1FJMA

Protein serine/threonine phosphatase-1 (alpha isoform, type 1) complexed with microcystin-lr toxin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the catalytic subunit of protein serine/threonine phosphatase-1.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN SERINE/THREONINE PHOSPHATASE-1 (ALPHA ISOFORM, TYPE
total genus 105
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1995-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1fjmA00
1HP1A 4IYPC 2WDFA 3KBPA 3CK2A 3THNA 3IB7A 3EGGA 3H69A 2YVTA 4B2OA 1WAO1 5J28A 2Z06A 1HPUA 1JK7A 2GJUA 1USHA 4V0WA 4TUIA 5INBA 4V0VA 4LACC 4ORBA 1M63A 3ICFA 3V4YA 1OIDA 4UT2A 2NYLC 1NNWA 1T71A 1S3MA 3ZTVA 3H63A 4H2GA 3ZU0A 2P6BA 5C1VA 2O8AA 5JJTA 2NPPC 1UF3A 4ZVZA 1U32A 2DFJA 4NZVA 4O24A 4KBPA 1Z2XA 2Z72A 4G9JA 2CV9A 4H1SA 5EQVA 5GTUA 1XM7A 2Z1AA 3C5WC 4HD0A 2QFRA 4UT3B 4H2IA 2BDXA 2WDEA 4H1YP 2IE4C 3H68A 4MOVA 3N5UA 4ZX2A 1V73A 3RL5A 1UTEA 2HYOA 1IT6A 1S95A 3H66A 2HYPA 1FJMA 1TCOA 2ZBMA 3K7WC 1QHWA 4XPNA 1QFCA 4WWLA 3H64A 4UT3A 2BQ8X 2IE3C 4I5NC 5JPEA 1W24A 1Z2WA 4FBQA 2XMOA 4DT2A 1XZWA 1G5BA 2QFPA 2WDCA 3RQZA 4YKEA 2Q8UA 1S8EA 4JA9A 4OR9A 3T1IA 4Q7FA 1MF8A 4J6OA 3H62B 1KBPA 1S3LA 3E7BA 3H60A 4FBWA 4V0XA 4I5LC 5F3WA 3LL8A 2NXFA 4TUGA 4O43A 1OI8A 3PSNA 4H2BA 3H61A 3AUZA 4ORCA 1T70A 1SU1A 5DNYA 4H2FA 2JOGA 2A22A 3QFMA 4FBKA 4ORAA 2IAEC 4UWQA 3QFOA 1II7A 4O5GA 4DSYA 3RL3A 3DW8C 3P71C 1AUIA 3FGAC 1S3NA 2R17A 1HO5A 3DSCA 3THOB 3IVEA 3IVDA 4LTYA 4MP0A 3QFKA 4MOYA 5IOHA 3E7AA 4LU9A 5JPFA 3JYFA 3RL4A 5B8IA 1S70A 2NYMC 4M0VA 4F0ZA 3HVQA 3DSDA 3EGHA 2AHDA 3K7VC 4KKZA 3TGHA 3IB8A 4JA7A 3AV0A 4O4KA 1OIEA 3H67A 3C9FA 3PSOA 4IL1A 4DHLA 2USHA 4FCXA 5HPEA 3QG5C 2BCDA 2QJCA 1WARA 2O8GA 2KKNA 2HY1A 3QFNA 2WDDA 3GVEA
chains in the Genus database with same CATH superfamily
