1FKHA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkhA00
4GGQA 1R9HA 2JZVA 3LUOA 3TCZA 1J4RA 4DRMA 1ROTA 3OOBA 2DG9A 5J6EA 1C9HA 5HUAA 1TCOC 1ROUA 4BF8A 2PV2A 4JFIA 2XPBA 4ODLA 2VN1A 2F21A 4ODRA 1D7JA 3O5LA 4DRKA 2ZQSA 2XP5A 4DZ3A 4G2PA 2LKNA 3KZ7A 3JXVA 3B7XA 2L2SA 1PINA 4G50A 1FKTA 4TNSA 4W9QA 1B6CA 1FKDA 4DRJA 3KAIA 2XP7A 3NI6A 2KE0A 3RGCA 3O5MA 1D7IA 1FKGA 3O5FA 3UQAA 3UI4A 2VCDA 4DRQA 3FAPA 3TDBA 1W26A 3O5RA 1HXVA 2AWGA 1FJDA 1FD9A 2XPAA 3KCEA 1KT1A 2UZ5A 3JYJA 4W9PA 3O5JA 3KABA 4J4NA 2M1IA 2ZQUA 1JVWA 4IQCA 4O2TA 2D9FA 4DIPA 2KGJA 4JFLA 1P5QA 3GPKA 2ZR4A 5HKGA 2F2DA 2RSEA 2FKEA 4JFJA 2RQSA 4ITZA 4LAVA 5DIVA 3KAGA 1JNTA 2XP4A 4MSPA 4DZ2A 2N87A 4JYSA 1FKLA 2Q5AA 4MGVA 4TX0A 4GIVA 2RURA 2IF4A 4FAPA 2M08A 2M2AA 4U86A 1Q6IA 3UQIA 2DG4A 4R0XA 4DRPA 2XP9A 4LAXA 4ODKA 2LJ4A 3O5IA 1J4HA 2MLYA 5D75A 4C02B 5HWBA 2ZR6A 1NMVA 3O5OA 3UI6A 3IKGA 1N1AA 4DRIA 1BL4A 1FKBA 2MLZA 2MNTA 4QT2A 4TW8A 4W9OA 3RFWA 1FKRA 4TW7A 3WH0A 1ZCNA 2ITKA 3PRBA 3CGMA 4DRNA 3KAHA 2MF9A 5HT1A 1M5YA 2ZQTA 3VAWA 1EQ3A 4U84A 4TW6A 4ODQA 1D7HA 4JFKA 4LAWA 3NRKA 1FKKA 3IK8A 4JFMA 2ZQVA 4N19A 2MLXA 3O5DA 3UQBA 2F4EA 5B8IC 2XP8A 4QT3A 4FN2A 1NSGA 5HWCA 2LGOA 2Y78A 2KR7A 2XP3A 1Q6UA 4U85A 3UF8A 3NTPA 1EYMA 1FKHA 2RUDA 5HW7A 1FKFA 2KO7A 1FKIA 1D6OA 3IHZA 1FAPA 3JYMA 4QIBA 5DIUA 1PBKA 1QPLA 4DH0A 4ODNA 2FAPA 5DITA 1YW5A 2PPPA 3O5KA 1Q6HA 5HW8A 4NNRA 3I6CA 3KADA 1F40A 4ODPA 3O5PA 2XP6A 3KAFA 2KFWA 1Q1CA 1FKSA 2OFNA 2RUQA 4ODOA 2PPOA 4DRHA 1JNSA 3TC5A 1ZK6A 1Y0OA 1J4IA 3O5EA 2PV1A 4J4OA 3EY6A 4IPXA 1J6YA 4LAYA 3PRDA 1QPFA 1U79A 4TYOA 3H9RB 1NMWA 2KI3A 3PA7A 4ODMA 5HW6A 1L1PA 2PV3A 1QZ2A 1A7XA 2PBCA 5BXJA 4DROA 4IQ2A 4DT4A 1BKFA 2PPNA 3UI5A 1KT0A 2DG3A 3IKDA 3ODKA 3O5GA 3CGNA 1F8AB 1T11A 1YATA 2MPHA 2RUCA 1FKJA 2LPVA 3O5QA 2ZR5A 5GPGA 5HTGA 5I98A 3MDYB 3KACA 2K8IA
chains in the Genus database with same CATH superfamily
2EULA 4DRMA 1GPFA 4P8VA 4WIWA 1FFQA 5J6EA 5GQBA 1C9HA 3B9DA 2XPBA 3O5LA 4DZ3A 1E15A 2WK2A 3KZ7A 4TNSA 1PINA 1FKTA 3KAIA 1FKGA 1E6RA 4DRQA 3FY1A 1UR8A 4Z2JA 1FD9A 3KCEA 2M1IA 3CH9A 1JVWA 3GPKA 4KR0B 3BMBA 3WQVA 4MNKA 4MNLA 2FKEA 4ITZA 5DIVA 4Z2KA 4MSPA 3WD4A 3G6LA 2O92A 4GIVA 4U86A 4DRPA 2LJ4A 1W1VA 3O5IA 2MLYA 5D75A 4C02B 5HWBA 2ZR6A 1NMVA 3QOKA 4TW8A 1H0GA 3WD1A 2MF9A 2PI6A 3AQUA 4U84A 2FDMA 3BXWA 2YBUA 3NRKA 3ARWA 2WLZA 3O5DA 2F4EA 1HKIA 3OA5A 3RM9A 2XP3A 3NTPA 2KO7A 1FKIA 4QIBA 1NWSA 4WK9A 2FAPA 1YW5A 2PPPA 3O5KA 1SYTA 4LGXA 1FKSA 1OWQA 1SR0A 2PV1A 2DSUA 3EY6A 3PRDA 1L1PA 1HXVA 1NMWA 2PBCA 4DROA 3UI5A 3AS3A 3CGNA 3B9EA 1JNEA 3MDYB 3KACA 1ZBWA 3OOBA 1ZL1A 4IT4A 5HUAA 