1FKGA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkgA00
1W26A 2DG4A 1FKKA 1BKFA 3NI6A 4ODKA 2XP4A 2FAPA 2XP6A 3KABA 3I6CA 1D7IA 2MNTA 2ZQTA 1A7XA 4DROA 2RQSA 4MGVA 4U86A 3UI5A 3KCEA 1L1PA 4JFIA 4W9QA 1Q6HA 1Q6UA 2KE0A 1YATA 1TCOC 1FKSA 3JYJA 4GGQA 4U85A 1T11A 2XP7A 4ODNA 4JFKA 1NMWA 2KR7A 3UQAA 2F2DA 1Y0OA 2PV2A 2KO7A 4DIPA 3VAWA 4BF8A 4ODQA 3RFWA 1ZK6A 2M1IA 3CGMA 3IKGA 3UQIA 3KAGA 3O5OA 3PRDA 4QIBA 1EYMA 1ROTA 2KGJA 2ZQUA 3O5MA 1FD9A 5HW8A 1BL4A 3EY6A 1ZCNA 4U84A 3TCZA 2Y78A 4DZ3A 4ODMA 4QT2A 3UF8A 3CGNA 3GPKA 3ODKA 5B8IC 1FKJA 3KAIA 2XP8A 2RUDA 1NSGA 4IQCA 1JVWA 1QPFA 4O2TA 5HT1A 5J6EA 1KT0A 4DZ2A 5DITA 1FKIA 5BXJA 1FKHA 4DRPA 3KAHA 1J4RA 3UI4A 2PBCA 4JYSA 2PPOA 2F21A 1F40A 2Q5AA 3O5KA 3PRBA 1D7HA 4C02B 1FKGA 4IPXA 3LUOA 3PA7A 1J4IA 3IK8A 2XP3A 2XPAA 4ODOA 4DRMA 1FKRA 3TC5A 3O5FA 4DRKA 1FKTA 1QZ2A 2F4EA 3JXVA 5I98A 2VCDA 1M5YA 4TW6A 5HW7A 2AWGA 2PPNA 5HWCA 2MLXA 4FAPA 1F8AB 4G2PA 4ODPA 5DIVA 2M08A 3O5GA 3MDYB 4LAVA 3O5RA 1FJDA 2LGOA 2LJ4A 1FKBA 2MPHA 4TW8A 3UI6A 3NTPA 1N1AA 1JNTA 4J4OA 3JYMA 4IQ2A 2JZVA 1D6OA 2VN1A 2L2SA 4NNRA 5HUAA 1FKLA 1R9HA 1C9HA 3H9RB 4LAWA 5DIUA 5GPGA 3UQBA 2OFNA 4W9OA 5HTGA 2KI3A 2RURA 4TNSA 4TX0A 3B7XA 1Q6IA 5HKGA 1KT1A 4QT3A 2PV3A 2MLYA 2PV1A 5HWBA 1HXVA 2IF4A 2K8IA 1P5QA 1QPLA 1NMVA 3TDBA 2ZR5A 2KFWA 2LKNA 2ZR6A 3FAPA 3KACA 4J4NA 4MSPA 1ROUA 2UZ5A 1PINA 2XP5A 4G50A 3WH0A 2ZQVA 2D9FA 4LAXA 1B6CA 2RUCA 2RUQA 3KAFA 5HW6A 3O5QA 3KZ7A 3O5IA 4ITZA 3RGCA 3O5PA 3O5DA 1EQ3A 1FAPA 4TYOA 4W9PA 2DG3A 2MF9A 2N87A 2ZQSA 2LPVA 4DT4A 2XPBA 1Q1CA 4DRHA 2RSEA 4DH0A 1FKFA 3OOBA 3NRKA 4JFJA 4ODLA 3O5LA 4R0XA 2M2AA 1PBKA 1YW5A 3O5JA 2DG9A 4FN2A 1JNSA 3IHZA 1D7JA 2FKEA 4JFMA 4JFLA 4TW7A 2MLZA 5D75A 4LAYA 2ITKA 4DRJA 4DRIA 1FKDA 4DRNA 2XP9A 2ZR4A 1U79A 1J4HA 3IKDA 3KADA 3O5EA 4GIVA 4ODRA 1J6YA 4N19A 4DRQA 2PPPA
chains in the Genus database with same CATH superfamily
2WK2A 1FKKA 4ODKA 3EIPA 1CTNA 3KABA 4Q22A 3CHDA 4U86A 3ARTA 4W9QA 1YATA 3RM9A 3JYJA 4GGQA 2F2DA 3VAWA 4BF8A 4ODQA 2A3EA 2DT2A 1EDQA 2WM0A 3KAGA 3AQUA 3O5OA 1NWSA 3ARVA 3O5MA 2KGJA 3AS2A 3TCZA 2Y78A 4DZ3A 1W1VA 3KAIA 2XP8A 3B9AA 2RUDA 2PN0A 1ZB5A 1QPFA 4O2TA 5DITA 2A3CA 4JYSA 2PPOA 1D2KA 1FKGA 1E6PA 3LUOA 4DRMA 4ODOA 3BMBA 1FKRA 3TC5A 4DRKA 1QZ2A 4WJXA 1GUVA 3CH9A 4FAPA 1F8AB 4ODPA 1WNOA 3MDYB 4LAVA 2YBTA 1N1AA 1JNTA 3JYMA 3CHCA 1D6OA 4ZS6A 4AY1A 4NNRA 3ARWA 1FKLA 1JNEA 3H9RB 1NWTA 4DWSC 2O92A 4TX0A 3B9EA 1XRVA 2WLZA 1P5QA 1H0IA 1QPLA 1NMVA 3TDBA 4QZVB 2UZ5A 2ZQVA 1B6CA 2RUQA 1HKMA 3O5QA 4ITZA 3ARXA 3QOKA 1EQ3A 4DT4A 2XPBA 3OOBA 4ODLA 3GU0A 4FN2A 3FXYA 3WL1A 4LGXA 1D7JA 