1FKHA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkhA00
1QZ2A 3MDYB 1F8AB 4LAVA 4TW8A 1FKIA 3O5QA 4W9PA 5HW7A 1JVWA 2N87A 2Q5AA 4TW7A 1EQ3A 4JFLA 1TCOC 2ZR4A 4U85A 3KZ7A 4DZ3A 1R9HA 4MSPA 4DRPA 3I6CA 3IKDA 4DRQA 1B6CA 3GPKA 3TDBA 1A7XA 4MGVA 1ZCNA 3O5IA 5HW8A 3KCEA 1Y0OA 2RUDA 3VAWA 3UQAA 1ZK6A 4DRNA 3KABA 1D7JA 1T11A 2VCDA 1EYMA 5J6EA 1FKBA 4ODOA 2OFNA 1YATA 2PPNA 2XPBA 4N19A 2ZQSA 3NTPA 3O5PA 2FKEA 1Q6HA 5HUAA 3O5DA 2LGOA 3UQIA 1J4IA 2KGJA 3UI4A 1YW5A 3KAIA 1Q6UA 1C9HA 4JFJA 4LAXA 1P5QA 4ODRA 1KT1A 5I98A 1FKTA 1FD9A 1FKSA 2KO7A 2XP5A 4GGQA 4W9OA 2M08A 2LKNA 1BKFA 3O5GA 2PV2A 1W26A 3IK8A 4U86A 2MLXA 1NMVA 2ZR6A 2M1IA 3KACA 2XP9A 2KFWA 3O5RA 5HT1A 2F4EA 3JYMA 3RGCA 2DG3A 1L1PA 2IF4A 2LPVA 2MNTA 2XP3A 1N1AA 1QPFA 4R0XA 4LAWA 3PRDA 4O2TA 4LAYA 4BF8A 4DRKA 2KR7A 4DRIA 2RUQA 4TNSA 5B8IC 4U84A 4FN2A 1J4RA 3JXVA 4ODKA 1Q6IA 2MLZA 1ROUA 2MLYA 2PPPA 3EY6A 1J6YA 2RSEA 2PBCA 4TW6A 2L2SA 1FKLA 2RURA 2VN1A 2K8IA 5DITA 4ODMA 4DRMA 3PA7A 3UQBA 2ZQTA 3O5KA 2XP7A 3RFWA 5HW6A 4G50A 4IPXA 1BL4A 1D7HA 3O5EA 1FKKA 2M2AA 3ODKA 3UI6A 3UI5A 1HXVA 1FAPA 4ODNA 3O5MA 3O5JA 4GIVA 4TX0A 3JYJA 4FAPA 1Q1CA 1FJDA 2LJ4A 1FKFA 2F2DA 4DROA 3H9RB 2MF9A 4J4OA 1NMWA 1JNSA 3PRBA 4JFMA 1FKRA 2XP8A 1ROTA 3FAPA 4QT2A 5HWBA 2AWGA 2ITKA 1D6OA 2KE0A 2XP4A 3KAHA 3KAFA 3NRKA 4ODQA 4W9QA 4JFIA 2XP6A 4G2PA 2Y78A 3KADA 1JNTA 1FKHA 1FKGA 5D75A 4DH0A 2KI3A 5HKGA 3LUOA 4DRJA 2PPOA 3O5OA 4DRHA 2ZR5A 2RQSA 2PV1A 1PBKA 4QIBA 4ODLA 1FKJA 3IHZA 4DT4A 1PINA 4IQCA 3O5LA 4J4NA 5GPGA 1M5YA 3UF8A 5HTGA 1F40A 3CGMA 1U79A 2D9FA 4NNRA 4DIPA 1FKDA 2DG9A 2DG4A 1QPLA 2ZQVA 3WH0A 2JZVA 5BXJA 3TC5A 3IKGA 3OOBA 2UZ5A 5DIUA 4DZ2A 2RUCA 3TCZA 1NSGA 4ODPA 3NI6A 5HWCA 4C02B 2F21A 4IQ2A 1J4HA 2XPAA 1D7IA 3O5FA 4ITZA 2FAPA 2MPHA 4TYOA 3CGNA 4JYSA 2PV3A 2ZQUA 4JFKA 1KT0A 3B7XA 5DIVA 3KAGA 4QT3A
chains in the Genus database with same CATH superfamily
3MDYB 1FKIA 5HW7A 1JVWA 4W5UA 4KR0B 4L3NA 4U85A 1LQ0A 1UR8A 1XRVA 4NZCA 3I6CA 4DRQA 3GPKA 1FFQA 1W9VA 4MGVA 1ZCNA 5HW8A 5HBFA 2DT2A 1D7JA 3AS1A 1EYMA 5J6EA 1FKBA 2ZQSA 3UQIA 1J4IA 4MNLA 3KAIA 4IT4A 3W4RA 3WL1A 4IT6A 1KT1A 2XP5A 4GGQA 2LKNA 1BKFA 1W26A 1NMVA 2YBTA 1EIBA 1L1PA 2IF4A 1N1AA 4R0XA 1HKIA 3PRDA 4O2TA 4DRKA 4DRIA 2A3CA 1ZBCA 4P8UA 4TNSA 1J4RA 1Q6IA 3QOKA 1O6IA 2RSEA 4HBEA 2L2SA 4MTVA 2K8IA 4DRMA 3UQBA 1OGBA 2ZQTA 4WJXA 4IPXA 3O5EA 3CHCA 3ODKA 3UI6A 2PN0A 3UI5A 3WD2A 1LJYA 1XHGA 3JYJA 1FKFA 2DPEA 4DROA 4J4OA 3WQVA 1JNSA 3PRBA 4MAVA 4ZS6A 2ITKA 3NRKA 3KAFA 3PR9A 1X6LA 1ZBKA 5DO2A 2Y78A 3KADA 3LUOA 4DRJA 4DRHA 3RM8A 1HJVA 4WIWA 2ZR5A 2PV1A 1PBKA 3WD4A 4DWSC 1IX5A 