1FKKA

Atomic structure of fkbp12, an immunophilin binding protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
pubmed doi rcsb
molecule tags Rotamase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkkA00
1QPLA 2MLZA 2ZQTA 4J4NA 1D7IA 2F4EA 4DRPA 5HKGA 3UQAA 1JVWA 5HWBA 3IHZA 2KE0A 1HXVA 2ZR5A 4LAYA 3MDYB 3UI6A 3ODKA 3IKGA 3PA7A 1JNTA 4DZ3A 4DT4A 2OFNA 2XP4A 5BXJA 2KO7A 4DRIA 1R9HA 3IK8A 4LAVA 1TCOC 2KGJA 2LPVA 4ODQA 4ODKA 1YW5A 1J4HA 2MF9A 3JYJA 1P5QA 3KAGA 3I6CA 4JFIA 3EY6A 4U84A 5HW6A 3CGNA 4JFJA 1M5YA 4ODLA 2KR7A 2XPBA 1F40A 5J6EA 5HT1A 4DH0A 2ZQSA 1FD9A 5HW8A 2PV3A 3O5LA 4TNSA 1J6YA 1L1PA 1FKSA 4TW7A 4ITZA 3IKDA 2FKEA 3O5MA 1B6CA 4JYSA 2KFWA 1YATA 4GIVA 1ZK6A 3O5EA 3UI5A 3UQBA 3TDBA 2F21A 2RUQA 1KT1A 3O5IA 1EYMA 4U86A 2PBCA 3KCEA 2ZR4A 4QT2A 3NTPA 4N19A 3O5GA 4QT3A 4W9QA 4W9PA 1FKRA 2DG4A 4ODOA 1F8AB 1Q1CA 1EQ3A 3KABA 2JZVA 4DRKA 3PRBA 4ODMA 1FAPA 2PPNA 2M08A 3O5QA 1FKDA 1FKBA 4ODRA 3UF8A 2RQSA 5HW7A 1PINA 1BL4A 2FAPA 1D6OA 1A7XA 1PBKA 2L2SA 2RUCA 4GGQA 1BKFA 1JNSA 2LJ4A 3GPKA 2ZQUA 1Q6HA 4ODNA 2PV1A 4DRQA 1FJDA 2ITKA 1FKGA 1Y0OA 2Y78A 1W26A 2XPAA 3NRKA 4G50A 4W9OA 2AWGA 4MSPA 2XP8A 4IPXA 4DIPA 3RFWA 5HTGA 2MNTA 3FAPA 1KT0A 1Q6IA 1ROUA 1FKHA 4FAPA 4TW6A 1C9HA 5I98A 4TW8A 5DIVA 1FKIA 1QZ2A 2Q5AA 3VAWA 4DROA 1FKFA 2PV2A 3KZ7A 1J4RA 2XP5A 3O5PA 2MPHA 3CGMA 3O5KA 1FKTA 2N87A 2VN1A 2RSEA 5HUAA 4JFLA 4R0XA 3PRDA 1T11A 3B7XA 4JFMA 2LKNA 1N1AA 4QIBA 2DG3A 2D9FA 4TX0A 4DRJA 3UI4A 3UQIA 2IF4A 2VCDA 3JXVA 3RGCA 3O5RA 3O5JA 3TC5A 2UZ5A 3JYMA 5B8IC 2F2DA 5GPGA 4G2PA 1ZCNA 4DRHA 3KAFA 1J4IA 2M2AA 1FKKA 2MLYA 4IQCA 4ODPA 2MLXA 2KI3A 4DRMA 5HWCA 1NSGA 3O5FA 1FKJA 2XP6A 2DG9A 2PPOA 2XP3A 1Q6UA 5D75A 4DZ2A 2RURA 3O5DA 4O2TA 2M1IA 3KADA 4MGVA 2XP9A 4J4OA 1NMWA 2PPPA 2ZQVA 1D7JA 3NI6A 3KACA 2ZR6A 3O5OA 1U79A 4LAXA 4U85A 3WH0A 5DIUA 1ROTA 2LGOA 4IQ2A 3TCZA 2RUDA 4LAWA 3LUOA 1QPFA 1FKLA 3KAHA 1NMVA 3OOBA 3H9RB 2XP7A 2K8IA 1D7HA 5DITA 4BF8A 4NNRA 3KAIA 4TYOA 4C02B 4FN2A 4DRNA 4JFKA
chains in the Genus database with same CATH superfamily
1D7IA 3UQAA 3IHZA 2KE0A 2A3EA 2KO7A 4DRIA 1TCOC 1ZL1A 2O9OA 3ARUA 4DWSA 1J4HA 1OGGA 1LL7A 3KAGA 4U84A 2A3AA 3EIPA 1M5YA 1W9VA 1W1PA 1HJWA 2KR7A 4TNSA 1FKSA 4ITZA 3IKDA 3O5MA 4XAKA 1ZK6A 3O5EA 2PN0A 3BMBA 2RUQA 1D2KA 4U86A 1EYMA 3KCEA 2ZR4A 3NTPA 4N19A 4QT3A 4UDMA 1EQ3A 3KABA 1SYTA 1JNDA 1FAPA 3ARSA 3O5QA 1GRJA 2DSVA 5HW7A 1E6ZA 2B5UB 3ARPA 1BL4A 3CHDA 1D6OA 1LG1A 4PTMA 1JNSA 1WNOA 1IX5A 1FJDA 2ITKA 2Y78A 3NRKA 2XPAA 2AOSA 4IPXA 2MNTA 1W1TA 1KT0A 4FAPA 1HJVA 4DROA 2A3BA 4ML4A 3O5KA 1E44A 1H0GA 4WIWA 2N87A 1UR9A 3PRDA 3AS3A 2D9FA 4MTVA 3UI4A 3O5JA 