2FKEA 4JFLA 4TW7A 3B8SA 3B9DA 1E6NA 1J4HA 1U79A 1WAWA 4GIVA 4ODRA 1J6YA 4Q7NA 2PPPA 2DG4A 1HJXA 2XP4A 2FAPA 4WK9A 3RM4A 1D7IA 4MNMA 1A7XA 2A3AA 4URIA 4U85A 4WKFA 1NMWA 4Z2GA 3CZ8A 2KO7A 3AROA 3RFWA 1NWUA 1W9PA 1ZU8A 2G41A 4UDMA 1EHNA 1ZCNA 4U84A 3ARRA 3WIJA 4ODMA 4P8UA 3UF8A 3ODKA 5B8IC 2B31A 1O6IA 1NSGA 1JVWA 5J6EA 1KT0A 4DZ2A 4Z2JA 1E6ZA 1W9UA 1W1TA 1KFWA 2PBCA 1HKJA 2F21A 2Q5AA 3O5KA 1D7HA 3WD2A 1GOIA 1J4IA 3IK8A 2XPAA 1FKTA 2F4EA 3ARYA 5I98A 1M5YA 4TW6A 1UR8A 2AWGA 4MPKA 2DT3A 5DIVA 3O5GA 1FJDA 2LGOA 4ML4A 2LJ4A 2G8ZA 4TW8A 2DSWA 2L2SA 3G6LA 5HUAA 1R9HA 1C9HA 3WD1A 3UQBA 5JH8A 3GTYX 2KI3A 2RURA 4MAVA 5HKGA 1KT1A 4QT3A 5HWBA 1UR9A 3WD4A 2ZR5A 3CHEA 2KFWA 4P8WA 4J4NA 4MSPA 1HJWA 1ROUA 3ARQA 1WB0A 4LAXA 4S3JA 2RUCA 3KAFA 1X6LA 1HKIA 1FAPA 4P8VA 2DG3A 2N87A 2ZQSA 4MTVA 4DRHA 2RSEA 1FKFA 5DEZA 4JFJA 2M2AA 4KQZA 2DSUA 1JNSA 4DRJA 1FKDA 3WD0A 4DRNA 1LG2A 4DWSA 4N19A 1JNDA 1W26A 4Z2IA 1BKFA 5HBFA 2DSZA 5DF0A 3I6CA 3ARPA 2IUZA 1K9TA 2MNTA 3ALFA 2ZQTA 4DROA 1E44A 2RQSA 1LL7A 4MGVA 3UI5A 3KCEA 4JFIA 4HBEA 1Q6HA 1TCOC 1FKSA 4XAKA 1T11A 5DO2A 2XP7A 3ARZA 3UQAA 1Y0OA 1W1PA 4DIPA 1OGGA 3CGMA 3IKGA 4ZPTR 3PRDA 4S3KA 1FD9A 5HW8A 3EY6A 5GPRA 4Z2LA 1XHGA 3CGNA 4DWSB 1IX5A 4R5EA 4IQCA 1E15A 1FFRA 1FKIA 3RMEA 1FKHA 5BXJA 3UI4A 3RM8A 1OWQA 1F40A 3PRBA 3AS0A 2DPEA 3WD3A 3JXVA 1NH6A 1FFQA 2ETNA 2VCDA 5HW7A 2PPNA 2YBUA 4G2PA 2M08A 1HJVA 4W5UA 1ZBKA 1FKBA 2MPHA 3PR9A 1X6NA 3NTPA 4WKHA 4J4OA 4IQ2A 4MNLA 2JZVA 1JCHB 2VN1A 5GPGA 4LAWA 1VF8A 3FY1A 2DT0A 4W9OA 1GPFA 2F23A 4P8XA 5HTGA 2PV3A 2MLYA 2PV1A 4IT4A 1HXVA 4IT6A 4Z2HA 4WIWA 2LKNA 2ZR6A 3FAPA 3KACA 2B5UB 2DSVA 2D9FA 1EIBA 3RGCA 1SR0A 2OLHA 3O5PA 3O5DA 4TYOA 1Q1CA 3NRKA 1PBKA 1YW5A 1SYTA 3W4RA 3IHZA 4JFMA 5D75A 4LAYA 2ITKA 1ZBWA 2ZR4A 3IKDA 4DRQA 3NI6A 2XP6A 1RD6A 1HKKA 4ZPVR 2EULA 1L1PA 1OGBA 1Q6UA 2KE0A 2A3BA 3WL0A 4ODNA 4JFKA 1LJYA 2KR7A 2PV2A 3AS3A 1NWRA 4L72B 1ZK6A 2M1IA 3UQIA 1H0GA 4QIBA 5GQBA 1EYMA 1ROTA 2ZQUA 1BL4A 4QT2A 3GPKA 2AOSA 3PRAA 3WKZA 3AS1A 4MNKA 1FKJA 1LG1A 5HT1A 1ITXA 4NZCA 4L3NA 4DRPA 3KAHA 2PI6A 1J4RA 3CHFA 4C02B 4WKAA 4IPXA 3PA7A 3ARUA 3ALGA 2XP3A 3O5FA 4ZPWR 5HWCA 2ESCA 2MLXA 1TFVA 4HBOA 2QF8A 3O5RA 1GRJA 3UI6A 1W1YA 4DWSD 1ZBCA 4KR0B 3WQWA 1LL4A 1W9VA 5DIUA 2OFNA 4TNSA 3B7XA 2DT1A 1Q6IA 3ARSA 4HARA 2IF4A 2FDMA 2K8IA 4MNJA 1ZBVA 3BXWA 3G6MA 1PINA 2XP5A 1ZL1A 4G50A 3WH0A 4Z2KA 1LL6A 5HW6A 3KZ7A 3O5IA 4W9PA 1LQ0A 2MF9A 2P4VA 2LPVA 4PTMA 4DH0A 2O9OA 3O5LA 4R0XA 3O5JA 2DG9A 1E6RA 2WLYA 2MLZA 4DRIA 2XP9A 3KADA 3WQVA 3O5EA 4NSBA 3OA5A 1E9LA
chains in the Genus database with same CATH topology