3WL0A 3AQUA 3O5LA 1F40A 4NNRA 1FKDA 1EHNA 1W9PA 2DG9A 3TC5A 2UZ5A 2RUCA 1FFRA 3B9EA 1ZB5A 4ODPA 3NI6A 1GOIA 1H0GA 2P4VA 2ZQUA 1NWUA 1QZ2A 1F8AB 4TW8A 4WK9A 4W9PA 2N87A 4TW7A 3ARZA 3CZ8A 4ZPVR 2ZR4A 4DZ3A 4DRPA 1ZBVA 3IKDA 1B6CA 3TDBA 3O5IA 1D2KA 3KCEA 2RUDA 1ZU8A 3VAWA 1W1YA 3WD0A 4ODOA 2XPBA 5HUAA 3WQWA 4XAKA 1C9HA 3CHFA 2DSWA 4R5EA 2KO7A 4W9OA 4WKAA 4AY1A 1TFVA 2ZR6A 2M1IA 3KACA 4DWSB 2KFWA 2DT3A 2F4EA 2DG3A 2WLYA 3CHDA 5DEZA 2LPVA 2MNTA 1QPFA 2DT0A 4BF8A 2RUQA 4HBOA 4U84A 2FDMA 1ZL1A 3EY6A 2VN1A 3PA7A 3RM4A 2WLZA 2XP7A 4Z2LA 4NSBA 1BL4A 1FKKA 2M2AA 1K9TA 1E6RA 1GRJA 2B5UB 4GIVA 4TX0A 4Z2IA 3B8SA 2LJ4A 4Z2KA 2QF8A 4JFMA 1FKRA 2A3AA 4QT2A 5HWBA 2KE0A 4ODQA 4W9QA 3KAHA 4JFIA 2XP6A 1JNEA 4G2PA 1ITXA 4DH0A 1FKHA 1HJXA 1JNDA 1E15A 1HKJA 2KI3A 3ARPA 1E6NA 3AS0A 1HKKA 2RQSA 4ODLA 2ESCA 3IHZA 4DT4A 4J4NA 3GTYX 1WAWA 4DIPA 4L72B 1QPLA 2ZQVA 2JZVA 4DZ2A 5DF0A 3ARXA 3FXYA 3G6LA 3ARTA 2IUZA 2FAPA 4TYOA 2PV3A 4JFKA 1VF8A 3RFWA 3KAGA 4QT3A 4LAVA 2WK2A 3O5QA 1EQ3A 3B9DA 3B9AA 4QZVB 4MSPA 1ZK6A 3KABA 2OFNA 1W1PA 1YATA 4N19A 4DWSD 1NH6A 2FKEA 2LGOA 1YW5A 1WNOA 1Q6UA 4JFJA 1FKTA 1FKSA 3O5GA 2PV2A 3IK8A 4U86A 1SR0A 1E6PA 1E44A 3WIJA 5HT1A 3JYMA 2O92A 3AS3A 2EULA 4LGXA 4ZPTR 1LG1A 2XP3A 2DSUA 4DWSA 4Z2JA 3ARYA 1UR9A 2DT1A 5GQBA 4FN2A 2WM0A 2MLZA 2MLYA 2PPPA 1J6YA 2PBCA 4TW6A 2B31A 5DITA 4ODMA 4Z2HA 3ALGA 5GPRA 1HXVA 1OWQA 1CTNA 1HJWA 4S3KA 1Q1CA 3ARWA 2F2DA 2MF9A 3RM9A 2G41A 2XP8A 1EDQA 1D6OA 4HARA 4P8VA 1JNTA 3AS2A 5D75A 1LG2A 2PPOA 3O5OA 4MPKA 3OA5A 1FKJA 4P8WA 3CHEA 1GUVA 5GPGA 4IQCA 3UF8A 5HTGA 3ARRA 3CH9A 3WH0A 2DG4A 4MNMA 4MNKA 3IKGA 1E9LA 2ETNA 3EIPA 1NSGA 4Q22A 1WB0A 5HWCA 1J4HA 1KFWA 2XPAA 4ITZA 3O5FA 3CGNA 1KT0A 3B7XA 5DIVA 4S3JA 1LL4A 3RMEA 1SYTA 2Q5AA 4JFLA 3ARQA 1TCOC 3KZ7A 1R9HA 2G8ZA 1A7XA 1Y0OA 1LL7A 3UQAA 1OGGA 4DRNA 1T11A 2VCDA 3ARSA 2PPNA 3O5PA 1Q6HA 1LL6A 3O5DA 3WD3A 3AROA 1NWTA 2KGJA 3UI4A 4LAXA 4ODRA 1P5QA 5I98A 1FD9A 4Q7NA 2M08A 2MLXA 1JCHB 4UDMA 2XP9A 3O5RA 1X6NA 4PTMA 3RGCA 1GPFA 4WKHA 4LAWA 3G6MA 4LAYA 2KR7A 1ZBWA 5B8IC 3JXVA 4ODKA 4ML4A 2YBUA 1ROUA 4URIA 4MNJA 2F23A 1FKLA 2RURA 3ARVA 3O5KA 5HW6A 4G50A 4Z2GA 3PRAA 1D7HA 4KQZA 5JH8A 3BXWA 1FAPA 4WKFA 1NWRA 4ODNA 3BMBA 3O5MA 3O5JA 4FAPA 1H0IA 1RD6A 1FJDA 3H9RB 1NMWA 4ZPWR 3ALFA 1ROTA 3FAPA 2AWGA 2XP4A 1FKGA 5HKGA 3WKZA 4P8XA 1W1TA 1W1VA 1W9UA 1E6ZA 4QIBA 2AOSA 3WD1A 2OLHA 1PINA 1M5YA 3CGMA 1U79A 2D9FA 2DSZA 1NWSA 5BXJA 3OOBA 5DIUA 3TCZA 2PI6A 3FY1A 2DSVA 3ARUA 3GU0A 4C02B 2F21A 4IQ2A 2A3EA 1D7IA 2O9OA 1HKMA 2MPHA 4JYSA 3NTPA 2A3BA
chains in the Genus database with same CATH topology