1HP1A 4IYPC 2WDFA 3KBPA 3CK2A 3THNA 3IB7A 3EGGA 3H69A 2YVTA 4B2OA 1WAO1 5J28A 2Z06A 1HPUA 1JK7A 2GJUA 1USHA 4V0WA 4TUIA 5INBA 4V0VA 4LACC 4ORBA 1M63A 3ICFA 3V4YA 1OIDA 4UT2A 2NYLC 1NNWA 1T71A 1S3MA 3ZTVA 3H63A 4H2GA 3ZU0A 2P6BA 5C1VA 2O8AA 5JJTA 2NPPC 1UF3A 4ZVZA 1U32A 2DFJA 4NZVA 2DXNA 4O24A 4KBPA 1Z2XA 2Z72A 4G9JA 2CV9A 4H1SA 5EQVA 5GTUA 1XM7A 2Z1AA 3C5WC 4HD0A 2QFRA 4UT3B 4H2IA 2BDXA 2WDEA 4H1YP 2IE4C 3H68A 4MOVA 3N5UA 4ZX2A 1V73A 3RL5A 1UTEA 2HYOA 1IT6A 1S95A 3H66A 2HYPA 1FJMA 3FLOA 1TCOA 2ZBMA 3K7WC 1QHWA 4XPNA 3E0JA 1QFCA 4WWLA 3H64A 4UT3A 2BQ8X 2IE3C 4I5NC 5JPEA 1W24A 1Z2WA 4FBQA 2XMOA 4DT2A 1XZWA 3D03A 1G5BA 2QFPA 2WDCA 3RQZA 4YKEA 2Q8UA 1S8EA 4JA9A 4OR9A 3T1IA 4Q7FA 1MF8A 4J6OA 3H62B 1KBPA 1S3LA 3E7BA 3H60A 4FBWA 4V0XA 4I5LC 5F3WA 3LL8A 2NXFA 4TUGA 4O43A 1OI8A 3PSNA 2DXLA 4H2BA 3H61A 3AUZA 4ORCA 1T70A 1SU1A 5DNYA 4H2FA 2JOGA 2A22A 3QFMA 4FBKA 4ORAA 2IAEC 4UWQA 3QFOA 1II7A 4O5GA 4DSYA 3RL3A 3DW8C 3P71C 1AUIA 3FGAC 1S3NA 2R17A 1HO5A 3DSCA 3THOB 3IVEA 3IVDA 4LTYA 4MP0A 3QFKA 4MOYA 5IOHA 3E7AA 4LU9A 5JPFA 3JYFA 3RL4A 5B8IA 2ZOAA 1S70A 2YEQA 2NYMC 4M0VA 4F0ZA 3HVQA 3DSDA 3EGHA 2AHDA 3K7VC 4KKZA 3TGHA 3IB8A 4JA7A 3AV0A 4O4KA 1OIEA 3H67A 3C9FA 2ZO9B 3PSOA 4IL1A 4DHLA 2USHA 4FCXA 5HPEA 3QG5C 2BCDA 2QJCA 1WARA 2O8GA 2KKNA 2HY1A 3QFNA 2WDDA 3GVEA
chains in the Genus database with same CATH topology
1HP1A 4IYPC 2WDFA 3KBPA 3CK2A 3THNA 3IB7A 3EGGA 3H69A 2YVTA 4B2OA 1WAO1 5J28A 2Z06A 1HPUA 1JK7A 2GJUA 1USHA 4V0WA 4TUIA 5INBA 4V0VA 4LACC 4ORBA 1M63A 3ICFA 3V4YA 1OIDA 4UT2A 2NYLC 1NNWA 1T71A 1S3MA 3ZTVA 3H63A 4H2GA 3ZU0A 2P6BA 5C1VA 2O8AA 5JJTA 2NPPC 1UF3A 4ZVZA 1U32A 2DFJA 4NZVA 2DXNA 4O24A 4KBPA 1Z2XA 2Z72A 4G9JA 2CV9A 4H1SA 5EQVA 5GTUA 1XM7A 2Z1AA 3C5WC 4HD0A 2QFRA 4UT3B 4H2IA 2BDXA 2WDEA 4H1YP 2IE4C 3H68A 4MOVA 3N5UA 4ZX2A 1V73A 3RL5A 1UTEA 2HYOA 1IT6A 1S95A 3H66A 2HYPA 1FJMA 3FLOA 1TCOA 2ZBMA 3K7WC 1QHWA 4XPNA 3E0JA 1QFCA 4WWLA 3H64A 4UT3A 2BQ8X 2IE3C 4I5NC 5JPEA 1W24A 1Z2WA 4FBQA 2XMOA 4DT2A 1XZWA 3D03A 1G5BA 2QFPA 2WDCA 3RQZA 4YKEA 2Q8UA 1S8EA 4JA9A 4OR9A 3T1IA 4Q7FA 1MF8A 4J6OA 3H62B 1KBPA 1S3LA 3E7BA 3H60A 4FBWA 4V0XA 4I5LC 5F3WA 3LL8A 2NXFA 4TUGA 4O43A 1OI8A 3PSNA 2DXLA 4H2BA 3H61A 3AUZA 4ORCA 1T70A 1SU1A 5DNYA 4H2FA 2JOGA 2A22A 3QFMA 4FBKA 4ORAA 2IAEC 4UWQA 3QFOA 1II7A 4O5GA 4DSYA 3RL3A 3DW8C 3P71C 1AUIA 3FGAC 1S3NA 2R17A 1HO5A 3DSCA 3THOB 3IVEA 3IVDA 4LTYA 4MP0A 3QFKA 4MOYA 5IOHA 