2WK2A 1FKKA 4ODKA 1CTNA 3KABA 4Q22A 3CHDA 4U86A 3ARTA 4W9QA 1YATA 3RM9A 3JYJA 4GGQA 2F2DA 3VAWA 4BF8A 4ODQA 2A3EA 2DT2A 1EDQA 2WM0A 3KAGA 3AQUA 3O5OA 1NWSA 3ARVA 3O5MA 2KGJA 3AS2A 3TCZA 2Y78A 4DZ3A 1W1VA 3KAIA 2XP8A 3B9AA 2RUDA 1ZB5A 1QPFA 4O2TA 5DITA 2A3CA 4JYSA 2PPOA 1D2KA 1FKGA 1E6PA 3LUOA 4DRMA 4ODOA 1FKRA 3TC5A 4DRKA 1QZ2A 4WJXA 1GUVA 3CH9A 4FAPA 1F8AB 4ODPA 1WNOA 3MDYB 4LAVA 2YBTA 1N1AA 1JNTA 3JYMA 3CHCA 1D6OA 4ZS6A 4AY1A 4NNRA 3ARWA 1FKLA 1JNEA 3H9RB 1NWTA 4DWSC 2O92A 4TX0A 3B9EA 1XRVA 2WLZA 1P5QA 1H0IA 1QPLA 1NMVA 3TDBA 4QZVB 2UZ5A 2ZQVA 1B6CA 2RUQA 1HKMA 3O5QA 4ITZA 3ARXA 3QOKA 1EQ3A 4DT4A 2XPBA 3OOBA 4ODLA 4FN2A 3FXYA 3WL1A 4LGXA 1D7JA 2FKEA 4JFLA 4TW7A 3B8SA 3B9DA 1E6NA 1J4HA 1U79A 1WAWA 4GIVA 4ODRA 1J6YA 4Q7NA 2PPPA 2DG4A 1HJXA 2XP4A 2FAPA 4WK9A 3RM4A 1D7IA 4MNMA 1A7XA 2A3AA 4URIA 4U85A 4WKFA 1NMWA 4Z2GA 3CZ8A 2KO7A 3AROA 3RFWA 1NWUA 1W9PA 1ZU8A 2G41A 1EHNA 1ZCNA 4U84A 3ARRA 3WIJA 4ODMA 4P8UA 3UF8A 3ODKA 5B8IC 2B31A 1O6IA 1NSGA 1JVWA 5J6EA 1KT0A 4DZ2A 4Z2JA 1E6ZA 1W9UA 1W1TA 1KFWA 2PBCA 1HKJA 2F21A 2Q5AA 3O5KA 1D7HA 3WD2A 1GOIA 1J4IA 3IK8A 2XPAA 1FKTA 2F4EA 3ARYA 5I98A 1M5YA 4TW6A 1UR8A 2AWGA 4MPKA 2DT3A 5DIVA 3O5GA 1FJDA 2LGOA 4ML4A 2LJ4A 2G8ZA 4TW8A 2DSWA 2L2SA 3G6LA 5HUAA 1R9HA 1C9HA 3WD1A 3UQBA 5JH8A 2KI3A 2RURA 4MAVA 5HKGA 1KT1A 4QT3A 5HWBA 1UR9A 3WD4A 2ZR5A 3CHEA 2KFWA 4P8WA 4J4NA 4MSPA 1HJWA 1ROUA 3ARQA 1WB0A 4LAXA 4S3JA 2RUCA 3KAFA 1X6LA 1HKIA 1FAPA 4P8VA 2DG3A 2N87A 2ZQSA 4MTVA 4DRHA 2RSEA 1FKFA 5DEZA 4JFJA 2M2AA 4KQZA 2DSUA 1JNSA 4DRJA 1FKDA 3WD0A 4DRNA 1LG2A 4DWSA 4N19A 1JNDA 1W26A 4Z2IA 1BKFA 5HBFA 2DSZA 5DF0A 3I6CA 3ARPA 2IUZA 1K9TA 2MNTA 3ALFA 2ZQTA 4DROA 2RQSA 4MGVA 1LL7A 3UI5A 3KCEA 4JFIA 4HBEA 1Q6HA 1TCOC 1FKSA 4XAKA 1T11A 5DO2A 2XP7A 3ARZA 3UQAA 1Y0OA 1W1PA 4DIPA 1OGGA 3CGMA 3IKGA 4ZPTR 3PRDA 4S3KA 1FD9A 5HW8A 3EY6A 5GPRA 4Z2LA 1XHGA 3CGNA 4DWSB 1IX5A 4R5EA 4IQCA 1E15A 1FFRA 1FKIA 3RMEA 1FKHA 5BXJA 3UI4A 3RM8A 1OWQA 1F40A 3PRBA 3AS0A 2DPEA 3WD3A 3JXVA 1NH6A 1FFQA 2VCDA 5HW7A 2PPNA 2YBUA 4G2PA 2M08A 1HJVA 4W5UA 1ZBKA 1FKBA 2MPHA 3PR9A 1X6NA 3NTPA 4WKHA 4J4OA 4IQ2A 4MNLA 2JZVA 2VN1A 5GPGA 4LAWA 1VF8A 3FY1A 2DT0A 4W9OA 1GPFA 4P8XA 5HTGA 2PV3A 2MLYA 2PV1A 4IT4A 1HXVA 4IT6A 4Z2HA 4WIWA 2LKNA 2ZR6A 3FAPA 3KACA 2DSVA 2D9FA 1EIBA 3RGCA 1SR0A 2OLHA 3O5PA 3O5DA 4TYOA 1Q1CA 3NRKA 1PBKA 1YW5A 1SYTA 3W4RA 3IHZA 4JFMA 5D75A 4LAYA 2ITKA 1ZBWA 2ZR4A 3IKDA 4DRQA 3NI6A 2XP6A 1RD6A 1HKKA 4ZPVR 1L1PA 1OGBA 1Q6UA 2KE0A 2A3BA 3WL0A 4ODNA 4JFKA 1LJYA 2KR7A 2PV2A 3AS3A 1NWRA 4L72B 1ZK6A 2M1IA 3UQIA 1H0GA 4QIBA 5GQBA 1EYMA 1ROTA 2ZQUA 1BL4A 4QT2A 3GPKA 2AOSA 