1FJMA

Protein serine/threonine phosphatase-1 (alpha isoform, type 1) complexed with microcystin-lr toxin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN SERINE/THREONINE PHOSPHATASE-1 (ALPHA ISOFORM, TYPE
publication title Three-dimensional structure of the catalytic subunit of protein serine/threonine phosphatase-1.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 105
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1995-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1fjmA00
3EGGA 1MF8A 4FBKA 3P71C 1AUIA 1JK7A 3FGAC 3DSDA 1NNWA 4I5LC 1XZWA 4DSYA 4DT2A 3V4YA 4TUGA 4O24A 2WDFA 2NYMC 1HPUA 5HPEA 1II7A 3E7BA 2HY1A 1HO5A 1S3MA 3K7VC 2WDEA 2IAEC 5EQVA 1XM7A 3TGHA 3AV0A 3IB8A 3IVDA 3DW8C 4V0WA 4HD0A 1S8EA 1U32A 1KBPA 2QJCA 5IOHA 4H2IA 5JPEA 4ORAA 3RL4A 2QFRA 1QHWA 5INBA 1S3NA 4I5NC 1WARA 4NZVA 3ZTVA 4UT3B 3ZU0A 2Z06A 5JJTA 2Z72A 3C9FA 1S95A 2Z1AA 4O5GA 4F0ZA 2IE4C 4MOVA 3CK2A 1Z2XA 4ZX2A 1IT6A 3AUZA 3QFKA 3THOB 4B2OA 3LL8A 1G5BA 1HP1A 3H67A 3H60A 1WAO1 4V0VA 4KBPA 4O4KA 3E7AA 4V0XA 2BDXA 4UT3A 4MP0A 4DHLA 2NYLC 2JOGA 3H68A 2ZBMA 4H2BA 3RQZA 2WDDA 3EGHA 4MOYA 1USHA 1S3LA 5F3WA 2YVTA 1Z2WA 4M0VA 2USHA 4ORCA 2AHDA 2BQ8X 3PSOA 3H61A 2QFPA 2R17A 3H63A 3KBPA 1OI8A 4ORBA 2Q8UA 2O8AA 4Q7FA 3PSNA 2DFJA 1M63A 4JA7A 3H64A 1T71A 3H69A 4H1YP 4FBQA 4H2FA 3T1IA 4FCXA 3RL5A 4FBWA 5C1VA 5B8IA 1T70A 3QFNA 2P6BA 1W24A 4UT2A 3DSCA 3QFOA 3HVQA 2WDCA 4IL1A 4O43A 4ZVZA 3THNA 2GJUA 3QG5C 2NXFA 2O8GA 3GVEA 3H66A 2HYPA 1SU1A 1OIEA 1OIDA 2KKNA 2XMOA 3QFMA 4G9JA 4J6OA 3IB7A 2NPPC 3C5WC 4JA9A 3ICFA 4WWLA 3N5UA 4KKZA 2HYOA 4XPNA 2CV9A 1TCOA 4H1SA 1UTEA 5DNYA 4LACC 2IE3C 4H2GA 4OR9A 1UF3A 5J28A 1QFCA 1S70A 5JPFA 3JYFA 1FJMA 3H62B 4LU9A 4LTYA 5GTUA 4TUIA 3RL3A 3K7WC 4YKEA 2BCDA 4IYPC 1V73A 3IVEA 4UWQA 2A22A
chains in the Genus database with same CATH superfamily