1NWRA 3JYMA 5B8IC 5GPGA 4DRHA 2M2AA 1FKKA 4DRMA 2KI3A 3WL0A 1ZB5A 2DG9A 1GPFA 2FDMA 5D75A 1O6IA 4ZPVR 3WD3A 4MGVA 3ARZA 4ZPWR 2PPPA 3WH0A 1EDQA 1EHNA 1ZBVA 1QPFA 4Q7NA 1FKLA 4DWSB 3AQUA 1NMVA 5GQBA 2K8IA 3FXYA 4TYOA 1GUVA 1JNEA 4JFKA 2MLZA 4J4NA 4DRPA 3ARWA 1X6LA 1JVWA 3MDYB 5DEZA 1JNTA 1WAWA 4MNKA 2OFNA 2XP4A 4Q22A 5BXJA 2G41A 3RMEA 1R9HA 3AS0A 3WL1A 2MF9A 4JFIA 4JFJA 3OA5A 2EULA 4MAVA 2XPBA 4WKFA 4WKHA 1ZBCA 5HW8A 1L1PA 4URIA 1GOIA 1B6CA 2DT2A 1OWQA 3ARTA 4JYSA 3UI5A 1YATA 3UQBA 4IT4A 2F21A 4LGXA 3WIJA 3WQVA 2PBCA 2DT0A 4L72B 2DG4A 3CHEA 2JZVA 1LG2A 3PRBA 4ODMA 2PPNA 4MNLA 4ODRA 3UF8A 4KR0B 1FKBA 3AS2A 4ZS6A 4HBEA 1PBKA 2RUCA 4GGQA 1BKFA 3PR9A 4NSBA 4WK9A 4WKAA 4DWSC 4ODNA 4L3NA 4DRQA 3PRAA 4G50A 2DPEA 2F23A 2XP8A 5HTGA 2B31A 1NWSA 1FKHA 4Z2IA 1C9HA 1E6NA 1LQ0A 5DIVA 1FKIA 2DSZA 3VAWA 3AROA 3KZ7A 1J4RA 1E6RA 2MPHA 2VN1A 5HUAA 1SR0A 1CTNA 4NZCA 4R0XA 2LKNA 1H0IA 2DG3A 4TX0A 4DRJA 1LL4A 3RM8A 3B9AA 2IF4A 2VCDA 4WJXA 1ITXA 2DSWA 3KAFA 4IQCA 4ODPA 5HWCA 1NSGA 3O5FA 1FKJA 1EIBA 1KFWA 3KADA 2XP9A 4HBOA 4J4OA 3NI6A 2WK2A 1D7JA 3B9DA 3FY1A 2LGOA 4IQ2A 2QF8A 4LAWA 1WB0A 2XP7A 1D7HA 5DITA 4BF8A 4C02B 1W1VA 1LL6A 3ARYA 5HKGA 1XRVA 3ALGA 1HXVA 2ZR5A 3UI6A 3RM4A 3IKGA 4AY1A 4P8VA 3IK8A 4Z2HA 2KGJA 3B9EA 2LPVA 4ODQA 3RM9A 1YW5A 1ZU8A 1HKIA 1P5QA 3I6CA 3WQWA 2DT3A 1HKJA 4ODLA 3G6MA 5HT1A 4DH0A 1W9PA 2ZQSA 3O5LA 4QZVB 1NWUA 4TW7A 3CH9A 3WD2A 3BXWA 4GIVA 4MNJA 2G8ZA 1KT1A 4S3JA 1FKRA 3O5GA 2A3CA 1NH6A 4S3KA 1E6PA 4DRKA 1LJYA 2M08A 4Z2JA 2RQSA 1K9TA 1RD6A 1PINA 1A7XA 3GTYX 3GPKA 1JCHB 1Q6HA 2PV1A 2YBUA 1FKGA 4W9OA 1W26A 5GPRA 1X6NA 3FAPA 1HJXA 1ROUA 2O92A 4TW6A 5I98A 4TW8A 1QZ2A 2Q5AA 1FKFA 2PV2A 3O5PA 3CGMA 2IUZA 4P8UA 4W5UA 2P4VA 4JFLA 2ESCA 5HBFA 1N1AA 2DT1A 3JXVA 3RGCA 2UZ5A 2F2DA 4G2PA 1ZCNA 1J4IA 3W4RA 1W9UA 1FFQA 2XP6A 2XP3A 1Q6UA 3O5DA 4O2TA 1E9LA 3ARXA 1NMWA 3KACA 2ZR6A 5DIUA 2RUDA 1XHGA 4NNRA 2DSUA 4FN2A 4DRNA 1QPLA 3ARQA 1NWTA 2ZQTA 2F4EA 1VF8A 5HWBA 4LAYA 3ODKA 3PA7A 4DZ3A 4DT4A 4KQZA 2WLYA 4LAVA 4ODKA 3JYJA 5HW6A 3EY6A 3CGNA 3WKZA 1F40A 5J6EA 1FD9A 1J6YA 2PV3A 2FKEA 3B8SA 2KFWA 3CHFA 3TDBA 5JH8A 4Z2KA 1HKMA 3TC5A 3O5IA 4P8XA 4QT2A 4W9QA 4W9PA 4ODOA 1F8AB 1Q1CA 4IT6A 1FKDA 2PI6A 4P8WA 3AS1A 2WM0A 2FAPA 2L2SA 4DWSD 2LJ4A 2ZQUA 3ALFA 4HARA 4MNMA 1Y0OA 4DIPA 2AWGA 4MSPA 1FFRA 2WLZA 3RFWA 2ETNA 1Q6IA 2XP5A 1ZBKA 1FKTA 1ZBWA 2OLHA 2RSEA 1W1YA 1TFVA 4R5EA 1T11A 3B7XA 3WD0A 3CZ8A 4JFMA 4QIBA 3WD1A 3GU0A 3QOKA 3UQIA 1HKKA 3O5RA 2YBTA 1OGBA 4ZPTR 2MLYA 3WD4A 2MLXA 1E15A 2PPOA 4DZ2A 1UR8A 2RURA 2M1IA 4Z2GA 3CHCA 5DF0A 3ARRA 4LAXA 2ZQVA 3O5OA 4U85A 1U79A 1ROTA 3TCZA 4Z2LA 3G6LA 3LUOA 3ARVA 3KAHA 3OOBA 3H9RB 4MPKA 3KAIA 5DO2A