3PRAA 3WKZA 3AS1A 4MNKA 1FKJA 1LG1A 5HT1A 1ITXA 4NZCA 4L3NA 4DRPA 3KAHA 2PI6A 1J4RA 3CHFA 4C02B 4WKAA 4IPXA 3PA7A 3ARUA 3ALGA 2XP3A 3O5FA 4ZPWR 5HWCA 2ESCA 2MLXA 1TFVA 4HBOA 2QF8A 3O5RA 3UI6A 1W1YA 4DWSD 1ZBCA 4KR0B 3WQWA 1LL4A 1W9VA 5DIUA 2OFNA 4TNSA 3B7XA 2DT1A 1Q6IA 3ARSA 4HARA 2IF4A 2FDMA 2K8IA 4MNJA 1ZBVA 3BXWA 3G6MA 1PINA 2XP5A 1ZL1A 4G50A 3WH0A 4Z2KA 1LL6A 5HW6A 3KZ7A 3O5IA 4W9PA 1LQ0A 2MF9A 4PTMA 2LPVA 4DH0A 2O9OA 3O5LA 4R0XA 3O5JA 2DG9A 1E6RA 2WLYA 2MLZA 4DRIA 2XP9A 3KADA 3WQVA 3O5EA 4NSBA 3OA5A 1E9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W26 A;  2DG4 A;  1FKK A;  1BKF A;  3NI6 A;  4ODK A;  2XP4 A;  2FAP A;  2XP6 A;  3KAB A;  3I6C A;  1D7I A;  2MNT A;  2ZQT A;  1A7X A;  4DRO A;  2RQS A;  4MGV A;  4U86 A;  3UI5 A;  3KCE A;  1L1P A;  4JFI A;  4W9Q A;  1Q6H A;  1Q6U A;  2KE0 A;  1YAT A;  1TCO C;  1FKS A;  3JYJ A;  4GGQ A;  4U85 A;  1T11 A;  2XP7 A;  4ODN A;  4JFK A;  1NMW A;  2KR7 A;  3UQA A;  2F2D A;  1Y0O A;  2PV2 A;  2KO7 A;  4DIP A;  3VAW A;  4BF8 A;  4ODQ A;  3RFW A;  1ZK6 A;  2M1I A;  3CGM A;  3IKG A;  3UQI A;  3KAG A;  3O5O A;  3PRD A;  4QIB A;  1EYM A;  1ROT A;  2KGJ A;  2ZQU A;  3O5M A;  1FD9 A;  5HW8 A;  1BL4 A;  3EY6 A;  1ZCN A;  4U84 A;  3TCZ A;  2Y78 A;  4DZ3 A;  4ODM A;  4QT2 A;  3UF8 A;  3CGN A;  3GPK A;  3ODK A;  5B8I C;  1FKJ A;  3KAI A;  2XP8 A;  2RUD A;  1NSG A;  4IQC A;  1JVW A;  1QPF A;  4O2T A;  5HT1 A;  5J6E A;  1KT0 A;  4DZ2 A;  5DIT A;  1FKI A;  5BXJ A;  1FKH A;  4DRP A;  3KAH A;  1J4R A;  3UI4 A;  2PBC A;  4JYS A;  2PPO A;  2F21 A;  1F40 A;  2Q5A A;  3O5K A;  3PRB A;  1D7H A;  4C02 B;  1FKG A;  4IPX A;  3LUO A;  3PA7 A;  1J4I A;  3IK8 A;  2XP3 A;  2XPA A;  4ODO A;  4DRM A;  1FKR A;  3TC5 A;  3O5F A;  4DRK A;  1FKT A;  1QZ2 A;  2F4E A;  3JXV A;  5I98 A;  2VCD A;  1M5Y A;  4TW6 A;  5HW7 A;  2AWG A;  2PPN A;  5HWC A;  2MLX A;  4FAP A;  1F8A B;  4G2P A;  4ODP A;  5DIV A;  2M08 A;  3O5G A;  3MDY B;  4LAV A;  3O5R A;  1FJD A;  2LGO A;  2LJ4 A;  1FKB A;  2MPH A;  4TW8 A;  3UI6 A;  3NTP A;  1N1A A;  1JNT A;  4J4O A;  3JYM A;  4IQ2 A;  2JZV A;  1D6O A;  2VN1 A;  2L2S A;  4NNR A;  5HUA A;  1FKL A;  1R9H A;  1C9H A;  3H9R B;  4LAW A;  5DIU A;  5GPG A;  3UQB A;  2OFN A;  4W9O A;  5HTG A;  2KI3 A;  2RUR A;  4TNS A;  4TX0 A;  3B7X A;  1Q6I A;  5HKG A;  1KT1 A;  4QT3 A;  2PV3 A;  2MLY A;  2PV1 A;  5HWB A;  1HXV A;  2IF4 A;  2K8I A;  1P5Q A;  1QPL A;  1NMV A;  3TDB A;  2ZR5 A;  2KFW A;  2LKN A;  2ZR6 A;  3FAP A;  3KAC A;  4J4N A;  4MSP A;  1ROU A;  2UZ5 A;  1PIN A;  2XP5 A;  4G50 A;  3WH0 A;  2ZQV A;  2D9F A;  4LAX A;  