1FKHA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkhA00
2FAPA 1FKKA 2LKNA 4TYOA 3PRBA 2MLZA 1BKFA 1ROTA 5HT1A 4C02B 3O5KA 4TW6A 3RGCA 1QZ2A 1NMWA 4BF8A 3CGNA 1U79A 1W26A 1J4RA 5I98A 1FKSA 1F40A 1FKJA 2Y78A 3KACA 3UQBA 1C9HA 2M2AA 1J4IA 3TCZA 2XPAA 3RFWA 2DG3A 4W9OA 5HKGA 1FJDA 3I6CA 3KAIA 4TX0A 3O5OA 1ROUA 2F4EA 3O5MA 3KAGA 4ODQA 2PV2A 4TW7A 2MNTA 2XPBA 2ZR5A 3KAHA 4ODRA 2ZQSA 3FAPA 4TNSA 1R9HA 4DRQA 2MF9A 5HWBA 4QIBA 5HTGA 4ODLA 1FKTA 4TW8A 2DG4A 2FKEA 2ZR6A 2ITKA 1B6CA 4DZ2A 4DH0A 2M1IA 2RUCA 3KAFA 5HUAA 1Q6UA 2L2SA 2ZR4A 2KFWA 5J6EA 4IPXA 4IQ2A 4ODKA 4DROA 5B8IC 2XP7A 3IKDA 4DRPA 1T11A 2KGJA 3B7XA 4IQCA 1Y0OA 5DIVA 2N87A 4JFJA 1FKGA 3KADA 2KO7A 4MSPA 1NSGA 4W9PA 3WH0A 5HWCA 2K8IA 4U86A 4DRNA 1ZCNA 2MLXA 3IHZA 3GPKA 3UQIA 4JFMA 4G2PA 1P5QA 2RUQA 4MGVA 4JFLA 5BXJA 3KABA 3O5QA 4FN2A 3NRKA 1D6OA 4FAPA 1J4HA 3KCEA 4LAWA 3ODKA 1KT0A 2VN1A 4J4NA 2AWGA 2XP5A 1D7JA 1N1AA 2ZQVA 2PPNA 2MPHA 4O2TA 4DRIA 1KT1A 3H9RB 3O5GA 1EYMA 2M08A 5DITA 1FKRA 1QPFA 5GPGA 3NI6A 3JYMA 4DT4A 2PPPA 2RURA 1L1PA 2XP3A 1FAPA 1Q1CA 3OOBA 4GGQA 4DRJA 3O5DA 1JNSA 4ODOA 2ZQTA 3UI6A 1PINA 2RQSA 3O5FA 4LAYA 2XP4A 2KI3A 4GIVA 4ODMA 5DIUA 4DRKA 3UF8A 5HW7A 1FD9A 3IK8A 3O5PA 2PV1A 2F2DA 1FKFA 1NMVA 1JNTA 3O5EA 3JYJA 2JZVA 4LAVA 2KR7A 1FKHA 4QT3A 4J4OA 4DRHA 3LUOA 2KE0A 2VCDA 4NNRA 3VAWA 3EY6A 2Q5AA 3O5RA 1JVWA 1YATA 2ZQUA 4DIPA 2XP9A 1FKLA 1D7HA 4N19A 3UI5A 5HW6A 1ZK6A 3O5LA 3PA7A 2OFNA 2RSEA 4R0XA 4ITZA 4JFIA 3O5JA 4JFKA 5HW8A 5D75A 2RUDA 4ODPA 2PV3A 3TC5A 1J6YA 1Q6IA 1QPLA 4DZ3A 1YW5A 3O5IA 1D7IA 2IF4A 2LPVA 1A7XA 2XP8A 3UI4A 1PBKA 1F8AB 2D9FA 1TCOC 3NTPA 2XP6A 2MLYA 4U85A 1EQ3A 3MDYB 1FKIA 3CGMA 2PBCA 2LGOA 3IKGA 3PRDA 1FKDA 1M5YA 2DG9A 4G50A 4ODNA 1BL4A 2LJ4A 3UQAA 3JXVA 1FKBA 3KZ7A 4LAXA 3TDBA 4U84A 1Q6HA 4DRMA 1HXVA 4W9QA 2PPOA 2UZ5A 2F21A 4JYSA 4QT2A
chains in the Genus database with same CATH superfamily
3PRBA 2B5UB 4KQZA 1BKFA 1QZ2A 5I98A 1WAWA 2Y78A 1C9HA 4DWSA 2DSUA 3WIJA 2WK2A 1NWSA 3G6MA 1ROUA 4ODQA 2MNTA 3KAHA 4ODRA 4DRQA 3GU0A 1CTNA 2DG4A 2ZR6A 3AS1A 3RM9A 4MNKA 5HUAA 1ZB5A 2ZR4A 2KFWA 4ZPWR 5B8IC 4JFJA 3KADA 1NSGA 3B9AA 2YBTA 1ZCNA 2MLXA 5BXJA 4MNLA 1D6OA 2DSZA 1JNDA 2AWGA 2ZQVA 2MPHA 1KT1A 1ITXA 2M08A 5DITA 4L3NA 3JYMA 3WKZA 3WL1A 3CHDA 3W4RA 4DT4A 3O5DA 5GQBA 4ODOA 1W9VA 3AS2A 3O5FA 2KI3A 4GIVA 2PV1A 1FKFA 3JYJA 1WNOA 3LUOA 4NNRA 3VAWA 3EY6A 2Q5AA 1JVWA 3QOKA 5HW6A 3PA7A 3RM4A 1LQ0A 4JFIA 4UDMA 5HW8A 4JFKA 2RUDA 4ODPA 3TC5A 1D7IA 1PBKA 1E6PA 3WL0A 1EQ3A 3CGMA 2LGOA 3IKGA 3AS3A 1XRVA 4G50A 3BMBA 1GRJA 1BL4A 4HBOA 3ARUA 1NWRA 4LAXA 4U84A 1E6ZA 2AOSA 3WD0A 4QT2A 