chains in the Genus database with same CATH topology
1D7IA 3UQAA 3IHZA 2KE0A 2A3EA 2KO7A 4DRIA 1TCOC 1ZL1A 2O9OA 3ARUA 4DWSA 1J4HA 1OGGA 1LL7A 3KAGA 4U84A 2A3AA 1M5YA 1W9VA 1W1PA 1HJWA 2KR7A 4TNSA 1FKSA 4ITZA 3IKDA 3O5MA 4XAKA 1ZK6A 3O5EA 2RUQA 1D2KA 4U86A 1EYMA 3KCEA 2ZR4A 3NTPA 4N19A 4QT3A 1EQ3A 3KABA 1SYTA 1JNDA 1FAPA 3ARSA 3O5QA 2DSVA 5HW7A 1E6ZA 3ARPA 1BL4A 3CHDA 1D6OA 1LG1A 4PTMA 1JNSA 1WNOA 1IX5A 1FJDA 2ITKA 2Y78A 3NRKA 2XPAA 2AOSA 4IPXA 2MNTA 1W1TA 1KT0A 4FAPA 1HJVA 4DROA 2A3BA 4ML4A 3O5KA 4WIWA 1H0GA 2N87A 1UR9A 3PRDA 3AS3A 2D9FA 4MTVA 3UI4A 3O5JA 1NWRA 3JYMA 5B8IC 5GPGA 4DRHA 2M2AA 1FKKA 4DRMA 2KI3A 3WL0A 1ZB5A 2DG9A 1GPFA 2FDMA 5D75A 1O6IA 4ZPVR 3WD3A 4MGVA 3ARZA 4ZPWR 2PPPA 3WH0A 1EDQA 1EHNA 1ZBVA 1QPFA 4Q7NA 1FKLA 4DWSB 3AQUA 1NMVA 5GQBA 2K8IA 3FXYA 4TYOA 1GUVA 1JNEA 4JFKA 2MLZA 4J4NA 4DRPA 3ARWA 1X6LA 1JVWA 3MDYB 5DEZA 1JNTA 1WAWA 4MNKA 2OFNA 2XP4A 4Q22A 5BXJA 2G41A 3RMEA 1R9HA 3AS0A 3WL1A 2MF9A 4JFIA 4JFJA 3OA5A 4MAVA 4WKFA 2XPBA 4WKHA 1ZBCA 5HW8A 1L1PA 4URIA 1GOIA 1B6CA 2DT2A 1OWQA 3ARTA 4JYSA 3UI5A 1YATA 3UQBA 4IT4A 2F21A 4LGXA 3WIJA 3WQVA 2PBCA 2DT0A 4L72B 2DG4A 3CHEA 2JZVA 1LG2A 3PRBA 4ODMA 2PPNA 4MNLA 4ODRA 3UF8A 4KR0B 1FKBA 3AS2A 4ZS6A 4HBEA 1PBKA 2RUCA 4GGQA 1BKFA 3PR9A 4NSBA 4WK9A 4WKAA 4DWSC 4ODNA 4L3NA 4DRQA 3PRAA 4G50A 2DPEA 2XP8A 5HTGA 2B31A 1NWSA 1FKHA 4Z2IA 1C9HA 1E6NA 1LQ0A 5DIVA 1FKIA 2DSZA 3VAWA 3AROA 3KZ7A 1J4RA 1E6RA 2MPHA 2VN1A 5HUAA 1SR0A 1CTNA 4NZCA 4R0XA 2LKNA 1H0IA 2DG3A 4TX0A 4DRJA 1LL4A 3RM8A 3B9AA 2IF4A 2VCDA 4WJXA 1ITXA 2DSWA 3KAFA 4IQCA 4ODPA 5HWCA 1NSGA 3O5FA 1FKJA 1EIBA 1KFWA 3KADA 2XP9A 4HBOA 4J4OA 3NI6A 2WK2A 1D7JA 3B9DA 3FY1A 2LGOA 4IQ2A 2QF8A 4LAWA 1WB0A 2XP7A 1D7HA 5DITA 4BF8A 4C02B 1W1VA 1LL6A 3ARYA 5HKGA 1XRVA 3ALGA 1HXVA 2ZR5A 3UI6A 3RM4A 3IKGA 4AY1A 4P8VA 3IK8A 4Z2HA 2KGJA 3B9EA 2LPVA 4ODQA 3RM9A 1YW5A 1ZU8A 1HKIA 1P5QA 3I6CA 3WQWA 2DT3A 1HKJA 4ODLA 3G6MA 5HT1A 4DH0A 1W9PA 2ZQSA 3O5LA 4QZVB 1NWUA 4TW7A 3CH9A 3WD2A 3BXWA 4GIVA 4MNJA 2G8ZA 1KT1A 4S3JA 1FKRA 3O5GA 2A3CA 1NH6A 4S3KA 1E6PA 4DRKA 1LJYA 2M08A 4Z2JA 2RQSA 1K9TA 1RD6A 1PINA 1A7XA 3GPKA 1Q6HA 2PV1A 2YBUA 1FKGA 4W9OA 1W26A 5GPRA 1X6NA 3FAPA 1HJXA 1ROUA 2O92A 4TW6A 5I98A 4TW8A 1QZ2A 2Q5AA 1FKFA 2PV2A 3O5PA 3CGMA 2IUZA 4P8UA 4W5UA 4JFLA 2ESCA 5HBFA 1N1AA 2DT1A 3JXVA 3RGCA 2UZ5A 2F2DA 4G2PA 1ZCNA 1J4IA 3W4RA 1W9UA 1FFQA 2XP6A 2XP3A 1Q6UA 3O5DA 4O2TA 1E9LA 3ARXA 1NMWA 3KACA 2ZR6A 5DIUA 2RUDA 1XHGA 4NNRA 2DSUA 4FN2A 4DRNA 1QPLA 3ARQA 1NWTA 2ZQTA 2F4EA 1VF8A 5HWBA 4LAYA 3ODKA 3PA7A 4DZ3A 4DT4A 4KQZA 2WLYA 4LAVA 4ODKA 