1FJMA

Protein serine/threonine phosphatase-1 (alpha isoform, type 1) complexed with microcystin-lr toxin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the catalytic subunit of protein serine/threonine phosphatase-1.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN SERINE/THREONINE PHOSPHATASE-1 (ALPHA ISOFORM, TYPE
total genus 105
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1995-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1fjmA00
3FGAC 1OIEA 3IB8A 3V4YA 1AUIA 2QFPA 3GVEA 3H60A 3IVEA 4O4KA 5JJTA 4MP0A 2R17A 3H62B 4DSYA 3IB7A 4H2BA 4ZX2A 1S3LA 3H66A 4F0ZA 4UWQA 3C9FA 1T71A 4V0WA 3CK2A 2USHA 2Z06A 4MOVA 4KBPA 1QFCA 1XZWA 4UT3B 4H1YP 3RL3A 1JK7A 4YKEA 5IOHA 4OR9A 4WWLA 4B2OA 3N5UA 3EGGA 4M0VA 2QFRA 3C5WC 3PSOA 5JPEA 3IVDA 4I5NC 3E7AA 5HPEA 4ORAA 1MF8A 4MOYA 2P6BA 4KKZA 2NYLC 1G5BA 1IT6A 2HYOA 4ZVZA 3EGHA 1S95A 1OIDA 1UF3A 3H63A 5JPFA 5C1VA 2WDDA 4H2IA 4I5LC 1T70A 2NYMC 4FCXA 2Q8UA 4H1SA 4DT2A 2O8AA 4O24A 1KBPA 2CV9A 3PSNA 5DNYA 4H2GA 3E7BA 1TCOA 1WARA 1II7A 4NZVA 5GTUA 2Z72A 3H61A 3THOB 4O43A 4J6OA 4JA9A 1WAO1 2DFJA 2JOGA 4LTYA 2BDXA 4ORCA 4UT2A 2KKNA 3QFKA 5B8IA 4V0XA 1SU1A 2IE3C 3QFNA 1FJMA 1U32A 3H67A 4ORBA 4H2FA 4LU9A 3RL5A 5INBA 1NNWA 1HO5A 3K7WC 1HPUA 4JA7A 2WDEA 1S70A 3ZU0A 4TUGA 3QFMA 3HVQA 2GJUA 2AHDA 2WDCA 4FBKA 3TGHA 2IE4C 3QG5C 1USHA 3DW8C 1S3NA 3RQZA 3DSDA 4TUIA 1M63A 1QHWA 1UTEA 4O5GA 2NXFA 3H69A 4Q7FA 2O8GA 2HYPA 1Z2WA 3T1IA 2WDFA 1XM7A 4UT3A 2HY1A 2BCDA 4HD0A 1OI8A 3H68A 3QFOA 5F3WA 3THNA 2Z1AA 4G9JA 5J28A 1V73A 4FBQA 1HP1A 3AV0A 3ICFA 4IYPC 2ZBMA 3DSCA 3P71C 3AUZA 4IL1A 1S3MA 3LL8A 3KBPA 4LACC 5EQVA 3ZTVA 1S8EA 2NPPC 2XMOA 4XPNA 3K7VC 3H64A 2IAEC 2QJCA 4FBWA 4V0VA 1W24A 3RL4A 2BQ8X 3JYFA 2A22A 2YVTA 1Z2XA 4DHLA
chains in the Genus database with same CATH superfamily
