1FKGA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
molecule tags Cis-trans isomerase
source organism Homo sapiens
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkgA00
1J4HA 2K8IA 2LPVA 2D9FA 5DIUA 5I98A 4TX0A 3CGNA 2PPPA 2MF9A 4IQCA 4DRNA 4QT2A 4U84A 1P5QA 1PBKA 2PPNA 1JNSA 3KZ7A 3TC5A 3PRBA 3KAIA 2VCDA 1FKFA 3KAFA 1J4IA 4W9QA 3IHZA 3NRKA 4ODRA 1FD9A 3O5GA 3TDBA 1TCOC 4JFKA 4DIPA 1U79A 1N1AA 2AWGA 4DRPA 4DRIA 2LGOA 4J4NA 2KO7A 1L1PA 2PV1A 3KACA 3H9RB 3KABA 1YATA 4U86A 1EYMA 3O5FA 2L2SA 2M2AA 4DROA 2RUDA 4ODPA 1YW5A 1FKGA 3MDYB 4ODMA 5HW8A 1FKKA 1Q6IA 1Q6UA 4DRQA 2M1IA 2PPOA 2DG3A 2F2DA 1FJDA 4TYOA 4U85A 4JFJA 4N19A 1ROUA 2PV3A 4FAPA 3IKGA 5HWBA 4GGQA 3NTPA 4ODOA 5HT1A 2XP9A 5HUAA 1FKIA 1ROTA 2F21A 2MNTA 2MLZA 3O5PA 3GPKA 2KR7A 3O5IA 4JYSA 4W9OA 3UF8A 2DG9A 1FKHA 2M08A 2RUCA 2XPAA 3JYMA 4QT3A 3O5QA 4LAVA 4ODLA 1D7JA 1PINA 2LKNA 4JFIA 1W26A 3IK8A 1FKTA 3KAHA 4DZ3A 3IKDA 4J4OA 4BF8A 4DZ2A 3O5KA 4IQ2A 3B7XA 3O5LA 4TW7A 5DIVA 1BKFA 1QPLA 2FKEA 2XP6A 3WH0A 3JYJA 3NI6A 3UI5A 2ITKA 5HTGA 2ZR6A 5HWCA 3CGMA 2LJ4A 1NMWA 1QPFA 4C02B 3UI4A 1D7IA 3O5MA 4W9PA 4DRJA 4JFLA 3KADA 4DH0A 4G50A 4ODNA 4R0XA 2N87A 1D6OA 1JNTA 1QZ2A 2F4EA 1R9HA 5GPGA 1J6YA 4LAYA 2XPBA 4IPXA 1FKSA 3O5DA 2RUQA 2OFNA 3UI6A 5DITA 2XP7A 4DRKA 4TW6A 4GIVA 3VAWA 2Q5AA 3PRDA 1FAPA 2ZQTA 1KT0A 2RSEA 3JXVA 4TW8A 2PV2A 2RURA 3OOBA 2MLXA 5HKGA 2UZ5A 2DG4A 3O5OA 2MLYA 1NMVA 2ZR4A 1FKJA 1Q1CA 4QIBA 2KGJA 2XP4A 3ODKA 3RGCA 2ZQUA 2ZR5A 4DRMA 1F8AB 1ZCNA 1FKBA 3KCEA 3O5RA 4DRHA 1HXVA 2ZQVA 3TCZA 2XP8A 5B8IC 1D7HA 1BL4A 2KFWA 1ZK6A 3UQIA 4G2PA 5HW6A 2FAPA 3LUOA 4FN2A 4MGVA 4O2TA 1JVWA 1B6CA 1Q6HA 1FKLA 1KT1A 2VN1A 2XP3A 3UQAA 4DT4A 2XP5A 2IF4A 1F40A 1EQ3A 3RFWA 2MPHA 1FKRA 2KI3A 2PBCA 5J6EA 4MSPA 3FAPA 3PA7A 4ODQA 1A7XA 5D75A 2Y78A 1T11A 5HW7A 3I6CA 5BXJA 3KAGA 4LAWA 4LAXA 4TNSA 2KE0A 2JZVA 1FKDA 1NSGA 3O5EA 3O5JA 4JFMA 4ITZA 1C9HA 4NNRA 4ODKA 1Y0OA 3UQBA 3EY6A 1J4RA 2RQSA 1M5YA 2ZQSA
chains in the Genus database with same CATH superfamily
2AOSA 3AS2A 2MF9A 4DRNA 1HKMA 4QT2A 4U84A 1P5QA 1PBKA 2PPNA 3PRBA 1J4IA 1E44A 5DO2A 4MNKA 4ODRA 4IT6A 3RMEA 1TCOC 1X6LA 1E6ZA 2G41A 1ZB5A 3KABA 2DSZA 1NWRA 3O5FA 1TFVA 1IX5A 4ODPA 1W1YA 4S3KA 3WD1A 1Q6IA 1Q6UA 2PPOA 1FJDA 4TYOA 4U85A 4N19A 1NWUA 4Z2JA 1LL7A 2F21A 3UF8A 4L3NA 2DG9A 2M08A 2RUCA 3JYMA 4ODLA 4UDMA 3G6LA 1SR0A 1PINA 1W26A 1JNDA 1FKTA 3WD4A 4J4OA 4BF8A 4DZ2A 3B7XA 2IUZA 1BKFA 2FKEA 3NI6A 3UI5A 1ZBCA 3CGMA 1NMWA 1NWTA 1QPFA 1D7IA 4DH0A 3WQWA 1E6PA 3ALFA 4MNMA 1JNTA 1J6YA 2DSUA 4ML4A 5DITA 4DRKA 1WB0A 3WH0A 5HTGA 3PRDA 1EHNA 4Z2KA 3CH9A 2RURA 2MLYA 1NMVA 4Z2GA 