3MDYB 1FKIA 5HW7A 1JVWA 4W5UA 4KR0B 4L3NA 4U85A 1LQ0A 1UR8A 1XRVA 4NZCA 3I6CA 4DRQA 3GPKA 1FFQA 1W9VA 4MGVA 1ZCNA 5HW8A 5HBFA 2DT2A 1D7JA 3AS1A 1EYMA 5J6EA 1FKBA 2ZQSA 3UQIA 1J4IA 4MNLA 3KAIA 4IT4A 3W4RA 3WL1A 4IT6A 1KT1A 2XP5A 4GGQA 2LKNA 1BKFA 1W26A 1NMVA 2YBTA 1EIBA 1L1PA 2IF4A 1N1AA 4R0XA 1HKIA 3PRDA 4O2TA 4DRKA 4DRIA 2A3CA 1ZBCA 4P8UA 4TNSA 1J4RA 1Q6IA 3QOKA 1O6IA 2RSEA 4HBEA 2L2SA 4MTVA 2K8IA 4DRMA 3UQBA 1OGBA 2ZQTA 4WJXA 4IPXA 3O5EA 3CHCA 3ODKA 3UI6A 3UI5A 3WD2A 1LJYA 1XHGA 3JYJA 1FKFA 2DPEA 4DROA 4J4OA 3WQVA 1JNSA 3PRBA 4MAVA 4ZS6A 2ITKA 3NRKA 3KAFA 3PR9A 1X6LA 1ZBKA 5DO2A 2Y78A 3KADA 3LUOA 4DRJA 4DRHA 3RM8A 1HJVA 4WIWA 2ZR5A 2PV1A 1PBKA 3WD4A 4DWSC 1IX5A 3WL0A 3AQUA 3O5LA 1F40A 4NNRA 1FKDA 1EHNA 1W9PA 2DG9A 3TC5A 2UZ5A 2RUCA 1FFRA 3B9EA 1ZB5A 4ODPA 3NI6A 1GOIA 1H0GA 2ZQUA 1NWUA 1QZ2A 1F8AB 4TW8A 4WK9A 4W9PA 2N87A 4TW7A 3ARZA 3CZ8A 4ZPVR 2ZR4A 4DZ3A 4DRPA 1ZBVA 3IKDA 1B6CA 3TDBA 3O5IA 1D2KA 3KCEA 2RUDA 1ZU8A 3VAWA 1W1YA 3WD0A 4ODOA 2XPBA 5HUAA 3WQWA 4XAKA 1C9HA 3CHFA 2DSWA 4R5EA 2KO7A 4W9OA 4WKAA 4AY1A 1TFVA 2ZR6A 2M1IA 3KACA 4DWSB 2KFWA 2DT3A 2F4EA 2DG3A 2WLYA 3CHDA 5DEZA 2LPVA 2MNTA 1QPFA 2DT0A 4BF8A 2RUQA 4HBOA 4U84A 2FDMA 1ZL1A 3EY6A 2VN1A 3PA7A 3RM4A 2WLZA 2XP7A 4Z2LA 4NSBA 1BL4A 1FKKA 2M2AA 1K9TA 1E6RA 4GIVA 4TX0A 4Z2IA 3B8SA 2LJ4A 4Z2KA 2QF8A 4JFMA 1FKRA 2A3AA 4QT2A 5HWBA 2KE0A 4ODQA 4W9QA 3KAHA 4JFIA 2XP6A 1JNEA 4G2PA 1ITXA 4DH0A 1FKHA 1HJXA 1JNDA 1E15A 1HKJA 2KI3A 3ARPA 1E6NA 3AS0A 1HKKA 2RQSA 4ODLA 2ESCA 3IHZA 4DT4A 4J4NA 1WAWA 4DIPA 4L72B 1QPLA 2ZQVA 2JZVA 4DZ2A 5DF0A 3ARXA 3FXYA 3G6LA 3ARTA 2IUZA 2FAPA 4TYOA 2PV3A 4JFKA 1VF8A 3RFWA 3KAGA 4QT3A 4LAVA 2WK2A 3O5QA 1EQ3A 3B9DA 3B9AA 4QZVB 4MSPA 1ZK6A 3KABA 2OFNA 1W1PA 1YATA 4N19A 4DWSD 1NH6A 2FKEA 2LGOA 1YW5A 1WNOA 1Q6UA 4JFJA 1FKTA 1FKSA 3O5GA 2PV2A 3IK8A 4U86A 1SR0A 1E6PA 3WIJA 5HT1A 3JYMA 2O92A 3AS3A 4ZPTR 4LGXA 1LG1A 2XP3A 2DSUA 4DWSA 4Z2JA 3ARYA 1UR9A 2DT1A 5GQBA 4FN2A 2WM0A 2MLZA 2MLYA 2PPPA 1J6YA 2PBCA 4TW6A 2B31A 5DITA 4ODMA 4Z2HA 3ALGA 5GPRA 1HXVA 1OWQA 1CTNA 1HJWA 4S3KA 1Q1CA 3ARWA 2F2DA 2MF9A 3RM9A 2G41A 2XP8A 1EDQA 1D6OA 4HARA 4P8VA 1JNTA 3AS2A 5D75A 1LG2A 2PPOA 3O5OA 4MPKA 3OA5A 1FKJA 4P8WA 3CHEA 1GUVA 5GPGA 4IQCA 3UF8A 5HTGA 3ARRA 3CH9A 3WH0A 2DG4A 4MNMA 4MNKA 3IKGA 1E9LA 1NSGA 4Q22A 1WB0A 5HWCA 1J4HA 1KFWA 2XPAA 4ITZA 3O5FA 3CGNA 1KT0A 3B7XA 5DIVA 4S3JA 1LL4A 3RMEA 1SYTA 2Q5AA 4JFLA 3ARQA 1TCOC 3KZ7A 1R9HA 2G8ZA 1A7XA 1Y0OA 1LL7A 3UQAA 1OGGA 4DRNA 1T11A 2VCDA 3ARSA 2PPNA 3O5PA 1Q6HA 1LL6A 3O5DA 3WD3A 3AROA 1NWTA 2KGJA 3UI4A 4LAXA 4ODRA 1P5QA 5I98A 1FD9A 4Q7NA 2M08A 2MLXA 2XP9A 