3FGAC 1OIEA 3IB8A 3V4YA 1AUIA 2QFPA 3GVEA 3H60A 3IVEA 4O4KA 5JJTA 4MP0A 2R17A 3H62B 4DSYA 3IB7A 4H2BA 4ZX2A 1S3LA 3H66A 4F0ZA 4UWQA 3D03A 3C9FA 1T71A 4V0WA 3CK2A 2USHA 2Z06A 4MOVA 4KBPA 3FLOA 1QFCA 1XZWA 4UT3B 4H1YP 3RL3A 1JK7A 2DXNA 4YKEA 5IOHA 4OR9A 4WWLA 4B2OA 3N5UA 3EGGA 4M0VA 2QFRA 2DXLA 3C5WC 3PSOA 5JPEA 3IVDA 4I5NC 3E7AA 5HPEA 4ORAA 1MF8A 4MOYA 2P6BA 4KKZA 2NYLC 1G5BA 1IT6A 2HYOA 4ZVZA 3EGHA 1S95A 1OIDA 1UF3A 3H63A 5JPFA 5C1VA 2WDDA 4H2IA 4I5LC 1T70A 2NYMC 4FCXA 2Q8UA 4H1SA 4DT2A 2O8AA 4O24A 1KBPA 2CV9A 3PSNA 5DNYA 4H2GA 3E7BA 1TCOA 1WARA 1II7A 4NZVA 5GTUA 2Z72A 3H61A 2ZOAA 3THOB 4O43A 4J6OA 4JA9A 1WAO1 2DFJA 2JOGA 4LTYA 2BDXA 4ORCA 4UT2A 2KKNA 3QFKA 5B8IA 4V0XA 1SU1A 2IE3C 3QFNA 1FJMA 1U32A 3H67A 4ORBA 4H2FA 4LU9A 3RL5A 5INBA 1NNWA 1HO5A 3K7WC 1HPUA 4JA7A 2WDEA 1S70A 3ZU0A 4TUGA 3QFMA 3HVQA 2GJUA 2AHDA 2WDCA 4FBKA 3TGHA 2IE4C 3QG5C 1USHA 3DW8C 1S3NA 3RQZA 3DSDA 4TUIA 1M63A 1QHWA 1UTEA 4O5GA 2NXFA 3H69A 4Q7FA 2O8GA 2HYPA 1Z2WA 3T1IA 2ZO9B 2WDFA 1XM7A 4UT3A 2HY1A 2BCDA 4HD0A 1OI8A 3H68A 3QFOA 5F3WA 3THNA 2Z1AA 4G9JA 5J28A 1V73A 4FBQA 1HP1A 3AV0A 3ICFA 4IYPC 2ZBMA 3DSCA 3P71C 3AUZA 4IL1A 3E0JA 1S3MA 3LL8A 3KBPA 4LACC 5EQVA 3ZTVA 1S8EA 2NPPC 2XMOA 4XPNA 3K7VC 3H64A 2IAEC 2QJCA 4FBWA 4V0VA 1W24A 3RL4A 2BQ8X 3JYFA 2A22A 2YVTA 1Z2XA 2YEQA 4DHLA
chains in the Genus database with same CATH topology
3FGAC 1OIEA 3IB8A 3V4YA 1AUIA 2QFPA 3GVEA 3H60A 3IVEA 4O4KA 5JJTA 4MP0A 2R17A 3H62B 4DSYA 3IB7A 4H2BA 4ZX2A 1S3LA 3H66A 4F0ZA 4UWQA 3D03A 3C9FA 1T71A 4V0WA 3CK2A 2USHA 2Z06A 4MOVA 4KBPA 3FLOA 1QFCA 1XZWA 4UT3B 4H1YP 3RL3A 1JK7A 2DXNA 4YKEA 5IOHA 4OR9A 4WWLA 4B2OA 3N5UA 3EGGA 4M0VA 2QFRA 2DXLA 3C5WC 3PSOA 5JPEA 3IVDA 4I5NC 3E7AA 5HPEA 4ORAA 1MF8A 4MOYA 2P6BA 4KKZA 2NYLC 1G5BA 1IT6A 2HYOA 4ZVZA 3EGHA 1S95A 1OIDA 1UF3A 3H63A 5JPFA 5C1VA 2WDDA 4H2IA 4I5LC 1T70A 2NYMC 4FCXA 2Q8UA 4H1SA 4DT2A 2O8AA 4O24A 1KBPA 2CV9A 3PSNA 5DNYA 4H2GA 3E7BA 1TCOA 1WARA 1II7A 4NZVA 5GTUA 2Z72A 3H61A 2ZOAA 3THOB 4O43A 4J6OA 4JA9A 1WAO1 2DFJA 2JOGA 4LTYA 2BDXA 4ORCA 4UT2A 2KKNA 3QFKA 5B8IA 4V0XA 1SU1A 2IE3C 3QFNA 1FJMA 1U32A 3H67A 4ORBA 4H2FA 4LU9A 3RL5A 5INBA 1NNWA 1HO5A 3K7WC 1HPUA 4JA7A 2WDEA 1S70A 3ZU0A 4TUGA 3QFMA 3HVQA 2GJUA 2AHDA 2WDCA 4FBKA 3TGHA 2IE4C 3QG5C 1USHA 3DW8C 1S3NA 3RQZA 3DSDA 4TUIA 1M63A 1QHWA 1UTEA 4O5GA 2NXFA 3H69A 4Q7FA 2O8GA 2HYPA 1Z2WA 3T1IA 2ZO9B 2WDFA 1XM7A 4UT3A 2HY1A 2BCDA 4HD0A 1OI8A 3H68A 