3E7AA 4LU9A 5JPFA 3JYFA 3RL4A 5B8IA 2ZOAA 1S70A 2YEQA 2NYMC 4M0VA 4F0ZA 3HVQA 3DSDA 3EGHA 2AHDA 3K7VC 4KKZA 3TGHA 3IB8A 4JA7A 3AV0A 4O4KA 1OIEA 3H67A 3C9FA 2ZO9B 3PSOA 4IL1A 4DHLA 2USHA 4FCXA 5HPEA 3QG5C 2BCDA 2QJCA 1WARA 2O8GA 2KKNA 2HY1A 3QFNA 2WDDA 3GVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP1 A;  4IYP C;  2WDF A;  3KBP A;  3CK2 A;  3THN A;  3IB7 A;  3EGG A;  3H69 A;  2YVT A;  4B2O A;  1WAO 1;  5J28 A;  2Z06 A;  1HPU A;  1JK7 A;  2GJU A;  1USH A;  4V0W A;  4TUI A;  5INB A;  4V0V A;  4LAC C;  4ORB A;  1M63 A;  3ICF A;  3V4Y A;  1OID A;  4UT2 A;  2NYL C;  1NNW A;  1T71 A;  1S3M A;  3ZTV A;  3H63 A;  4H2G A;  3ZU0 A;  2P6B A;  5C1V A;  2O8A A;  5JJT A;  2NPP C;  1UF3 A;  4ZVZ A;  1U32 A;  2DFJ A;  4NZV A;  4O24 A;  4KBP A;  1Z2X A;  2Z72 A;  4G9J A;  2CV9 A;  4H1S A;  5EQV A;  5GTU A;  1XM7 A;  2Z1A A;  3C5W C;  4HD0 A;  2QFR A;  4UT3 B;  4H2I A;  2BDX A;  2WDE A;  4H1Y P;  2IE4 C;  3H68 A;  4MOV A;  3N5U A;  4ZX2 A;  1V73 A;  3RL5 A;  1UTE A;  2HYO A;  1IT6 A;  1S95 A;  3H66 A;  2HYP A;  1FJM A;  1TCO A;  2ZBM A;  3K7W C;  1QHW A;  4XPN A;  1QFC A;  4WWL A;  3H64 A;  4UT3 A;  2BQ8 X;  2IE3 C;  4I5N C;  5JPE A;  1W24 A;  1Z2W A;  4FBQ A;  2XMO A;  4DT2 A;  1XZW A;  1G5B A;  2QFP A;  2WDC A;  3RQZ A;  4YKE A;  2Q8U A;  1S8E A;  4JA9 A;  4OR9 A;  3T1I A;  4Q7F A;  1MF8 A;  4J6O A;  3H62 B;  1KBP A;  1S3L A;  3E7B A;  3H60 A;  4FBW A;  4V0X A;  4I5L C;  5F3W A;  3LL8 A;  2NXF A;  4TUG A;  4O43 A;  1OI8 A;  3PSN A;  4H2B A;  3H61 A;  3AUZ A;  4ORC A;  1T70 A;  1SU1 A;  5DNY A;  4H2F A;  2JOG A;  2A22 A;  3QFM A;  4FBK A;  4ORA A;  2IAE C;  4UWQ A;  3QFO A;  1II7 A;  4O5G A;  4DSY A;  3RL3 A;  3DW8 C;  3P71 C;  1AUI A;  3FGA C;  1S3N A;  2R17 A;  1HO5 A;  3DSC A;  3THO B;  3IVE A;  3IVD A;  4LTY A;  4MP0 A;  3QFK A;  4MOY A;  5IOH A;  3E7A A;  4LU9 A;  5JPF A;  3JYF A;  3RL4 A;  5B8I A;  1S70 A;  2NYM C;  4M0V A;  4F0Z A;  3HVQ A;  3DSD A;  3EGH A;  2AHD A;  3K7V C;  4KKZ A;  3TGH A;  3IB8 A;  4JA7 A;  3AV0 A;  4O4K A;  1OIE A;  3H67 A;  3C9F A;  3PSO A;  4IL1 A;  4DHL A;  2USH A;  4FCX A;  5HPE A;  3QG5 C;  2BCD A;  2QJC A;  1WAR A;  2O8G A;  2KKN A;  2HY1 A;  3QFN A;  2WDD A;  3GVE A; 
