1FKGA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkgA00
3O5LA 2RSEA 2MLZA 3PRDA 4DRJA 3NTPA 1B6CA 2MNTA 1NMWA 1FAPA 2XP4A 4LAXA 4U84A 2ZQUA 2ZR6A 3O5FA 5HW7A 1A7XA 3IKDA 3O5OA 1D7HA 4JFJA 4DIPA 1W26A 1NMVA 3O5MA 1D7JA 1F8AB 2PV3A 3IKGA 4U85A 4LAWA 2N87A 1J4RA 1FKTA 3PA7A 4DZ3A 4JYSA 2RURA 3O5IA 4DROA 1FKDA 2KR7A 2PBCA 4U86A 2M08A 3LUOA 4DRIA 1TCOC 4ODNA 2Y78A 3CGNA 2XP9A 4TNSA 3VAWA 4MGVA 4ODQA 2DG9A 2VCDA 1U79A 1J4HA 3O5RA 2F2DA 2XPAA 2KGJA 3O5KA 3KAGA 2ITKA 3O5GA 2KFWA 3JYMA 4NNRA 4ODPA 2L2SA 3B7XA 1J4IA 1FKJA 3ODKA 1YATA 1FKHA 4QT3A 1FKIA 1FKBA 4DZ2A 5B8IC 5HWCA 3TCZA 2LPVA 2XP8A 2ZQVA 3JYJA 4G2PA 4MSPA 3O5QA 1FKLA 1QZ2A 2JZVA 3MDYB 3UQBA 3KAFA 3TDBA 3JXVA 4O2TA 5DITA 3UQAA 1FKSA 3H9RB 2RUCA 2FAPA 3KABA 4TW8A 3UI4A 1FJDA 4JFIA 2DG4A 2F21A 2LGOA 1Y0OA 2MLYA 2XP6A 4GIVA 5D75A 5DIVA 4DRKA 1JNSA 2UZ5A 4W9PA 1T11A 2IF4A 2XP5A 2ZQSA 3GPKA 4ODMA 1FD9A 1PBKA 2DG3A 1Q6UA 2ZR5A 4GGQA 5HTGA 2XP3A 2FKEA 2LJ4A 1NSGA 1PINA 1YW5A 2KI3A 2KO7A 1EQ3A 4IQ2A 1FKGA 4TW7A 3RGCA 3UF8A 4DRNA 4ODRA 4LAYA 3IHZA 1M5YA 4N19A 1L1PA 1QPLA 3UQIA 5HWBA 2XP7A 4R0XA 1F40A 3FAPA 3PRBA 4LAVA 3EY6A 4TX0A 4C02B 4DRMA 1FKKA 3NRKA 3O5PA 3KADA 3KZ7A 3IK8A 2MPHA 4JFMA 4J4NA 2KE0A 4BF8A 2LKNA 2AWGA 1BL4A 1ZK6A 1QPFA 5GPGA 5J6EA 2M1IA 3O5EA 3I6CA 4DRQA 1R9HA 3KAHA 2PPNA 2VN1A 3KACA 2PPPA 1ZCNA 1BKFA 1P5QA 2PV2A 4ODOA 3WH0A 1N1AA 1D6OA 4JFLA 4DH0A 4FAPA 4ITZA 1EYMA 1ROUA 2PV1A 1Q6IA 2PPOA 3KCEA 3UI5A 5HT1A 2RUDA 4DT4A 1JVWA 2M2AA 1J6YA 1KT1A 4QT2A 3RFWA 2MLXA 3O5JA 3OOBA 4G50A 4IQCA 1D7IA 2RUQA 4QIBA 4W9QA 4DRPA 5HUAA 1C9HA 5I98A 2RQSA 2D9FA 1ROTA 1FKRA 2K8IA 5BXJA 2F4EA 2MF9A 1KT0A 2ZR4A 4DRHA 3CGMA 4TYOA 2ZQTA 4W9OA 1HXVA 4IPXA 4FN2A 3O5DA 5DIUA 4J4OA 4TW6A 2OFNA 3KAIA 1FKFA 2XPBA 3UI6A 4JFKA 3TC5A 1Q6HA 1Q1CA 5HKGA 5HW6A 5HW8A 4ODLA 2Q5AA 3NI6A 1JNTA 4ODKA
chains in the Genus database with same CATH superfamily
4Z2LA 1FFQA 2MLZA 1B6CA 2ZQUA 2ZR6A 1A7XA 1UR8A 3CH9A 4JFJA 1NMVA 4P8WA 4QZVB 1OGGA 1JCHB 1FKTA 1ZB5A 4JYSA 3W4RA 1TCOC 1CTNA 1W1YA 4MNMA 4WKAA 4WJXA 1ZBWA 2A3BA 4DWSA 1LQ0A 1EIBA 5HBFA 5B8IC 5HWCA 4MSPA 4Z2JA 3WQVA 3TDBA 3JXVA 5DITA 1FKSA 4TW8A 2WLYA 1VF8A 2F21A 1SYTA 2XP6A 5DIVA 2G41A 1JNSA 4ZPVR 2P4VA 4ODMA 1FD9A 1PBKA 4P8UA 2DSWA 2XP3A 1NSGA 1W1VA 1FFRA 2DSZA 4IQ2A 1FKGA 4Q22A 3BMBA 5HWBA 3WD1A 2A3AA 1F40A 4C02B 4TX0A 4ZPTR 4DRMA 2MPHA 2KE0A 2O92A 3CHFA 3ARVA 3CHDA 2PV2A 1BKFA 4ODOA 3WH0A 1N1AA 1D6OA 1E9LA 2DT1A 1EYMA 3UI5A 4DWSC 3RM9A 4QIBA 4IQCA 2G8ZA 1LL4A 3BXWA 1GUVA 5BXJA 1KT0A 3G6MA 4TYOA 1ZBCA 4FN2A 3O5DA 5DIUA 2OFNA 1ZBKA 2O9OA 2WK2A 4Z2KA 1OWQA 1ZU8A 5HW8A 