1B6C A;  2RUC A;  2RUQ A;  3KAF A;  5HW6 A;  3O5Q A;  3KZ7 A;  3O5I A;  4ITZ A;  3RGC A;  3O5P A;  3O5D A;  1EQ3 A;  1FAP A;  4TYO A;  4W9P A;  2DG3 A;  2MF9 A;  2N87 A;  2ZQS A;  2LPV A;  4DT4 A;  2XPB A;  1Q1C A;  4DRH A;  2RSE A;  4DH0 A;  1FKF A;  3OOB A;  3NRK A;  4JFJ A;  4ODL A;  3O5L A;  4R0X A;  2M2A A;  1PBK A;  1YW5 A;  3O5J A;  2DG9 A;  4FN2 A;  1JNS A;  3IHZ A;  1D7J A;  2FKE A;  4JFM A;  4JFL A;  4TW7 A;  2MLZ A;  5D75 A;  4LAY A;  2ITK A;  4DRJ A;  4DRI A;  1FKD A;  4DRN A;  2XP9 A;  2ZR4 A;  1U79 A;  1J4H A;  3IKD A;  3KAD A;  3O5E A;  4GIV A;  4ODR A;  1J6Y A;  4N19 A;  4DRQ A;  2PPP A; 
#chains in the Genus database with same CATH topology
 2WK2 A;  1FKK A;  4ODK A;  3EIP A;  1CTN A;  3KAB A;  4Q22 A;  3CHD A;  4U86 A;  3ART A;  4W9Q A;  1YAT A;  3RM9 A;  3JYJ A;  4GGQ A;  2F2D A;  3VAW A;  4BF8 A;  4ODQ A;  2A3E A;  2DT2 A;  1EDQ A;  2WM0 A;  3KAG A;  3AQU A;  3O5O A;  1NWS A;  3ARV A;  3O5M A;  2KGJ A;  3AS2 A;  3TCZ A;  2Y78 A;  4DZ3 A;  1W1V A;  3KAI A;  2XP8 A;  3B9A A;  2RUD A;  2PN0 A;  1ZB5 A;  1QPF A;  4O2T A;  5DIT A;  2A3C A;  4JYS A;  2PPO A;  1D2K A;  1FKG A;  1E6P A;  3LUO A;  4DRM A;  4ODO A;  3BMB A;  1FKR A;  3TC5 A;  4DRK A;  1QZ2 A;  4WJX A;  1GUV A;  3CH9 A;  4FAP A;  1F8A B;  4ODP A;  1WNO A;  3MDY B;  4LAV A;  2YBT A;  1N1A A;  1JNT A;  3JYM A;  3CHC A;  1D6O A;  4ZS6 A;  4AY1 A;  4NNR A;  3ARW A;  1FKL A;  1JNE A;  3H9R B;  1NWT A;  4DWS C;  2O92 A;  4TX0 A;  3B9E A;  1XRV A;  2WLZ A;  1P5Q A;  1H0I A;  1QPL A;  1NMV A;  3TDB A;  4QZV B;  2UZ5 A;  2ZQV A;  1B6C A;  2RUQ A;  1HKM A;  3O5Q A;  4ITZ A;  3ARX A;  3QOK A;  1EQ3 A;  4DT4 A;  2XPB A;  3OOB A;  4ODL A;  3GU0 A;  4FN2 A;  3FXY A;  3WL1 A;  4LGX A;  1D7J A;  2FKE A;  4JFL A;  4TW7 A;  3B8S A;  3B9D A;  1E6N A;  1J4H A;  1U79 A;  1WAW A;  4GIV A;  4ODR A;  1J6Y A;  4Q7N A;  2PPP A;  2DG4 A;  1HJX A;  2XP4 A;  2FAP A;  4WK9 A;  3RM4 A;  1D7I A;  4MNM A;  1A7X A;  2A3A A;  4URI A;  4U85 A;  4WKF A;  1NMW A;  4Z2G A;  3CZ8 A;  2KO7 A;  3ARO A;  3RFW A;  1NWU A;  1W9P A;  1ZU8 A;  2G41 A;  4UDM A;  1EHN A;  1ZCN A;  4U84 A;  3ARR A;  3WIJ A;  4ODM A;  4P8U A;  3UF8 A;  3ODK A;  5B8I C;  2B31 A;  1O6I A;  1NSG A;  1JVW A;  5J6E A;  1KT0 A;  4DZ2 A;  4Z2J A;  1E6Z A;  1W9U A;  1W1T A;  1KFW A;  2PBC A;  1HKJ A;  2F21 A;  2Q5A A;  3O5K A;  1D7H A;  3WD2 A;  1GOI A;  1J4I A;  3IK8 A;  2XPA A;  1FKT A;  2F4E A;  3ARY A;  5I98 A;  1M5Y A;  4TW6 A;  1UR8 A;  2AWG A;  4MPK A;  2DT3 A;  5DIV A;  3O5G A;  1FJD A;  2LGO A;  4ML4 A;  2LJ4 A;  2G8Z A;  4TW8 A;  2DSW