3O5RA 1X6NA 4PTMA 3RGCA 1GPFA 4WKHA 4LAWA 3G6MA 4LAYA 2KR7A 1ZBWA 5B8IC 3JXVA 4ODKA 4ML4A 2YBUA 1ROUA 4URIA 4MNJA 1FKLA 2RURA 3ARVA 3O5KA 5HW6A 4G50A 4Z2GA 3PRAA 1D7HA 4KQZA 5JH8A 3BXWA 1FAPA 4WKFA 1NWRA 4ODNA 3O5MA 3O5JA 4FAPA 1H0IA 1RD6A 1FJDA 3H9RB 1NMWA 4ZPWR 3ALFA 1ROTA 3FAPA 2AWGA 2XP4A 1FKGA 5HKGA 3WKZA 4P8XA 1W1TA 1W1VA 1W9UA 1E6ZA 4QIBA 2AOSA 3WD1A 2OLHA 1PINA 1M5YA 3CGMA 1U79A 2D9FA 2DSZA 1NWSA 5BXJA 3OOBA 5DIUA 3TCZA 2PI6A 3FY1A 2DSVA 3ARUA 4C02B 2F21A 4IQ2A 2A3EA 1D7IA 2O9OA 1HKMA 2MPHA 4JYSA 3NTPA 2A3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ2 A;  3MDY B;  1F8A B;  4LAV A;  4TW8 A;  1FKI A;  3O5Q A;  4W9P A;  5HW7 A;  1JVW A;  2N87 A;  2Q5A A;  4TW7 A;  1EQ3 A;  4JFL A;  1TCO C;  2ZR4 A;  4U85 A;  3KZ7 A;  4DZ3 A;  1R9H A;  4MSP A;  4DRP A;  3I6C A;  3IKD A;  4DRQ A;  1B6C A;  3GPK A;  3TDB A;  1A7X A;  4MGV A;  1ZCN A;  3O5I A;  5HW8 A;  3KCE A;  1Y0O A;  2RUD A;  3VAW A;  3UQA A;  1ZK6 A;  4DRN A;  3KAB A;  1D7J A;  1T11 A;  2VCD A;  1EYM A;  5J6E A;  1FKB A;  4ODO A;  2OFN A;  1YAT A;  2PPN A;  2XPB A;  4N19 A;  2ZQS A;  3NTP A;  3O5P A;  2FKE A;  1Q6H A;  5HUA A;  3O5D A;  2LGO A;  3UQI A;  1J4I A;  2KGJ A;  3UI4 A;  1YW5 A;  3KAI A;  1Q6U A;  1C9H A;  4JFJ A;  4LAX A;  1P5Q A;  4ODR A;  1KT1 A;  5I98 A;  1FKT A;  1FD9 A;  1FKS A;  2KO7 A;  2XP5 A;  4GGQ A;  4W9O A;  2M08 A;  2LKN A;  1BKF A;  3O5G A;  2PV2 A;  1W26 A;  3IK8 A;  4U86 A;  2MLX A;  1NMV A;  2ZR6 A;  2M1I A;  3KAC A;  2XP9 A;  2KFW A;  3O5R A;  5HT1 A;  2F4E A;  3JYM A;  3RGC A;  2DG3 A;  1L1P A;  2IF4 A;  2LPV A;  2MNT A;  2XP3 A;  1N1A A;  1QPF A;  4R0X A;  4LAW A;  3PRD A;  4O2T A;  4LAY A;  4BF8 A;  4DRK A;  2KR7 A;  4DRI A;  2RUQ A;  4TNS A;  5B8I C;  4U84 A;  4FN2 A;  1J4R A;  3JXV A;  4ODK A;  1Q6I A;  2MLZ A;  1ROU A;  2MLY A;  2PPP A;  3EY6 A;  1J6Y A;  2RSE A;  2PBC A;  4TW6 A;  2L2S A;  1FKL A;  2RUR A;  2VN1 A;  2K8I A;  5DIT A;  4ODM A;  4DRM A;  3PA7 A;  3UQB A;  2ZQT A;  3O5K A;  2XP7 A;  3RFW A;  5HW6 A;  4G50 A;  4IPX A;  1BL4 A;  1D7H A;  3O5E A;  1FKK A;  2M2A A;  3ODK A;  3UI6 A;  3UI5 A;  1HXV A;  1FAP A;  4ODN A;  3O5M A;  3O5J A;  4GIV A;  4TX0 A;  3JYJ A;  4FAP A;  1Q1C A;  1FJD A;  2LJ4 A;  1FKF A;  2F2D A;  4DRO A;  3H9R B;  2MF9 A;  4J4O A;  1NMW A;  1JNS A;  3PRB A;  4JFM A;  1FKR A;  2XP8 A;  1ROT A;  3FAP A;  4QT2 A;  5HWB A;  2AWG A;  2ITK A;  1D6O A;  2KE0 A;  2XP4 A;  3KAH A;  3KAF A;  3NRK A;  4ODQ A;  4W9Q A;  4JFI A;  2XP6 A;  4G2P A;  2Y78 A;  3KAD A;  1JNT A;  1FKH A;  1FKG A;  5D75 A;  4DH0 A;  2KI3 A;  5HKG A;  3LUO A;  