3QFOA 5F3WA 3THNA 2Z1AA 4G9JA 5J28A 1V73A 4FBQA 1HP1A 3AV0A 3ICFA 4IYPC 2ZBMA 3DSCA 3P71C 3AUZA 4IL1A 3E0JA 1S3MA 3LL8A 3KBPA 4LACC 5EQVA 3ZTVA 1S8EA 2NPPC 2XMOA 4XPNA 3K7VC 3H64A 2IAEC 2QJCA 4FBWA 4V0VA 1W24A 3RL4A 2BQ8X 3JYFA 2A22A 2YVTA 1Z2XA 2YEQA 4DHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGA C;  1OIE A;  3IB8 A;  3V4Y A;  1AUI A;  2QFP A;  3GVE A;  3H60 A;  3IVE A;  4O4K A;  5JJT A;  4MP0 A;  2R17 A;  3H62 B;  4DSY A;  3IB7 A;  4H2B A;  4ZX2 A;  1S3L A;  3H66 A;  4F0Z A;  4UWQ A;  3C9F A;  1T71 A;  4V0W A;  3CK2 A;  2USH A;  2Z06 A;  4MOV A;  4KBP A;  1QFC A;  1XZW A;  4UT3 B;  4H1Y P;  3RL3 A;  1JK7 A;  4YKE A;  5IOH A;  4OR9 A;  4WWL A;  4B2O A;  3N5U A;  3EGG A;  4M0V A;  2QFR A;  3C5W C;  3PSO A;  5JPE A;  3IVD A;  4I5N C;  3E7A A;  5HPE A;  4ORA A;  1MF8 A;  4MOY A;  2P6B A;  4KKZ A;  2NYL C;  1G5B A;  1IT6 A;  2HYO A;  4ZVZ A;  3EGH A;  1S95 A;  1OID A;  1UF3 A;  3H63 A;  5JPF A;  5C1V A;  2WDD A;  4H2I A;  4I5L C;  1T70 A;  2NYM C;  4FCX A;  2Q8U A;  4H1S A;  4DT2 A;  2O8A A;  4O24 A;  1KBP A;  2CV9 A;  3PSN A;  5DNY A;  4H2G A;  3E7B A;  1TCO A;  1WAR A;  1II7 A;  4NZV A;  5GTU A;  2Z72 A;  3H61 A;  3THO B;  4O43 A;  4J6O A;  4JA9 A;  1WAO 1;  2DFJ A;  2JOG A;  4LTY A;  2BDX A;  4ORC A;  4UT2 A;  2KKN A;  3QFK A;  5B8I A;  4V0X A;  1SU1 A;  2IE3 C;  3QFN A;  1FJM A;  1U32 A;  3H67 A;  4ORB A;  4H2F A;  4LU9 A;  3RL5 A;  5INB A;  1NNW A;  1HO5 A;  3K7W C;  1HPU A;  4JA7 A;  2WDE A;  1S70 A;  3ZU0 A;  4TUG A;  3QFM A;  3HVQ A;  2GJU A;  2AHD A;  2WDC A;  4FBK A;  3TGH A;  2IE4 C;  3QG5 C;  1USH A;  3DW8 C;  1S3N A;  3RQZ A;  3DSD A;  4TUI A;  1M63 A;  1QHW A;  1UTE A;  4O5G A;  2NXF A;  3H69 A;  4Q7F A;  2O8G A;  2HYP A;  1Z2W A;  3T1I A;  2WDF A;  1XM7 A;  4UT3 A;  2HY1 A;  2BCD A;  4HD0 A;  1OI8 A;  3H68 A;  3QFO A;  5F3W A;  3THN A;  2Z1A A;  4G9J A;  5J28 A;  1V73 A;  4FBQ A;  1HP1 A;  3AV0 A;  3ICF A;  4IYP C;  2ZBM A;  3DSC A;  3P71 C;  3AUZ A;  4IL1 A;  1S3M A;  3LL8 A;  3KBP A;  4LAC C;  5EQV A;  3ZTV A;  1S8E A;  2NPP C;  2XMO A;  4XPN A;  3K7V C;  3H64 A;  2IAE C;  2QJC A;  4FBW A;  4V0V A;  1W24 A;  3RL4 A;  2BQ8 X;  3JYF A;  2A22 A;  2YVT A;  1Z2X A;  4DHL A; 