A;  2L2S A;  3G6L A;  5HUA A;  1R9H A;  1C9H A;  3WD1 A;  3UQB A;  5JH8 A;  3GTY X;  2KI3 A;  2RUR A;  4MAV A;  5HKG A;  1KT1 A;  4QT3 A;  5HWB A;  1UR9 A;  3WD4 A;  2ZR5 A;  3CHE A;  2KFW A;  4P8W A;  4J4N A;  4MSP A;  1HJW A;  1ROU A;  3ARQ A;  1WB0 A;  4LAX A;  4S3J A;  2RUC A;  3KAF A;  1X6L A;  1HKI A;  1FAP A;  4P8V A;  2DG3 A;  2N87 A;  2ZQS A;  4MTV A;  4DRH A;  2RSE A;  1FKF A;  5DEZ A;  4JFJ A;  2M2A A;  4KQZ A;  2DSU A;  1JNS A;  4DRJ A;  1FKD A;  3WD0 A;  4DRN A;  1LG2 A;  4DWS A;  4N19 A;  1JND A;  1W26 A;  4Z2I A;  1BKF A;  5HBF A;  2DSZ A;  5DF0 A;  3I6C A;  3ARP A;  2IUZ A;  1K9T A;  2MNT A;  3ALF A;  2ZQT A;  4DRO A;  1E44 A;  2RQS A;  1LL7 A;  4MGV A;  3UI5 A;  3KCE A;  4JFI A;  4HBE A;  1Q6H A;  1TCO C;  1FKS A;  4XAK A;  1T11 A;  5DO2 A;  2XP7 A;  3ARZ A;  3UQA A;  1Y0O A;  1W1P A;  4DIP A;  1OGG A;  3CGM A;  3IKG A;  4ZPT R;  3PRD A;  4S3K A;  1FD9 A;  5HW8 A;  3EY6 A;  5GPR A;  4Z2L A;  1XHG A;  3CGN A;  4DWS B;  1IX5 A;  4R5E A;  4IQC A;  1E15 A;  1FFR A;  1FKI A;  3RME A;  1FKH A;  5BXJ A;  3UI4 A;  3RM8 A;  1OWQ A;  1F40 A;  3PRB A;  3AS0 A;  2DPE A;  3WD3 A;  3JXV A;  1NH6 A;  1FFQ A;  2ETN A;  2VCD A;  5HW7 A;  2PPN A;  2YBU A;  4G2P A;  2M08 A;  1HJV A;  4W5U A;  1ZBK A;  1FKB A;  2MPH A;  3PR9 A;  1X6N A;  3NTP A;  4WKH A;  4J4O A;  4IQ2 A;  4MNL A;  2JZV A;  1JCH B;  2VN1 A;  5GPG A;  4LAW A;  1VF8 A;  3FY1 A;  2DT0 A;  4W9O A;  1GPF A;  2F23 A;  4P8X A;  5HTG A;  2PV3 A;  2MLY A;  2PV1 A;  4IT4 A;  1HXV A;  4IT6 A;  4Z2H A;  4WIW A;  2LKN A;  2ZR6 A;  3FAP A;  3KAC A;  2B5U B;  2DSV A;  2D9F A;  1EIB A;  3RGC A;  1SR0 A;  2OLH A;  3O5P A;  3O5D A;  4TYO A;  1Q1C A;  3NRK A;  1PBK A;  1YW5 A;  1SYT A;  3W4R A;  3IHZ A;  4JFM A;  5D75 A;  4LAY A;  2ITK A;  1ZBW A;  2ZR4 A;  3IKD A;  4DRQ A;  3NI6 A;  2XP6 A;  1RD6 A;  1HKK A;  4ZPV R;  2EUL A;  1L1P A;  1OGB A;  1Q6U A;  2KE0 A;  2A3B A;  3WL0 A;  4ODN A;  4JFK A;  1LJY A;  2KR7 A;  2PV2 A;  3AS3 A;  1NWR A;  4L72 B;  1ZK6 A;  2M1I A;  3UQI A;  1H0G A;  4QIB A;  5GQB A;  1EYM A;  1ROT A;  2ZQU A;  1BL4 A;  4QT2 A;  3GPK A;  2AOS A;  3PRA A;  3WKZ A;  3AS1 A;  4MNK A;  1FKJ A;  1LG1 A;  5HT1 A;  1ITX A;  4NZC A;  4L3N A;  4DRP A;  3KAH A;  2PI6 A;  1J4R A;  3CHF A;  4C02 B;  4WKA A;  4IPX A;  3PA7 A;  3ARU A;  3ALG A;  2XP3 A;  3O5F A;  4ZPW R;  5HWC A;  2ESC A;  2MLX A;  1TFV A;  4HBO A;  2QF8 A;  3O5R A;  1GRJ A;  3UI6 A;  1W1Y A;  4DWS D;  1ZBC A;  4KR0 B;  3WQW A;  1LL4 A;  1W9V A;  5DIU A;  2OFN A;  4TNS A;  3B7X A;  2DT1 A;  1Q6I A;  3ARS A;  4HAR A;  2IF4 A;  2FDM A;  2K8I A;  4MNJ A;  1ZBV A;  3BXW A;  3G6M A;  1PIN A;  2XP5 A;  1ZL1 A;  4G50 A;  3WH0 A;  4Z2K A;  1LL6 A;  5HW6 A;  3KZ7 A;  3O5I A;  4W9P A;  1LQ0 A;  2MF9 A;  2P4V A;  2LPV A;  4PTM A;  4DH0 A;  2O9O A;  3O5L A;  4R0X A;  3O5J A;  2DG9 A;  1E6R A;  2WLY A;  2MLZ A;  4DRI A;  2XP9 A;  3KAD A;  3WQV A;  3O5E A;  4NSB A;  3OA5 A;  1E9L A; 