1FKJA 1Q1CA 4QIBA 3ODKA 1HXVA 1F8AB 3KCEA 3O5RA 3OA5A 1E15A 1LL6A 1BL4A 1EIBA 1ZK6A 4KQZA 2FAPA 3LUOA 4MGVA 4O2TA 1JVWA 2VN1A 1WAWA 2XP3A 4DT4A 4Z2LA 2KI3A 1NH6A 5J6EA 4ODQA 1A7XA 3ARZA 1W9VA 2Y78A 5HW7A 4WKAA 1VF8A 4WK9A 1FKDA 3O5EA 1C9HA 2K8IA 2LPVA 5I98A 2PPPA 4HBOA 1LL4A 4ZPTR 3TC5A 3PRAA 3KAIA 5DF0A 3KAFA 1FFQA 1W1PA 4W9QA 2P4VA 3NRKA 3CHFA 2WM0A 3O5GA 3TDBA 2DSVA 5HBFA 4DIPA 1U79A 1N1AA 2AWGA 2DPEA 4DRPA 3ARYA 1LQ0A 4J4NA 1SYTA 2KO7A 3AQUA 4PTMA 4ODMA 1JNEA 4WKFA 1FKKA 1ZBKA 2M1IA 1ROUA 3G6MA 4MNJA 4GGQA 4ODOA 4DWSB 5HT1A 2XP9A 3CZ8A 1FKIA 1ROTA 2MNTA 1O6IA 2KR7A 4DWSA 4QT3A 2DT1A 2YBUA 2LKNA 4JFIA 3IK8A 5DEZA 2DT3A 3KAHA 1HJVA 4DZ3A 3ARWA 3O5LA 2XP6A 3JYJA 2ITKA 5HWCA 2WK2A 4HARA 1GRJA 3UI4A 4KR0B 3O5MA 2A3CA 1ZBWA 4G50A 1W9PA 5GPGA 2F4EA 1ITXA 2XPBA 1FKSA 4IPXA 2OFNA 3UI6A 1KT0A 1OGBA 3JXVA 3RM8A 2PV2A 1HJWA 4MAVA 4WIWA 2XP4A 3RGCA 3EIPA 1ZCNA 1UR9A 1LG2A 5B8IC 1D7HA 3UQIA 4ZS6A 4G2PA 4URIA 5HW6A 4P8WA 1EQ3A 2MPHA 2PI6A 1H0GA 3FAPA 1X6NA 1T11A 1CTNA 3I6CA 4S3JA 2FDMA 4LAXA 4MPKA 4NSBA 1ZU8A 4ITZA 3WIJA 3WKZA 2O92A 3UQBA 3EY6A 5HW8A 3CHCA 2D9FA 2ETNA 3QOKA 3FY1A 4Z2HA 3KZ7A 3BMBA 2VCDA 1FKFA 3ARSA 1RD6A 3IHZA 4ZPWR 1OGGA 4JFKA 3B9DA 1H0IA 4DRIA 2LGOA 1L1PA 2PV1A 3KACA 1D2KA 2YBTA 1YATA 4U86A 1EYMA 3ARXA 2DT2A 3MDYB 2ESCA 2DG3A 2F2DA 4P8XA 4JFJA 2F23A 2PV3A 3IKGA 1GPFA 3NTPA 3WQVA 2MLZA 3O5PA 3GPKA 4W9OA 1GOIA 5HUAA 2XPAA 1FKRA 1XHGA 4IQ2A 4TW7A 2O9OA 4WKHA 2ZR6A 2LJ4A 4IT4A 4C02B 2DSWA 4DRJA 3ARRA 3KADA 1FFRA 1OWQA 2OLHA 1WNOA 3ARTA 4R0XA 1JCHB 3W4RA 1D6OA 1R9HA 4LGXA 4LAYA 2XP7A 3B8SA 4GIVA 3VAWA 1FAPA 2RSEA 4TW8A 2DG4A 3WD2A 2ZR5A 4DRHA 1FKBA 3GU0A 1K9TA 3TCZA 2XP8A 1HJXA 1ZL1A 3AS3A 1Q6HA 1XRVA 3UQAA 1F40A 5JH8A 2IF4A 3PA7A 5D75A 4NZCA 1ZBVA 2KE0A 2JZVA 4ODKA 4JFMA 1EDQA 1Y0OA 1J4RA 1GUVA 2RQSA 2ZQSA 1J4HA 5DIUA 1LJYA 3GTYX 3CGNA 4TX0A 3AS0A 4IQCA 3WL0A 3WD0A 2DT0A 3RM9A 3ARUA 1FD9A 2B5UB 1HKJA 1E6RA 3H9RB 5GQBA 4W5UA 2L2SA 2M2AA 3ARQA 2RUDA 3CHEA 1YW5A 1FKGA 3PR9A 4QZVB 3AROA 4XAKA 4DRQA 4R5EA 2WLYA 3ARPA 4MTVA 4FAPA 5HWBA 4AY1A 3O5IA 4JYSA 1UR8A 1FKHA 3O5QA 4LAVA 1D7JA 2WLZA 3IKDA 1LG1A 3O5KA 4Q7NA 5DIVA 4MNLA 1JNSA 1QPLA 4Q22A 4Z2IA 3B9EA 4WJXA 4JFLA 4L72B 4DWSC 1W1TA 4ODNA 1E9LA 2A3EA 1W1VA 2N87A 1QZ2A 3O5DA 2RUQA 4P8VA 4TW6A 2Q5AA 2ZQTA 3WD3A 3FXYA 3OOBA 5HKGA 2MLXA 2UZ5A 3CHDA 3O5OA 2ZR4A 3RM4A 3B9AA 4P8UA 2KGJA 1W9UA 2ZQUA 2B31A 2EULA 3ALGA 1E6NA 3WL1A 4DRMA 2PN0A 2QF8A 2ZQVA 3BXWA 4HBEA 2KFWA 4FN2A 2A3AA 1B6CA 1FKLA 1KT1A 2XP5A 3RFWA 2PBCA 4DWSD 3ARVA 4MSPA 4ZPVR 5GPRA 2A3BA 1HKIA 1HKKA 5BXJA 3KAGA 4LAWA 4TNSA 4DROA 4W9PA 1NSGA 1KFWA 3O5JA 1NWSA 4NNRA 3AS1A 2G8ZA 1M5YA