4DRJ A;  2PPO A;  3O5O A;  4DRH A;  2ZR5 A;  2RQS A;  2PV1 A;  1PBK A;  4QIB A;  4ODL A;  1FKJ A;  3IHZ A;  4DT4 A;  1PIN A;  4IQC A;  3O5L A;  4J4N A;  5GPG A;  1M5Y A;  3UF8 A;  5HTG A;  1F40 A;  3CGM A;  1U79 A;  2D9F A;  4NNR A;  4DIP A;  1FKD A;  2DG9 A;  2DG4 A;  1QPL A;  2ZQV A;  3WH0 A;  2JZV A;  5BXJ A;  3TC5 A;  3IKG A;  3OOB A;  2UZ5 A;  5DIU A;  4DZ2 A;  2RUC A;  3TCZ A;  1NSG A;  4ODP A;  3NI6 A;  5HWC A;  4C02 B;  2F21 A;  4IQ2 A;  1J4H A;  2XPA A;  1D7I A;  3O5F A;  4ITZ A;  2FAP A;  2MPH A;  4TYO A;  3CGN A;  4JYS A;  2PV3 A;  2ZQU A;  4JFK A;  1KT0 A;  3B7X A;  5DIV A;  3KAG A;  4QT3 A; 
#chains in the Genus database with same CATH topology
 3MDY B;  1FKI A;  5HW7 A;  1JVW A;  4W5U A;  4KR0 B;  4L3N A;  4U85 A;  1LQ0 A;  1UR8 A;  1XRV A;  4NZC A;  3I6C A;  4DRQ A;  3GPK A;  1FFQ A;  1W9V A;  4MGV A;  1ZCN A;  5HW8 A;  5HBF A;  2DT2 A;  1D7J A;  3AS1 A;  1EYM A;  5J6E A;  1FKB A;  2ZQS A;  3UQI A;  1J4I A;  4MNL A;  3KAI A;  4IT4 A;  3W4R A;  3WL1 A;  4IT6 A;  1KT1 A;  2XP5 A;  4GGQ A;  2LKN A;  1BKF A;  1W26 A;  1NMV A;  2YBT A;  1EIB A;  1L1P A;  2IF4 A;  1N1A A;  4R0X A;  1HKI A;  3PRD A;  4O2T A;  4DRK A;  4DRI A;  2A3C A;  1ZBC A;  4P8U A;  4TNS A;  1J4R A;  1Q6I A;  3QOK A;  1O6I A;  2RSE A;  4HBE A;  2L2S A;  4MTV A;  2K8I A;  4DRM A;  3UQB A;  1OGB A;  2ZQT A;  4WJX A;  4IPX A;  3O5E A;  3CHC A;  3ODK A;  3UI6 A;  2PN0 A;  3UI5 A;  3WD2 A;  1LJY A;  1XHG A;  3JYJ A;  1FKF A;  2DPE A;  4DRO A;  4J4O A;  3WQV A;  1JNS A;  3PRB A;  4MAV A;  4ZS6 A;  2ITK A;  3NRK A;  3KAF A;  3PR9 A;  1X6L A;  1ZBK A;  5DO2 A;  2Y78 A;  3KAD A;  3LUO A;  4DRJ A;  4DRH A;  3RM8 A;  1HJV A;  4WIW A;  2ZR5 A;  2PV1 A;  1PBK A;  3WD4 A;  4DWS C;  1IX5 A;  3WL0 A;  3AQU A;  3O5L A;  1F40 A;  4NNR A;  1FKD A;  1EHN A;  1W9P A;  2DG9 A;  3TC5 A;  2UZ5 A;  2RUC A;  1FFR A;  3B9E A;  1ZB5 A;  4ODP A;  3NI6 A;  1GOI A;  1H0G A;  2P4V A;  2ZQU A;  1NWU A;  1QZ2 A;  1F8A B;  4TW8 A;  4WK9 A;  4W9P A;  2N87 A;  4TW7 A;  3ARZ A;  3CZ8 A;  4ZPV R;  2ZR4 A;  4DZ3 A;  4DRP A;  1ZBV A;  3IKD A;  1B6C A;  3TDB A;  3O5I A;  1D2K A;  3KCE A;  2RUD A;  1ZU8 A;  3VAW A;  1W1Y A;  3WD0 A;  4ODO A;  2XPB A;  5HUA A;  3WQW A;  4XAK A;  1C9H A;  3CHF A;  2DSW A;  4R5E A;  2KO7 A;  4W9O A;  4WKA A;  4AY1 A;  1TFV A;  2ZR6 A;  2M1I A;  3KAC A;  4DWS B;  2KFW A;  2DT3 A;  2F4E A;  2DG3 A;  2WLY A;  3CHD A;  5DEZ A;  2LPV A;  2MNT A;  1QPF A;  2DT0 A;  4BF8 A;  2RUQ A;  4HBO A;  4U84 A;  2FDM A;  1ZL1 A;  3EY6 A;  2VN1 A;  3PA7 A;  3RM4 A;  2WLZ A;  2XP7 A;  4Z2L A;  4NSB A;  