#chains in the Genus database with same CATH topology
 3FGA C;  1OIE A;  3IB8 A;  3V4Y A;  1AUI A;  2QFP A;  3GVE A;  3H60 A;  3IVE A;  4O4K A;  5JJT A;  4MP0 A;  2R17 A;  3H62 B;  4DSY A;  3IB7 A;  4H2B A;  4ZX2 A;  1S3L A;  3H66 A;  4F0Z A;  4UWQ A;  3D03 A;  3C9F A;  1T71 A;  4V0W A;  3CK2 A;  2USH A;  2Z06 A;  4MOV A;  4KBP A;  3FLO A;  1QFC A;  1XZW A;  4UT3 B;  4H1Y P;  3RL3 A;  1JK7 A;  2DXN A;  4YKE A;  5IOH A;  4OR9 A;  4WWL A;  4B2O A;  3N5U A;  3EGG A;  4M0V A;  2QFR A;  2DXL A;  3C5W C;  3PSO A;  5JPE A;  3IVD A;  4I5N C;  3E7A A;  5HPE A;  4ORA A;  1MF8 A;  4MOY A;  2P6B A;  4KKZ A;  2NYL C;  1G5B A;  1IT6 A;  2HYO A;  4ZVZ A;  3EGH A;  1S95 A;  1OID A;  1UF3 A;  3H63 A;  5JPF A;  5C1V A;  2WDD A;  4H2I A;  4I5L C;  1T70 A;  2NYM C;  4FCX A;  2Q8U A;  4H1S A;  4DT2 A;  2O8A A;  4O24 A;  1KBP A;  2CV9 A;  3PSN A;  5DNY A;  4H2G A;  3E7B A;  1TCO A;  1WAR A;  1II7 A;  4NZV A;  5GTU A;  2Z72 A;  3H61 A;  2ZOA A;  3THO B;  4O43 A;  4J6O A;  4JA9 A;  1WAO 1;  2DFJ A;  2JOG A;  4LTY A;  2BDX A;  4ORC A;  4UT2 A;  2KKN A;  3QFK A;  5B8I A;  4V0X A;  1SU1 A;  2IE3 C;  3QFN A;  1FJM A;  1U32 A;  3H67 A;  4ORB A;  4H2F A;  4LU9 A;  3RL5 A;  5INB A;  1NNW A;  1HO5 A;  3K7W C;  1HPU A;  4JA7 A;  2WDE A;  1S70 A;  3ZU0 A;  4TUG A;  3QFM A;  3HVQ A;  2GJU A;  2AHD A;  2WDC A;  4FBK A;  3TGH A;  2IE4 C;  3QG5 C;  1USH A;  3DW8 C;  1S3N A;  3RQZ A;  3DSD A;  4TUI A;  1M63 A;  1QHW A;  1UTE A;  4O5G A;  2NXF A;  3H69 A;  4Q7F A;  2O8G A;  2HYP A;  1Z2W A;  3T1I A;  2ZO9 B;  2WDF A;  1XM7 A;  4UT3 A;  2HY1 A;  2BCD A;  4HD0 A;  1OI8 A;  3H68 A;  3QFO A;  5F3W A;  3THN A;  2Z1A A;  4G9J A;  5J28 A;  1V73 A;  4FBQ A;  1HP1 A;  3AV0 A;  3ICF A;  4IYP C;  2ZBM A;  3DSC A;  3P71 C;  3AUZ A;  4IL1 A;  3E0J A;  1S3M A;  3LL8 A;  3KBP A;  4LAC C;  5EQV A;  3ZTV A;  1S8E A;  2NPP C;  2XMO A;  4XPN A;  3K7V C;  3H64 A;  2IAE C;  2QJC A;  4FBW A;  4V0V A;  1W24 A;  3RL4 A;  2BQ8 X;  3JYF A;  2A22 A;  2YVT A;  1Z2X A;  2YEQ A;  4DHL A; 
