A;  3BRV B;  1GTW A;  1L4A D;  2H8P D;  1SLQ A;  1VPC A;  4XE5 B;  2OYI C;  1NTK K;  3VTP C;  1GL2 B;  1T3J A;  1EQ7 A;  3CL3 D;  3VYI A;  1GL2 A;  1IO4 A;  3CLQ A;  3MUD A;  2JEE A;  4AQR D;  1JY3 O;  1MV8 A;  4GKG A;  3U1C A;  1VDF A;  4AYC A;  2HG5 D;  1LT9 B;  3KDP B;  3WMM 0;  1LT9 A;  2R5D A;  1ZN5 A;  1LTG C;  4EIJ A;  5APV A;  3RL0 C;  1NTZ K;  2WPR A;  1NWQ A;  5CCH C;  1NOH A;  2VRS A;  2HYN A;  1MFZ A;  3EFG A;  3I5C A;  4OH8 B;  2N1T D;  1GZL A;  2N1T C;  5APS A;  2OYH B;  2OYH A;  2ZXE B;  3NXS A;  5AW0 B;  5APW A;  1N7L A;  1HGZ A;  1FJP A;  2MJZ A;  2NPS D;  3NFQ A;  1LTS C;  1T3U A;  3M0D A;  1FZE A;  2WWW A;  3TYY A;  3IFM A;  3L36 A;  2POH A;  2E43 A;  2H43 A;  1G1I A;  4N78 D;  2J58 A;  5APT A;  2KLV A;  3V2Q A;  4ZKU A;  1H8A A;  1LGH B;  2P67 A;  4N78 E;  5CJ4 A;  1E5W A;  1X9V A;  1N86 A;  1SFC B;  1FAV A;  3IR9 A;  1J1D B;  1JMM A;  1HH0 A;  1IFN A;  2YKP A;  1FOS E;  4WBA A;  1JY3 P;  3HD7 B;  1GD2 E;  1XTC C;  2CPB A;  1KIL D;  1KIL C;  5AVV B;  2QM7 A;  1FZC A;  5AVY B;  4AUW A;  2O01 H;  4WY4 B;  5AVT B;  4WY4 A;  2WZ7 A;  1IFM A;  5KTB A;  3A2A A;  3HUS C;  3GHG C;  1HVV A;  1JNM A;  1RE4 C;  2PAJ A;  1OWA A;  3A7O A;  4JYC A;  2WIT A;  2C9L Y;  2W6A A;  1MZ9 A;  4JF7 A;  5AVS B;  1CZQ A;  3BVH A;  4M3L A;  3RK2 C;  1LTJ B;  1JTH B;  4Y99 C;  1LTJ A;  5KJ7 D;  5KJ7 C;  3P32 A;  3VMZ A;  2R32 A;  2IFM A;  2WT7 B;  1GL2 D;  3P7K A;  2WT7 A;  3OJA B;  1M7L A;  1GDT A;  2E42 A;  3HE5 B;  2O1J A;  1N7S A;  3HE5 A;  3M06 A;  1NKN A;  2Q5U A;  1GK6 A;  4IFD K;  2WTY A;  1FOS F;  1NTM K;  5APQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...