3EGGA 1MF8A 4FBKA 3P71C 1AUIA 1JK7A 3FGAC 3DSDA 1NNWA 4I5LC 1XZWA 4DSYA 4DT2A 3V4YA 4TUGA 4O24A 2WDFA 2NYMC 1HPUA 5HPEA 1II7A 3E7BA 2HY1A 1HO5A 1S3MA 3K7VC 2WDEA 2IAEC 5EQVA 1XM7A 3TGHA 3AV0A 3IB8A 3IVDA 3DW8C 4V0WA 4HD0A 1S8EA 1U32A 1KBPA 2QJCA 5IOHA 4H2IA 5JPEA 4ORAA 3RL4A 2ZO9B 2QFRA 1QHWA 5INBA 1S3NA 4I5NC 1WARA 4NZVA 3ZTVA 4UT3B 3ZU0A 2Z06A 5JJTA 3E0JA 2Z72A 3C9FA 1S95A 2Z1AA 4O5GA 4F0ZA 2IE4C 4MOVA 3CK2A 1Z2XA 4ZX2A 1IT6A 3AUZA 3QFKA 3THOB 4B2OA 3LL8A 1G5BA 1HP1A 3H67A 3H60A 1WAO1 4V0VA 4KBPA 4O4KA 3E7AA 4V0XA 2BDXA 4UT3A 4MP0A 4DHLA 2NYLC 2JOGA 3H68A 2ZBMA 4H2BA 3RQZA 2WDDA 3EGHA 4MOYA 1USHA 1S3LA 5F3WA 2YVTA 1Z2WA 4M0VA 2USHA 4ORCA 2AHDA 2BQ8X 3PSOA 3H61A 2QFPA 2DXLA 2R17A 3H63A 3KBPA 1OI8A 4ORBA 2Q8UA 2O8AA 4Q7FA 3PSNA 3FLOA 2DFJA 1M63A 2YEQA 4JA7A 3H64A 1T71A 3H69A 4H1YP 4FBQA 4H2FA 3T1IA 4FCXA 3RL5A 4FBWA 5C1VA 5B8IA 1T70A 3QFNA 2P6BA 1W24A 4UT2A 3DSCA 3QFOA 3HVQA 2WDCA 4IL1A 4O43A 4ZVZA 3THNA 2DXNA 2GJUA 2NXFA 3QG5C 2O8GA 3GVEA 3H66A 2HYPA 1SU1A 1OIEA 1OIDA 2KKNA 2XMOA 3QFMA 4G9JA 4J6OA 3IB7A 2NPPC 3C5WC 4JA9A 3ICFA 2ZOAA 4WWLA 3N5UA 4KKZA 2HYOA 4XPNA 2CV9A 1TCOA 4H1SA 1UTEA 5DNYA 4LACC 2IE3C 4H2GA 4OR9A 1UF3A 5J28A 1QFCA 1S70A 5JPFA 3D03A 3JYFA 1FJMA 3H62B 4LU9A 4LTYA 5GTUA 4TUIA 3RL3A 3K7WC 4YKEA 2BCDA 4IYPC 1V73A 3IVEA 4UWQA 2A22A
chains in the Genus database with same CATH topology
3EGGA 1MF8A 4FBKA 3P71C 1AUIA 1JK7A 3FGAC 3DSDA 1NNWA 4I5LC 1XZWA 4DSYA 4DT2A 3V4YA 4TUGA 4O24A 2WDFA 2NYMC 1HPUA 5HPEA 1II7A 3E7BA 2HY1A 1HO5A 1S3MA 3K7VC 2WDEA 2IAEC 5EQVA 1XM7A 3TGHA 3AV0A 3IB8A 3IVDA 3DW8C 4V0WA 4HD0A 1S8EA 1U32A 1KBPA 2QJCA 5IOHA 4H2IA 5JPEA 4ORAA 3RL4A 2ZO9B 2QFRA 1QHWA 5INBA 1S3NA 4I5NC 1WARA 4NZVA 3ZTVA 4UT3B 3ZU0A 2Z06A 5JJTA 3E0JA 2Z72A 3C9FA 1S95A 2Z1AA 4O5GA 4F0ZA 2IE4C 4MOVA 3CK2A 1Z2XA 4ZX2A 1IT6A 3AUZA 3QFKA 3THOB 4B2OA 3LL8A 1G5BA 1HP1A 3H67A 3H60A 1WAO1 4V0VA 4KBPA 4O4KA 3E7AA 4V0XA 2BDXA 4UT3A 4MP0A 4DHLA 2NYLC 2JOGA 3H68A 2ZBMA 4H2BA 3RQZA 2WDDA 3EGHA 4MOYA 1USHA 1S3LA 5F3WA 2YVTA 1Z2WA 4M0VA 2USHA 4ORCA 2AHDA 2BQ8X 3PSOA 3H61A 2QFPA 2DXLA 2R17A 3H63A 3KBPA 1OI8A 4ORBA 2Q8UA 2O8AA 4Q7FA 3PSNA 3FLOA 2DFJA 1M63A 2YEQA 4JA7A 3H64A 1T71A 3H69A 4H1YP 4FBQA 4H2FA 3T1IA 4FCXA 3RL5A 4FBWA 5C1VA 5B8IA 1T70A 3QFNA 2P6BA 1W24A 4UT2A 3DSCA 3QFOA 3HVQA 2WDCA 4IL1A 4O43A 4ZVZA 3THNA 2DXNA 2GJUA 2NXFA 3QG5C 2O8GA 3GVEA 3H66A 2HYPA 1SU1A 1OIEA 1OIDA 