3JYJA 5HW6A 3EY6A 3CGNA 3WKZA 1F40A 5J6EA 1FD9A 1J6YA 2PV3A 2FKEA 3B8SA 2KFWA 3CHFA 3TDBA 5JH8A 4Z2KA 1HKMA 3TC5A 3O5IA 4P8XA 4QT2A 4W9QA 4W9PA 4ODOA 1F8AB 1Q1CA 4IT6A 1FKDA 2PI6A 4P8WA 3AS1A 2WM0A 2FAPA 2L2SA 4DWSD 2LJ4A 2ZQUA 3ALFA 4HARA 4MNMA 1Y0OA 4DIPA 2AWGA 4MSPA 1FFRA 2WLZA 3RFWA 1Q6IA 2XP5A 1ZBKA 1FKTA 1ZBWA 2OLHA 2RSEA 1W1YA 1TFVA 4R5EA 1T11A 3B7XA 3WD0A 3CZ8A 4JFMA 4QIBA 3WD1A 3QOKA 3UQIA 1HKKA 3O5RA 2YBTA 1OGBA 4ZPTR 2MLYA 3WD4A 2MLXA 1E15A 2PPOA 4DZ2A 1UR8A 2RURA 2M1IA 4Z2GA 3CHCA 5DF0A 3ARRA 4LAXA 2ZQVA 3O5OA 4U85A 1U79A 1ROTA 3TCZA 4Z2LA 3G6LA 3LUOA 3ARVA 3KAHA 3OOBA 3H9RB 4MPKA 3KAIA 5DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPL A;  2MLZ A;  2ZQT A;  4J4N A;  1D7I A;  2F4E A;  4DRP A;  5HKG A;  3UQA A;  1JVW A;  5HWB A;  3IHZ A;  2KE0 A;  1HXV A;  2ZR5 A;  4LAY A;  3MDY B;  3UI6 A;  3ODK A;  3IKG A;  3PA7 A;  1JNT A;  4DZ3 A;  4DT4 A;  2OFN A;  2XP4 A;  5BXJ A;  2KO7 A;  4DRI A;  1R9H A;  3IK8 A;  4LAV A;  1TCO C;  2KGJ A;  2LPV A;  4ODQ A;  4ODK A;  1YW5 A;  1J4H A;  2MF9 A;  3JYJ A;  1P5Q A;  3KAG A;  3I6C A;  4JFI A;  3EY6 A;  4U84 A;  5HW6 A;  3CGN A;  4JFJ A;  1M5Y A;  4ODL A;  2KR7 A;  2XPB A;  1F40 A;  5J6E A;  5HT1 A;  4DH0 A;  2ZQS A;  1FD9 A;  5HW8 A;  2PV3 A;  3O5L A;  4TNS A;  1J6Y A;  1L1P A;  1FKS A;  4TW7 A;  4ITZ A;  3IKD A;  2FKE A;  3O5M A;  1B6C A;  4JYS A;  2KFW A;  1YAT A;  4GIV A;  1ZK6 A;  3O5E A;  3UI5 A;  3UQB A;  3TDB A;  2F21 A;  2RUQ A;  1KT1 A;  3O5I A;  1EYM A;  4U86 A;  2PBC A;  3KCE A;  2ZR4 A;  4QT2 A;  3NTP A;  4N19 A;  3O5G A;  4QT3 A;  4W9Q A;  4W9P A;  1FKR A;  2DG4 A;  4ODO A;  1F8A B;  1Q1C A;  1EQ3 A;  3KAB A;  2JZV A;  4DRK A;  3PRB A;  4ODM A;  1FAP A;  2PPN A;  2M08 A;  3O5Q A;  1FKD A;  1FKB A;  4ODR A;  3UF8 A;  2RQS A;  5HW7 A;  1PIN A;  1BL4 A;  2FAP A;  1D6O A;  1A7X A;  1PBK A;  2L2S A;  2RUC A;  4GGQ A;  1BKF A;  1JNS A;  2LJ4 A;  3GPK A;  2ZQU A;  1Q6H A;  4ODN A;  2PV1 A;  4DRQ A;  1FJD A;  2ITK A;  1FKG A;  1Y0O A;  2Y78 A;  1W26 A;  2XPA A;  3NRK A;  4G50 A;  4W9O A;  2AWG A;  4MSP A;  2XP8 A;  4IPX A;  4DIP A;  3RFW A;  5HTG A;  2MNT A;  3FAP A;  1KT0 A;  1Q6I A;  1ROU A;  1FKH A;  4FAP A;  4TW6 A;  1C9H A;  5I98 A;  4TW8 A;  5DIV A;  1FKI A;  1QZ2 A;  2Q5A A;  3VAW A;  4DRO A;  1FKF A;  2PV2 A;  3KZ7 A;  1J4R A;  2XP5 A;  3O5P A;  2MPH A;  3CGM A;  3O5K A;  1FKT A;  2N87 A;  2VN1 A;  2RSE A;  5HUA A;  4JFL A;  4R0X A;  3PRD A;  1T11 A;  3B7X A;  4JFM A;  2LKN A;  1N1A A;  4QIB A;  2DG3 A;  2D9F A;  4TX0 A;  4DRJ A;  3UI4 A;  3UQI A;  2IF4 A;  2VCD A;  3JXV A;  3RGC A;  3O5R A;  3O5J