1H0IA 2Q5AA 1JNTA 3O5LA 4P8VA 2MNTA 1NMWA 1FAPA 4LAXA 3OA5A 2DT2A 4UDMA 1ZL1A 1D7JA 4AY1A 3PR9A 3IKGA 4U85A 4LAWA 1J4RA 2RURA 4DROA 1KFWA 2F23A 4DRIA 1RD6A 4KQZA 2DG9A 4LGXA 4R5EA 1ZBVA 3B9DA 2F2DA 2KGJA 3KAGA 2ITKA 3O5GA 4NNRA 1FKHA 4Q7NA 1HKMA 1ITXA 1QZ2A 1JNEA 3KAFA 4NSBA 2FAPA 3UI4A 1FJDA 4JFIA 3GPKA 1GRJA 3ARXA 3QOKA 2LJ4A 1HKKA 2KO7A 1EQ3A 3ARTA 2QF8A 4TW7A 3RGCA 4MPKA 3UF8A 4LAYA 1X6NA 3UQIA 3WD4A 3FAPA 3EY6A 3ARUA 4MAVA 3O5PA 3KADA 4JFMA 3IK8A 4J4NA 1W9VA 1ZK6A 1QPFA 1LJYA 3EIPA 5J6EA 4DRQA 2YBUA 3I6CA 1R9HA 4L3NA 3AS0A 4FAPA 4DH0A 1WAWA 4ITZA 1ROUA 1W9UA 2PPOA 3KCEA 5HT1A 2RUDA 1W1PA 1J6YA 3RFWA 2MLXA 3OOBA 4W9QA 1D7IA 5HUAA 1C9HA 3RM4A 2DT0A 4WK9A 2K8IA 1LG2A 1HKJA 2F4EA 2MF9A 1IX5A 5DEZA 2ZR4A 1E6RA 3CGMA 2ZQTA 1NWSA 1HXVA 3ALFA 3ARPA 4J4OA 1EDQA 4P8XA 4L72B 4MNLA 1EHNA 3UI6A 4JFKA 1FKRA 3WL0A 1HKIA 2RSEA 3WD3A 1XHGA 3PRDA 4DRJA 5JH8A 5HW7A 1HJWA 2IUZA 3IKDA 4DIPA 1W26A 2N87A 3PA7A 1FKDA 2KR7A 2M08A 3LUOA 2Y78A 2XP9A 1U79A 1J4HA 1LL7A 3O5RA 4ZS6A 2XPAA 2KFWA 3CHCA 1XRVA 2L2SA 1J4IA 1FKJA 3ODKA 1K9TA 1YATA 1FKIA 1FKBA 3AQUA 4IT4A 2EULA 4ZPWR 4DZ2A 2XP8A 2ZQVA 3JYJA 4G2PA 1FKLA 2JZVA 3RM8A 2YBTA 5GQBA 3WD2A 2DG4A 2LGOA 5D75A 1GOIA 2DSUA 2IF4A 2DG3A 2ZR5A 1HJXA 2FKEA 1PINA 4HARA 3G6LA 4DRNA 2DSVA 3FXYA 4PTMA 2AOSA 1L1PA 4R0XA 4KR0B 4WKHA 4Z2HA 3CHEA 1E15A 1FKKA 2PI6A 1UR9A 3NRKA 2LKNA 2B31A 2A3CA 3ARSA 1D2KA 1P5QA 3B8SA 1NWUA 1GPFA 4DT4A 2M2AA 4ML4A 4QT2A 1TFVA 3O5JA 4G50A 1LG1A 2PN0A 2D9FA 1ROTA 2ESCA 4NZCA 1NWTA 5GPRA 4S3JA 3WKZA 3B9EA 4W9OA 4DWSD 4TW6A 3ARQA 3KAIA 1FKFA 3TC5A 1Q6HA 3FY1A 5HKGA 4HBOA 3NI6A 4WKFA 4W5UA 3RMEA 5DF0A 1X6LA 3NTPA 3AS3A 2XP4A 4U84A 3O5FA 3WIJA 3O5OA 1D7HA 4MNJA 3O5MA 1F8AB 1JNDA 2DT3A 2PV3A 2A3EA 3ALGA 1E6ZA 4DZ3A 1E6PA 2DPEA 3O5IA 2PBCA 4U86A 4MNKA 4ODNA 3CGNA 4TNSA 3VAWA 4MGVA 4ODQA 2VCDA 3WD0A 3O5KA 3JYMA 4ODPA 3B7XA 1W1TA 1W9PA 2B5UB 3AS1A 4QT3A 1WNOA 3TCZA 1LL6A 2LPVA 3GU0A 4S3KA 3O5QA 4IT6A 3MDYB 3UQBA 1SR0A 3ARRA 4O2TA 3UQAA 3KABA 3H9RB 2RUCA 3WL1A 3CZ8A 1Y0OA 2MLYA 4GIVA 4DRKA 3AROA 1NH6A 2UZ5A 4W9PA 1T11A 2XP5A 2ZQSA 3WQWA 1Q6UA 3ARWA 4GGQA 5HTGA 4URIA 1H0GA 4WIWA 1YW5A 2KI3A 1E44A 1NWRA 2WLZA 4ODRA 3AS2A 3IHZA 1M5YA 2OLHA 4N19A 1QPLA 3B9AA 2XP7A 3PRBA 4MTVA 4LAVA 3KZ7A 4BF8A 1HJVA 4Z2GA 4Z2IA 2AWGA 1BL4A 5GPGA 2M1IA 3O5EA 3KAHA 2PPNA 2VN1A 3KACA 2PPPA 1ZCNA 5HW6A 3PRAA 3GTYX 4JFLA 2PV1A 1Q6IA 1JVWA 3ARYA 1KT1A 5DO2A 4DRPA 2RUQA 5I98A 1OGBA 2RQSA 3ARZA 1E6NA 2FDMA 4XAKA 1WB0A 4DRHA 4DWSB 4IPXA 2WM0A 1O6IA 2ETNA 2XPBA 4HBEA 1Q1CA 4ODLA 4ODKA
chains in the Genus database with same CATH topology