chains in the Genus database with same CATH topology
2AOSA 3AS2A 2MF9A 4DRNA 1HKMA 4QT2A 4U84A 1P5QA 1PBKA 2PPNA 3PRBA 1J4IA 5DO2A 4MNKA 4ODRA 4IT6A 3RMEA 1TCOC 1X6LA 1E6ZA 2G41A 1ZB5A 3KABA 2DSZA 1NWRA 3O5FA 1TFVA 1IX5A 4ODPA 1W1YA 4S3KA 3WD1A 1Q6IA 1Q6UA 2PPOA 1FJDA 4TYOA 4U85A 4N19A 1NWUA 4Z2JA 1LL7A 2F21A 3UF8A 4L3NA 2DG9A 2M08A 2RUCA 3JYMA 4ODLA 3G6LA 1SR0A 1PINA 1W26A 1JNDA 1FKTA 3WD4A 4J4OA 4BF8A 4DZ2A 3B7XA 2IUZA 1BKFA 2FKEA 3NI6A 3UI5A 1ZBCA 3CGMA 1NMWA 1NWTA 1QPFA 1D7IA 4DH0A 3WQWA 1E6PA 3ALFA 4MNMA 1JNTA 1J6YA 2DSUA 4ML4A 5DITA 4DRKA 1WB0A 3WH0A 5HTGA 3PRDA 1EHNA 4Z2KA 3CH9A 2RURA 2MLYA 1NMVA 4Z2GA 1FKJA 1Q1CA 4QIBA 3ODKA 1HXVA 1F8AB 3KCEA 3O5RA 3OA5A 1E15A 1LL6A 1BL4A 1EIBA 1ZK6A 4KQZA 2FAPA 3LUOA 4MGVA 4O2TA 1JVWA 2VN1A 1WAWA 2XP3A 4DT4A 4Z2LA 2KI3A 1NH6A 5J6EA 4ODQA 1A7XA 3ARZA 1W9VA 2Y78A 5HW7A 4WKAA 1VF8A 4WK9A 1FKDA 3O5EA 1C9HA 2K8IA 2LPVA 5I98A 2PPPA 4HBOA 1LL4A 4ZPTR 3TC5A 3PRAA 3KAIA 5DF0A 3KAFA 1FFQA 1W1PA 4W9QA 3NRKA 3CHFA 2WM0A 3O5GA 3TDBA 2DSVA 5HBFA 4DIPA 1U79A 1N1AA 2AWGA 2DPEA 4DRPA 3ARYA 1LQ0A 4J4NA 1SYTA 2KO7A 3AQUA 4PTMA 4ODMA 1JNEA 4WKFA 1FKKA 1ZBKA 2M1IA 1ROUA 3G6MA 4MNJA 4GGQA 4ODOA 4DWSB 5HT1A 2XP9A 3CZ8A 1FKIA 1ROTA 2MNTA 1O6IA 2KR7A 4DWSA 4QT3A 2DT1A 2YBUA 4JFIA 2LKNA 3IK8A 5DEZA 2DT3A 3KAHA 1HJVA 4DZ3A 3ARWA 3O5LA 2XP6A 3JYJA 2ITKA 5HWCA 2WK2A 4HARA 3UI4A 4KR0B 3O5MA 2A3CA 1ZBWA 4G50A 1W9PA 5GPGA 2F4EA 1ITXA 2XPBA 1FKSA 4IPXA 2OFNA 3UI6A 1KT0A 1OGBA 3JXVA 3RM8A 2PV2A 1HJWA 4MAVA 4WIWA 2XP4A 3RGCA 1ZCNA 1UR9A 1LG2A 5B8IC 1D7HA 3UQIA 4ZS6A 4G2PA 4URIA 5HW6A 4P8WA 1EQ3A 2MPHA 2PI6A 1H0GA 3FAPA 1X6NA 1T11A 1CTNA 3I6CA 4S3JA 2FDMA 4LAXA 4MPKA 4NSBA 1ZU8A 4ITZA 3WIJA 3WKZA 2O92A 3UQBA 3EY6A 5HW8A 3CHCA 2D9FA 3QOKA 3FY1A 4Z2HA 3KZ7A 2VCDA 1FKFA 3ARSA 1RD6A 3IHZA 4ZPWR 1OGGA 4JFKA 3B9DA 1H0IA 4DRIA 2LGOA 1L1PA 2PV1A 3KACA 1D2KA 2YBTA 1YATA 4U86A 1EYMA 3ARXA 2DT2A 3MDYB 2ESCA 2DG3A 2F2DA 4P8XA 4JFJA 2PV3A 3IKGA 1GPFA 3NTPA 3WQVA 2MLZA 3O5PA 3GPKA 4W9OA 1GOIA 5HUAA 2XPAA 1FKRA 1XHGA 4IQ2A 4TW7A 2O9OA 4WKHA 2ZR6A 2LJ4A 4IT4A 4C02B 2DSWA 4DRJA 3ARRA 3KADA 1FFRA 1OWQA 2OLHA 1WNOA 3ARTA 4R0XA 3W4RA 1D6OA 1R9HA 4LGXA 4LAYA 2XP7A 3B8SA 4GIVA 3VAWA 1FAPA 2RSEA 4TW8A 2DG4A 3WD2A 2ZR5A 4DRHA 1FKBA 1K9TA 3TCZA 2XP8A 1HJXA 1ZL1A 3AS3A 1Q6HA 1XRVA 3UQAA 1F40A 5JH8A 2IF4A 3PA7A 5D75A 4NZCA 1ZBVA 2KE0A 2JZVA 4ODKA 4JFMA 1EDQA 1Y0OA 1J4RA 1GUVA 2RQSA 2ZQSA 1J4HA 5DIUA 1LJYA 4TX0A 3CGNA 3AS0A 4IQCA 3WL0A 3WD0A 2DT0A 3RM9A 3ARUA 1FD9A 1HKJA 1E6RA 3H9RB 5GQBA 4W5UA 2L2SA 2M2AA 3ARQA 2RUDA 3CHEA 1YW5A 1FKGA 3PR9A 4QZVB 3AROA 4XAKA 