1TCOC 1ROUA 1O6IA 1E6NA 2VN1A 2F21A 1D7JA 1RD6A 3B7XA 1KFWA 2DSZA 1B6CA 3RGCA 3O5MA 1D7IA 3UQAA 3O5FA 3RMEA 1W26A 1WAWA 2ESCA 4W9PA 2UZ5A 4UDMA 2ZQUA 4IQCA 4O2TA 2KGJA 2DT2A 2ZR4A 3ALGA 4L72B 5GPRA 2F2DA 1TFVA 3ARVA 2OLHA 4MAVA 2N87A 4MGVA 4TX0A 4FAPA 2M08A 3UQIA 2XP9A 4LAXA 4ODKA 3UI6A 3GU0A 1FKBA 1HKKA 4TW7A 1ZCNA 2DT0A 2B31A 3ARXA 3CGMA 1HKJA 3KAHA 5HT1A 4NZCA 3ARTA 5HBFA 3ARRA 4LAWA 1FKKA 3IK8A 3PRAA 3UQBA 4Z2LA 4QT3A 1NSGA 2LGOA 4U85A 1Q6UA 1LL7A 1EYMA 1FKHA 2RUDA 2PN0A 5DIUA 4DH0A 4AY1A 4ODNA 5DITA 1W1TA 2F23A 4NNRA 1X6LA 3I6CA 3O5PA 3KAFA 2KFWA 1LG1A 1Q1CA 2PPOA 3TC5A 1EHNA 1ZK6A 1Y0OA 3O5EA 1HJXA 4J4OA 1J6YA 4LAYA 1QPFA 1U79A 2A3BA 3H9RB 4ODMA 5HW6A 3B8SA 4S3JA 1QZ2A 1A7XA 5BXJA 1BKFA 1KT0A 2DG3A 3IKDA 1F8AB 1T11A 2QF8A 4R5EA 4ZPVR 5I98A 4Q22A 4MNJA 1R9HA 3CHEA 3LUOA 4S3KA 4WKFA 1ROTA 2DG9A 3B9AA 1JNDA 1HJVA 4BF8A 4W5UA 2A3CA 1H0IA 4ODRA 4DRKA 4WKAA 2ZQSA 4DWSC 1WNOA 1W9PA 2WLYA 4G50A 4W9QA 4Z2IA 2DPEA 3UI4A 2VCDA 3AS0A 3FAPA 3ARSA 1EIBA 3O5RA 1FJDA 2XPAA 1KT1A 1HKMA 4MPKA 2D9FA 3PR9A 4JFLA 4JFJA 4LAVA 4IT6A 2XP4A 1IX5A 1GOIA 4Z2GA 1GRJA 4JYSA 1FKLA 4P8WA 2RURA 1ZBVA 2IF4A 3GTYX 4R0XA 1W1YA 1J4HA 3CHFA 1BL4A 2MLZA 1ZBKA 4W9OA 4DWSD 1FKRA 1LL4A 1NWTA 1E44A 3PRBA 4DRNA 4ZS6A 3RM8A 1UR9A 2DSWA 2ZQTA 1EQ3A 1ZU8A 2WM0A 4ODQA 4TW6A 1D7HA 4JFKA 3CHDA 2DT1A 3CHCA 4JFMA 2ZQVA 5B8IC 2XP8A 3G6MA 5HWCA 5DEZA 2KR7A 3UF8A 3RM4A 1OGBA 5HW7A 4KQZA 1FKFA 4QZVB 1D6OA 3IHZA 1FAPA 3JYMA 1PBKA 3ARQA 2YBTA 2DT3A 2IUZA 1E6PA 1F40A 2OFNA 3EIPA 4DRHA 2P4VA 5DF0A 1VF8A 4TYOA 3ARZA 2PV3A 1EDQA 4NSBA 1LG2A 4IQ2A 4DT4A 2PPNA 3W4RA 1K9TA 3ODKA 3O5GA 1YATA 2LPVA 4ZPTR 2ZR5A 3WL0A 5HTGA 3WD0A 1OGGA 4WKHA 4GGQA 2JZVA 3TCZA 1J4RA 1D2KA 3WQWA 3WD3A 4URIA 1W9VA 2PV2A 4MTVA 4JFIA 4Q7NA 1NWRA 4ODLA 1NWUA 1XHGA 3ARPA 1ZB5A 4HBEA 2XP5A 4G2PA 2LKNA 3JXVA 1XRVA 2L2SA 4DRJA 1FKDA 4L3NA 1GUVA 2XP7A 3WD2A 1WB0A 2KE0A 3NI6A 3ARUA 1E6ZA 5DO2A 3TDBA 2AWGA 2A3EA 3JYJA 1FFRA 3O5JA 3AROA 3KABA 4J4NA 3WL1A 4DIPA 1P5QA 5HKGA 2RSEA 3ARYA 2RQSA 1CTNA 3KAGA 1JNTA 2AOSA 4DZ2A 4XAKA 1LJYA 3AS2A 2Q5AA 4HBOA 4DWSB 1ITXA 2M2AA 1Q6IA 2DG4A 1W1PA 2O9OA 4ZPWR 3ALFA 2B5UB 3O5OA 4ML4A 3IKGA 1N1AA 1NH6A 3RFWA 4DRIA 2MNTA 4QT2A 3WH0A 2ITKA 1LQ0A 3FXYA 1HJWA 1M5YA 3VAWA 3WIJA 3AS1A 2G8ZA 4DWSA 4N19A 2MLXA 4MNMA 4FN2A 1ZBCA 2Y78A 2G41A 1QPLA 1JCHB 1Q6HA 5HW8A 3CZ8A 3KADA 4ODPA 2XP6A 2RUQA 4ODOA 1JNSA 1W9UA 1J4IA 1E9LA 4IPXA 4WJXA 1X6NA 2A3AA 2KI3A 3PA7A 3WKZA 4P8XA 4PTMA 4P8UA 1LL6A 2RUCA 2ETNA 2MPHA 1FKJA 2DSVA 3O5QA 5GPGA 5JH8A 4Z2HA 4HARA 2K8IA
chains in the Genus database with same CATH topology