1FKKA 1JCHB 4C02B 3O5KA 3CHCA 4BF8A 1NMWA 3ARQA 4Q7NA 3AQUA 1J4RA 3KACA 3WQVA 2DG3A 3WD4A 1FJDA 3I6CA 1KFWA 3O5OA 1RD6A 3O5MA 4TW7A 2XPBA 1E6RA 3FAPA 1HJXA 4QIBA 2FKEA 2ITKA 2M1IA 2RUCA 4NZCA 1GUVA 4MAVA 2PI6A 4WKHA 4IPXA 4DROA 1Y0OA 4ML4A 4Z2LA 1SR0A 2FDMA 2N87A 1FKGA 2KO7A 4W9PA 2K8IA 3WD2A 3UQIA 1TFVA 1P5QA 2QF8A 2RUQA 1ZL1A 4LGXA 3ALFA 3O5QA 1NH6A 4FAPA 4LAWA 1LL4A 1KT0A 1EIBA 2VN1A 1N1AA 3OA5A 4DRIA 4NSBA 3O5GA 1EYMA 1OGBA 1W1PA 4DWSC 2RURA 1FAPA 1Q1CA 4GGQA 3CHFA 4MNJA 2A3BA 1OWQA 3FY1A 3PRAA 1X6LA 4ODMA 3UF8A 1EHNA 3IK8A 2F2DA 1NMVA 1JNTA 3ALGA 2KR7A 4QT3A 1ZBKA 2KE0A 4IT6A 4MPKA 1W1YA 1FKLA 3UI5A 4WKFA 2OFNA 1J6YA 4URIA 4DZ3A 3B9DA 1W9PA 2D9FA 4Z2KA 1TCOC 4U85A 2PBCA 3AS0A 1LL6A 1M5YA 2PN0A 3TDBA 3ARSA 1HXVA 2PPOA 2A3CA 1H0GA 4WKAA 1LG2A 2FAPA 2LKNA 4S3JA 5HBFA 1LL7A 2MLZA 1ROTA 4HARA 3CGNA 4XAKA 1J4IA 1UR9A 3TCZA 3ARWA 4W9OA 4TX0A 2F4EA 2DPEA 2PV2A 4Z2HA 1E15A 2ZQSA 4TNSA 5HTGA 3G6LA 4ODLA 5DO2A 4TW8A 4DZ2A 4DH0A 4DWSD 1E6NA 4MNMA 3KAFA 3RM8A 1W1VA 3ARTA 5J6EA 3ARYA 4ODKA 1NWUA 3ARZA 4IQCA 5DIVA 1WB0A 3WD3A 1IX5A 3ARRA 4U86A 3GPKA 4JFMA 4Z2IA 3CH9A 4MGVA 1EDQA 3KABA 4HBEA 4FN2A 5DF0A 1O6IA 1J4HA 3BXWA 2XP5A 3CHEA 4O2TA 5GPRA 2WLYA 4L72B 1FKRA 1QPFA 5GPGA 3NI6A 2XP3A 3OOBA 3RMEA 2ZQTA 1E44A 1PINA 2RQSA 4LAYA 5HW7A 1FD9A 2WLZA 4WJXA 2JZVA 1FKHA 1ZU8A 4J4OA 3ARPA 1HJWA 4DRHA 3WQWA 1LG1A 4DIPA 1D7HA 3GTYX 4N19A 1ZK6A 4PTMA 4ITZA 3O5JA 5D75A 1HKJA 2O9OA 2PV3A 3ARXA 1Q6IA 1ZBVA 4P8UA 1A7XA 2XP8A 1F8AB 4Z2GA 3CZ8A 1FKDA 2DG9A 4KR0B 2LJ4A 2WM0A 3JXVA 1W9UA 4R5EA 1Q6HA 4DRMA 4W9QA 2UZ5A 1XHGA 1D2KA 4TYOA 5DEZA 4ZS6A 5HT1A 2O92A 4AY1A 4TW6A 3RGCA 4ZPTR 5JH8A 1U79A 1W26A 1FKSA 1OGGA 4Q22A 1F40A 1FKJA 3UQBA 4P8XA 2ESCA 2M2AA 2XPAA 3RFWA 2DT2A 5HKGA 3KAIA 3AROA 1FFQA 4P8WA 1H0IA 3KAGA 2ZR5A 2DSWA 1UR8A 2DT3A 1X6NA 1R9HA 4DWSB 2MF9A 5HWBA 1FKTA 2DSVA 1B6CA 2A3AA 2YBUA 4QZVB 1Q6UA 2L2SA 4W5UA 2OLHA 1E9LA 4IQ2A 2XP7A 3IKDA 4DRPA 1T11A 2KGJA 3B7XA 1ZBCA 4MSPA 5HWCA 4ZPVR 3WH0A 2EULA 4DRNA 1HKIA 3IHZA 4G2PA 4JFLA 3NRKA 1K9TA 3KCEA 3ODKA 4J4NA 1D7JA 1LJYA 3B9EA 3B8SA 2PPNA 2G41A 4WK9A 3H9RB 1GPFA 2B31A 2PPPA 1L1PA 4DRJA 1FFRA 1JNSA 1GOIA 3UI6A 1SYTA 2XP4A 5DIUA 4DRKA 2DT0A 3O5PA 2P4VA 3O5EA 4LAVA 1NWTA 2VCDA 2G8ZA 1HKKA 1ZBWA 3O5RA 1HJVA 1YATA 2DT1A 2ZQUA 2XP9A 1W1TA 3O5LA 2RSEA 4R0XA 2IUZA 3FXYA 4WIWA 1QPLA 2A3EA 1YW5A 3O5IA 2IF4A 2LPVA 3UI4A 3NTPA 1JNEA 2MLYA 2XP6A 4P8VA 3ARVA 1FKIA 3MDYB 3PRDA 3WD1A 3EIPA 3PR9A 4ODNA 3UQAA 1HKMA 1FKBA 4MTVA 4IT4A 3KZ7A 4S3KA 2F23A 2ETNA 4Z2JA 1VF8A 2F21A 4JYSA
chains in the Genus database with same CATH topology