4DRQA 4R5EA 2WLYA 3ARPA 4MTVA 4FAPA 5HWBA 4AY1A 3O5IA 4JYSA 1UR8A 1FKHA 3O5QA 4LAVA 1D7JA 2WLZA 3IKDA 1LG1A 3O5KA 4Q7NA 5DIVA 4MNLA 1JNSA 1QPLA 4Q22A 4Z2IA 3B9EA 4WJXA 4JFLA 4L72B 4DWSC 1W1TA 4ODNA 1E9LA 2A3EA 1W1VA 2N87A 1QZ2A 3O5DA 2RUQA 4P8VA 4TW6A 2Q5AA 2ZQTA 3WD3A 3FXYA 3OOBA 5HKGA 2MLXA 2UZ5A 3CHDA 3O5OA 2ZR4A 3RM4A 3B9AA 4P8UA 2KGJA 1W9UA 2ZQUA 2B31A 3WL1A 3ALGA 1E6NA 4DRMA 2QF8A 2ZQVA 3BXWA 4HBEA 2KFWA 4FN2A 2A3AA 1B6CA 1FKLA 1KT1A 2XP5A 3RFWA 2PBCA 4DWSD 3ARVA 4MSPA 4ZPVR 5GPRA 2A3BA 1HKIA 1HKKA 5BXJA 3KAGA 4LAWA 4TNSA 4DROA 4W9PA 1NSGA 1KFWA 3O5JA 1NWSA 4NNRA 3AS1A 2G8ZA 1M5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4H A;  2K8I A;  2LPV A;  2D9F A;  5DIU A;  5I98 A;  4TX0 A;  3CGN A;  2PPP A;  2MF9 A;  4IQC A;  4DRN A;  4QT2 A;  4U84 A;  1P5Q A;  1PBK A;  2PPN A;  1JNS A;  3KZ7 A;  3TC5 A;  3PRB A;  3KAI A;  2VCD A;  1FKF A;  3KAF A;  1J4I A;  4W9Q A;  3IHZ A;  3NRK A;  4ODR A;  1FD9 A;  3O5G A;  3TDB A;  1TCO C;  4JFK A;  4DIP A;  1U79 A;  1N1A A;  2AWG A;  4DRP A;  4DRI A;  2LGO A;  4J4N A;  2KO7 A;  1L1P A;  2PV1 A;  3KAC A;  3H9R B;  3KAB A;  1YAT A;  4U86 A;  1EYM A;  3O5F A;  2L2S A;  2M2A A;  4DRO A;  2RUD A;  4ODP A;  1YW5 A;  1FKG A;  3MDY B;  4ODM A;  5HW8 A;  1FKK A;  1Q6I A;  1Q6U A;  4DRQ A;  2M1I A;  2PPO A;  2DG3 A;  2F2D A;  1FJD A;  4TYO A;  4U85 A;  4JFJ A;  4N19 A;  1ROU A;  2PV3 A;  4FAP A;  3IKG A;  5HWB A;  4GGQ A;  3NTP A;  4ODO A;  5HT1 A;  2XP9 A;  5HUA A;  1FKI A;  1ROT A;  2F21 A;  2MNT A;  2MLZ A;  3O5P A;  3GPK A;  2KR7 A;  3O5I A;  4JYS A;  4W9O A;  3UF8 A;  2DG9 A;  1FKH A;  2M08 A;  2RUC A;  2XPA A;  3JYM A;  4QT3 A;  3O5Q A;  4LAV A;  4ODL A;  1D7J A;  1PIN A;  2LKN A;  4JFI A;  1W26 A;  3IK8 A;  1FKT A;  3KAH A;  4DZ3 A;  3IKD A;  4J4O A;  4BF8 A;  4DZ2 A;  3O5K A;  4IQ2 A;  3B7X A;  3O5L A;  4TW7 A;  5DIV A;  1BKF A;  1QPL A;  2FKE A;  2XP6 A;  3WH0 A;  3JYJ A;  3NI6 A;  3UI5 A;  2ITK A;  5HTG A;  2ZR6 A;  5HWC A;  3CGM A;  2LJ4 A;  1NMW A;  1QPF A;  4C02 B;  3UI4 A;  1D7I A;  3O5M A;  4W9P A;  4DRJ A;  4JFL A;  3KAD A;  4DH0 A;  4G50 A;  4ODN A;  4R0X A;  2N87 A;  1D6O A;  1JNT A;  1QZ2 A;  2F4E A;  1R9H A;  5GPG A;  1J6Y A;  4LAY A;  2XPB A;  4IPX A;  1FKS A;  3O5D A;  2RUQ A;  2OFN A;  3UI6 A;  5DIT A;  2XP7 A;  4DRK A;  4TW6 A;  4GIV A;  3VAW A;  2Q5A A;  3PRD A;  1FAP A;  2ZQT A;  1KT0 A;  2RSE A;  3JXV A;  4TW8 A;  2PV2 A;  2RUR A;  3OOB A;  2MLX A;  5HKG A;  2UZ5 A;  2DG4 A;  3O5O A;  2MLY A;  1NMV A;  2ZR4 A;  1FKJ A;  1Q1C A;  4QIB A;  2KGJ A;  2XP4 A;  3ODK A;  3RGC A;  2ZQU A;  2ZR5 A;  4DRM A;  1F8A