4DRMA 1GPFA 4P8VA 4WIWA 1FFQA 5J6EA 5GQBA 1C9HA 3B9DA 2XPBA 3O5LA 4DZ3A 1E15A 2WK2A 3KZ7A 4TNSA 1PINA 1FKTA 3KAIA 1FKGA 1E6RA 4DRQA 3FY1A 1UR8A 4Z2JA 1FD9A 3KCEA 2M1IA 3CH9A 1JVWA 3GPKA 4KR0B 3WQVA 4MNKA 4MNLA 2FKEA 4ITZA 5DIVA 4Z2KA 4MSPA 3WD4A 3G6LA 2O92A 4GIVA 4U86A 4DRPA 2LJ4A 1W1VA 3O5IA 2MLYA 5D75A 4C02B 5HWBA 2ZR6A 1NMVA 3QOKA 4TW8A 1H0GA 3WD1A 2MF9A 2PI6A 3AQUA 4U84A 2FDMA 3BXWA 2YBUA 3NRKA 3ARWA 2WLZA 3O5DA 2F4EA 1HKIA 3OA5A 3RM9A 2XP3A 3NTPA 2KO7A 1FKIA 4QIBA 1NWSA 4WK9A 2FAPA 1YW5A 2PPPA 3O5KA 1SYTA 4LGXA 1FKSA 1OWQA 1SR0A 2PV1A 2DSUA 3EY6A 3PRDA 1L1PA 1HXVA 1NMWA 2PBCA 4DROA 3UI5A 3AS3A 3CGNA 3B9EA 1JNEA 3MDYB 3KACA 1ZBWA 3OOBA 1ZL1A 4IT4A 5HUAA 1TCOC 1ROUA 1O6IA 1E6NA 2VN1A 2F21A 1D7JA 1RD6A 3B7XA 1KFWA 2DSZA 1B6CA 3RGCA 3O5MA 1D7IA 3UQAA 3O5FA 3RMEA 1W26A 1WAWA 2ESCA 4W9PA 2UZ5A 2ZQUA 4IQCA 4O2TA 2KGJA 2DT2A 2ZR4A 3ALGA 4L72B 5GPRA 2F2DA 1TFVA 3ARVA 2OLHA 4MAVA 2N87A 4MGVA 4TX0A 4FAPA 2M08A 3UQIA 2XP9A 4LAXA 4ODKA 3UI6A 1FKBA 1HKKA 4TW7A 1ZCNA 2DT0A 2B31A 3ARXA 3CGMA 1HKJA 3KAHA 5HT1A 4NZCA 3ARTA 5HBFA 3ARRA 4LAWA 1FKKA 3IK8A 3PRAA 3UQBA 4Z2LA 4QT3A 1NSGA 2LGOA 4U85A 1Q6UA 1LL7A 1EYMA 1FKHA 2RUDA 5DIUA 4DH0A 4AY1A 4ODNA 5DITA 1W1TA 4NNRA 1X6LA 3I6CA 3O5PA 3KAFA 2KFWA 1LG1A 1Q1CA 2PPOA 3TC5A 1EHNA 1ZK6A 1Y0OA 3O5EA 1HJXA 4J4OA 1J6YA 4LAYA 1QPFA 1U79A 2A3BA 3H9RB 4ODMA 5HW6A 3B8SA 4S3JA 1QZ2A 1A7XA 5BXJA 1BKFA 1KT0A 2DG3A 3IKDA 1F8AB 1T11A 2QF8A 4R5EA 4ZPVR 5I98A 4Q22A 4MNJA 1R9HA 3CHEA 3LUOA 4S3KA 4WKFA 1ROTA 2DG9A 3B9AA 1JNDA 1HJVA 4BF8A 4W5UA 2A3CA 1H0IA 4ODRA 4DRKA 4WKAA 2ZQSA 4DWSC 1WNOA 1W9PA 2WLYA 4G50A 4W9QA 4Z2IA 2DPEA 3UI4A 2VCDA 3AS0A 3FAPA 3ARSA 1EIBA 3O5RA 1FJDA 2XPAA 1KT1A 1HKMA 4MPKA 2D9FA 3PR9A 4JFLA 4JFJA 4LAVA 4IT6A 2XP4A 1IX5A 1GOIA 4Z2GA 4JYSA 1FKLA 4P8WA 2RURA 1ZBVA 2IF4A 4R0XA 1W1YA 1J4HA 3CHFA 1BL4A 2MLZA 1ZBKA 4W9OA 4DWSD 1FKRA 1LL4A 1NWTA 3PRBA 4DRNA 4ZS6A 3RM8A 1UR9A 2DSWA 2ZQTA 1EQ3A 1ZU8A 2WM0A 4ODQA 4TW6A 1D7HA 4JFKA 3CHDA 2DT1A 3CHCA 4JFMA 2ZQVA 5B8IC 2XP8A 3G6MA 5HWCA 5DEZA 2KR7A 3UF8A 3RM4A 1OGBA 5HW7A 4KQZA 1FKFA 4QZVB 1D6OA 3IHZA 1FAPA 3JYMA 1PBKA 3ARQA 2YBTA 2DT3A 2IUZA 1E6PA 1F40A 2OFNA 4DRHA 5DF0A 1VF8A 4TYOA 3ARZA 2PV3A 1EDQA 4NSBA 1LG2A 4IQ2A 4DT4A 2PPNA 3W4RA 1K9TA 3ODKA 3O5GA 1YATA 2LPVA 4ZPTR 2ZR5A 3WL0A 5HTGA 3WD0A 1OGGA 4WKHA 4GGQA 2JZVA 3TCZA 1J4RA 1D2KA 3WQWA 3WD3A 4URIA 1W9VA 2PV2A 4MTVA 4JFIA 4Q7NA 1NWRA 4ODLA 1NWUA 1XHGA 3ARPA 1ZB5A 4HBEA 2XP5A 4G2PA 2LKNA 3JXVA 1XRVA 2L2SA 4DRJA 1FKDA 4L3NA 1GUVA 2XP7A 3WD2A 1WB0A 2KE0A 3NI6A 3ARUA 1E6ZA 5DO2A 3TDBA 2AWGA 2A3EA 3JYJA 1FFRA 3O5JA 3AROA 3KABA 4J4NA 