3PRBA 4KQZA 1BKFA 1QZ2A 5I98A 1WAWA 2Y78A 1C9HA 4DWSA 2DSUA 3WIJA 2WK2A 1NWSA 3G6MA 1ROUA 4ODQA 2MNTA 3KAHA 4ODRA 4DRQA 1CTNA 2DG4A 2ZR6A 3AS1A 3RM9A 4MNKA 5HUAA 1ZB5A 2ZR4A 2KFWA 4ZPWR 5B8IC 4JFJA 3KADA 1NSGA 3B9AA 2YBTA 1ZCNA 2MLXA 5BXJA 4MNLA 1D6OA 2DSZA 1JNDA 2AWGA 2ZQVA 2MPHA 1KT1A 1ITXA 2M08A 5DITA 4L3NA 3JYMA 3WKZA 3WL1A 3CHDA 3W4RA 4DT4A 3O5DA 5GQBA 4ODOA 1W9VA 3AS2A 3O5FA 2KI3A 4GIVA 2PV1A 1FKFA 3JYJA 1WNOA 3LUOA 4NNRA 3VAWA 3EY6A 2Q5AA 1JVWA 3QOKA 5HW6A 3PA7A 3RM4A 1LQ0A 4JFIA 5HW8A 4JFKA 2RUDA 4ODPA 3TC5A 1D7IA 1PBKA 1E6PA 3WL0A 1EQ3A 3CGMA 2LGOA 3IKGA 3AS3A 1XRVA 4G50A 1BL4A 4HBOA 3ARUA 1NWRA 4LAXA 4U84A 1E6ZA 2AOSA 3WD0A 4QT2A 1FKKA 4C02B 3O5KA 3CHCA 4BF8A 1NMWA 3ARQA 4Q7NA 3AQUA 1J4RA 3KACA 3WQVA 2DG3A 3WD4A 1FJDA 3I6CA 1KFWA 3O5OA 1RD6A 3O5MA 4TW7A 2XPBA 1E6RA 3FAPA 1HJXA 4QIBA 2FKEA 2ITKA 2M1IA 2RUCA 4NZCA 1GUVA 4MAVA 2PI6A 4WKHA 4IPXA 4DROA 1Y0OA 4ML4A 4Z2LA 1SR0A 2FDMA 2N87A 1FKGA 2KO7A 4W9PA 2K8IA 3WD2A 3UQIA 1TFVA 1P5QA 2QF8A 2RUQA 1ZL1A 4LGXA 3ALFA 3O5QA 1NH6A 4FAPA 4LAWA 1LL4A 1KT0A 1EIBA 2VN1A 1N1AA 3OA5A 4DRIA 4NSBA 3O5GA 1EYMA 1OGBA 1W1PA 4DWSC 2RURA 1FAPA 1Q1CA 4GGQA 3CHFA 4MNJA 2A3BA 1OWQA 3FY1A 3PRAA 1X6LA 4ODMA 3UF8A 1EHNA 3IK8A 2F2DA 1NMVA 1JNTA 3ALGA 2KR7A 4QT3A 1ZBKA 2KE0A 4IT6A 4MPKA 1W1YA 1FKLA 3UI5A 4WKFA 2OFNA 1J6YA 4URIA 4DZ3A 3B9DA 1W9PA 2D9FA 4Z2KA 1TCOC 4U85A 2PBCA 3AS0A 1LL6A 1M5YA 3TDBA 3ARSA 1HXVA 2PPOA 2A3CA 1H0GA 4WKAA 1LG2A 2FAPA 2LKNA 4S3JA 5HBFA 1LL7A 2MLZA 1ROTA 4HARA 3CGNA 4XAKA 1J4IA 1UR9A 3TCZA 3ARWA 4W9OA 4TX0A 2F4EA 2DPEA 2PV2A 4Z2HA 1E15A 2ZQSA 4TNSA 5HTGA 3G6LA 4ODLA 5DO2A 4TW8A 4DZ2A 4DH0A 4DWSD 1E6NA 4MNMA 3KAFA 3RM8A 1W1VA 3ARTA 5J6EA 3ARYA 4ODKA 1NWUA 3ARZA 4IQCA 5DIVA 1WB0A 3WD3A 1IX5A 3ARRA 4U86A 3GPKA 4JFMA 4Z2IA 3CH9A 4MGVA 1EDQA 3KABA 4HBEA 4FN2A 5DF0A 1O6IA 1J4HA 3BXWA 2XP5A 3CHEA 4O2TA 5GPRA 2WLYA 4L72B 1FKRA 1QPFA 5GPGA 3NI6A 2XP3A 3OOBA 3RMEA 2ZQTA 1PINA 2RQSA 4LAYA 5HW7A 1FD9A 2WLZA 4WJXA 2JZVA 1FKHA 1ZU8A 4J4OA 3ARPA 1HJWA 4DRHA 3WQWA 1LG1A 4DIPA 1D7HA 4N19A 1ZK6A 4PTMA 4ITZA 3O5JA 5D75A 1HKJA 2O9OA 2PV3A 3ARXA 1Q6IA 1ZBVA 4P8UA 1A7XA 2XP8A 1F8AB 4Z2GA 3CZ8A 1FKDA 2DG9A 4KR0B 2LJ4A 2WM0A 3JXVA 1W9UA 4R5EA 1Q6HA 4DRMA 4W9QA 2UZ5A 1XHGA 1D2KA 4TYOA 5DEZA 4ZS6A 5HT1A 2O92A 4AY1A 4TW6A 3RGCA 4ZPTR 5JH8A 1U79A 1W26A 1FKSA 1OGGA 4Q22A 1F40A 1FKJA 3UQBA 4P8XA 2ESCA 2M2AA 2XPAA 3RFWA 2DT2A 5HKGA 3KAIA 3AROA 1FFQA 4P8WA 1H0IA 3KAGA 2ZR5A 2DSWA 1UR8A 2DT3A 1X6NA 1R9HA 4DWSB 2MF9A 5HWBA 1FKTA 2DSVA 1B6CA 2A3AA 2YBUA 4QZVB 1Q6UA 2L2SA 4W5UA 2OLHA 1E9LA 4IQ2A 2XP7A 3IKDA 4DRPA 1T11A 2KGJA 3B7XA 1ZBCA 