#chains in the Genus database with same CATH topology
 1HP1 A;  4IYP C;  2WDF A;  3KBP A;  3CK2 A;  3THN A;  3IB7 A;  3EGG A;  3H69 A;  2YVT A;  4B2O A;  1WAO 1;  5J28 A;  2Z06 A;  1HPU A;  1JK7 A;  2GJU A;  1USH A;  4V0W A;  4TUI A;  5INB A;  4V0V A;  4LAC C;  4ORB A;  1M63 A;  3ICF A;  3V4Y A;  1OID A;  4UT2 A;  2NYL C;  1NNW A;  1T71 A;  1S3M A;  3ZTV A;  3H63 A;  4H2G A;  3ZU0 A;  2P6B A;  5C1V A;  2O8A A;  5JJT A;  2NPP C;  1UF3 A;  4ZVZ A;  1U32 A;  2DFJ A;  4NZV A;  2DXN A;  4O24 A;  4KBP A;  1Z2X A;  2Z72 A;  4G9J A;  2CV9 A;  4H1S A;  5EQV A;  5GTU A;  1XM7 A;  2Z1A A;  3C5W C;  4HD0 A;  2QFR A;  4UT3 B;  4H2I A;  2BDX A;  2WDE A;  4H1Y P;  2IE4 C;  3H68 A;  4MOV A;  3N5U A;  4ZX2 A;  1V73 A;  3RL5 A;  1UTE A;  2HYO A;  1IT6 A;  1S95 A;  3H66 A;  2HYP A;  1FJM A;  3FLO A;  1TCO A;  2ZBM A;  3K7W C;  1QHW A;  4XPN A;  3E0J A;  1QFC A;  4WWL A;  3H64 A;  4UT3 A;  2BQ8 X;  2IE3 C;  4I5N C;  5JPE A;  1W24 A;  1Z2W A;  4FBQ A;  2XMO A;  4DT2 A;  1XZW A;  3D03 A;  1G5B A;  2QFP A;  2WDC A;  3RQZ A;  4YKE A;  2Q8U A;  1S8E A;  4JA9 A;  4OR9 A;  3T1I A;  4Q7F A;  1MF8 A;  4J6O A;  3H62 B;  1KBP A;  1S3L A;  3E7B A;  3H60 A;  4FBW A;  4V0X A;  4I5L C;  5F3W A;  3LL8 A;  2NXF A;  4TUG A;  4O43 A;  1OI8 A;  3PSN A;  2DXL A;  4H2B A;  3H61 A;  3AUZ A;  4ORC A;  1T70 A;  1SU1 A;  5DNY A;  4H2F A;  2JOG A;  2A22 A;  3QFM A;  4FBK A;  4ORA A;  2IAE C;  4UWQ A;  3QFO A;  1II7 A;  4O5G A;  4DSY A;  3RL3 A;  3DW8 C;  3P71 C;  1AUI A;  3FGA C;  1S3N A;  2R17 A;  1HO5 A;  3DSC A;  3THO B;  3IVE A;  3IVD A;  4LTY A;  4MP0 A;  3QFK A;  4MOY A;  5IOH A;  3E7A A;  4LU9 A;  5JPF A;  3JYF A;  3RL4 A;  5B8I A;  2ZOA A;  1S70 A;  2YEQ A;  2NYM C;  4M0V A;  4F0Z A;  3HVQ A;  3DSD A;  3EGH A;  2AHD A;  3K7V C;  4KKZ A;  3TGH A;  3IB8 A;  4JA7 A;  3AV0 A;  4O4K A;  1OIE A;  3H67 A;  3C9F A;  2ZO9 B;  3PSO A;  4IL1 A;  4DHL A;  2USH A;  4FCX A;  5HPE A;  3QG5 C;  2BCD A;  2QJC A;  1WAR A;  2O8G A;  2KKN A;  2HY1 A;  3QFN A;  2WDD A;  3GVE A; 