A;  3TC5 A;  2UZ5 A;  3JYM A;  5B8I C;  2F2D A;  5GPG A;  4G2P A;  1ZCN A;  4DRH A;  3KAF A;  1J4I A;  2M2A A;  1FKK A;  2MLY A;  4IQC A;  4ODP A;  2MLX A;  2KI3 A;  4DRM A;  5HWC A;  1NSG A;  3O5F A;  1FKJ A;  2XP6 A;  2DG9 A;  2PPO A;  2XP3 A;  1Q6U A;  5D75 A;  4DZ2 A;  2RUR A;  3O5D A;  4O2T A;  2M1I A;  3KAD A;  4MGV A;  2XP9 A;  4J4O A;  1NMW A;  2PPP A;  2ZQV A;  1D7J A;  3NI6 A;  3KAC A;  2ZR6 A;  3O5O A;  1U79 A;  4LAX A;  4U85 A;  3WH0 A;  5DIU A;  1ROT A;  2LGO A;  4IQ2 A;  3TCZ A;  2RUD A;  4LAW A;  3LUO A;  1QPF A;  1FKL A;  3KAH A;  1NMV A;  3OOB A;  3H9R B;  2XP7 A;  2K8I A;  1D7H A;  5DIT A;  4BF8 A;  4NNR A;  3KAI A;  4TYO A;  4C02 B;  4FN2 A;  4DRN A;  4JFK A; 
#chains in the Genus database with same CATH topology
 1D7I A;  3UQA A;  3IHZ A;  2KE0 A;  2A3E A;  2KO7 A;  4DRI A;  1TCO C;  1ZL1 A;  2O9O A;  3ARU A;  4DWS A;  1J4H A;  1OGG A;  1LL7 A;  3KAG A;  4U84 A;  2A3A A;  3EIP A;  1M5Y A;  1W9V A;  1W1P A;  1HJW A;  2KR7 A;  4TNS A;  1FKS A;  4ITZ A;  3IKD A;  3O5M A;  4XAK A;  1ZK6 A;  3O5E A;  2PN0 A;  3BMB A;  2RUQ A;  1D2K A;  4U86 A;  1EYM A;  3KCE A;  2ZR4 A;  3NTP A;  4N19 A;  4QT3 A;  4UDM A;  1EQ3 A;  3KAB A;  1SYT A;  1JND A;  1FAP A;  3ARS A;  3O5Q A;  1GRJ A;  2DSV A;  5HW7 A;  1E6Z A;  2B5U B;  3ARP A;  1BL4 A;  3CHD A;  1D6O A;  1LG1 A;  4PTM A;  1JNS A;  1WNO A;  1IX5 A;  1FJD A;  2ITK A;  2Y78 A;  3NRK A;  2XPA A;  2AOS A;  4IPX A;  2MNT A;  1W1T A;  1KT0 A;  4FAP A;  1HJV A;  4DRO A;  2A3B A;  4ML4 A;  3O5K A;  1E44 A;  1H0G A;  4WIW A;  2N87 A;  1UR9 A;  3PRD A;  3AS3 A;  2D9F A;  4MTV A;  3UI4 A;  3O5J A;  1NWR A;  3JYM A;  5B8I C;  5GPG A;  4DRH A;  2M2A A;  1FKK A;  4DRM A;  2KI3 A;  3WL0 A;  1ZB5 A;  2DG9 A;  1GPF A;  2FDM A;  5D75 A;  1O6I A;  4ZPV R;  3WD3 A;  4MGV A;  3ARZ A;  4ZPW R;  2PPP A;  3WH0 A;  1EDQ A;  1EHN A;  1ZBV A;  1QPF A;  4Q7N A;  1FKL A;  4DWS B;  3AQU A;  1NMV A;  5GQB A;  2K8I A;  3FXY A;  4TYO A;  1GUV A;  1JNE A;  4JFK A;  2MLZ A;  4J4N A;  4DRP A;  3ARW A;  1X6L A;  1JVW A;  3MDY B;  5DEZ A;  1JNT A;  1WAW A;  4MNK A;  2OFN A;  2XP4 A;  4Q22 A;  5BXJ A;  2G41 A;  3RME A;  1R9H A;  3AS0 A;  3WL1 A;  2MF9 A;  4JFI A;  4JFJ A;  3OA5 A;  2EUL A;  4MAV A;  2XPB A;  4WKF A;  4WKH A;  1ZBC A;  5HW8 A;  1L1P A;  4URI A;  1GOI A;  1B6C A;  2DT2 A;  1OWQ A;  3ART A;  4JYS A;  3UI5 A;  1YAT A;  3UQB A;  4IT4 A;  2F21 A;  4LGX A;  3WIJ A;  3WQV A;  2PBC A;  2DT0 A;  4L72 B;  2DG4 A;  3CHE A;  2JZV A;  1LG2 A;  3PRB A;  4ODM A;  2PPN A;  4MNL A;  4ODR A;  3UF8 A;  4KR0 B;  1FKB A;  3AS2 A;  4ZS6 A;  4HBE A;  1PBK