4MSPA 5HWCA 4ZPVR 3WH0A 4DRNA 1HKIA 3IHZA 4G2PA 4JFLA 3NRKA 1K9TA 3KCEA 3ODKA 4J4NA 1D7JA 1LJYA 3B9EA 3B8SA 2PPNA 2G41A 4WK9A 3H9RB 1GPFA 2B31A 2PPPA 1L1PA 4DRJA 1FFRA 1JNSA 1GOIA 3UI6A 1SYTA 2XP4A 5DIUA 4DRKA 2DT0A 3O5PA 3O5EA 4LAVA 1NWTA 2VCDA 2G8ZA 1HKKA 3O5RA 1ZBWA 1HJVA 1YATA 2DT1A 2ZQUA 2XP9A 1W1TA 3O5LA 2RSEA 4R0XA 2IUZA 3FXYA 4WIWA 1QPLA 2A3EA 1YW5A 3O5IA 2IF4A 2LPVA 3UI4A 3NTPA 1JNEA 2MLYA 2XP6A 4P8VA 3ARVA 1FKIA 3MDYB 3PRDA 3WD1A 3PR9A 4ODNA 3UQAA 1HKMA 1FKBA 4MTVA 4IT4A 3KZ7A 4S3KA 4Z2JA 1VF8A 2F21A 4JYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP A;  1FKK A;  2LKN A;  4TYO A;  3PRB A;  2MLZ A;  1BKF A;  1ROT A;  5HT1 A;  4C02 B;  3O5K A;  4TW6 A;  3RGC A;  1QZ2 A;  1NMW A;  4BF8 A;  3CGN A;  1U79 A;  1W26 A;  1J4R A;  5I98 A;  1FKS A;  1F40 A;  1FKJ A;  2Y78 A;  3KAC A;  3UQB A;  1C9H A;  2M2A A;  1J4I A;  3TCZ A;  2XPA A;  3RFW A;  2DG3 A;  4W9O A;  5HKG A;  1FJD A;  3I6C A;  3KAI A;  4TX0 A;  3O5O A;  1ROU A;  2F4E A;  3O5M A;  3KAG A;  4ODQ A;  2PV2 A;  4TW7 A;  2MNT A;  2XPB A;  2ZR5 A;  3KAH A;  4ODR A;  2ZQS A;  3FAP A;  4TNS A;  1R9H A;  4DRQ A;  2MF9 A;  5HWB A;  4QIB A;  5HTG A;  4ODL A;  1FKT A;  4TW8 A;  2DG4 A;  2FKE A;  2ZR6 A;  2ITK A;  1B6C A;  4DZ2 A;  4DH0 A;  2M1I A;  2RUC A;  3KAF A;  5HUA A;  1Q6U A;  2L2S A;  2ZR4 A;  2KFW A;  5J6E A;  4IPX A;  4IQ2 A;  4ODK A;  4DRO A;  5B8I C;  2XP7 A;  3IKD A;  4DRP A;  1T11 A;  2KGJ A;  3B7X A;  4IQC A;  1Y0O A;  5DIV A;  2N87 A;  4JFJ A;  1FKG A;  3KAD A;  2KO7 A;  4MSP A;  1NSG A;  4W9P A;  3WH0 A;  5HWC A;  2K8I A;  4U86 A;  4DRN A;  1ZCN A;  2MLX A;  3IHZ A;  3GPK A;  3UQI A;  4JFM A;  4G2P A;  1P5Q A;  2RUQ A;  4MGV A;  4JFL A;  5BXJ A;  3KAB A;  3O5Q A;  4FN2 A;  3NRK A;  1D6O A;  4FAP A;  1J4H A;  3KCE A;  4LAW A;  3ODK A;  1KT0 A;  2VN1 A;  4J4N A;  2AWG A;  2XP5 A;  1D7J A;  1N1A A;  2ZQV A;  2PPN A;  2MPH A;  4O2T A;  4DRI A;  1KT1 A;  3H9R B;  3O5G A;  1EYM A;  2M08 A;  5DIT A;  1FKR A;  1QPF A;  5GPG A;  3NI6 A;  3JYM A;  4DT4 A;  2PPP A;  2RUR A;  1L1P A;  2XP3 A;  1FAP A;  1Q1C A;  3OOB A;  4GGQ A;  4DRJ A;  3O5D A;  1JNS A;  4ODO A;  2ZQT A;  3UI6 A;  1PIN A;  2RQS A;  3O5F A;  4LAY A;  2XP4 A;  2KI3 A;  4GIV A;  4ODM A;  5DIU A;  4DRK A;  3UF8 A;  5HW7 A;  1FD9 A;  3IK8 A;  3O5P A;  2PV1 A;  2F2D A;  1FKF A;  1NMV A;  1JNT A;  3O5E A;  3JYJ A;  2JZV A;  4LAV A;  2KR7 A;  1FKH A;  4QT3 A;  4J4O A;  4DRH A;  3LUO A;  2KE0 A;  2VCD A;  4NNR A;  3VAW A;  3EY6 A;  2Q5A A;  3O5R A;  1JVW A;  1YAT A;  2ZQU A;  4DIP A;  2XP9 A;  1FKL A;  1D7H A;  4N19 A;  3UI5 A;  