3WL1A 4DIPA 1P5QA 5HKGA 2RSEA 3ARYA 2RQSA 1CTNA 3KAGA 1JNTA 2AOSA 4DZ2A 4XAKA 1LJYA 3AS2A 2Q5AA 4HBOA 4DWSB 1ITXA 2M2AA 1Q6IA 2DG4A 1W1PA 2O9OA 4ZPWR 3ALFA 3O5OA 4ML4A 3IKGA 1N1AA 1NH6A 3RFWA 4DRIA 2MNTA 4QT2A 3WH0A 2ITKA 1LQ0A 3FXYA 1HJWA 1M5YA 3VAWA 3WIJA 3AS1A 2G8ZA 4DWSA 4N19A 2MLXA 4MNMA 4FN2A 1ZBCA 2Y78A 2G41A 1QPLA 1Q6HA 5HW8A 3CZ8A 3KADA 4ODPA 2XP6A 2RUQA 4ODOA 1JNSA 1W9UA 1J4IA 1E9LA 4IPXA 4WJXA 1X6NA 2A3AA 2KI3A 3PA7A 3WKZA 4P8XA 4PTMA 4P8UA 1LL6A 2MPHA 2RUCA 1FKJA 2DSVA 3O5QA 5GPGA 5JH8A 4Z2HA 4HARA 2K8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGQ A;  1R9H A;  2JZV A;  3LUO A;  3TCZ A;  1J4R A;  4DRM A;  1ROT A;  3OOB A;  2DG9 A;  5J6E A;  1C9H A;  5HUA A;  1TCO C;  1ROU A;  4BF8 A;  2PV2 A;  4JFI A;  2XPB A;  4ODL A;  2VN1 A;  2F21 A;  4ODR A;  1D7J A;  3O5L A;  4DRK A;  2ZQS A;  2XP5 A;  4DZ3 A;  4G2P A;  2LKN A;  3KZ7 A;  3JXV A;  3B7X A;  2L2S A;  1PIN A;  4G50 A;  1FKT A;  4TNS A;  4W9Q A;  1B6C A;  1FKD A;  4DRJ A;  3KAI A;  2XP7 A;  3NI6 A;  2KE0 A;  3RGC A;  3O5M A;  1D7I A;  1FKG A;  3O5F A;  3UQA A;  3UI4 A;  2VCD A;  4DRQ A;  3FAP A;  3TDB A;  1W26 A;  3O5R A;  1HXV A;  2AWG A;  1FJD A;  1FD9 A;  2XPA A;  3KCE A;  1KT1 A;  2UZ5 A;  3JYJ A;  4W9P A;  3O5J A;  3KAB A;  4J4N A;  2M1I A;  2ZQU A;  1JVW A;  4IQC A;  4O2T A;  2D9F A;  4DIP A;  2KGJ A;  4JFL A;  1P5Q A;  3GPK A;  2ZR4 A;  5HKG A;  2F2D A;  2RSE A;  2FKE A;  4JFJ A;  2RQS A;  4ITZ A;  4LAV A;  5DIV A;  3KAG A;  1JNT A;  2XP4 A;  4MSP A;  4DZ2 A;  2N87 A;  4JYS A;  1FKL A;  2Q5A A;  4MGV A;  4TX0 A;  4GIV A;  2RUR A;  2IF4 A;  4FAP A;  2M08 A;  2M2A A;  4U86 A;  1Q6I A;  3UQI A;  2DG4 A;  4R0X A;  4DRP A;  2XP9 A;  4LAX A;  4ODK A;  2LJ4 A;  3O5I A;  1J4H A;  2MLY A;  5D75 A;  4C02 B;  5HWB A;  2ZR6 A;  1NMV A;  3O5O A;  3UI6 A;  3IKG A;  1N1A A;  4DRI A;  1BL4 A;  1FKB A;  2MLZ A;  2MNT A;  4QT2 A;  4TW8 A;  4W9O A;  3RFW A;  1FKR A;  4TW7 A;  3WH0 A;  1ZCN A;  2ITK A;  3PRB A;  3CGM A;  4DRN A;  3KAH A;  2MF9 A;  5HT1 A;  1M5Y A;  2ZQT A;  3VAW A;  1EQ3 A;  4U84 A;  4TW6 A;  4ODQ A;  1D7H A;  4JFK A;  4LAW A;  3NRK A;  1FKK A;  3IK8 A;  4JFM A;  2ZQV A;  4N19 A;  2MLX A;  3O5D A;  3UQB A;  2F4E A;  5B8I C;  2XP8 A;  4QT3 A;  4FN2 A;  1NSG A;  5HWC A;  2LGO A;  2Y78 A;  2KR7 A;  2XP3 A;  1Q6U A;  4U85 A;  3UF8 A;  3NTP A;  1EYM A;  1FKH A;  2RUD A;  5HW7 A;  1FKF A;  2KO7 A;  1FKI A;  1D6O A;  3IHZ A;  1FAP A;  3JYM A;  4QIB A;  5DIU A;  1PBK A;  1QPL A;  4DH0 A;  4ODN A;  2FAP A;  5DIT A;  1YW5 A;  2PPP A;  3O5K A;  1Q6H A;  5HW8 A;  4NNR A;  3I6C A;  3KAD A;  1F40 A;  4ODP A;  3O5P A;  2XP6 A;  3KAF A;  2KFW A;  1Q1C A;  1FKS A;  2OFN A;  2RUQ A;  4ODO A;  2PPO A;  4DRH A;  1JNS A;  3TC5 A;  1ZK6 A;  1Y0O A;  1J4I A;  3O5E A;  2PV1 A;  4J4O A;  3EY6 A;  4IPX A;  1J6Y A;  4LAY A;  3PRD A;  1QPF A;  1U79 A;  4TYO A;  3H9R B;  1NMW A;  2KI3 A;  3PA7 A;  4ODM A;  5HW6 A;  1L1P A;  2PV3 A;  1QZ2 A;  1A7X A;  2PBC A;  5BXJ A;  4DRO A;  4IQ2 A;  4DT4 A;  1BKF A;  2PPN A;  3UI5 A;  1KT0 A;  2DG3 A;  3IKD A;  3ODK A;  3O5G A;  3CGN A;  1F8A B;  1T11 A;  1YAT A;  2MPH A;  2RUC A;  1FKJ A;  2LPV A;  3O5Q A;  2ZR5 A;  5GPG A;  5HTG A;  5I98 A;  3MDY B;  3KAC A;  2K8I A; 
#chains in the Genus database with same CATH topology
 2EUL A;  4DRM A;  1GPF A;  4P8V A;  4WIW A;  1FFQ A;  5J6E A;  5GQB A;  1C9H A;  3B9D A;  2XPB A;  3O5L A;  4DZ3 A;  1E15 A;  2WK2 A;  3KZ7 A;  4TNS A;  1PIN A;  1FKT A;  3KAI A;  1FKG A;  1E6R A;  4DRQ A;  3FY1 A;  1UR8 A;  4Z2J A;  1FD9 A;  3KCE A;  2M1I A;  3CH9 A;  1JVW A;  3GPK A;  4KR0 B;  3BMB A;  3WQV A;  4MNK A;  4MNL A;  2FKE A;  4ITZ A;  5DIV A;  4Z2K A;  4MSP A;  3WD4 A;  3G6L A;  2O92 A;  4GIV A;  4U86 A;  4DRP A;  2LJ4 A;  1W1V A;  3O5I A;  2MLY A;  5D75 A;  4C02 B;  5HWB A;  2ZR6 A;  1NMV A;  3QOK A;  4TW8 A;  1H0G A;  3WD1 A;  2MF9 A;  2PI6 A;  3AQU A;  4U84 A;  2FDM A;  3BXW A;  2YBU A;  3NRK A;  3ARW A;  2WLZ A;  3O5D A;  2F4E A;  1HKI A;  3OA5 A;  3RM9 A;  2XP3 A;  3NTP A;  2KO7 A;  1FKI A;  4QIB A;  1NWS A;  4WK9 A;  2FAP A;  1YW5 A;  2PPP A;  3O5K A;  1SYT A;  4LGX A;  1FKS A;  1OWQ A;  1SR0 A;  2PV1 A;  2DSU A;  3EY6 A;  3PRD A;  1L1P A;  1HXV A;  1NMW A;  2PBC A;  4DRO A;  3UI5 A;  3AS3 A;  3CGN A;  3B9E A;  1JNE A;  3MDY B;  3KAC A;  1ZBW A;  3OOB A;  1ZL1 A;  4IT4 A;  5HUA A;  1TCO C;  1ROU A;  1O6I A;  1E6N A;  2VN1 A;  2F21 A;  1D7J A;  1RD6 A;  3B7X A;  1KFW A;  2DSZ A;  1B6C A;  3RGC A;  3O5M A;  1D7I A;  3UQA A;  3O5F A;  3RME A;  1W26 A;  1WAW A;  2ESC A;  4W9P A;  2UZ5 A;  4UDM A;  2ZQU A;  4IQC A;  4O2T A;  2KGJ A;  2DT2 A;  2ZR4 A;  3ALG A;  4L72 B;  5GPR A;  2F2D A;  1TFV A;  3ARV A;  2OLH A;  4MAV A;  2N87 A;  4MGV A;  4TX0 A;  4FAP A;  2M08 A;  3UQI A;  2XP9 A;  4LAX A;  4ODK A;  3UI6 A;  3GU0 A;  1FKB A;  1HKK A;  4TW7 A;  1ZCN A;  2DT0 A;  2B31 A;  3ARX A;  3CGM A;  1HKJ A;  3KAH A;  5HT1 A;  4NZC A;  3ART A;  5HBF A;  3ARR A;  4LAW A;  1FKK A;  3IK8 A;  3PRA A;  3UQB A;  4Z2L A;  4QT3 A;  1NSG A;  2LGO A;  4U85 A;  1Q6U A;  1LL7 A;  1EYM A;  1FKH A;  2RUD A;  2PN0 A;  5DIU A;  4DH0 A;  4AY1 A;  4ODN A;  5DIT A;  1W1T A;  2F23 A;  4NNR A;  1X6L A;  3I6C A;  