4Z2LA 1FFQA 2MLZA 1B6CA 2ZQUA 2ZR6A 1A7XA 1UR8A 3CH9A 4JFJA 1NMVA 4P8WA 4QZVB 1OGGA 1FKTA 1ZB5A 4JYSA 3W4RA 1TCOC 1CTNA 1W1YA 4MNMA 4WKAA 4WJXA 1ZBWA 2A3BA 4DWSA 1LQ0A 1EIBA 5HBFA 5B8IC 5HWCA 4MSPA 4Z2JA 3WQVA 3TDBA 3JXVA 5DITA 1FKSA 4TW8A 2WLYA 1VF8A 2F21A 1SYTA 2XP6A 5DIVA 2G41A 1JNSA 4ZPVR 4ODMA 1FD9A 1PBKA 4P8UA 2DSWA 2XP3A 1NSGA 1W1VA 1FFRA 2DSZA 4IQ2A 1FKGA 4Q22A 5HWBA 3WD1A 2A3AA 1F40A 4C02B 4TX0A 4ZPTR 4DRMA 2MPHA 2KE0A 2O92A 3CHFA 3ARVA 3CHDA 2PV2A 1BKFA 4ODOA 3WH0A 1N1AA 1D6OA 1E9LA 2DT1A 1EYMA 3UI5A 4DWSC 3RM9A 4QIBA 4IQCA 2G8ZA 1LL4A 3BXWA 1GUVA 5BXJA 1KT0A 3G6MA 4TYOA 1ZBCA 4FN2A 3O5DA 5DIUA 2OFNA 1ZBKA 2O9OA 2WK2A 4Z2KA 1OWQA 1ZU8A 5HW8A 1H0IA 2Q5AA 1JNTA 3O5LA 4P8VA 2MNTA 1NMWA 1FAPA 4LAXA 3OA5A 2DT2A 1ZL1A 1D7JA 4AY1A 3PR9A 3IKGA 4U85A 4LAWA 1J4RA 2RURA 4DROA 1KFWA 4DRIA 1RD6A 4KQZA 2DG9A 4LGXA 4R5EA 1ZBVA 3B9DA 2F2DA 2KGJA 3KAGA 2ITKA 3O5GA 4NNRA 1FKHA 4Q7NA 1HKMA 1ITXA 1QZ2A 1JNEA 3KAFA 4NSBA 2FAPA 3UI4A 1FJDA 4JFIA 3GPKA 3ARXA 3QOKA 2LJ4A 1HKKA 2KO7A 1EQ3A 3ARTA 2QF8A 4TW7A 3RGCA 4MPKA 3UF8A 4LAYA 1X6NA 3UQIA 3WD4A 3FAPA 3EY6A 3ARUA 4MAVA 3O5PA 3KADA 4JFMA 3IK8A 4J4NA 1W9VA 1ZK6A 1QPFA 1LJYA 5J6EA 4DRQA 2YBUA 3I6CA 1R9HA 4L3NA 3AS0A 4FAPA 4DH0A 1WAWA 4ITZA 1ROUA 1W9UA 2PPOA 3KCEA 5HT1A 2RUDA 1W1PA 1J6YA 3RFWA 2MLXA 3OOBA 4W9QA 1D7IA 5HUAA 1C9HA 3RM4A 2DT0A 4WK9A 2K8IA 1LG2A 1HKJA 2F4EA 2MF9A 1IX5A 5DEZA 2ZR4A 1E6RA 3CGMA 2ZQTA 1NWSA 1HXVA 3ALFA 3ARPA 4J4OA 1EDQA 4P8XA 4L72B 4MNLA 1EHNA 3UI6A 4JFKA 1FKRA 3WL0A 1HKIA 2RSEA 3WD3A 1XHGA 3PRDA 4DRJA 5JH8A 5HW7A 1HJWA 2IUZA 3IKDA 4DIPA 1W26A 2N87A 3PA7A 1FKDA 2KR7A 2M08A 3LUOA 2Y78A 2XP9A 1U79A 1J4HA 1LL7A 3O5RA 4ZS6A 2XPAA 2KFWA 3CHCA 1XRVA 2L2SA 1J4IA 1FKJA 3ODKA 1K9TA 1YATA 1FKIA 1FKBA 3AQUA 4IT4A 4ZPWR 4DZ2A 2XP8A 2ZQVA 3JYJA 4G2PA 1FKLA 2JZVA 3RM8A 2YBTA 5GQBA 3WD2A 2DG4A 2LGOA 5D75A 1GOIA 2DSUA 2IF4A 2DG3A 2ZR5A 1HJXA 2FKEA 1PINA 4HARA 3G6LA 4DRNA 2DSVA 3FXYA 4PTMA 2AOSA 1L1PA 4R0XA 4KR0B 4WKHA 4Z2HA 3CHEA 1E15A 1FKKA 2PI6A 1UR9A 3NRKA 2LKNA 2B31A 2A3CA 3ARSA 1D2KA 1P5QA 3B8SA 1NWUA 1GPFA 4DT4A 2M2AA 4ML4A 4QT2A 1TFVA 3O5JA 4G50A 1LG1A 2D9FA 1ROTA 2ESCA 4NZCA 1NWTA 5GPRA 4S3JA 3WKZA 3B9EA 4W9OA 4DWSD 4TW6A 3ARQA 3KAIA 1FKFA 3TC5A 1Q6HA 3FY1A 5HKGA 4HBOA 3NI6A 4WKFA 4W5UA 3RMEA 5DF0A 1X6LA 3NTPA 3AS3A 2XP4A 4U84A 3O5FA 3WIJA 3O5OA 1D7HA 4MNJA 3O5MA 1F8AB 1JNDA 2DT3A 2PV3A 2A3EA 3ALGA 1E6ZA 4DZ3A 1E6PA 2DPEA 3O5IA 2PBCA 4U86A 4MNKA 4ODNA 3CGNA 4TNSA 3VAWA 4MGVA 4ODQA 2VCDA 3WD0A 3O5KA 3JYMA 4ODPA 3B7XA 1W1TA 1W9PA 3AS1A 4QT3A 1WNOA 3TCZA 1LL6A 2LPVA 4S3KA 3O5QA 4IT6A 3MDYB 3UQBA 1SR0A 3ARRA 4O2TA 