#chains in the Genus database with same CATH homology
 1HP1 A;  4IYP C;  2WDF A;  3KBP A;  3CK2 A;  3THN A;  3IB7 A;  3EGG A;  3H69 A;  2YVT A;  4B2O A;  1WAO 1;  5J28 A;  2Z06 A;  1HPU A;  1JK7 A;  2GJU A;  1USH A;  4V0W A;  4TUI A;  5INB A;  4V0V A;  4LAC C;  4ORB A;  1M63 A;  3ICF A;  3V4Y A;  1OID A;  4UT2 A;  2NYL C;  1NNW A;  1T71 A;  1S3M A;  3ZTV A;  3H63 A;  4H2G A;  3ZU0 A;  2P6B A;  5C1V A;  2O8A A;  5JJT A;  2NPP C;  1UF3 A;  4ZVZ A;  1U32 A;  2DFJ A;  4NZV A;  2DXN A;  4O24 A;  4KBP A;  1Z2X A;  2Z72 A;  4G9J A;  2CV9 A;  4H1S A;  5EQV A;  5GTU A;  1XM7 A;  2Z1A A;  3C5W C;  4HD0 A;  2QFR A;  4UT3 B;  4H2I A;  2BDX A;  2WDE A;  4H1Y P;  2IE4 C;  3H68 A;  4MOV A;  3N5U A;  4ZX2 A;  1V73 A;  3RL5 A;  1UTE A;  2HYO A;  1IT6 A;  1S95 A;  3H66 A;  2HYP A;  1FJM A;  3FLO A;  1TCO A;  2ZBM A;  3K7W C;  1QHW A;  4XPN A;  3E0J A;  1QFC A;  4WWL A;  3H64 A;  4UT3 A;  2BQ8 X;  2IE3 C;  4I5N C;  5JPE A;  1W24 A;  1Z2W A;  4FBQ A;  2XMO A;  4DT2 A;  1XZW A;  3D03 A;  1G5B A;  2QFP A;  2WDC A;  3RQZ A;  4YKE A;  2Q8U A;  1S8E A;  4JA9 A;  4OR9 A;  3T1I A;  4Q7F A;  1MF8 A;  4J6O A;  3H62 B;  1KBP A;  1S3L A;  3E7B A;  3H60 A;  4FBW A;  4V0X A;  4I5L C;  5F3W A;  3LL8 A;  2NXF A;  4TUG A;  4O43 A;  1OI8 A;  3PSN A;  2DXL A;  4H2B A;  3H61 A;  3AUZ A;  4ORC A;  1T70 A;  1SU1 A;  5DNY A;  4H2F A;  2JOG A;  2A22 A;  3QFM A;  4FBK A;  4ORA A;  2IAE C;  4UWQ A;  3QFO A;  1II7 A;  4O5G A;  4DSY A;  3RL3 A;  3DW8 C;  3P71 C;  1AUI A;  3FGA C;  1S3N A;  2R17 A;  1HO5 A;  3DSC A;  3THO B;  3IVE A;  3IVD A;  4LTY A;  4MP0 A;  3QFK A;  4MOY A;  5IOH A;  3E7A A;  4LU9 A;  5JPF A;  3JYF A;  3RL4 A;  5B8I A;  2ZOA A;  1S70 A;  2YEQ A;  2NYM C;  4M0V A;  4F0Z A;  3HVQ A;  3DSD A;  3EGH A;  2AHD A;  3K7V C;  4KKZ A;  3TGH A;  3IB8 A;  4JA7 A;  3AV0 A;  4O4K A;  1OIE A;  3H67 A;  3C9F A;  2ZO9 B;  3PSO A;  4IL1 A;  4DHL A;  2USH A;  4FCX A;  5HPE A;  3QG5 C;  2BCD A;  2QJC A;  1WAR A;  2O8G A;  2KKN A;  2HY1 A;  3QFN A;  2WDD A;  3GVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...