B;  1ZCN A;  1FKB A;  3KCE A;  3O5R A;  4DRH A;  1HXV A;  2ZQV A;  3TCZ A;  2XP8 A;  5B8I C;  1D7H A;  1BL4 A;  2KFW A;  1ZK6 A;  3UQI A;  4G2P A;  5HW6 A;  2FAP A;  3LUO A;  4FN2 A;  4MGV A;  4O2T A;  1JVW A;  1B6C A;  1Q6H A;  1FKL A;  1KT1 A;  2VN1 A;  2XP3 A;  3UQA A;  4DT4 A;  2XP5 A;  2IF4 A;  1F40 A;  1EQ3 A;  3RFW A;  2MPH A;  1FKR A;  2KI3 A;  2PBC A;  5J6E A;  4MSP A;  3FAP A;  3PA7 A;  4ODQ A;  1A7X A;  5D75 A;  2Y78 A;  1T11 A;  5HW7 A;  3I6C A;  5BXJ A;  3KAG A;  4LAW A;  4LAX A;  4TNS A;  2KE0 A;  2JZV A;  1FKD A;  1NSG A;  3O5E A;  3O5J A;  4JFM A;  4ITZ A;  1C9H A;  4NNR A;  4ODK A;  1Y0O A;  3UQB A;  3EY6 A;  1J4R A;  2RQS A;  1M5Y A;  2ZQS A; 
#chains in the Genus database with same CATH topology
 2AOS A;  3AS2 A;  2MF9 A;  4DRN A;  1HKM A;  4QT2 A;  4U84 A;  1P5Q A;  1PBK A;  2PPN A;  3PRB A;  1J4I A;  1E44 A;  5DO2 A;  4MNK A;  4ODR A;  4IT6 A;  3RME A;  1TCO C;  1X6L A;  1E6Z A;  2G41 A;  1ZB5 A;  3KAB A;  2DSZ A;  1NWR A;  3O5F A;  1TFV A;  1IX5 A;  4ODP A;  1W1Y A;  4S3K A;  3WD1 A;  1Q6I A;  1Q6U A;  2PPO A;  1FJD A;  4TYO A;  4U85 A;  4N19 A;  1NWU A;  4Z2J A;  1LL7 A;  2F21 A;  3UF8 A;  4L3N A;  2DG9 A;  2M08 A;  2RUC A;  3JYM A;  4ODL A;  4UDM A;  3G6L A;  1SR0 A;  1PIN A;  1W26 A;  1JND A;  1FKT A;  3WD4 A;  4J4O A;  4BF8 A;  4DZ2 A;  3B7X A;  2IUZ A;  1BKF A;  2FKE A;  3NI6 A;  3UI5 A;  1ZBC A;  3CGM A;  1NMW A;  1NWT A;  1QPF A;  1D7I A;  4DH0 A;  3WQW A;  1E6P A;  3ALF A;  4MNM A;  1JNT A;  1J6Y A;  2DSU A;  4ML4 A;  5DIT A;  4DRK A;  1WB0 A;  3WH0 A;  5HTG A;  3PRD A;  1EHN A;  4Z2K A;  3CH9 A;  2RUR A;  2MLY A;  1NMV A;  4Z2G A;  1FKJ A;  1Q1C A;  4QIB A;  3ODK A;  1HXV A;  1F8A B;  3KCE A;  3O5R A;  3OA5 A;  1E15 A;  1LL6 A;  1BL4 A;  1EIB A;  1ZK6 A;  4KQZ A;  2FAP A;  3LUO A;  4MGV A;  4O2T A;  1JVW A;  2VN1 A;  1WAW A;  2XP3 A;  4DT4 A;  4Z2L A;  2KI3 A;  1NH6 A;  5J6E A;  4ODQ A;  1A7X A;  3ARZ A;  1W9V A;  2Y78 A;  5HW7 A;  4WKA A;  1VF8 A;  4WK9 A;  1FKD A;  3O5E A;  1C9H A;  2K8I A;  2LPV A;  5I98 A;  2PPP A;  4HBO A;  1LL4 A;  4ZPT R;  3TC5 A;  3PRA A;  3KAI A;  5DF0 A;  3KAF A;  1FFQ A;  1W1P A;  4W9Q A;  2P4V A;  3NRK A;  3CHF A;  2WM0 A;  3O5G A;  3TDB A;  2DSV A;  5HBF A;  4DIP A;  1U79 A;  1N1A A;  2AWG A;  2DPE A;  4DRP A;  3ARY A;  1LQ0 A;  4J4N A;  1SYT A;  2KO7 A;  3AQU A;  4PTM A;  4ODM A;  1JNE A;  4WKF A;  1FKK A;  1ZBK A;  2M1I A;  1ROU A;  3G6M A;  4MNJ A;  4GGQ A;  4ODO A;  4DWS B;  5HT1 A;  2XP9 A;  3CZ8 A;  1FKI A;  1ROT A;  2MNT A;  1O6I A;  2KR7 A;  4DWS A;  4QT3 A;  2DT1 A;  2YBU A;  2LKN A;  4JFI A;  