3UQAA 3KABA 3H9RB 2RUCA 3WL1A 3CZ8A 1Y0OA 2MLYA 4GIVA 4DRKA 3AROA 1NH6A 2UZ5A 4W9PA 1T11A 2XP5A 2ZQSA 3WQWA 1Q6UA 3ARWA 4GGQA 5HTGA 4URIA 1H0GA 4WIWA 1YW5A 2KI3A 1NWRA 2WLZA 4ODRA 3AS2A 3IHZA 1M5YA 2OLHA 4N19A 1QPLA 3B9AA 2XP7A 3PRBA 4MTVA 4LAVA 3KZ7A 4BF8A 1HJVA 4Z2GA 4Z2IA 2AWGA 1BL4A 5GPGA 2M1IA 3O5EA 3KAHA 2PPNA 2VN1A 3KACA 2PPPA 1ZCNA 5HW6A 3PRAA 4JFLA 2PV1A 1Q6IA 1JVWA 3ARYA 1KT1A 5DO2A 4DRPA 2RUQA 5I98A 1OGBA 2RQSA 3ARZA 1E6NA 2FDMA 4XAKA 1WB0A 4DRHA 4DWSB 4IPXA 2WM0A 1O6IA 2XPBA 4HBEA 1Q1CA 4ODLA 4ODKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5L A;  2RSE A;  2MLZ A;  3PRD A;  4DRJ A;  3NTP A;  1B6C A;  2MNT A;  1NMW A;  1FAP A;  2XP4 A;  4LAX A;  4U84 A;  2ZQU A;  2ZR6 A;  3O5F A;  5HW7 A;  1A7X A;  3IKD A;  3O5O A;  1D7H A;  4JFJ A;  4DIP A;  1W26 A;  1NMV A;  3O5M A;  1D7J A;  1F8A B;  2PV3 A;  3IKG A;  4U85 A;  4LAW A;  2N87 A;  1J4R A;  1FKT A;  3PA7 A;  4DZ3 A;  4JYS A;  2RUR A;  3O5I A;  4DRO A;  1FKD A;  2KR7 A;  2PBC A;  4U86 A;  2M08 A;  3LUO A;  4DRI A;  1TCO C;  4ODN A;  2Y78 A;  3CGN A;  2XP9 A;  4TNS A;  3VAW A;  4MGV A;  4ODQ A;  2DG9 A;  2VCD A;  1U79 A;  1J4H A;  3O5R A;  2F2D A;  2XPA A;  2KGJ A;  3O5K A;  3KAG A;  2ITK A;  3O5G A;  2KFW A;  3JYM A;  4NNR A;  4ODP A;  2L2S A;  3B7X A;  1J4I A;  1FKJ A;  3ODK A;  1YAT A;  1FKH A;  4QT3 A;  1FKI A;  1FKB A;  4DZ2 A;  5B8I C;  5HWC A;  3TCZ A;  2LPV A;  2XP8 A;  2ZQV A;  3JYJ A;  4G2P A;  4MSP A;  3O5Q A;  1FKL A;  1QZ2 A;  2JZV A;  3MDY B;  3UQB A;  3KAF A;  3TDB A;  3JXV A;  4O2T A;  5DIT A;  3UQA A;  1FKS A;  3H9R B;  2RUC A;  2FAP A;  3KAB A;  4TW8 A;  3UI4 A;  1FJD A;  4JFI A;  2DG4 A;  2F21 A;  2LGO A;  1Y0O A;  2MLY A;  2XP6 A;  4GIV A;  5D75 A;  5DIV A;  4DRK A;  1JNS A;  2UZ5 A;  4W9P A;  1T11 A;  2IF4 A;  2XP5 A;  2ZQS A;  3GPK A;  4ODM A;  1FD9 A;  1PBK A;  2DG3 A;  1Q6U A;  2ZR5 A;  4GGQ A;  5HTG A;  2XP3 A;  2FKE A;  2LJ4 A;  1NSG A;  1PIN A;  1YW5 A;  2KI3 A;  2KO7 A;  1EQ3 A;  4IQ2 A;  1FKG A;  4TW7 A;  3RGC A;  3UF8 A;  4DRN A;  4ODR A;  4LAY A;  3IHZ A;  1M5Y A;  4N19 A;  1L1P A;  1QPL A;  3UQI A;  5HWB A;  2XP7 A;  4R0X A;  1F40 A;  3FAP A;  3PRB A;  4LAV A;  3EY6 A;  4TX0 A;  4C02 B;  4DRM A;  1FKK A;  3NRK A;  3O5P A;  3KAD A;  3KZ7 A;  3IK8 A;  2MPH A;  4JFM A;  4J4N A;  2KE0 A;  4BF8 A;  2LKN A;  2AWG A;  1BL4 A;  1ZK6 A;  1QPF A;  5GPG A;  5J6E A;  2M1I A;  3O5E A;  3I6C A;  4DRQ A;  1R9H A;  3KAH A;  2PPN A;  2VN1 A;  3KAC A;  2PPP A;  1ZCN A;  1BKF A;  1P5Q A;  2PV2 A;  4ODO A;  3WH0 A;  1N1A A;  1D6O A;  4JFL A;  4DH0 A;  4FAP A;  4ITZ A;  