5HW6 A;  1ZK6 A;  3O5L A;  3PA7 A;  2OFN A;  2RSE A;  4R0X A;  4ITZ A;  4JFI A;  3O5J A;  4JFK A;  5HW8 A;  5D75 A;  2RUD A;  4ODP A;  2PV3 A;  3TC5 A;  1J6Y A;  1Q6I A;  1QPL A;  4DZ3 A;  1YW5 A;  3O5I A;  1D7I A;  2IF4 A;  2LPV A;  1A7X A;  2XP8 A;  3UI4 A;  1PBK A;  1F8A B;  2D9F A;  1TCO C;  3NTP A;  2XP6 A;  2MLY A;  4U85 A;  1EQ3 A;  3MDY B;  1FKI A;  3CGM A;  2PBC A;  2LGO A;  3IKG A;  3PRD A;  1FKD A;  1M5Y A;  2DG9 A;  4G50 A;  4ODN A;  1BL4 A;  2LJ4 A;  3UQA A;  3JXV A;  1FKB A;  3KZ7 A;  4LAX A;  3TDB A;  4U84 A;  1Q6H A;  4DRM A;  1HXV A;  4W9Q A;  2PPO A;  2UZ5 A;  2F21 A;  4JYS A;  4QT2 A; 
#chains in the Genus database with same CATH topology
 3PRB A;  2B5U B;  4KQZ A;  1BKF A;  1QZ2 A;  5I98 A;  1WAW A;  2Y78 A;  1C9H A;  4DWS A;  2DSU A;  3WIJ A;  2WK2 A;  1NWS A;  3G6M A;  1ROU A;  4ODQ A;  2MNT A;  3KAH A;  4ODR A;  4DRQ A;  3GU0 A;  1CTN A;  2DG4 A;  2ZR6 A;  3AS1 A;  3RM9 A;  4MNK A;  5HUA A;  1ZB5 A;  2ZR4 A;  2KFW A;  4ZPW R;  5B8I C;  4JFJ A;  3KAD A;  1NSG A;  3B9A A;  2YBT A;  1ZCN A;  2MLX A;  5BXJ A;  4MNL A;  1D6O A;  2DSZ A;  1JND A;  2AWG A;  2ZQV A;  2MPH A;  1KT1 A;  1ITX A;  2M08 A;  5DIT A;  4L3N A;  3JYM A;  3WKZ A;  3WL1 A;  3CHD A;  3W4R A;  4DT4 A;  3O5D A;  5GQB A;  4ODO A;  1W9V A;  3AS2 A;  3O5F A;  2KI3 A;  4GIV A;  2PV1 A;  1FKF A;  3JYJ A;  1WNO A;  3LUO A;  4NNR A;  3VAW A;  3EY6 A;  2Q5A A;  1JVW A;  3QOK A;  5HW6 A;  3PA7 A;  3RM4 A;  1LQ0 A;  4JFI A;  4UDM A;  5HW8 A;  4JFK A;  2RUD A;  4ODP A;  3TC5 A;  1D7I A;  1PBK A;  1E6P A;  3WL0 A;  1EQ3 A;  3CGM A;  2LGO A;  3IKG A;  3AS3 A;  1XRV A;  4G50 A;  3BMB A;  1GRJ A;  1BL4 A;  4HBO A;  3ARU A;  1NWR A;  4LAX A;  4U84 A;  1E6Z A;  2AOS A;  3WD0 A;  4QT2 A;  1FKK A;  1JCH B;  4C02 B;  3O5K A;  3CHC A;  4BF8 A;  1NMW A;  3ARQ A;  4Q7N A;  3AQU A;  1J4R A;  3KAC A;  3WQV A;  2DG3 A;  3WD4 A;  1FJD A;  3I6C A;  1KFW A;  3O5O A;  1RD6 A;  3O5M A;  4TW7 A;  2XPB A;  1E6R A;  3FAP A;  1HJX A;  4QIB A;  2FKE A;  2ITK A;  2M1I A;  2RUC A;  4NZC A;  1GUV A;  4MAV A;  2PI6 A;  4WKH A;  4IPX A;  4DRO A;  1Y0O A;  4ML4 A;  4Z2L A;  1SR0 A;  2FDM A;  2N87 A;  1FKG A;  2KO7 A;  4W9P A;  2K8I A;  3WD2 A;  3UQI A;  1TFV A;  1P5Q A;  2QF8 A;  2RUQ A;  1ZL1 A;  4LGX A;  3ALF A;  3O5Q A;  1NH6 A;  4FAP A;  4LAW A;  1LL4 A;  1KT0 A;  1EIB A;  2VN1 A;  1N1A A;  3OA5 A;  4DRI A;  4NSB A;  3O5G A;  1EYM A;  1OGB A;  1W1P A;  4DWS C;  2RUR A;  1FAP A;  1Q1C A;  4GGQ A;  3CHF A;  4MNJ A;  2A3B A;  1OWQ A;  3FY1 A;  3PRA A;  1X6L A;  4ODM A;  3UF8 A;  1EHN A;  3IK8 A;  2F2D A;  