#chains in the Genus database with same CATH homology
 3FGA C;  1OIE A;  3IB8 A;  3V4Y A;  1AUI A;  2QFP A;  3GVE A;  3H60 A;  3IVE A;  4O4K A;  5JJT A;  4MP0 A;  2R17 A;  3H62 B;  4DSY A;  3IB7 A;  4H2B A;  4ZX2 A;  1S3L A;  3H66 A;  4F0Z A;  4UWQ A;  3D03 A;  3C9F A;  1T71 A;  4V0W A;  3CK2 A;  2USH A;  2Z06 A;  4MOV A;  4KBP A;  3FLO A;  1QFC A;  1XZW A;  4UT3 B;  4H1Y P;  3RL3 A;  1JK7 A;  2DXN A;  4YKE A;  5IOH A;  4OR9 A;  4WWL A;  4B2O A;  3N5U A;  3EGG A;  4M0V A;  2QFR A;  2DXL A;  3C5W C;  3PSO A;  5JPE A;  3IVD A;  4I5N C;  3E7A A;  5HPE A;  4ORA A;  1MF8 A;  4MOY A;  2P6B A;  4KKZ A;  2NYL C;  1G5B A;  1IT6 A;  2HYO A;  4ZVZ A;  3EGH A;  1S95 A;  1OID A;  1UF3 A;  3H63 A;  5JPF A;  5C1V A;  2WDD A;  4H2I A;  4I5L C;  1T70 A;  2NYM C;  4FCX A;  2Q8U A;  4H1S A;  4DT2 A;  2O8A A;  4O24 A;  1KBP A;  2CV9 A;  3PSN A;  5DNY A;  4H2G A;  3E7B A;  1TCO A;  1WAR A;  1II7 A;  4NZV A;  5GTU A;  2Z72 A;  3H61 A;  2ZOA A;  3THO B;  4O43 A;  4J6O A;  4JA9 A;  1WAO 1;  2DFJ A;  2JOG A;  4LTY A;  2BDX A;  4ORC A;  4UT2 A;  2KKN A;  3QFK A;  5B8I A;  4V0X A;  1SU1 A;  2IE3 C;  3QFN A;  1FJM A;  1U32 A;  3H67 A;  4ORB A;  4H2F A;  4LU9 A;  3RL5 A;  5INB A;  1NNW A;  1HO5 A;  3K7W C;  1HPU A;  4JA7 A;  2WDE A;  1S70 A;  3ZU0 A;  4TUG A;  3QFM A;  3HVQ A;  2GJU A;  2AHD A;  2WDC A;  4FBK A;  3TGH A;  2IE4 C;  3QG5 C;  1USH A;  3DW8 C;  1S3N A;  3RQZ A;  3DSD A;  4TUI A;  1M63 A;  1QHW A;  1UTE A;  4O5G A;  2NXF A;  3H69 A;  4Q7F A;  2O8G A;  2HYP A;  1Z2W A;  3T1I A;  2ZO9 B;  2WDF A;  1XM7 A;  4UT3 A;  2HY1 A;  2BCD A;  4HD0 A;  1OI8 A;  3H68 A;  3QFO A;  5F3W A;  3THN A;  2Z1A A;  4G9J A;  5J28 A;  1V73 A;  4FBQ A;  1HP1 A;  3AV0 A;  3ICF A;  4IYP C;  2ZBM A;  3DSC A;  3P71 C;  3AUZ A;  4IL1 A;  3E0J A;  1S3M A;  3LL8 A;  3KBP A;  4LAC C;  5EQV A;  3ZTV A;  1S8E A;  2NPP C;  2XMO A;  4XPN A;  3K7V C;  3H64 A;  2IAE C;  2QJC A;  4FBW A;  4V0V A;  1W24 A;  3RL4 A;  2BQ8 X;  3JYF A;  2A22 A;  2YVT A;  1Z2X A;  2YEQ A;  4DHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...