1EYM A;  1ROU A;  2PV1 A;  1Q6I A;  2PPO A;  3KCE A;  3UI5 A;  5HT1 A;  2RUD A;  4DT4 A;  1JVW A;  2M2A A;  1J6Y A;  1KT1 A;  4QT2 A;  3RFW A;  2MLX A;  3O5J A;  3OOB A;  4G50 A;  4IQC A;  1D7I A;  2RUQ A;  4QIB A;  4W9Q A;  4DRP A;  5HUA A;  1C9H A;  5I98 A;  2RQS A;  2D9F A;  1ROT A;  1FKR A;  2K8I A;  5BXJ A;  2F4E A;  2MF9 A;  1KT0 A;  2ZR4 A;  4DRH A;  3CGM A;  4TYO A;  2ZQT A;  4W9O A;  1HXV A;  4IPX A;  4FN2 A;  3O5D A;  5DIU A;  4J4O A;  4TW6 A;  2OFN A;  3KAI A;  1FKF A;  2XPB A;  3UI6 A;  4JFK A;  3TC5 A;  1Q6H A;  1Q1C A;  5HKG A;  5HW6 A;  5HW8 A;  4ODL A;  2Q5A A;  3NI6 A;  1JNT A;  4ODK A; 
#chains in the Genus database with same CATH topology
 4Z2L A;  1FFQ A;  2MLZ A;  1B6C A;  2ZQU A;  2ZR6 A;  1A7X A;  1UR8 A;  3CH9 A;  4JFJ A;  1NMV A;  4P8W A;  4QZV B;  1OGG A;  1JCH B;  1FKT A;  1ZB5 A;  4JYS A;  3W4R A;  1TCO C;  1CTN A;  1W1Y A;  4MNM A;  4WKA A;  4WJX A;  1ZBW A;  2A3B A;  4DWS A;  1LQ0 A;  1EIB A;  5HBF A;  5B8I C;  5HWC A;  4MSP A;  4Z2J A;  3WQV A;  3TDB A;  3JXV A;  5DIT A;  1FKS A;  4TW8 A;  2WLY A;  1VF8 A;  2F21 A;  1SYT A;  2XP6 A;  5DIV A;  2G41 A;  1JNS A;  4ZPV R;  2P4V A;  4ODM A;  1FD9 A;  1PBK A;  4P8U A;  2DSW A;  2XP3 A;  1NSG A;  1W1V A;  1FFR A;  2DSZ A;  4IQ2 A;  1FKG A;  4Q22 A;  3BMB A;  5HWB A;  3WD1 A;  2A3A A;  1F40 A;  4C02 B;  4TX0 A;  4ZPT R;  4DRM A;  2MPH A;  2KE0 A;  2O92 A;  3CHF A;  3ARV A;  3CHD A;  2PV2 A;  1BKF A;  4ODO A;  3WH0 A;  1N1A A;  1D6O A;  1E9L A;  2DT1 A;  1EYM A;  3UI5 A;  4DWS C;  3RM9 A;  4QIB A;  4IQC A;  2G8Z A;  1LL4 A;  3BXW A;  1GUV A;  5BXJ A;  1KT0 A;  3G6M A;  4TYO A;  1ZBC A;  4FN2 A;  3O5D A;  5DIU A;  2OFN A;  1ZBK A;  2O9O A;  2WK2 A;  4Z2K A;  1OWQ A;  1ZU8 A;  5HW8 A;  1H0I A;  2Q5A A;  1JNT A;  3O5L A;  4P8V A;  2MNT A;  1NMW A;  1FAP A;  4LAX A;  3OA5 A;  2DT2 A;  4UDM A;  1ZL1 A;  1D7J A;  4AY1 A;  3PR9 A;  3IKG A;  4U85 A;  4LAW A;  1J4R A;  2RUR A;  4DRO A;  1KFW A;  2F23 A;  4DRI A;  1RD6 A;  4KQZ A;  2DG9 A;  4LGX A;  4R5E A;  1ZBV A;  3B9D A;  2F2D A;  2KGJ A;  3KAG A;  2ITK A;  3O5G A;  4NNR A;  1FKH A;  4Q7N A;  1HKM A;  1ITX A;  1QZ2 A;  1JNE A;  3KAF A;  4NSB A;  2FAP A;  3UI4 A;  1FJD A;  4JFI A;  3GPK A;  1GRJ A;  3ARX A;  3QOK A;  2LJ4 A;  1HKK A;  2KO7 A;  1EQ3 A;  3ART A;  2QF8 A;  4TW7 A;  3RGC A;  4MPK A;  3UF8 A;  4LAY A;  1X6N A;  3UQI A;  3WD4 A;  3FAP A;  3EY6 A;  3ARU A;  4MAV A;  3O5P A;  3KAD A;  4JFM A;  3IK8 A;  4J4N A;  1W9V A;  1ZK6 A;  1QPF A;  1LJY A;  3EIP A;  5J6E A;  4DRQ A;  2YBU A;  3I6C A;  1R9H A;  4L3N A;  3AS0 A;  4FAP A;  