#chains in the Genus database with same CATH homology
 2WK2 A;  1FKK A;  4ODK A;  1CTN A;  3KAB A;  4Q22 A;  3CHD A;  4U86 A;  3ART A;  4W9Q A;  1YAT A;  3RM9 A;  3JYJ A;  4GGQ A;  2F2D A;  3VAW A;  4BF8 A;  4ODQ A;  2A3E A;  2DT2 A;  1EDQ A;  2WM0 A;  3KAG A;  3AQU A;  3O5O A;  1NWS A;  3ARV A;  3O5M A;  2KGJ A;  3AS2 A;  3TCZ A;  2Y78 A;  4DZ3 A;  1W1V A;  3KAI A;  2XP8 A;  3B9A A;  2RUD A;  1ZB5 A;  1QPF A;  4O2T A;  5DIT A;  2A3C A;  4JYS A;  2PPO A;  1D2K A;  1FKG A;  1E6P A;  3LUO A;  4DRM A;  4ODO A;  1FKR A;  3TC5 A;  4DRK A;  1QZ2 A;  4WJX A;  1GUV A;  3CH9 A;  4FAP A;  1F8A B;  4ODP A;  1WNO A;  3MDY B;  4LAV A;  2YBT A;  1N1A A;  1JNT A;  3JYM A;  3CHC A;  1D6O A;  4ZS6 A;  4AY1 A;  4NNR A;  3ARW A;  1FKL A;  1JNE A;  3H9R B;  1NWT A;  4DWS C;  2O92 A;  4TX0 A;  3B9E A;  1XRV A;  2WLZ A;  1P5Q A;  1H0I A;  1QPL A;  1NMV A;  3TDB A;  4QZV B;  2UZ5 A;  2ZQV A;  1B6C A;  2RUQ A;  1HKM A;  3O5Q A;  4ITZ A;  3ARX A;  3QOK A;  1EQ3 A;  4DT4 A;  2XPB A;  3OOB A;  4ODL A;  4FN2 A;  3FXY A;  3WL1 A;  4LGX A;  1D7J A;  2FKE A;  4JFL A;  4TW7 A;  3B8S A;  3B9D A;  1E6N A;  1J4H A;  1U79 A;  1WAW A;  4GIV A;  4ODR A;  1J6Y A;  4Q7N A;  2PPP A;  2DG4 A;  1HJX A;  2XP4 A;  2FAP A;  4WK9 A;  3RM4 A;  1D7I A;  4MNM A;  1A7X A;  2A3A A;  4URI A;  4U85 A;  4WKF A;  1NMW A;  4Z2G A;  3CZ8 A;  2KO7 A;  3ARO A;  3RFW A;  1NWU A;  1W9P A;  1ZU8 A;  2G41 A;  1EHN A;  1ZCN A;  4U84 A;  3ARR A;  3WIJ A;  4ODM A;  4P8U A;  3UF8 A;  3ODK A;  5B8I C;  2B31 A;  1O6I A;  1NSG A;  1JVW A;  5J6E A;  1KT0 A;  4DZ2 A;  4Z2J A;  1E6Z A;  1W9U A;  1W1T A;  1KFW A;  2PBC A;  1HKJ A;  2F21 A;  2Q5A A;  3O5K A;  1D7H A;  3WD2 A;  1GOI A;  1J4I A;  3IK8 A;  2XPA A;  1FKT A;  2F4E A;  3ARY A;  5I98 A;  1M5Y A;  4TW6 A;  1UR8 A;  2AWG A;  4MPK A;  2DT3 A;  5DIV A;  3O5G A;  1FJD A;  2LGO A;  4ML4 A;  2LJ4 A;  2G8Z A;  4TW8 A;  2DSW A;  2L2S A;  3G6L A;  5HUA A;  1R9H A;  1C9H A;  3WD1 A;  3UQB A;  5JH8 A;  2KI3 A;  2RUR A;  4MAV A;  5HKG A;  1KT1 A;  4QT3 A;  5HWB A;  1UR9 A;  3WD4 A;  2ZR5 A;  3CHE A;  2KFW A;  4P8W A;  4J4N A;  4MSP A;  1HJW A;  1ROU A;  3ARQ A;  1WB0 A;  4LAX A;  4S3J A;  2RUC A;  3KAF A;  1X6L A;  1HKI A;  1FAP A;  4P8V