3IK8 A;  5DEZ A;  2DT3 A;  3KAH A;  1HJV A;  4DZ3 A;  3ARW A;  3O5L A;  2XP6 A;  3JYJ A;  2ITK A;  5HWC A;  2WK2 A;  4HAR A;  1GRJ A;  3UI4 A;  4KR0 B;  3O5M A;  2A3C A;  1ZBW A;  4G50 A;  1W9P A;  5GPG A;  2F4E A;  1ITX A;  2XPB A;  1FKS A;  4IPX A;  2OFN A;  3UI6 A;  1KT0 A;  1OGB A;  3JXV A;  3RM8 A;  2PV2 A;  1HJW A;  4MAV A;  4WIW A;  2XP4 A;  3RGC A;  3EIP A;  1ZCN A;  1UR9 A;  1LG2 A;  5B8I C;  1D7H A;  3UQI A;  4ZS6 A;  4G2P A;  4URI A;  5HW6 A;  4P8W A;  1EQ3 A;  2MPH A;  2PI6 A;  1H0G A;  3FAP A;  1X6N A;  1T11 A;  1CTN A;  3I6C A;  4S3J A;  2FDM A;  4LAX A;  4MPK A;  4NSB A;  1ZU8 A;  4ITZ A;  3WIJ A;  3WKZ A;  2O92 A;  3UQB A;  3EY6 A;  5HW8 A;  3CHC A;  2D9F A;  2ETN A;  3QOK A;  3FY1 A;  4Z2H A;  3KZ7 A;  3BMB A;  2VCD A;  1FKF A;  3ARS A;  1RD6 A;  3IHZ A;  4ZPW R;  1OGG A;  4JFK A;  3B9D A;  1H0I A;  4DRI A;  2LGO A;  1L1P A;  2PV1 A;  3KAC A;  1D2K A;  2YBT A;  1YAT A;  4U86 A;  1EYM A;  3ARX A;  2DT2 A;  3MDY B;  2ESC A;  2DG3 A;  2F2D A;  4P8X A;  4JFJ A;  2F23 A;  2PV3 A;  3IKG A;  1GPF A;  3NTP A;  3WQV A;  2MLZ A;  3O5P A;  3GPK A;  4W9O A;  1GOI A;  5HUA A;  2XPA A;  1FKR A;  1XHG A;  4IQ2 A;  4TW7 A;  2O9O A;  4WKH A;  2ZR6 A;  2LJ4 A;  4IT4 A;  4C02 B;  2DSW A;  4DRJ A;  3ARR A;  3KAD A;  1FFR A;  1OWQ A;  2OLH A;  1WNO A;  3ART A;  4R0X A;  1JCH B;  3W4R A;  1D6O A;  1R9H A;  4LGX A;  4LAY A;  2XP7 A;  3B8S A;  4GIV A;  3VAW A;  1FAP A;  2RSE A;  4TW8 A;  2DG4 A;  3WD2 A;  2ZR5 A;  4DRH A;  1FKB A;  3GU0 A;  1K9T A;  3TCZ A;  2XP8 A;  1HJX A;  1ZL1 A;  3AS3 A;  1Q6H A;  1XRV A;  3UQA A;  1F40 A;  5JH8 A;  2IF4 A;  3PA7 A;  5D75 A;  4NZC A;  1ZBV A;  2KE0 A;  2JZV A;  4ODK A;  4JFM A;  1EDQ A;  1Y0O A;  1J4R A;  1GUV A;  2RQS A;  2ZQS A;  1J4H A;  5DIU A;  1LJY A;  3GTY X;  3CGN A;  4TX0 A;  3AS0 A;  4IQC A;  3WL0 A;  3WD0 A;  2DT0 A;  3RM9 A;  3ARU A;  1FD9 A;  2B5U B;  1HKJ A;  1E6R A;  3H9R B;  5GQB A;  4W5U A;  2L2S A;  2M2A A;  3ARQ A;  2RUD A;  3CHE A;  1YW5 A;  1FKG A;  3PR9 A;  4QZV B;  3ARO A;  4XAK A;  4DRQ A;  4R5E A;  2WLY A;  3ARP A;  4MTV A;  4FAP A;  5HWB A;  4AY1 A;  3O5I A;  4JYS A;  1UR8 A;  1FKH A;  3O5Q A;  4LAV A;  1D7J A;  2WLZ A;  3IKD A;  1LG1 A;  3O5K A;  4Q7N A;  5DIV A;  4MNL A;  1JNS A;  1QPL A;  4Q22 A;  4Z2I A;  3B9E A;  4WJX A;  4JFL A;  4L72 B;  4DWS C;  1W1T A;  4ODN A;  1E9L A;  2A3E A;  1W1V A;  2N87 A;  1QZ2 A;  3O5D A;  2RUQ A;  4P8V A;  4TW6 A;  2Q5A A;  2ZQT A;  3WD3 A;  3FXY A;  3OOB A;  5HKG A;  2MLX A;  2UZ5 A;  3CHD A;  3O5O A;  2ZR4 A;  3RM4 A;  3B9A A;  4P8U A;  2KGJ A;  1W9U A;  2ZQU A;  2B31 A;  2EUL A;  3ALG A;  1E6N A;  3WL1 A;  4DRM A;  2PN0 A;  2QF8 A;  2ZQV A;  3BXW A;  4HBE A;  2KFW A;  4FN2 A;  2A3A A;  1B6C A;  1FKL A;  1KT1 A;  2XP5 A;  3RFW A;  2PBC A;  4DWS D;  3ARV A;  4MSP A;  4ZPV R;  5GPR A;  2A3B A;  1HKI A;  1HKK A;  5BXJ A;  3KAG A;  4LAW A;  4TNS A;  4DRO A;  4W9P A;  1NSG A;  1KFW A;  3O5J A;  1NWS A;  4NNR A;  3AS1 A;  2G8Z A;  1M5Y A; 