2KKNA 2XMOA 3QFMA 4G9JA 4J6OA 3IB7A 2NPPC 3C5WC 4JA9A 3ICFA 2ZOAA 4WWLA 3N5UA 4KKZA 2HYOA 4XPNA 2CV9A 1TCOA 4H1SA 1UTEA 5DNYA 4LACC 2IE3C 4H2GA 4OR9A 1UF3A 5J28A 1QFCA 1S70A 5JPFA 3D03A 3JYFA 1FJMA 3H62B 4LU9A 4LTYA 5GTUA 4TUIA 3RL3A 3K7WC 4YKEA 2BCDA 4IYPC 1V73A 3IVEA 4UWQA 2A22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGG A;  1MF8 A;  4FBK A;  3P71 C;  1AUI A;  1JK7 A;  3FGA C;  3DSD A;  1NNW A;  4I5L C;  1XZW A;  4DSY A;  4DT2 A;  3V4Y A;  4TUG A;  4O24 A;  2WDF A;  2NYM C;  1HPU A;  5HPE A;  1II7 A;  3E7B A;  2HY1 A;  1HO5 A;  1S3M A;  3K7V C;  2WDE A;  2IAE C;  5EQV A;  1XM7 A;  3TGH A;  3AV0 A;  3IB8 A;  3IVD A;  3DW8 C;  4V0W A;  4HD0 A;  1S8E A;  1U32 A;  1KBP A;  2QJC A;  5IOH A;  4H2I A;  5JPE A;  4ORA A;  3RL4 A;  2QFR A;  1QHW A;  5INB A;  1S3N A;  4I5N C;  1WAR A;  4NZV A;  3ZTV A;  4UT3 B;  3ZU0 A;  2Z06 A;  5JJT A;  2Z72 A;  3C9F A;  1S95 A;  2Z1A A;  4O5G A;  4F0Z A;  2IE4 C;  4MOV A;  3CK2 A;  1Z2X A;  4ZX2 A;  1IT6 A;  3AUZ A;  3QFK A;  3THO B;  4B2O A;  3LL8 A;  1G5B A;  1HP1 A;  3H67 A;  3H60 A;  1WAO 1;  4V0V A;  4KBP A;  4O4K A;  3E7A A;  4V0X A;  2BDX A;  4UT3 A;  4MP0 A;  4DHL A;  2NYL C;  2JOG A;  3H68 A;  2ZBM A;  4H2B A;  3RQZ A;  2WDD A;  3EGH A;  4MOY A;  1USH A;  1S3L A;  5F3W A;  2YVT A;  1Z2W A;  4M0V A;  2USH A;  4ORC A;  2AHD A;  2BQ8 X;  3PSO A;  3H61 A;  2QFP A;  2R17 A;  3H63 A;  3KBP A;  1OI8 A;  4ORB A;  2Q8U A;  2O8A A;  4Q7F A;  3PSN A;  2DFJ A;  1M63 A;  4JA7 A;  3H64 A;  1T71 A;  3H69 A;  4H1Y P;  4FBQ A;  4H2F A;  3T1I A;  4FCX A;  3RL5 A;  4FBW A;  5C1V A;  5B8I A;  1T70 A;  3QFN A;  2P6B A;  1W24 A;  4UT2 A;  3DSC A;  3QFO A;  3HVQ A;  2WDC A;  4IL1 A;  4O43 A;  4ZVZ A;  3THN A;  2GJU A;  3QG5 C;  2NXF A;  2O8G A;  3GVE A;  3H66 A;  2HYP A;  1SU1 A;  1OIE A;  1OID A;  2KKN A;  2XMO A;  3QFM A;  4G9J A;  4J6O A;  3IB7 A;  2NPP C;  3C5W C;  4JA9 A;  3ICF A;  4WWL A;  3N5U A;  4KKZ A;  2HYO A;  4XPN A;  2CV9 A;  1TCO A;  4H1S A;  1UTE A;  5DNY A;  4LAC C;  2IE3 C;  4H2G A;  4OR9 A;  1UF3 A;  5J28 A;  1QFC A;  1S70 A;  5JPF A;  3JYF A;  1FJM A;  3H62 B;  4LU9 A;  4LTY A;  5GTU A;  4TUI A;  3RL3 A;  3K7W C;  4YKE A;  2BCD A;  4IYP C;  1V73 A;  3IVE A;  4UWQ A;  2A22 A; 