3O5P A;  3KAF A;  2KFW A;  1LG1 A;  1Q1C A;  2PPO A;  3TC5 A;  1EHN A;  1ZK6 A;  1Y0O A;  3O5E A;  1HJX A;  4J4O A;  1J6Y A;  4LAY A;  1QPF A;  1U79 A;  2A3B A;  3H9R B;  4ODM A;  5HW6 A;  3B8S A;  4S3J A;  1QZ2 A;  1A7X A;  5BXJ A;  1BKF A;  1KT0 A;  2DG3 A;  3IKD A;  1F8A B;  1T11 A;  2QF8 A;  4R5E A;  4ZPV R;  5I98 A;  4Q22 A;  4MNJ A;  1R9H A;  3CHE A;  3LUO A;  4S3K A;  4WKF A;  1ROT A;  2DG9 A;  3B9A A;  1JND A;  1HJV A;  4BF8 A;  4W5U A;  2A3C A;  1H0I A;  4ODR A;  4DRK A;  4WKA A;  2ZQS A;  4DWS C;  1WNO A;  1W9P A;  2WLY A;  4G50 A;  4W9Q A;  4Z2I A;  2DPE A;  3UI4 A;  2VCD A;  3AS0 A;  3FAP A;  3ARS A;  1EIB A;  3O5R A;  1FJD A;  2XPA A;  1KT1 A;  1HKM A;  4MPK A;  2D9F A;  3PR9 A;  4JFL A;  4JFJ A;  4LAV A;  4IT6 A;  2XP4 A;  1IX5 A;  1GOI A;  4Z2G A;  1GRJ A;  4JYS A;  1FKL A;  4P8W A;  2RUR A;  1ZBV A;  2IF4 A;  3GTY X;  4R0X A;  1W1Y A;  1J4H A;  3CHF A;  1BL4 A;  2MLZ A;  1ZBK A;  4W9O A;  4DWS D;  1FKR A;  1LL4 A;  1NWT A;  1E44 A;  3PRB A;  4DRN A;  4ZS6 A;  3RM8 A;  1UR9 A;  2DSW A;  2ZQT A;  1EQ3 A;  1ZU8 A;  2WM0 A;  4ODQ A;  4TW6 A;  1D7H A;  4JFK A;  3CHD A;  2DT1 A;  3CHC A;  4JFM A;  2ZQV A;  5B8I C;  2XP8 A;  3G6M A;  5HWC A;  5DEZ A;  2KR7 A;  3UF8 A;  3RM4 A;  1OGB A;  5HW7 A;  4KQZ A;  1FKF A;  4QZV B;  1D6O A;  3IHZ A;  1FAP A;  3JYM A;  1PBK A;  3ARQ A;  2YBT A;  2DT3 A;  2IUZ A;  1E6P A;  1F40 A;  2OFN A;  3EIP A;  4DRH A;  2P4V A;  5DF0 A;  1VF8 A;  4TYO A;  3ARZ A;  2PV3 A;  1EDQ A;  4NSB A;  1LG2 A;  4IQ2 A;  4DT4 A;  2PPN A;  3W4R A;  1K9T A;  3ODK A;  3O5G A;  1YAT A;  2LPV A;  4ZPT R;  2ZR5 A;  3WL0 A;  5HTG A;  3WD0 A;  1OGG A;  4WKH A;  4GGQ A;  2JZV A;  3TCZ A;  1J4R A;  1D2K A;  3WQW A;  3WD3 A;  4URI A;  1W9V A;  2PV2 A;  4MTV A;  4JFI A;  4Q7N A;  1NWR A;  4ODL A;  1NWU A;  1XHG A;  3ARP A;  1ZB5 A;  4HBE A;  2XP5 A;  4G2P A;  2LKN A;  3JXV A;  1XRV A;  2L2S A;  4DRJ A;  1FKD A;  4L3N A;  1GUV A;  2XP7 A;  3WD2 A;  1WB0 A;  2KE0 A;  3NI6 A;  3ARU A;  1E6Z A;  5DO2 A;  3TDB A;  2AWG A;  2A3E A;  3JYJ A;  1FFR A;  3O5J A;  3ARO A;  3KAB A;  4J4N A;  3WL1 A;  4DIP A;  1P5Q A;  5HKG A;  2RSE A;  3ARY A;  2RQS A;  1CTN A;  3KAG A;  1JNT A;  2AOS A;  4DZ2 A;  4XAK A;  1LJY A;  3AS2 A;  2Q5A A;  4HBO A;  4DWS B;  1ITX A;  2M2A A;  1Q6I A;  2DG4 A;  1W1P A;  2O9O A;  4ZPW R;  3ALF A;  2B5U B;  3O5O A;  4ML4 A;  3IKG A;  1N1A A;  1NH6 A;  3RFW A;  4DRI A;  2MNT A;  4QT2 A;  3WH0 A;  2ITK A;  1LQ0 A;  3FXY A;  1HJW A;  1M5Y A;  3VAW A;  3WIJ A;  3AS1 A;  2G8Z A;  4DWS A;  4N19 A;  2MLX A;  4MNM A;  4FN2 A;  1ZBC A;  2Y78 A;  2G41 A;  1QPL A;  1JCH B;  1Q6H A;  5HW8 A;  3CZ8 A;  3KAD A;  4ODP A;  2XP6 A;  2RUQ A;  4ODO A;  1JNS A;  1W9U A;  1J4I A;  1E9L A;  4IPX A;  4WJX A;  1X6N A;  2A3A A;  2KI3 A;  3PA7 A;  3WKZ A;  4P8X A;  4PTM A;  4P8U A;  1LL6 A;  2RUC A;  2ETN A;  2MPH A;  1FKJ A;  2DSV A;  3O5Q A;  5GPG A;  5JH8 A;  4Z2H A;  4HAR A;  2K8I A; 