1BL4 A;  1FKK A;  2M2A A;  1K9T A;  1E6R A;  1GRJ A;  2B5U B;  4GIV A;  4TX0 A;  4Z2I A;  3B8S A;  2LJ4 A;  4Z2K A;  2QF8 A;  4JFM A;  1FKR A;  2A3A A;  4QT2 A;  5HWB A;  2KE0 A;  4ODQ A;  4W9Q A;  3KAH A;  4JFI A;  2XP6 A;  1JNE A;  4G2P A;  1ITX A;  4DH0 A;  1FKH A;  1HJX A;  1JND A;  1E15 A;  1HKJ A;  2KI3 A;  3ARP A;  1E6N A;  3AS0 A;  1HKK A;  2RQS A;  4ODL A;  2ESC A;  3IHZ A;  4DT4 A;  4J4N A;  3GTY X;  1WAW A;  4DIP A;  4L72 B;  1QPL A;  2ZQV A;  2JZV A;  4DZ2 A;  5DF0 A;  3ARX A;  3FXY A;  3G6L A;  3ART A;  2IUZ A;  2FAP A;  4TYO A;  2PV3 A;  4JFK A;  1VF8 A;  3RFW A;  3KAG A;  4QT3 A;  4LAV A;  2WK2 A;  3O5Q A;  1EQ3 A;  3B9D A;  3B9A A;  4QZV B;  4MSP A;  1ZK6 A;  3KAB A;  2OFN A;  1W1P A;  1YAT A;  4N19 A;  4DWS D;  1NH6 A;  2FKE A;  2LGO A;  1YW5 A;  1WNO A;  1Q6U A;  4JFJ A;  1FKT A;  1FKS A;  3O5G A;  2PV2 A;  3IK8 A;  4U86 A;  1SR0 A;  1E6P A;  1E44 A;  3WIJ A;  5HT1 A;  3JYM A;  2O92 A;  3AS3 A;  2EUL A;  4LGX A;  4ZPT R;  1LG1 A;  2XP3 A;  2DSU A;  4DWS A;  4Z2J A;  3ARY A;  1UR9 A;  2DT1 A;  5GQB A;  4FN2 A;  2WM0 A;  2MLZ A;  2MLY A;  2PPP A;  1J6Y A;  2PBC A;  4TW6 A;  2B31 A;  5DIT A;  4ODM A;  4Z2H A;  3ALG A;  5GPR A;  1HXV A;  1OWQ A;  1CTN A;  1HJW A;  4S3K A;  1Q1C A;  3ARW A;  2F2D A;  2MF9 A;  3RM9 A;  2G41 A;  2XP8 A;  1EDQ A;  1D6O A;  4HAR A;  4P8V A;  1JNT A;  3AS2 A;  5D75 A;  1LG2 A;  2PPO A;  3O5O A;  4MPK A;  3OA5 A;  1FKJ A;  4P8W A;  3CHE A;  1GUV A;  5GPG A;  4IQC A;  3UF8 A;  5HTG A;  3ARR A;  3CH9 A;  3WH0 A;  2DG4 A;  4MNM A;  4MNK A;  3IKG A;  1E9L A;  2ETN A;  3EIP A;  1NSG A;  4Q22 A;  1WB0 A;  5HWC A;  1J4H A;  1KFW A;  2XPA A;  4ITZ A;  3O5F A;  3CGN A;  1KT0 A;  3B7X A;  5DIV A;  4S3J A;  1LL4 A;  3RME A;  1SYT A;  2Q5A A;  4JFL A;  3ARQ A;  1TCO C;  3KZ7 A;  1R9H A;  2G8Z A;  1A7X A;  1Y0O A;  1LL7 A;  3UQA A;  1OGG A;  4DRN A;  1T11 A;  2VCD A;  3ARS A;  2PPN A;  3O5P A;  1Q6H A;  1LL6 A;  3O5D A;  3WD3 A;  3ARO A;  1NWT A;  2KGJ A;  3UI4 A;  4LAX A;  4ODR A;  1P5Q A;  5I98 A;  1FD9 A;  4Q7N A;  2M08 A;  2MLX A;  1JCH B;  4UDM A;  2XP9 A;  3O5R A;  1X6N A;  4PTM A;  3RGC A;  1GPF A;  4WKH A;  4LAW A;  3G6M A;  4LAY A;  2KR7 A;  1ZBW A;  5B8I C;  3JXV A;  4ODK A;  4ML4 A;  2YBU A;  1ROU A;  4URI A;  4MNJ A;  2F23 A;  1FKL A;  2RUR A;  3ARV A;  3O5K A;  5HW6 A;  4G50 A;  4Z2G A;  3PRA A;  1D7H A;  4KQZ A;  5JH8 A;  3BXW A;  1FAP A;  4WKF A;  1NWR A;  4ODN A;  3BMB A;  3O5M A;  3O5J A;  4FAP A;  1H0I A;  1RD6 A;  1FJD A;  3H9R B;  1NMW A;  4ZPW R;  3ALF A;  1ROT A;  3FAP A;  2AWG A;  2XP4 A;  1FKG A;  5HKG A;  3WKZ A;  4P8X A;  1W1T A;  1W1V A;  1W9U A;  1E6Z A;  4QIB A;  2AOS A;  3WD1 A;  2OLH A;  1PIN A;  1M5Y A;  3CGM A;  1U79 A;  2D9F A;  2DSZ A;  1NWS A;  5BXJ A;  3OOB A;  5DIU A;  3TCZ A;  2PI6 A;  3FY1 A;  2DSV A;  3ARU A;  3GU0 A;  4C02 B;  2F21 A;  4IQ2 A;  2A3E A;  1D7I A;  2O9O A;  1HKM A;  2MPH A;  4JYS A;  3NTP A;  2A3B A; 