1NMV A;  1JNT A;  3ALG A;  2KR7 A;  4QT3 A;  1ZBK A;  2KE0 A;  4IT6 A;  4MPK A;  1W1Y A;  1FKL A;  3UI5 A;  4WKF A;  2OFN A;  1J6Y A;  4URI A;  4DZ3 A;  3B9D A;  1W9P A;  2D9F A;  4Z2K A;  1TCO C;  4U85 A;  2PBC A;  3AS0 A;  1LL6 A;  1M5Y A;  2PN0 A;  3TDB A;  3ARS A;  1HXV A;  2PPO A;  2A3C A;  1H0G A;  4WKA A;  1LG2 A;  2FAP A;  2LKN A;  4S3J A;  5HBF A;  1LL7 A;  2MLZ A;  1ROT A;  4HAR A;  3CGN A;  4XAK A;  1J4I A;  1UR9 A;  3TCZ A;  3ARW A;  4W9O A;  4TX0 A;  2F4E A;  2DPE A;  2PV2 A;  4Z2H A;  1E15 A;  2ZQS A;  4TNS A;  5HTG A;  3G6L A;  4ODL A;  5DO2 A;  4TW8 A;  4DZ2 A;  4DH0 A;  4DWS D;  1E6N A;  4MNM A;  3KAF A;  3RM8 A;  1W1V A;  3ART A;  5J6E A;  3ARY A;  4ODK A;  1NWU A;  3ARZ A;  4IQC A;  5DIV A;  1WB0 A;  3WD3 A;  1IX5 A;  3ARR A;  4U86 A;  3GPK A;  4JFM A;  4Z2I A;  3CH9 A;  4MGV A;  1EDQ A;  3KAB A;  4HBE A;  4FN2 A;  5DF0 A;  1O6I A;  1J4H A;  3BXW A;  2XP5 A;  3CHE A;  4O2T A;  5GPR A;  2WLY A;  4L72 B;  1FKR A;  1QPF A;  5GPG A;  3NI6 A;  2XP3 A;  3OOB A;  3RME A;  2ZQT A;  1E44 A;  1PIN A;  2RQS A;  4LAY A;  5HW7 A;  1FD9 A;  2WLZ A;  4WJX A;  2JZV A;  1FKH A;  1ZU8 A;  4J4O A;  3ARP A;  1HJW A;  4DRH A;  3WQW A;  1LG1 A;  4DIP A;  1D7H A;  3GTY X;  4N19 A;  1ZK6 A;  4PTM A;  4ITZ A;  3O5J A;  5D75 A;  1HKJ A;  2O9O A;  2PV3 A;  3ARX A;  1Q6I A;  1ZBV A;  4P8U A;  1A7X A;  2XP8 A;  1F8A B;  4Z2G A;  3CZ8 A;  1FKD A;  2DG9 A;  4KR0 B;  2LJ4 A;  2WM0 A;  3JXV A;  1W9U A;  4R5E A;  1Q6H A;  4DRM A;  4W9Q A;  2UZ5 A;  1XHG A;  1D2K A;  4TYO A;  5DEZ A;  4ZS6 A;  5HT1 A;  2O92 A;  4AY1 A;  4TW6 A;  3RGC A;  4ZPT R;  5JH8 A;  1U79 A;  1W26 A;  1FKS A;  1OGG A;  4Q22 A;  1F40 A;  1FKJ A;  3UQB A;  4P8X A;  2ESC A;  2M2A A;  2XPA A;  3RFW A;  2DT2 A;  5HKG A;  3KAI A;  3ARO A;  1FFQ A;  4P8W A;  1H0I A;  3KAG A;  2ZR5 A;  2DSW A;  1UR8 A;  2DT3 A;  1X6N A;  1R9H A;  4DWS B;  2MF9 A;  5HWB A;  1FKT A;  2DSV A;  1B6C A;  2A3A A;  2YBU A;  4QZV B;  1Q6U A;  2L2S A;  4W5U A;  2OLH A;  1E9L A;  4IQ2 A;  2XP7 A;  3IKD A;  4DRP A;  1T11 A;  2KGJ A;  3B7X A;  1ZBC A;  4MSP A;  5HWC A;  4ZPV R;  3WH0 A;  2EUL A;  4DRN A;  1HKI A;  3IHZ A;  4G2P A;  4JFL A;  3NRK A;  1K9T A;  3KCE A;  3ODK A;  4J4N A;  1D7J A;  1LJY A;  3B9E A;  3B8S A;  2PPN A;  2G41 A;  4WK9 A;  3H9R B;  1GPF A;  2B31 A;  2PPP A;  1L1P A;  4DRJ A;  1FFR A;  1JNS A;  1GOI A;  3UI6 A;  1SYT A;  2XP4 A;  5DIU A;  4DRK A;  2DT0 A;  3O5P A;  2P4V A;  3O5E A;  4LAV A;  1NWT A;  2VCD A;  2G8Z A;  1HKK A;  1ZBW A;  3O5R A;  1HJV A;  1YAT A;  2DT1 A;  2ZQU A;  2XP9 A;  1W1T A;  3O5L A;  2RSE A;  4R0X A;  2IUZ A;  3FXY A;  4WIW A;  1QPL A;  2A3E A;  1YW5 A;  3O5I A;  2IF4 A;  2LPV A;  3UI4 A;  3NTP A;  1JNE A;  2MLY A;  2XP6 A;  4P8V A;  3ARV A;  1FKI A;  3MDY B;  3PRD A;  3WD1 A;  3EIP A;  3PR9 A;  4ODN A;  3UQA A;  1HKM A;  1FKB A;  4MTV A;  4IT4 A;  3KZ7 A;  4S3K A;  2F23 A;  2ETN A;  4Z2J A;  1VF8 A;  2F21 A;  4JYS A; 