A;  2RUC A;  4GGQ A;  1BKF A;  3PR9 A;  4NSB A;  4WK9 A;  4WKA A;  4DWS C;  4ODN A;  4L3N A;  4DRQ A;  3PRA A;  4G50 A;  2DPE A;  2F23 A;  2XP8 A;  5HTG A;  2B31 A;  1NWS A;  1FKH A;  4Z2I A;  1C9H A;  1E6N A;  1LQ0 A;  5DIV A;  1FKI A;  2DSZ A;  3VAW A;  3ARO A;  3KZ7 A;  1J4R A;  1E6R A;  2MPH A;  2VN1 A;  5HUA A;  1SR0 A;  1CTN A;  4NZC A;  4R0X A;  2LKN A;  1H0I A;  2DG3 A;  4TX0 A;  4DRJ A;  1LL4 A;  3RM8 A;  3B9A A;  2IF4 A;  2VCD A;  4WJX A;  1ITX A;  2DSW A;  3KAF A;  4IQC A;  4ODP A;  5HWC A;  1NSG A;  3O5F A;  1FKJ A;  1EIB A;  1KFW A;  3KAD A;  2XP9 A;  4HBO A;  4J4O A;  3NI6 A;  2WK2 A;  1D7J A;  3B9D A;  3FY1 A;  2LGO A;  4IQ2 A;  2QF8 A;  4LAW A;  1WB0 A;  2XP7 A;  1D7H A;  5DIT A;  4BF8 A;  4C02 B;  1W1V A;  1LL6 A;  3ARY A;  5HKG A;  1XRV A;  3ALG A;  1HXV A;  2ZR5 A;  3UI6 A;  3RM4 A;  3IKG A;  4AY1 A;  4P8V A;  3IK8 A;  4Z2H A;  2KGJ A;  3B9E A;  2LPV A;  4ODQ A;  3RM9 A;  1YW5 A;  1ZU8 A;  1HKI A;  1P5Q A;  3I6C A;  3WQW A;  2DT3 A;  1HKJ A;  4ODL A;  3G6M A;  5HT1 A;  4DH0 A;  1W9P A;  2ZQS A;  3O5L A;  4QZV B;  1NWU A;  4TW7 A;  3CH9 A;  3WD2 A;  3BXW A;  4GIV A;  4MNJ A;  2G8Z A;  1KT1 A;  4S3J A;  1FKR A;  3O5G A;  2A3C A;  1NH6 A;  4S3K A;  1E6P A;  4DRK A;  1LJY A;  2M08 A;  4Z2J A;  2RQS A;  1K9T A;  1RD6 A;  1PIN A;  1A7X A;  3GTY X;  3GPK A;  1JCH B;  1Q6H A;  2PV1 A;  2YBU A;  1FKG A;  4W9O A;  1W26 A;  5GPR A;  1X6N A;  3FAP A;  1HJX A;  1ROU A;  2O92 A;  4TW6 A;  5I98 A;  4TW8 A;  1QZ2 A;  2Q5A A;  1FKF A;  2PV2 A;  3O5P A;  3CGM A;  2IUZ A;  4P8U A;  4W5U A;  2P4V A;  4JFL A;  2ESC A;  5HBF A;  1N1A A;  2DT1 A;  3JXV A;  3RGC A;  2UZ5 A;  2F2D A;  4G2P A;  1ZCN A;  1J4I A;  3W4R A;  1W9U A;  1FFQ A;  2XP6 A;  2XP3 A;  1Q6U A;  3O5D A;  4O2T A;  1E9L A;  3ARX A;  1NMW A;  3KAC A;  2ZR6 A;  5DIU A;  2RUD A;  1XHG A;  4NNR A;  2DSU A;  4FN2 A;  4DRN A;  1QPL A;  3ARQ A;  1NWT A;  2ZQT A;  2F4E A;  1VF8 A;  5HWB A;  4LAY A;  3ODK A;  3PA7 A;  4DZ3 A;  4DT4 A;  4KQZ A;  2WLY A;  4LAV A;  4ODK A;  3JYJ A;  5HW6 A;  3EY6 A;  3CGN A;  3WKZ A;  1F40 A;  5J6E A;  1FD9 A;  1J6Y A;  2PV3 A;  2FKE A;  3B8S A;  2KFW A;  3CHF A;  3TDB A;  5JH8 A;  4Z2K A;  1HKM A;  3TC5 A;  3O5I A;  4P8X A;  4QT2 A;  4W9Q A;  4W9P A;  4ODO A;  1F8A B;  1Q1C A;  4IT6 A;  1FKD A;  2PI6 A;  4P8W A;  3AS1 A;  2WM0 A;  2FAP A;  2L2S A;  4DWS D;  2LJ4 A;  2ZQU A;  3ALF A;  4HAR A;  4MNM A;  1Y0O A;  4DIP A;  2AWG A;  4MSP A;  1FFR A;  2WLZ A;  3RFW A;  2ETN A;  1Q6I A;  2XP5 A;  1ZBK A;  1FKT A;  1ZBW A;  2OLH A;  2RSE A;  1W1Y A;  1TFV A;  4R5E A;  1T11 A;  3B7X A;  3WD0 