#chains in the Genus database with same CATH topology
 3EGG A;  1MF8 A;  4FBK A;  3P71 C;  1AUI A;  1JK7 A;  3FGA C;  3DSD A;  1NNW A;  4I5L C;  1XZW A;  4DSY A;  4DT2 A;  3V4Y A;  4TUG A;  4O24 A;  2WDF A;  2NYM C;  1HPU A;  5HPE A;  1II7 A;  3E7B A;  2HY1 A;  1HO5 A;  1S3M A;  3K7V C;  2WDE A;  2IAE C;  5EQV A;  1XM7 A;  3TGH A;  3AV0 A;  3IB8 A;  3IVD A;  3DW8 C;  4V0W A;  4HD0 A;  1S8E A;  1U32 A;  1KBP A;  2QJC A;  5IOH A;  4H2I A;  5JPE A;  4ORA A;  3RL4 A;  2ZO9 B;  2QFR A;  1QHW A;  5INB A;  1S3N A;  4I5N C;  1WAR A;  4NZV A;  3ZTV A;  4UT3 B;  3ZU0 A;  2Z06 A;  5JJT A;  3E0J A;  2Z72 A;  3C9F A;  1S95 A;  2Z1A A;  4O5G A;  4F0Z A;  2IE4 C;  4MOV A;  3CK2 A;  1Z2X A;  4ZX2 A;  1IT6 A;  3AUZ A;  3QFK A;  3THO B;  4B2O A;  3LL8 A;  1G5B A;  1HP1 A;  3H67 A;  3H60 A;  1WAO 1;  4V0V A;  4KBP A;  4O4K A;  3E7A A;  4V0X A;  2BDX A;  4UT3 A;  4MP0 A;  4DHL A;  2NYL C;  2JOG A;  3H68 A;  2ZBM A;  4H2B A;  3RQZ A;  2WDD A;  3EGH A;  4MOY A;  1USH A;  1S3L A;  5F3W A;  2YVT A;  1Z2W A;  4M0V A;  2USH A;  4ORC A;  2AHD A;  2BQ8 X;  3PSO A;  3H61 A;  2QFP A;  2DXL A;  2R17 A;  3H63 A;  3KBP A;  1OI8 A;  4ORB A;  2Q8U A;  2O8A A;  4Q7F A;  3PSN A;  3FLO A;  2DFJ A;  1M63 A;  2YEQ A;  4JA7 A;  3H64 A;  1T71 A;  3H69 A;  4H1Y P;  4FBQ A;  4H2F A;  3T1I A;  4FCX A;  3RL5 A;  4FBW A;  5C1V A;  5B8I A;  1T70 A;  3QFN A;  2P6B A;  1W24 A;  4UT2 A;  3DSC A;  3QFO A;  3HVQ A;  2WDC A;  4IL1 A;  4O43 A;  4ZVZ A;  3THN A;  2DXN A;  2GJU A;  2NXF A;  3QG5 C;  2O8G A;  3GVE A;  3H66 A;  2HYP A;  1SU1 A;  1OIE A;  1OID A;  2KKN A;  2XMO A;  3QFM A;  4G9J A;  4J6O A;  3IB7 A;  2NPP C;  3C5W C;  4JA9 A;  3ICF A;  2ZOA A;  4WWL A;  3N5U A;  4KKZ A;  2HYO A;  4XPN A;  2CV9 A;  1TCO A;  4H1S A;  1UTE A;  5DNY A;  4LAC C;  2IE3 C;  4H2G A;  4OR9 A;  1UF3 A;  5J28 A;  1QFC A;  1S70 A;  5JPF A;  3D03 A;  3JYF A;  1FJM A;  3H62 B;  4LU9 A;  4LTY A;  5GTU A;  4TUI A;  3RL3 A;  3K7W C;  4YKE A;  2BCD A;  4IYP C;  1V73 A;  3IVE A;  4UWQ A;  2A22 A; 