#chains in the Genus database with same CATH homology
 3MDY B;  1FKI A;  5HW7 A;  1JVW A;  4W5U A;  4KR0 B;  4L3N A;  4U85 A;  1LQ0 A;  1UR8 A;  1XRV A;  4NZC A;  3I6C A;  4DRQ A;  3GPK A;  1FFQ A;  1W9V A;  4MGV A;  1ZCN A;  5HW8 A;  5HBF A;  2DT2 A;  1D7J A;  3AS1 A;  1EYM A;  5J6E A;  1FKB A;  2ZQS A;  3UQI A;  1J4I A;  4MNL A;  3KAI A;  4IT4 A;  3W4R A;  3WL1 A;  4IT6 A;  1KT1 A;  2XP5 A;  4GGQ A;  2LKN A;  1BKF A;  1W26 A;  1NMV A;  2YBT A;  1EIB A;  1L1P A;  2IF4 A;  1N1A A;  4R0X A;  1HKI A;  3PRD A;  4O2T A;  4DRK A;  4DRI A;  2A3C A;  1ZBC A;  4P8U A;  4TNS A;  1J4R A;  1Q6I A;  3QOK A;  1O6I A;  2RSE A;  4HBE A;  2L2S A;  4MTV A;  2K8I A;  4DRM A;  3UQB A;  1OGB A;  2ZQT A;  4WJX A;  4IPX A;  3O5E A;  3CHC A;  3ODK A;  3UI6 A;  3UI5 A;  3WD2 A;  1LJY A;  1XHG A;  3JYJ A;  1FKF A;  2DPE A;  4DRO A;  4J4O A;  3WQV A;  1JNS A;  3PRB A;  4MAV A;  4ZS6 A;  2ITK A;  3NRK A;  3KAF A;  3PR9 A;  1X6L A;  1ZBK A;  5DO2 A;  2Y78 A;  3KAD A;  3LUO A;  4DRJ A;  4DRH A;  3RM8 A;  1HJV A;  4WIW A;  2ZR5 A;  2PV1 A;  1PBK A;  3WD4 A;  4DWS C;  1IX5 A;  3WL0 A;  3AQU A;  3O5L A;  1F40 A;  4NNR A;  1FKD A;  1EHN A;  1W9P A;  2DG9 A;  3TC5 A;  2UZ5 A;  2RUC A;  1FFR A;  3B9E A;  1ZB5 A;  4ODP A;  3NI6 A;  1GOI A;  1H0G A;  2ZQU A;  1NWU A;  1QZ2 A;  1F8A B;  4TW8 A;  4WK9 A;  4W9P A;  2N87 A;  4TW7 A;  3ARZ A;  3CZ8 A;  4ZPV R;  2ZR4 A;  4DZ3 A;  4DRP A;  1ZBV A;  3IKD A;  1B6C A;  3TDB A;  3O5I A;  1D2K A;  3KCE A;  2RUD A;  1ZU8 A;  3VAW A;  1W1Y A;  3WD0 A;  4ODO A;  2XPB A;  5HUA A;  3WQW A;  4XAK A;  1C9H A;  3CHF A;  2DSW A;  4R5E A;  2KO7 A;  4W9O A;  4WKA A;  4AY1 A;  1TFV A;  2ZR6 A;  2M1I A;  3KAC A;  4DWS B;  2KFW A;  2DT3 A;  2F4E A;  2DG3 A;  2WLY A;  3CHD A;  5DEZ A;  2LPV A;  2MNT A;  1QPF A;  2DT0 A;  4BF8 A;  2RUQ A;  4HBO A;  4U84 A;  2FDM A;  1ZL1 A;  3EY6 A;  2VN1 A;  3PA7 A;  3RM4 A;  2WLZ A;  2XP7 A;  4Z2L A;  4NSB A;  1BL4 A;  1FKK A;  2M2A A;  1K9T A;  1E6R A;  4GIV A;  4TX0 A;  4Z2I A;  3B8S A;  2LJ4 A;  4Z2K A;  2QF8 A;  4JFM A;  1FKR A;  2A3A A;  4QT2 A;  5HWB A;  2KE0 A;  4ODQ A;  4W9Q A;  3KAH A;  4JFI A;  2XP6 A;  1JNE A;  4G2P A;  1ITX A;  4DH0 A;  1FKH A;  1HJX A;  1JND A;  1E15 A;  1HKJ A;  2KI3 A;  3ARP A;  1E6N A;  3AS0 A;  1HKK A;  2RQS A;  4ODL A;  2ESC A;  3IHZ A;  4DT4 A;  4J4N A;  1WAW A;  4DIP A;  4L72 B;  1QPL A;  2ZQV A;  2JZV A;  4DZ2 A;  5DF0 A;  3ARX A;  3FXY A;  3G6L A;  3ART A;  2IUZ A;  2FAP A;  4TYO A;  2PV3 A;  4JFK A;  1VF8 A;  3RFW A;  3KAG A;  4QT3 A;  4LAV A;  2WK2 A;  3O5Q A;  1EQ3 A;  3B9D A;  3B9A A;  4QZV B;  4MSP A;  1ZK6 A;  3KAB A;  2OFN A;  1W1P A;  1YAT A;  4N19 A;  4DWS D;  1NH6 A;  2FKE A;  2LGO A;  1YW5 A;  1WNO A;  1Q6U A;  4JFJ A;  1FKT A;  1FKS A;  3O5G A;  2PV2 A;  3IK8 A;  4U86 A;  1SR0 A;  1E6P A;  3WIJ A;  5HT1 A;  3JYM A;  2O92 A;  3AS3 A;  4ZPT R;  4LGX A;  1LG1 A;  2XP3 A;  2DSU A;  4DWS A;  4Z2J A;  3ARY A;  1UR9 A;  2DT1 A;  5GQB A;  4FN2 A;  2WM0 A;  2MLZ A;  2MLY A;  2PPP A;  1J6Y A;  2PBC A;  4TW6 A;  2B31 A;  5DIT A;  4ODM A;  4Z2H A;  3ALG A;  5GPR A;  1HXV A;  1OWQ A;  1CTN A;  1HJW A;  4S3K A;  1Q1C A;  3ARW A;  2F2D A;  2MF9 A;  3RM9 A;  2G41 A;  2XP8 A;  1EDQ A;  1D6O A;  4HAR A;  4P8V A;  1JNT A;  3AS2 A;  5D75 A;  1LG2 A;  2PPO A;  3O5O A;  4MPK A;  3OA5 A;  1FKJ A;  4P8W A;  3CHE A;  1GUV A;  5GPG A;  4IQC A;  3UF8 A;  5HTG A;  3ARR A;  3CH9 A;  3WH0 A;  2DG4 A;  4MNM A;  4MNK A;  3IKG A;  1E9L A;  1NSG A;  4Q22 A;  1WB0 A;  5HWC A;  1J4H A;  1KFW A;  2XPA A;  4ITZ A;  3O5F A;  3CGN A;  1KT0 A;  3B7X A;  5DIV A;  4S3J A;  1LL4 A;  3RME A;  1SYT A;  2Q5A A;  4JFL A;  3ARQ A;  1TCO C;  3KZ7 A;  1R9H A;  2G8Z A;  1A7X A;  1Y0O A;  1LL7 A;  3UQA A;  1OGG A;  4DRN A;  1T11 A;  2VCD A;  3ARS A;  2PPN A;  3O5P A;  1Q6H A;  1LL6 A;  3O5D A;  3WD3 A;  3ARO A;  1NWT A;  2KGJ A;  3UI4 A;  4LAX A;  4ODR A;  1P5Q A;  5I98 A;  1FD9 A;  4Q7N A;  2M08 A;  2MLX A;  2XP9 A;  3O5R A;  1X6N A;  4PTM A;  3RGC A;  1GPF A;  4WKH A;  4LAW A;  3G6M A;  4LAY A;  2KR7 A;  1ZBW A;  5B8I C;  3JXV A;  4ODK A;  4ML4 A;  2YBU A;  1ROU A;  4URI A;  4MNJ A;  1FKL A;  2RUR A;  3ARV A;  3O5K A;  5HW6 A;  4G50 A;  4Z2G A;  3PRA A;  1D7H A;  4KQZ A;  5JH8 A;  3BXW A;  1FAP A;  4WKF A;  1NWR A;  4ODN A;  3O5M A;  3O5J A;  4FAP A;  1H0I A;  1RD6 A;  1FJD A;  3H9R B;  1NMW A;  4ZPW R;  3ALF A;  1ROT A;  3FAP A;  2AWG A;  2XP4 A;  1FKG A;  5HKG A;  3WKZ A;  4P8X A;  1W1T A;  1W1V A;  1W9U A;  1E6Z A;  4QIB A;  2AOS A;  3WD1 A;  2OLH A;  1PIN A;  1M5Y A;  3CGM A;  1U79 A;  2D9F A;  2DSZ A;  1NWS A;  5BXJ A;  3OOB A;  5DIU A;  3TCZ A;  2PI6 A;  3FY1 A;  2DSV A;  3ARU A;  4C02 B;  2F21 A;  4IQ2 A;  2A3E A;  1D7I A;  2O9O A;  1HKM A;  2MPH A;  4JYS A;  3NTP A;  2A3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...