4DH0 A;  1WAW A;  4ITZ A;  1ROU A;  1W9U A;  2PPO A;  3KCE A;  5HT1 A;  2RUD A;  1W1P A;  1J6Y A;  3RFW A;  2MLX A;  3OOB A;  4W9Q A;  1D7I A;  5HUA A;  1C9H A;  3RM4 A;  2DT0 A;  4WK9 A;  2K8I A;  1LG2 A;  1HKJ A;  2F4E A;  2MF9 A;  1IX5 A;  5DEZ A;  2ZR4 A;  1E6R A;  3CGM A;  2ZQT A;  1NWS A;  1HXV A;  3ALF A;  3ARP A;  4J4O A;  1EDQ A;  4P8X A;  4L72 B;  4MNL A;  1EHN A;  3UI6 A;  4JFK A;  1FKR A;  3WL0 A;  1HKI A;  2RSE A;  3WD3 A;  1XHG A;  3PRD A;  4DRJ A;  5JH8 A;  5HW7 A;  1HJW A;  2IUZ A;  3IKD A;  4DIP A;  1W26 A;  2N87 A;  3PA7 A;  1FKD A;  2KR7 A;  2M08 A;  3LUO A;  2Y78 A;  2XP9 A;  1U79 A;  1J4H A;  1LL7 A;  3O5R A;  4ZS6 A;  2XPA A;  2KFW A;  3CHC A;  1XRV A;  2L2S A;  1J4I A;  1FKJ A;  3ODK A;  1K9T A;  1YAT A;  1FKI A;  1FKB A;  3AQU A;  4IT4 A;  2EUL A;  4ZPW R;  4DZ2 A;  2XP8 A;  2ZQV A;  3JYJ A;  4G2P A;  1FKL A;  2JZV A;  3RM8 A;  2YBT A;  5GQB A;  3WD2 A;  2DG4 A;  2LGO A;  5D75 A;  1GOI A;  2DSU A;  2IF4 A;  2DG3 A;  2ZR5 A;  1HJX A;  2FKE A;  1PIN A;  4HAR A;  3G6L A;  4DRN A;  2DSV A;  3FXY A;  4PTM A;  2AOS A;  1L1P A;  4R0X A;  4KR0 B;  4WKH A;  4Z2H A;  3CHE A;  1E15 A;  1FKK A;  2PI6 A;  1UR9 A;  3NRK A;  2LKN A;  2B31 A;  2A3C A;  3ARS A;  1D2K A;  1P5Q A;  3B8S A;  1NWU A;  1GPF A;  4DT4 A;  2M2A A;  4ML4 A;  4QT2 A;  1TFV A;  3O5J A;  4G50 A;  1LG1 A;  2PN0 A;  2D9F A;  1ROT A;  2ESC A;  4NZC A;  1NWT A;  5GPR A;  4S3J A;  3WKZ A;  3B9E A;  4W9O A;  4DWS D;  4TW6 A;  3ARQ A;  3KAI A;  1FKF A;  3TC5 A;  1Q6H A;  3FY1 A;  5HKG A;  4HBO A;  3NI6 A;  4WKF A;  4W5U A;  3RME A;  5DF0 A;  1X6L A;  3NTP A;  3AS3 A;  2XP4 A;  4U84 A;  3O5F A;  3WIJ A;  3O5O A;  1D7H A;  4MNJ A;  3O5M A;  1F8A B;  1JND A;  2DT3 A;  2PV3 A;  2A3E A;  3ALG A;  1E6Z A;  4DZ3 A;  1E6P A;  2DPE A;  3O5I A;  2PBC A;  4U86 A;  4MNK A;  4ODN A;  3CGN A;  4TNS A;  3VAW A;  4MGV A;  4ODQ A;  2VCD A;  3WD0 A;  3O5K A;  3JYM A;  4ODP A;  3B7X A;  1W1T A;  1W9P A;  2B5U B;  3AS1 A;  4QT3 A;  1WNO A;  3TCZ A;  1LL6 A;  2LPV A;  3GU0 A;  4S3K A;  3O5Q A;  4IT6 A;  3MDY B;  3UQB A;  1SR0 A;  3ARR A;  4O2T A;  3UQA A;  3KAB A;  3H9R B;  2RUC A;  3WL1 A;  3CZ8 A;  1Y0O A;  2MLY A;  4GIV A;  4DRK A;  3ARO A;  1NH6 A;  2UZ5 A;  4W9P A;  1T11 A;  2XP5 A;  2ZQS A;  3WQW A;  1Q6U A;  3ARW A;  4GGQ A;  5HTG A;  4URI A;  1H0G A;  4WIW A;  1YW5 A;  2KI3 A;  1E44 A;  1NWR A;  2WLZ A;  4ODR A;  3AS2 A;  3IHZ A;  1M5Y A;  2OLH A;  4N19 A;  1QPL A;  3B9A A;  2XP7 A;  3PRB A;  4MTV A;  4LAV A;  3KZ7 A;  4BF8 A;  1HJV A;  4Z2G A;  4Z2I A;  2AWG A;  1BL4 A;  5GPG A;  2M1I A;  3O5E A;  3KAH A;  2PPN A;  2VN1 A;  3KAC A;  2PPP A;  1ZCN A;  5HW6 A;  3PRA A;  3GTY X;  4JFL A;  2PV1 A;  1Q6I A;  1JVW A;  3ARY A;  1KT1 A;  5DO2 A;  4DRP A;  2RUQ A;  5I98 A;  1OGB A;  2RQS A;  3ARZ A;  1E6N A;  2FDM A;  4XAK A;  1WB0 A;  4DRH A;  4DWS B;  4IPX A;  2WM0 A;  1O6I A;  2ETN A;  2XPB A;  4HBE A;  1Q1C A;  4ODL A;  4ODK A; 