#chains in the Genus database with same CATH homology
 3PRB A;  4KQZ A;  1BKF A;  1QZ2 A;  5I98 A;  1WAW A;  2Y78 A;  1C9H A;  4DWS A;  2DSU A;  3WIJ A;  2WK2 A;  1NWS A;  3G6M A;  1ROU A;  4ODQ A;  2MNT A;  3KAH A;  4ODR A;  4DRQ A;  1CTN A;  2DG4 A;  2ZR6 A;  3AS1 A;  3RM9 A;  4MNK A;  5HUA A;  1ZB5 A;  2ZR4 A;  2KFW A;  4ZPW R;  5B8I C;  4JFJ A;  3KAD A;  1NSG A;  3B9A A;  2YBT A;  1ZCN A;  2MLX A;  5BXJ A;  4MNL A;  1D6O A;  2DSZ A;  1JND A;  2AWG A;  2ZQV A;  2MPH A;  1KT1 A;  1ITX A;  2M08 A;  5DIT A;  4L3N A;  3JYM A;  3WKZ A;  3WL1 A;  3CHD A;  3W4R A;  4DT4 A;  3O5D A;  5GQB A;  4ODO A;  1W9V A;  3AS2 A;  3O5F A;  2KI3 A;  4GIV A;  2PV1 A;  1FKF A;  3JYJ A;  1WNO A;  3LUO A;  4NNR A;  3VAW A;  3EY6 A;  2Q5A A;  1JVW A;  3QOK A;  5HW6 A;  3PA7 A;  3RM4 A;  1LQ0 A;  4JFI A;  5HW8 A;  4JFK A;  2RUD A;  4ODP A;  3TC5 A;  1D7I A;  1PBK A;  1E6P A;  3WL0 A;  1EQ3 A;  3CGM A;  2LGO A;  3IKG A;  3AS3 A;  1XRV A;  4G50 A;  1BL4 A;  4HBO A;  3ARU A;  1NWR A;  4LAX A;  4U84 A;  1E6Z A;  2AOS A;  3WD0 A;  4QT2 A;  1FKK A;  4C02 B;  3O5K A;  3CHC A;  4BF8 A;  1NMW A;  3ARQ A;  4Q7N A;  3AQU A;  1J4R A;  3KAC A;  3WQV A;  2DG3 A;  3WD4 A;  1FJD A;  3I6C A;  1KFW A;  3O5O A;  1RD6 A;  3O5M A;  4TW7 A;  2XPB A;  1E6R A;  3FAP A;  1HJX A;  4QIB A;  2FKE A;  2ITK A;  2M1I A;  2RUC A;  4NZC A;  1GUV A;  4MAV A;  2PI6 A;  4WKH A;  4IPX A;  4DRO A;  1Y0O A;  4ML4 A;  4Z2L A;  1SR0 A;  2FDM A;  2N87 A;  1FKG A;  2KO7 A;  4W9P A;  2K8I A;  3WD2 A;  3UQI A;  1TFV A;  1P5Q A;  2QF8 A;  2RUQ A;  1ZL1 A;  4LGX A;  3ALF A;  3O5Q A;  1NH6 A;  4FAP A;  4LAW A;  1LL4 A;  1KT0 A;  1EIB A;  2VN1 A;  1N1A A;  3OA5 A;  4DRI A;  4NSB A;  3O5G A;  1EYM A;  1OGB A;  1W1P A;  4DWS C;  2RUR A;  1FAP A;  1Q1C A;  4GGQ A;  3CHF A;  4MNJ A;  2A3B A;  1OWQ A;  3FY1 A;  3PRA A;  1X6L A;  4ODM A;  3UF8 A;  1EHN A;  3IK8 A;  2F2D A;  1NMV A;  1JNT A;  3ALG A;  2KR7 A;  4QT3 A;  1ZBK A;  2KE0 A;  4IT6 A;  4MPK A;  1W1Y A;  1FKL A;  3UI5 A;  4WKF A;  2OFN A;  1J6Y A;  4URI A;  4DZ3 A;  3B9D A;  1W9P A;  2D9F A;  4Z2K A;  1TCO C;  4U85 A;  2PBC A;  3AS0 A;  1LL6 A;  1M5Y A;  3TDB A;  3ARS A;  1HXV A;  2PPO A;  2A3C A;  1H0G A;  4WKA A;  1LG2 A;  2FAP