A;  3CZ8 A;  4JFM A;  4QIB A;  3WD1 A;  3GU0 A;  3QOK A;  3UQI A;  1HKK A;  3O5R A;  2YBT A;  1OGB A;  4ZPT R;  2MLY A;  3WD4 A;  2MLX A;  1E15 A;  2PPO A;  4DZ2 A;  1UR8 A;  2RUR A;  2M1I A;  4Z2G A;  3CHC A;  5DF0 A;  3ARR A;  4LAX A;  2ZQV A;  3O5O A;  4U85 A;  1U79 A;  1ROT A;  3TCZ A;  4Z2L A;  3G6L A;  3LUO A;  3ARV A;  3KAH A;  3OOB A;  3H9R B;  4MPK A;  3KAI A;  5DO2 A; 
#chains in the Genus database with same CATH homology
 1D7I A;  3UQA A;  3IHZ A;  2KE0 A;  2A3E A;  2KO7 A;  4DRI A;  1TCO C;  1ZL1 A;  2O9O A;  3ARU A;  4DWS A;  1J4H A;  1OGG A;  1LL7 A;  3KAG A;  4U84 A;  2A3A A;  1M5Y A;  1W9V A;  1W1P A;  1HJW A;  2KR7 A;  4TNS A;  1FKS A;  4ITZ A;  3IKD A;  3O5M A;  4XAK A;  1ZK6 A;  3O5E A;  2RUQ A;  1D2K A;  4U86 A;  1EYM A;  3KCE A;  2ZR4 A;  3NTP A;  4N19 A;  4QT3 A;  1EQ3 A;  3KAB A;  1SYT A;  1JND A;  1FAP A;  3ARS A;  3O5Q A;  2DSV A;  5HW7 A;  1E6Z A;  3ARP A;  1BL4 A;  3CHD A;  1D6O A;  1LG1 A;  4PTM A;  1JNS A;  1WNO A;  1IX5 A;  1FJD A;  2ITK A;  2Y78 A;  3NRK A;  2XPA A;  2AOS A;  4IPX A;  2MNT A;  1W1T A;  1KT0 A;  4FAP A;  1HJV A;  4DRO A;  2A3B A;  4ML4 A;  3O5K A;  4WIW A;  1H0G A;  2N87 A;  1UR9 A;  3PRD A;  3AS3 A;  2D9F A;  4MTV A;  3UI4 A;  3O5J A;  1NWR A;  3JYM A;  5B8I C;  5GPG A;  4DRH A;  2M2A A;  1FKK A;  4DRM A;  2KI3 A;  3WL0 A;  1ZB5 A;  2DG9 A;  1GPF A;  2FDM A;  5D75 A;  1O6I A;  4ZPV R;  3WD3 A;  4MGV A;  3ARZ A;  4ZPW R;  2PPP A;  3WH0 A;  1EDQ A;  1EHN A;  1ZBV A;  1QPF A;  4Q7N A;  1FKL A;  4DWS B;  3AQU A;  1NMV A;  5GQB A;  2K8I A;  3FXY A;  4TYO A;  1GUV A;  1JNE A;  4JFK A;  2MLZ A;  4J4N A;  4DRP A;  3ARW A;  1X6L A;  1JVW A;  3MDY B;  5DEZ A;  1JNT A;  1WAW A;  4MNK A;  2OFN A;  2XP4 A;  4Q22 A;  5BXJ A;  2G41 A;  3RME A;  1R9H A;  3AS0 A;  3WL1 A;  2MF9 A;  4JFI A;  4JFJ A;  3OA5 A;  4MAV A;  4WKF A;  2XPB A;  4WKH A;  1ZBC A;  5HW8 A;  1L1P A;  4URI A;  1GOI A;  1B6C A;  2DT2 A;  1OWQ A;  3ART A;  4JYS A;  3UI5 A;  1YAT A;  3UQB A;  4IT4 A;  2F21 A;  4LGX A;  3WIJ A;  3WQV A;  2PBC A;  2DT0 A;  4L72 B;  2DG4 A;  3CHE A;  2JZV A;  1LG2 A;  3PRB A;  4ODM A;  2PPN A;  4MNL A;  4ODR A;  3UF8 A;  4KR0 B;  1FKB A;  3AS2 A;  4ZS6 A;  4HBE A;  1PBK A;  2RUC A;  4GGQ A;  1BKF A;  3PR9 A;  4NSB A;  4WK9 A;  4WKA A;  4DWS C;  4ODN A;  4L3N A;  4DRQ A;  3PRA A;  4G50 A;  2DPE A;  2XP8 A;  5HTG A;  2B31 A;  1NWS A;  1FKH A;  4Z2I A;  1C9H A;  1E6N A;  1LQ0 A;  5DIV A;  1FKI A;  2DSZ A;  3VAW A;  3ARO A;  3KZ7 A;  1J4R A;  1E6R A;  2MPH A;  2VN1 A;  5HUA A;  1SR0 A;  1CTN A;  4NZC A;  4R0X A;  2LKN A;  1H0I A;  2DG3 A;  4TX0 