A;  2DG3 A;  2N87 A;  2ZQS A;  4MTV A;  4DRH A;  2RSE A;  1FKF A;  5DEZ A;  4JFJ A;  2M2A A;  4KQZ A;  2DSU A;  1JNS A;  4DRJ A;  1FKD A;  3WD0 A;  4DRN A;  1LG2 A;  4DWS A;  4N19 A;  1JND A;  1W26 A;  4Z2I A;  1BKF A;  5HBF A;  2DSZ A;  5DF0 A;  3I6C A;  3ARP A;  2IUZ A;  1K9T A;  2MNT A;  3ALF A;  2ZQT A;  4DRO A;  2RQS A;  4MGV A;  1LL7 A;  3UI5 A;  3KCE A;  4JFI A;  4HBE A;  1Q6H A;  1TCO C;  1FKS A;  4XAK A;  1T11 A;  5DO2 A;  2XP7 A;  3ARZ A;  3UQA A;  1Y0O A;  1W1P A;  4DIP A;  1OGG A;  3CGM A;  3IKG A;  4ZPT R;  3PRD A;  4S3K A;  1FD9 A;  5HW8 A;  3EY6 A;  5GPR A;  4Z2L A;  1XHG A;  3CGN A;  4DWS B;  1IX5 A;  4R5E A;  4IQC A;  1E15 A;  1FFR A;  1FKI A;  3RME A;  1FKH A;  5BXJ A;  3UI4 A;  3RM8 A;  1OWQ A;  1F40 A;  3PRB A;  3AS0 A;  2DPE A;  3WD3 A;  3JXV A;  1NH6 A;  1FFQ A;  2VCD A;  5HW7 A;  2PPN A;  2YBU A;  4G2P A;  2M08 A;  1HJV A;  4W5U A;  1ZBK A;  1FKB A;  2MPH A;  3PR9 A;  1X6N A;  3NTP A;  4WKH A;  4J4O A;  4IQ2 A;  4MNL A;  2JZV A;  2VN1 A;  5GPG A;  4LAW A;  1VF8 A;  3FY1 A;  2DT0 A;  4W9O A;  1GPF A;  4P8X A;  5HTG A;  2PV3 A;  2MLY A;  2PV1 A;  4IT4 A;  1HXV A;  4IT6 A;  4Z2H A;  4WIW A;  2LKN A;  2ZR6 A;  3FAP A;  3KAC A;  2DSV A;  2D9F A;  1EIB A;  3RGC A;  1SR0 A;  2OLH A;  3O5P A;  3O5D A;  4TYO A;  1Q1C A;  3NRK A;  1PBK A;  1YW5 A;  1SYT A;  3W4R A;  3IHZ A;  4JFM A;  5D75 A;  4LAY A;  2ITK A;  1ZBW A;  2ZR4 A;  3IKD A;  4DRQ A;  3NI6 A;  2XP6 A;  1RD6 A;  1HKK A;  4ZPV R;  1L1P A;  1OGB A;  1Q6U A;  2KE0 A;  2A3B A;  3WL0 A;  4ODN A;  4JFK A;  1LJY A;  2KR7 A;  2PV2 A;  3AS3 A;  1NWR A;  4L72 B;  1ZK6 A;  2M1I A;  3UQI A;  1H0G A;  4QIB A;  5GQB A;  1EYM A;  1ROT A;  2ZQU A;  1BL4 A;  4QT2 A;  3GPK A;  2AOS A;  3PRA A;  3WKZ A;  3AS1 A;  4MNK A;  1FKJ A;  1LG1 A;  5HT1 A;  1ITX A;  4NZC A;  4L3N A;  4DRP A;  3KAH A;  2PI6 A;  1J4R A;  3CHF A;  4C02 B;  4WKA A;  4IPX A;  3PA7 A;  3ARU A;  3ALG A;  2XP3 A;  3O5F A;  4ZPW R;  5HWC A;  2ESC A;  2MLX A;  1TFV A;  4HBO A;  2QF8 A;  3O5R A;  3UI6 A;  1W1Y A;  4DWS D;  1ZBC A;  4KR0 B;  3WQW A;  1LL4 A;  1W9V A;  5DIU A;  2OFN A;  4TNS A;  3B7X A;  2DT1 A;  1Q6I A;  3ARS A;  4HAR A;  2IF4 A;  2FDM A;  2K8I A;  4MNJ A;  1ZBV A;  3BXW A;  3G6M A;  1PIN A;  2XP5 A;  1ZL1 A;  4G50 A;  3WH0 A;  4Z2K A;  1LL6 A;  5HW6 A;  3KZ7 A;  3O5I A;  4W9P A;  1LQ0 A;  2MF9 A;  4PTM A;  2LPV A;  4DH0 A;  2O9O A;  3O5L A;  4R0X A;  3O5J A;  2DG9 A;  1E6R A;  2WLY A;  2MLZ A;  4DRI A;  2XP9 A;  3KAD A;  3WQV A;  3O5E A;  4NSB A;  3OA5 A;  1E9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...