#chains in the Genus database with same CATH homology
 4Z2L A;  1FFQ A;  2MLZ A;  1B6C A;  2ZQU A;  2ZR6 A;  1A7X A;  1UR8 A;  3CH9 A;  4JFJ A;  1NMV A;  4P8W A;  4QZV B;  1OGG A;  1FKT A;  1ZB5 A;  4JYS A;  3W4R A;  1TCO C;  1CTN A;  1W1Y A;  4MNM A;  4WKA A;  4WJX A;  1ZBW A;  2A3B A;  4DWS A;  1LQ0 A;  1EIB A;  5HBF A;  5B8I C;  5HWC A;  4MSP A;  4Z2J A;  3WQV A;  3TDB A;  3JXV A;  5DIT A;  1FKS A;  4TW8 A;  2WLY A;  1VF8 A;  2F21 A;  1SYT A;  2XP6 A;  5DIV A;  2G41 A;  1JNS A;  4ZPV R;  4ODM A;  1FD9 A;  1PBK A;  4P8U A;  2DSW A;  2XP3 A;  1NSG A;  1W1V A;  1FFR A;  2DSZ A;  4IQ2 A;  1FKG A;  4Q22 A;  5HWB A;  3WD1 A;  2A3A A;  1F40 A;  4C02 B;  4TX0 A;  4ZPT R;  4DRM A;  2MPH A;  2KE0 A;  2O92 A;  3CHF A;  3ARV A;  3CHD A;  2PV2 A;  1BKF A;  4ODO A;  3WH0 A;  1N1A A;  1D6O A;  1E9L A;  2DT1 A;  1EYM A;  3UI5 A;  4DWS C;  3RM9 A;  4QIB A;  4IQC A;  2G8Z A;  1LL4 A;  3BXW A;  1GUV A;  5BXJ A;  1KT0 A;  3G6M A;  4TYO A;  1ZBC A;  4FN2 A;  3O5D A;  5DIU A;  2OFN A;  1ZBK A;  2O9O A;  2WK2 A;  4Z2K A;  1OWQ A;  1ZU8 A;  5HW8 A;  1H0I A;  2Q5A A;  1JNT A;  3O5L A;  4P8V A;  2MNT A;  1NMW A;  1FAP A;  4LAX A;  3OA5 A;  2DT2 A;  1ZL1 A;  1D7J A;  4AY1 A;  3PR9 A;  3IKG A;  4U85 A;  4LAW A;  1J4R A;  2RUR A;  4DRO A;  1KFW A;  4DRI A;  1RD6 A;  4KQZ A;  2DG9 A;  4LGX A;  4R5E A;  1ZBV A;  3B9D A;  2F2D A;  2KGJ A;  3KAG A;  2ITK A;  3O5G A;  4NNR A;  1FKH A;  4Q7N A;  1HKM A;  1ITX A;  1QZ2 A;  1JNE A;  3KAF A;  4NSB A;  2FAP A;  3UI4 A;  1FJD A;  4JFI A;  3GPK A;  3ARX A;  3QOK A;  2LJ4 A;  1HKK A;  2KO7 A;  1EQ3 A;  3ART A;  2QF8 A;  4TW7 A;  3RGC A;  4MPK A;  3UF8 A;  4LAY A;  1X6N A;  3UQI A;  3WD4 A;  3FAP A;  3EY6 A;  3ARU A;  4MAV A;  3O5P A;  3KAD A;  4JFM A;  3IK8 A;  4J4N A;  1W9V A;  1ZK6 A;  1QPF A;  1LJY A;  5J6E A;  4DRQ A;  2YBU A;  3I6C A;  1R9H A;  4L3N A;  3AS0 A;  4FAP A;  4DH0 A;  1WAW A;  4ITZ A;  1ROU A;  1W9U A;  2PPO A;  3KCE A;  5HT1 A;  2RUD A;  1W1P A;  1J6Y A;  3RFW A;  2MLX A;  3OOB A;  4W9Q A;  1D7I A;  5HUA A;  1C9H A;  3RM4 A;  2DT0 A;  4WK9 A;  2K8I A;  1LG2 A;  1HKJ A;  2F4E A;  2MF9 A;  1IX5 A;  5DEZ A;  2ZR4 A;  1E6R A;  3CGM A;  2ZQT A;  1NWS A;  1HXV A;  3ALF A;  3ARP A;  4J4O