#chains in the Genus database with same CATH homology
 2AOS A;  3AS2 A;  2MF9 A;  4DRN A;  1HKM A;  4QT2 A;  4U84 A;  1P5Q A;  1PBK A;  2PPN A;  3PRB A;  1J4I A;  5DO2 A;  4MNK A;  4ODR A;  4IT6 A;  3RME A;  1TCO C;  1X6L A;  1E6Z A;  2G41 A;  1ZB5 A;  3KAB A;  2DSZ A;  1NWR A;  3O5F A;  1TFV A;  1IX5 A;  4ODP A;  1W1Y A;  4S3K A;  3WD1 A;  1Q6I A;  1Q6U A;  2PPO A;  1FJD A;  4TYO A;  4U85 A;  4N19 A;  1NWU A;  4Z2J A;  1LL7 A;  2F21 A;  3UF8 A;  4L3N A;  2DG9 A;  2M08 A;  2RUC A;  3JYM A;  4ODL A;  3G6L A;  1SR0 A;  1PIN A;  1W26 A;  1JND A;  1FKT A;  3WD4 A;  4J4O A;  4BF8 A;  4DZ2 A;  3B7X A;  2IUZ A;  1BKF A;  2FKE A;  3NI6 A;  3UI5 A;  1ZBC A;  3CGM A;  1NMW A;  1NWT A;  1QPF A;  1D7I A;  4DH0 A;  3WQW A;  1E6P A;  3ALF A;  4MNM A;  1JNT A;  1J6Y A;  2DSU A;  4ML4 A;  5DIT A;  4DRK A;  1WB0 A;  3WH0 A;  5HTG A;  3PRD A;  1EHN A;  4Z2K A;  3CH9 A;  2RUR A;  2MLY A;  1NMV A;  4Z2G A;  1FKJ A;  1Q1C A;  4QIB A;  3ODK A;  1HXV A;  1F8A B;  3KCE A;  3O5R A;  3OA5 A;  1E15 A;  1LL6 A;  1BL4 A;  1EIB A;  1ZK6 A;  4KQZ A;  2FAP A;  3LUO A;  4MGV A;  4O2T A;  1JVW A;  2VN1 A;  1WAW A;  2XP3 A;  4DT4 A;  4Z2L A;  2KI3 A;  1NH6 A;  5J6E A;  4ODQ A;  1A7X A;  3ARZ A;  1W9V A;  2Y78 A;  5HW7 A;  4WKA A;  1VF8 A;  4WK9 A;  1FKD A;  3O5E A;  1C9H A;  2K8I A;  2LPV A;  5I98 A;  2PPP A;  4HBO A;  1LL4 A;  4ZPT R;  3TC5 A;  3PRA A;  3KAI A;  5DF0 A;  3KAF A;  1FFQ A;  1W1P A;  4W9Q A;  3NRK A;  3CHF A;  2WM0 A;  3O5G A;  3TDB A;  2DSV A;  5HBF A;  4DIP A;  1U79 A;  1N1A A;  2AWG A;  2DPE A;  4DRP A;  3ARY A;  1LQ0 A;  4J4N A;  1SYT A;  2KO7 A;  3AQU A;  4PTM A;  4ODM A;  1JNE A;  4WKF A;  1FKK A;  1ZBK A;  2M1I A;  1ROU A;  3G6M A;  4MNJ A;  4GGQ A;  4ODO A;  4DWS B;  5HT1 A;  2XP9 A;  3CZ8 A;  1FKI A;  1ROT A;  2MNT A;  1O6I A;  2KR7 A;  4DWS A;  4QT3 A;  2DT1 A;  2YBU A;  4JFI A;  2LKN A;  3IK8 A;  5DEZ A;  2DT3 A;  3KAH A;  1HJV A;  4DZ3 A;  3ARW A;  3O5L A;  2XP6 A;  3JYJ A;  2ITK A;  5HWC A;  2WK2 A;  4HAR A;  3UI4 A;  4KR0 B;  3O5M A;  2A3C A;  1ZBW A;  4G50 A;  1W9P A;  5GPG A;  2F4E A;  1ITX A;  2XPB A;  1FKS A;  4IPX A;  2OFN A;  3UI6 A;  1KT0 A;  1OGB A;  3JXV A;  3RM8 A;  2PV2 A;  1HJW A;  4MAV A;  