#chains in the Genus database with same CATH homology
 4DRM A;  1GPF A;  4P8V A;  4WIW A;  1FFQ A;  5J6E A;  5GQB A;  1C9H A;  3B9D A;  2XPB A;  3O5L A;  4DZ3 A;  1E15 A;  2WK2 A;  3KZ7 A;  4TNS A;  1PIN A;  1FKT A;  3KAI A;  1FKG A;  1E6R A;  4DRQ A;  3FY1 A;  1UR8 A;  4Z2J A;  1FD9 A;  3KCE A;  2M1I A;  3CH9 A;  1JVW A;  3GPK A;  4KR0 B;  3WQV A;  4MNK A;  4MNL A;  2FKE A;  4ITZ A;  5DIV A;  4Z2K A;  4MSP A;  3WD4 A;  3G6L A;  2O92 A;  4GIV A;  4U86 A;  4DRP A;  2LJ4 A;  1W1V A;  3O5I A;  2MLY A;  5D75 A;  4C02 B;  5HWB A;  2ZR6 A;  1NMV A;  3QOK A;  4TW8 A;  1H0G A;  3WD1 A;  2MF9 A;  2PI6 A;  3AQU A;  4U84 A;  2FDM A;  3BXW A;  2YBU A;  3NRK A;  3ARW A;  2WLZ A;  3O5D A;  2F4E A;  1HKI A;  3OA5 A;  3RM9 A;  2XP3 A;  3NTP A;  2KO7 A;  1FKI A;  4QIB A;  1NWS A;  4WK9 A;  2FAP A;  1YW5 A;  2PPP A;  3O5K A;  1SYT A;  4LGX A;  1FKS A;  1OWQ A;  1SR0 A;  2PV1 A;  2DSU A;  3EY6 A;  3PRD A;  1L1P A;  1HXV A;  1NMW A;  2PBC A;  4DRO A;  3UI5 A;  3AS3 A;  3CGN A;  3B9E A;  1JNE A;  3MDY B;  3KAC A;  1ZBW A;  3OOB A;  1ZL1 A;  4IT4 A;  5HUA A;  1TCO C;  1ROU A;  1O6I A;  1E6N A;  2VN1 A;  2F21 A;  1D7J A;  1RD6 A;  3B7X A;  1KFW A;  2DSZ A;  1B6C A;  3RGC A;  3O5M A;  1D7I A;  3UQA A;  3O5F A;  3RME A;  1W26 A;  1WAW A;  2ESC A;  4W9P A;  2UZ5 A;  2ZQU A;  4IQC A;  4O2T A;  2KGJ A;  2DT2 A;  2ZR4 A;  3ALG A;  4L72 B;  5GPR A;  2F2D A;  1TFV A;  3ARV A;  2OLH A;  4MAV A;  2N87 A;  4MGV A;  4TX0 A;  4FAP A;  2M08 A;  3UQI A;  2XP9 A;  4LAX A;  4ODK A;  3UI6 A;  1FKB A;  1HKK A;  4TW7 A;  1ZCN A;  2DT0 A;  2B31 A;  3ARX A;  3CGM A;  1HKJ A;  3KAH A;  5HT1 A;  4NZC A;  3ART A;  5HBF A;  3ARR A;  4LAW A;  1FKK A;  3IK8 A;  3PRA A;  3UQB A;  4Z2L A;  4QT3 A;  1NSG A;  2LGO A;  4U85 A;  1Q6U A;  1LL7 A;  1EYM A;  1FKH A;  2RUD A;  5DIU A;  4DH0 A;  4AY1 A;  4ODN A;  5DIT A;  1W1T A;  4NNR A;  1X6L A;  3I6C A;  3O5P A;  3KAF A;  2KFW A;  1LG1 A;  1Q1C A;  2PPO A;  3TC5 A;  1EHN A;  1ZK6 A;  1Y0O A;  3O5E A;  1HJX A;  4J4O A;  1J6Y A;  4LAY A;  1QPF A;  1U79 A;  2A3B A;  3H9R B;  4ODM A;  5HW6 A;  3B8S A;  4S3J A;  1QZ2 A;  1A7X A;  5BXJ A;  1BKF A;  1KT0 A;  2DG3 A;  3IKD A;  1F8A B;  1T11 A;  2QF8 A;  4R5E A;  4ZPV R;  5I98 