A;  1EDQ A;  4P8X A;  4L72 B;  4MNL A;  1EHN A;  3UI6 A;  4JFK A;  1FKR A;  3WL0 A;  1HKI A;  2RSE A;  3WD3 A;  1XHG A;  3PRD A;  4DRJ A;  5JH8 A;  5HW7 A;  1HJW A;  2IUZ A;  3IKD A;  4DIP A;  1W26 A;  2N87 A;  3PA7 A;  1FKD A;  2KR7 A;  2M08 A;  3LUO A;  2Y78 A;  2XP9 A;  1U79 A;  1J4H A;  1LL7 A;  3O5R A;  4ZS6 A;  2XPA A;  2KFW A;  3CHC A;  1XRV A;  2L2S A;  1J4I A;  1FKJ A;  3ODK A;  1K9T A;  1YAT A;  1FKI A;  1FKB A;  3AQU A;  4IT4 A;  4ZPW R;  4DZ2 A;  2XP8 A;  2ZQV A;  3JYJ A;  4G2P A;  1FKL A;  2JZV A;  3RM8 A;  2YBT A;  5GQB A;  3WD2 A;  2DG4 A;  2LGO A;  5D75 A;  1GOI A;  2DSU A;  2IF4 A;  2DG3 A;  2ZR5 A;  1HJX A;  2FKE A;  1PIN A;  4HAR A;  3G6L A;  4DRN A;  2DSV A;  3FXY A;  4PTM A;  2AOS A;  1L1P A;  4R0X A;  4KR0 B;  4WKH A;  4Z2H A;  3CHE A;  1E15 A;  1FKK A;  2PI6 A;  1UR9 A;  3NRK A;  2LKN A;  2B31 A;  2A3C A;  3ARS A;  1D2K A;  1P5Q A;  3B8S A;  1NWU A;  1GPF A;  4DT4 A;  2M2A A;  4ML4 A;  4QT2 A;  1TFV A;  3O5J A;  4G50 A;  1LG1 A;  2D9F A;  1ROT A;  2ESC A;  4NZC A;  1NWT A;  5GPR A;  4S3J A;  3WKZ A;  3B9E A;  4W9O A;  4DWS D;  4TW6 A;  3ARQ A;  3KAI A;  1FKF A;  3TC5 A;  1Q6H A;  3FY1 A;  5HKG A;  4HBO A;  3NI6 A;  4WKF A;  4W5U A;  3RME A;  5DF0 A;  1X6L A;  3NTP A;  3AS3 A;  2XP4 A;  4U84 A;  3O5F A;  3WIJ A;  3O5O A;  1D7H A;  4MNJ A;  3O5M A;  1F8A B;  1JND A;  2DT3 A;  2PV3 A;  2A3E A;  3ALG A;  1E6Z A;  4DZ3 A;  1E6P A;  2DPE A;  3O5I A;  2PBC A;  4U86 A;  4MNK A;  4ODN A;  3CGN A;  4TNS A;  3VAW A;  4MGV A;  4ODQ A;  2VCD A;  3WD0 A;  3O5K A;  3JYM A;  4ODP A;  3B7X A;  1W1T A;  1W9P A;  3AS1 A;  4QT3 A;  1WNO A;  3TCZ A;  1LL6 A;  2LPV A;  4S3K A;  3O5Q A;  4IT6 A;  3MDY B;  3UQB A;  1SR0 A;  3ARR A;  4O2T A;  3UQA A;  3KAB A;  3H9R B;  2RUC A;  3WL1 A;  3CZ8 A;  1Y0O A;  2MLY A;  4GIV A;  4DRK A;  3ARO A;  1NH6 A;  2UZ5 A;  4W9P A;  1T11 A;  2XP5 A;  2ZQS A;  3WQW A;  1Q6U A;  3ARW A;  4GGQ A;  5HTG A;  4URI A;  1H0G A;  4WIW A;  1YW5 A;  2KI3 A;  1NWR A;  2WLZ A;  4ODR A;  3AS2 A;  3IHZ A;  1M5Y A;  2OLH A;  4N19 A;  1QPL A;  3B9A A;  2XP7 A;  3PRB A;  4MTV A;  4LAV A;  3KZ7 A;  4BF8 A;  1HJV A;  4Z2G A;  4Z2I A;  2AWG A;  1BL4 A;  5GPG A;  2M1I A;  3O5E A;  3KAH A;  2PPN A;  2VN1 A;  3KAC A;  2PPP A;  1ZCN A;  5HW6 A;  3PRA A;  4JFL A;  2PV1 A;  1Q6I A;  1JVW A;  3ARY A;  1KT1 A;  5DO2 A;  4DRP A;  2RUQ A;  5I98 A;  1OGB A;  2RQS A;  3ARZ A;  1E6N A;  2FDM A;  4XAK A;  1WB0 A;  4DRH A;  4DWS B;  4IPX A;  2WM0 A;  1O6I A;  2XPB A;  4HBE A;  1Q1C A;  4ODL A;  4ODK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...