4WIW A;  2XP4 A;  3RGC A;  1ZCN A;  1UR9 A;  1LG2 A;  5B8I C;  1D7H A;  3UQI A;  4ZS6 A;  4G2P A;  4URI A;  5HW6 A;  4P8W A;  1EQ3 A;  2MPH A;  2PI6 A;  1H0G A;  3FAP A;  1X6N A;  1T11 A;  1CTN A;  3I6C A;  4S3J A;  2FDM A;  4LAX A;  4MPK A;  4NSB A;  1ZU8 A;  4ITZ A;  3WIJ A;  3WKZ A;  2O92 A;  3UQB A;  3EY6 A;  5HW8 A;  3CHC A;  2D9F A;  3QOK A;  3FY1 A;  4Z2H A;  3KZ7 A;  2VCD A;  1FKF A;  3ARS A;  1RD6 A;  3IHZ A;  4ZPW R;  1OGG A;  4JFK A;  3B9D A;  1H0I A;  4DRI A;  2LGO A;  1L1P A;  2PV1 A;  3KAC A;  1D2K A;  2YBT A;  1YAT A;  4U86 A;  1EYM A;  3ARX A;  2DT2 A;  3MDY B;  2ESC A;  2DG3 A;  2F2D A;  4P8X A;  4JFJ A;  2PV3 A;  3IKG A;  1GPF A;  3NTP A;  3WQV A;  2MLZ A;  3O5P A;  3GPK A;  4W9O A;  1GOI A;  5HUA A;  2XPA A;  1FKR A;  1XHG A;  4IQ2 A;  4TW7 A;  2O9O A;  4WKH A;  2ZR6 A;  2LJ4 A;  4IT4 A;  4C02 B;  2DSW A;  4DRJ A;  3ARR A;  3KAD A;  1FFR A;  1OWQ A;  2OLH A;  1WNO A;  3ART A;  4R0X A;  3W4R A;  1D6O A;  1R9H A;  4LGX A;  4LAY A;  2XP7 A;  3B8S A;  4GIV A;  3VAW A;  1FAP A;  2RSE A;  4TW8 A;  2DG4 A;  3WD2 A;  2ZR5 A;  4DRH A;  1FKB A;  1K9T A;  3TCZ A;  2XP8 A;  1HJX A;  1ZL1 A;  3AS3 A;  1Q6H A;  1XRV A;  3UQA A;  1F40 A;  5JH8 A;  2IF4 A;  3PA7 A;  5D75 A;  4NZC A;  1ZBV A;  2KE0 A;  2JZV A;  4ODK A;  4JFM A;  1EDQ A;  1Y0O A;  1J4R A;  1GUV A;  2RQS A;  2ZQS A;  1J4H A;  5DIU A;  1LJY A;  4TX0 A;  3CGN A;  3AS0 A;  4IQC A;  3WL0 A;  3WD0 A;  2DT0 A;  3RM9 A;  3ARU A;  1FD9 A;  1HKJ A;  1E6R A;  3H9R B;  5GQB A;  4W5U A;  2L2S A;  2M2A A;  3ARQ A;  2RUD A;  3CHE A;  1YW5 A;  1FKG A;  3PR9 A;  4QZV B;  3ARO A;  4XAK A;  4DRQ A;  4R5E A;  2WLY A;  3ARP A;  4MTV A;  4FAP A;  5HWB A;  4AY1 A;  3O5I A;  4JYS A;  1UR8 A;  1FKH A;  3O5Q A;  4LAV A;  1D7J A;  2WLZ A;  3IKD A;  1LG1 A;  3O5K A;  4Q7N A;  5DIV A;  4MNL A;  1JNS A;  1QPL A;  4Q22 A;  4Z2I A;  3B9E A;  4WJX A;  4JFL A;  4L72 B;  4DWS C;  1W1T A;  4ODN A;  1E9L A;  2A3E A;  1W1V A;  2N87 A;  1QZ2 A;  3O5D A;  2RUQ A;  4P8V A;  4TW6 A;  2Q5A A;  2ZQT A;  3WD3 A;  3FXY A;  3OOB A;  5HKG A;  2MLX A;  2UZ5 A;  3CHD A;  3O5O A;  2ZR4 A;  3RM4 A;  3B9A A;  4P8U A;  2KGJ A;  1W9U A;  2ZQU A;  2B31 A;  3WL1 A;  3ALG A;  1E6N A;  4DRM A;  2QF8 A;  2ZQV A;  3BXW A;  4HBE A;  2KFW A;  4FN2 A;  2A3A A;  1B6C A;  1FKL A;  1KT1 A;  2XP5 A;  3RFW A;  2PBC A;  4DWS D;  3ARV A;  4MSP A;  4ZPV R;  5GPR A;  2A3B A;  1HKI A;  1HKK A;  5BXJ A;  3KAG A;  4LAW A;  4TNS A;  4DRO A;  4W9P A;  1NSG A;  1KFW A;  3O5J A;  1NWS A;  4NNR A;  3AS1 A;  2G8Z A;  1M5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...