A;  4Q22 A;  4MNJ A;  1R9H A;  3CHE A;  3LUO A;  4S3K A;  4WKF A;  1ROT A;  2DG9 A;  3B9A A;  1JND A;  1HJV A;  4BF8 A;  4W5U A;  2A3C A;  1H0I A;  4ODR A;  4DRK A;  4WKA A;  2ZQS A;  4DWS C;  1WNO A;  1W9P A;  2WLY A;  4G50 A;  4W9Q A;  4Z2I A;  2DPE A;  3UI4 A;  2VCD A;  3AS0 A;  3FAP A;  3ARS A;  1EIB A;  3O5R A;  1FJD A;  2XPA A;  1KT1 A;  1HKM A;  4MPK A;  2D9F A;  3PR9 A;  4JFL A;  4JFJ A;  4LAV A;  4IT6 A;  2XP4 A;  1IX5 A;  1GOI A;  4Z2G A;  4JYS A;  1FKL A;  4P8W A;  2RUR A;  1ZBV A;  2IF4 A;  4R0X A;  1W1Y A;  1J4H A;  3CHF A;  1BL4 A;  2MLZ A;  1ZBK A;  4W9O A;  4DWS D;  1FKR A;  1LL4 A;  1NWT A;  3PRB A;  4DRN A;  4ZS6 A;  3RM8 A;  1UR9 A;  2DSW A;  2ZQT A;  1EQ3 A;  1ZU8 A;  2WM0 A;  4ODQ A;  4TW6 A;  1D7H A;  4JFK A;  3CHD A;  2DT1 A;  3CHC A;  4JFM A;  2ZQV A;  5B8I C;  2XP8 A;  3G6M A;  5HWC A;  5DEZ A;  2KR7 A;  3UF8 A;  3RM4 A;  1OGB A;  5HW7 A;  4KQZ A;  1FKF A;  4QZV B;  1D6O A;  3IHZ A;  1FAP A;  3JYM A;  1PBK A;  3ARQ A;  2YBT A;  2DT3 A;  2IUZ A;  1E6P A;  1F40 A;  2OFN A;  4DRH A;  5DF0 A;  1VF8 A;  4TYO A;  3ARZ A;  2PV3 A;  1EDQ A;  4NSB A;  1LG2 A;  4IQ2 A;  4DT4 A;  2PPN A;  3W4R A;  1K9T A;  3ODK A;  3O5G A;  1YAT A;  2LPV A;  4ZPT R;  2ZR5 A;  3WL0 A;  5HTG A;  3WD0 A;  1OGG A;  4WKH A;  4GGQ A;  2JZV A;  3TCZ A;  1J4R A;  1D2K A;  3WQW A;  3WD3 A;  4URI A;  1W9V A;  2PV2 A;  4MTV A;  4JFI A;  4Q7N A;  1NWR A;  4ODL A;  1NWU A;  1XHG A;  3ARP A;  1ZB5 A;  4HBE A;  2XP5 A;  4G2P A;  2LKN A;  3JXV A;  1XRV A;  2L2S A;  4DRJ A;  1FKD A;  4L3N A;  1GUV A;  2XP7 A;  3WD2 A;  1WB0 A;  2KE0 A;  3NI6 A;  3ARU A;  1E6Z A;  5DO2 A;  3TDB A;  2AWG A;  2A3E A;  3JYJ A;  1FFR A;  3O5J A;  3ARO A;  3KAB A;  4J4N A;  3WL1 A;  4DIP A;  1P5Q A;  5HKG A;  2RSE A;  3ARY A;  2RQS A;  1CTN A;  3KAG A;  1JNT A;  2AOS A;  4DZ2 A;  4XAK A;  1LJY A;  3AS2 A;  2Q5A A;  4HBO A;  4DWS B;  1ITX A;  2M2A A;  1Q6I A;  2DG4 A;  1W1P A;  2O9O A;  4ZPW R;  3ALF A;  3O5O A;  4ML4 A;  3IKG A;  1N1A A;  1NH6 A;  3RFW A;  4DRI A;  2MNT A;  4QT2 A;  3WH0 A;  2ITK A;  1LQ0 A;  3FXY A;  1HJW A;  1M5Y A;  3VAW A;  3WIJ A;  3AS1 A;  2G8Z A;  4DWS A;  4N19 A;  2MLX A;  4MNM A;  4FN2 A;  1ZBC A;  2Y78 A;  2G41 A;  1QPL A;  1Q6H A;  5HW8 A;  3CZ8 A;  3KAD A;  4ODP A;  2XP6 A;  2RUQ A;  4ODO A;  1JNS A;  1W9U A;  1J4I A;  1E9L A;  4IPX A;  4WJX A;  1X6N A;  2A3A A;  2KI3 A;  3PA7 A;  3WKZ A;  4P8X A;  4PTM A;  4P8U A;  1LL6 A;  2MPH A;  2RUC A;  1FKJ A;  2DSV A;  3O5Q A;  5GPG A;  5JH8 A;  4Z2H A;  4HAR A;  2K8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...