#chains in the Genus database with same CATH homology
 3EGG A;  1MF8 A;  4FBK A;  3P71 C;  1AUI A;  1JK7 A;  3FGA C;  3DSD A;  1NNW A;  4I5L C;  1XZW A;  4DSY A;  4DT2 A;  3V4Y A;  4TUG A;  4O24 A;  2WDF A;  2NYM C;  1HPU A;  5HPE A;  1II7 A;  3E7B A;  2HY1 A;  1HO5 A;  1S3M A;  3K7V C;  2WDE A;  2IAE C;  5EQV A;  1XM7 A;  3TGH A;  3AV0 A;  3IB8 A;  3IVD A;  3DW8 C;  4V0W A;  4HD0 A;  1S8E A;  1U32 A;  1KBP A;  2QJC A;  5IOH A;  4H2I A;  5JPE A;  4ORA A;  3RL4 A;  2ZO9 B;  2QFR A;  1QHW A;  5INB A;  1S3N A;  4I5N C;  1WAR A;  4NZV A;  3ZTV A;  4UT3 B;  3ZU0 A;  2Z06 A;  5JJT A;  3E0J A;  2Z72 A;  3C9F A;  1S95 A;  2Z1A A;  4O5G A;  4F0Z A;  2IE4 C;  4MOV A;  3CK2 A;  1Z2X A;  4ZX2 A;  1IT6 A;  3AUZ A;  3QFK A;  3THO B;  4B2O A;  3LL8 A;  1G5B A;  1HP1 A;  3H67 A;  3H60 A;  1WAO 1;  4V0V A;  4KBP A;  4O4K A;  3E7A A;  4V0X A;  2BDX A;  4UT3 A;  4MP0 A;  4DHL A;  2NYL C;  2JOG A;  3H68 A;  2ZBM A;  4H2B A;  3RQZ A;  2WDD A;  3EGH A;  4MOY A;  1USH A;  1S3L A;  5F3W A;  2YVT A;  1Z2W A;  4M0V A;  2USH A;  4ORC A;  2AHD A;  2BQ8 X;  3PSO A;  3H61 A;  2QFP A;  2DXL A;  2R17 A;  3H63 A;  3KBP A;  1OI8 A;  4ORB A;  2Q8U A;  2O8A A;  4Q7F A;  3PSN A;  3FLO A;  2DFJ A;  1M63 A;  2YEQ A;  4JA7 A;  3H64 A;  1T71 A;  3H69 A;  4H1Y P;  4FBQ A;  4H2F A;  3T1I A;  4FCX A;  3RL5 A;  4FBW A;  5C1V A;  5B8I A;  1T70 A;  3QFN A;  2P6B A;  1W24 A;  4UT2 A;  3DSC A;  3QFO A;  3HVQ A;  2WDC A;  4IL1 A;  4O43 A;  4ZVZ A;  3THN A;  2DXN A;  2GJU A;  2NXF A;  3QG5 C;  2O8G A;  3GVE A;  3H66 A;  2HYP A;  1SU1 A;  1OIE A;  1OID A;  2KKN A;  2XMO A;  3QFM A;  4G9J A;  4J6O A;  3IB7 A;  2NPP C;  3C5W C;  4JA9 A;  3ICF A;  2ZOA A;  4WWL A;  3N5U A;  4KKZ A;  2HYO A;  4XPN A;  2CV9 A;  1TCO A;  4H1S A;  1UTE A;  5DNY A;  4LAC C;  2IE3 C;  4H2G A;  4OR9 A;  1UF3 A;  5J28 A;  1QFC A;  1S70 A;  5JPF A;  3D03 A;  3JYF A;  1FJM A;  3H62 B;  4LU9 A;  4LTY A;  5GTU A;  4TUI A;  3RL3 A;  3K7W C;  4YKE A;  2BCD A;  4IYP C;  1V73 A;  3IVE A;  4UWQ A;  2A22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...