A;  4DRJ A;  1LL4 A;  3RM8 A;  3B9A A;  2IF4 A;  2VCD A;  4WJX A;  1ITX A;  2DSW A;  3KAF A;  4IQC A;  4ODP A;  5HWC A;  1NSG A;  3O5F A;  1FKJ A;  1EIB A;  1KFW A;  3KAD A;  2XP9 A;  4HBO A;  4J4O A;  3NI6 A;  2WK2 A;  1D7J A;  3B9D A;  3FY1 A;  2LGO A;  4IQ2 A;  2QF8 A;  4LAW A;  1WB0 A;  2XP7 A;  1D7H A;  5DIT A;  4BF8 A;  4C02 B;  1W1V A;  1LL6 A;  3ARY A;  5HKG A;  1XRV A;  3ALG A;  1HXV A;  2ZR5 A;  3UI6 A;  3RM4 A;  3IKG A;  4AY1 A;  4P8V A;  3IK8 A;  4Z2H A;  2KGJ A;  3B9E A;  2LPV A;  4ODQ A;  3RM9 A;  1YW5 A;  1ZU8 A;  1HKI A;  1P5Q A;  3I6C A;  3WQW A;  2DT3 A;  1HKJ A;  4ODL A;  3G6M A;  5HT1 A;  4DH0 A;  1W9P A;  2ZQS A;  3O5L A;  4QZV B;  1NWU A;  4TW7 A;  3CH9 A;  3WD2 A;  3BXW A;  4GIV A;  4MNJ A;  2G8Z A;  1KT1 A;  4S3J A;  1FKR A;  3O5G A;  2A3C A;  1NH6 A;  4S3K A;  1E6P A;  4DRK A;  1LJY A;  2M08 A;  4Z2J A;  2RQS A;  1K9T A;  1RD6 A;  1PIN A;  1A7X A;  3GPK A;  1Q6H A;  2PV1 A;  2YBU A;  1FKG A;  4W9O A;  1W26 A;  5GPR A;  1X6N A;  3FAP A;  1HJX A;  1ROU A;  2O92 A;  4TW6 A;  5I98 A;  4TW8 A;  1QZ2 A;  2Q5A A;  1FKF A;  2PV2 A;  3O5P A;  3CGM A;  2IUZ A;  4P8U A;  4W5U A;  4JFL A;  2ESC A;  5HBF A;  1N1A A;  2DT1 A;  3JXV A;  3RGC A;  2UZ5 A;  2F2D A;  4G2P A;  1ZCN A;  1J4I A;  3W4R A;  1W9U A;  1FFQ A;  2XP6 A;  2XP3 A;  1Q6U A;  3O5D A;  4O2T A;  1E9L A;  3ARX A;  1NMW A;  3KAC A;  2ZR6 A;  5DIU A;  2RUD A;  1XHG A;  4NNR A;  2DSU A;  4FN2 A;  4DRN A;  1QPL A;  3ARQ A;  1NWT A;  2ZQT A;  2F4E A;  1VF8 A;  5HWB A;  4LAY A;  3ODK A;  3PA7 A;  4DZ3 A;  4DT4 A;  4KQZ A;  2WLY A;  4LAV A;  4ODK A;  3JYJ A;  5HW6 A;  3EY6 A;  3CGN A;  3WKZ A;  1F40 A;  5J6E A;  1FD9 A;  1J6Y A;  2PV3 A;  2FKE A;  3B8S A;  2KFW A;  3CHF A;  3TDB A;  5JH8 A;  4Z2K A;  1HKM A;  3TC5 A;  3O5I A;  4P8X A;  4QT2 A;  4W9Q A;  4W9P A;  4ODO A;  1F8A B;  1Q1C A;  4IT6 A;  1FKD A;  2PI6 A;  4P8W A;  3AS1 A;  2WM0 A;  2FAP A;  2L2S A;  4DWS D;  2LJ4 A;  2ZQU A;  3ALF A;  4HAR A;  4MNM A;  1Y0O A;  4DIP A;  2AWG A;  4MSP A;  1FFR A;  2WLZ A;  3RFW A;  1Q6I A;  2XP5 A;  1ZBK A;  1FKT A;  1ZBW A;  2OLH A;  2RSE A;  1W1Y A;  1TFV A;  4R5E A;  1T11 A;  3B7X A;  3WD0 A;  3CZ8 A;  4JFM A;  4QIB A;  3WD1 A;  3QOK A;  3UQI A;  1HKK A;  3O5R A;  2YBT A;  1OGB A;  4ZPT R;  2MLY A;  3WD4 A;  2MLX A;  1E15 A;  2PPO A;  4DZ2 A;  1UR8 A;  2RUR A;  2M1I A;  4Z2G A;  3CHC A;  5DF0 A;  3ARR A;  4LAX A;  2ZQV A;  3O5O A;  4U85 A;  1U79 A;  1ROT A;  3TCZ A;  4Z2L A;  3G6L A;  3LUO A;  3ARV A;  3KAH A;  3OOB A;  3H9R B;  4MPK A;  3KAI A;  5DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...