A;  2LKN A;  4S3J A;  5HBF A;  1LL7 A;  2MLZ A;  1ROT A;  4HAR A;  3CGN A;  4XAK A;  1J4I A;  1UR9 A;  3TCZ A;  3ARW A;  4W9O A;  4TX0 A;  2F4E A;  2DPE A;  2PV2 A;  4Z2H A;  1E15 A;  2ZQS A;  4TNS A;  5HTG A;  3G6L A;  4ODL A;  5DO2 A;  4TW8 A;  4DZ2 A;  4DH0 A;  4DWS D;  1E6N A;  4MNM A;  3KAF A;  3RM8 A;  1W1V A;  3ART A;  5J6E A;  3ARY A;  4ODK A;  1NWU A;  3ARZ A;  4IQC A;  5DIV A;  1WB0 A;  3WD3 A;  1IX5 A;  3ARR A;  4U86 A;  3GPK A;  4JFM A;  4Z2I A;  3CH9 A;  4MGV A;  1EDQ A;  3KAB A;  4HBE A;  4FN2 A;  5DF0 A;  1O6I A;  1J4H A;  3BXW A;  2XP5 A;  3CHE A;  4O2T A;  5GPR A;  2WLY A;  4L72 B;  1FKR A;  1QPF A;  5GPG A;  3NI6 A;  2XP3 A;  3OOB A;  3RME A;  2ZQT A;  1PIN A;  2RQS A;  4LAY A;  5HW7 A;  1FD9 A;  2WLZ A;  4WJX A;  2JZV A;  1FKH A;  1ZU8 A;  4J4O A;  3ARP A;  1HJW A;  4DRH A;  3WQW A;  1LG1 A;  4DIP A;  1D7H A;  4N19 A;  1ZK6 A;  4PTM A;  4ITZ A;  3O5J A;  5D75 A;  1HKJ A;  2O9O A;  2PV3 A;  3ARX A;  1Q6I A;  1ZBV A;  4P8U A;  1A7X A;  2XP8 A;  1F8A B;  4Z2G A;  3CZ8 A;  1FKD A;  2DG9 A;  4KR0 B;  2LJ4 A;  2WM0 A;  3JXV A;  1W9U A;  4R5E A;  1Q6H A;  4DRM A;  4W9Q A;  2UZ5 A;  1XHG A;  1D2K A;  4TYO A;  5DEZ A;  4ZS6 A;  5HT1 A;  2O92 A;  4AY1 A;  4TW6 A;  3RGC A;  4ZPT R;  5JH8 A;  1U79 A;  1W26 A;  1FKS A;  1OGG A;  4Q22 A;  1F40 A;  1FKJ A;  3UQB A;  4P8X A;  2ESC A;  2M2A A;  2XPA A;  3RFW A;  2DT2 A;  5HKG A;  3KAI A;  3ARO A;  1FFQ A;  4P8W A;  1H0I A;  3KAG A;  2ZR5 A;  2DSW A;  1UR8 A;  2DT3 A;  1X6N A;  1R9H A;  4DWS B;  2MF9 A;  5HWB A;  1FKT A;  2DSV A;  1B6C A;  2A3A A;  2YBU A;  4QZV B;  1Q6U A;  2L2S A;  4W5U A;  2OLH A;  1E9L A;  4IQ2 A;  2XP7 A;  3IKD A;  4DRP A;  1T11 A;  2KGJ A;  3B7X A;  1ZBC A;  4MSP A;  5HWC A;  4ZPV R;  3WH0 A;  4DRN A;  1HKI A;  3IHZ A;  4G2P A;  4JFL A;  3NRK A;  1K9T A;  3KCE A;  3ODK A;  4J4N A;  1D7J A;  1LJY A;  3B9E A;  3B8S A;  2PPN A;  2G41 A;  4WK9 A;  3H9R B;  1GPF A;  2B31 A;  2PPP A;  1L1P A;  4DRJ A;  1FFR A;  1JNS A;  1GOI A;  3UI6 A;  1SYT A;  2XP4 A;  5DIU A;  4DRK A;  2DT0 A;  3O5P A;  3O5E A;  4LAV A;  1NWT A;  2VCD A;  2G8Z A;  1HKK A;  3O5R A;  1ZBW A;  1HJV A;  1YAT A;  2DT1 A;  2ZQU A;  2XP9 A;  1W1T A;  3O5L A;  2RSE A;  4R0X A;  2IUZ A;  3FXY A;  4WIW A;  1QPL A;  2A3E A;  1YW5 A;  3O5I A;  2IF4 A;  2LPV A;  3UI4 A;  3NTP A;  1JNE A;  2MLY A;  2XP6 A;  4P8V A;  3ARV A;  1FKI A;  3MDY B;  3PRD A;  3WD1 A;  3PR9 A;  4ODN A;  3UQA A;  1HKM A;  1FKB A;  4MTV A;  4IT4 A;  3KZ7 A;  4S3K A;  4Z2J A;  1VF8 A;  2F21 A;  4JYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...