1FKKA

Atomic structure of fkbp12, an immunophilin binding protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
pubmed doi rcsb
molecule tags Rotamase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkkA00
1W26A 4DH0A 2RUQA 1D7JA 1A7XA 1FKGA 2XP5A 3UQBA 4IPXA 1J4HA 1KT1A 3O5JA 2OFNA 5DITA 5HW7A 3LUOA 3UI4A 2MNTA 2ZQUA 3UQIA 5DIUA 1HXVA 1JNTA 2ZR5A 1FKTA 4NNRA 4TW8A 4TYOA 2KI3A 3TC5A 2MPHA 3KCEA 2ZQSA 4W9QA 2UZ5A 1J4IA 4W9PA 4TX0A 1FKSA 5B8IC 3NI6A 5HT1A 4TW6A 3O5PA 3O5GA 1EQ3A 4DRHA 2RQSA 3O5QA 3MDYB 1FKHA 1QPLA 2RUDA 2PV3A 1F40A 4JFKA 1FKFA 3TCZA 1TCOC 3UF8A 4TNSA 1PINA 2KE0A 2VN1A 4BF8A 1D6OA 2N87A 5HW8A 2XP7A 2PPOA 1EYMA 5DIVA 2LPVA 5HTGA 2ZQTA 3KAGA 1FKBA 4U86A 2PBCA 2ZQVA 1FKKA 2ITKA 4LAVA 2F21A 1ZK6A 2PPNA 3H9RB 3PRDA 1QZ2A 2RUCA 3O5RA 4DROA 1BKFA 4JYSA 4O2TA 3JXVA 1PBKA 4G50A 1NMVA 2KO7A 4C02B 2JZVA 1L1PA 1FKDA 4DRIA 4TW7A 4U85A 3KABA 2VCDA 1J4RA 2XP8A 3ODKA 4ODKA 1Q1CA 1T11A 2AWGA 2MLXA 3FAPA 3KACA 4ITZA 1FD9A 4QT2A 2DG4A 2XPBA 3O5EA 1ROUA 4JFIA 1JNSA 3PA7A 2M2AA 2XP6A 5D75A 2XP3A 3OOBA 4MGVA 5I98A 4U84A 1Q6IA 4J4NA 3KAHA 3IKGA 2RSEA 3JYJA 4JFJA 4ODPA 4ODQA 3UI6A 1R9HA 4G2PA 1BL4A 2Y78A 3IHZA 2KGJA 3EY6A 1Y0OA 3GPKA 4ODOA 2Q5AA 3RGCA 1QPFA 2D9FA 2XP9A 4MSPA 4DRNA 4DZ2A 4FAPA 5HUAA 2PV1A 2PPPA 3O5LA 4DRJA 5J6EA 2XP4A 2M1IA 4R0XA 4DZ3A 3O5MA 4JFMA 1B6CA 2MLYA 1P5QA 1Q6HA 2FAPA 2IF4A 2LGOA 2F4EA 3I6CA 3O5IA 4LAXA 2K8IA 1JVWA 3O5KA 3KAIA 2M08A 4IQ2A 4N19A 1F8AB 2DG3A 2F2DA 2LKNA 3CGNA 2LJ4A 2KR7A 3O5OA 4QIBA 4DRQA 4GGQA 3CGMA 2ZR6A 4GIVA 3WH0A 3IKDA 2XPAA 4DRMA 4ODLA 3NRKA 1N1AA 4DT4A 5HW6A 1FKIA 1NMWA 2MF9A 4DRKA 1FKJA 1KT0A 1D7IA 4QT3A 2ZR4A 4ODMA 1J6YA 4W9OA 3JYMA 3UI5A 1Q6UA 1FKLA 3RFWA 2MLZA 5HWBA 3KADA 4IQCA 3KAFA 3PRBA 1M5YA 5HWCA 1FJDA 5BXJA 4DRPA 5GPGA 4DIPA 1ROTA 2L2SA 1FKRA 4LAYA 4JFLA 1NSGA 2KFWA 2RURA 3NTPA 3IK8A 3O5FA 3KZ7A 1YATA 1U79A 2DG9A 3TDBA 2FKEA 1C9HA 3B7XA 1ZCNA 1YW5A 4LAWA 5HKGA 3O5DA 4ODRA 4ODNA 1FAPA 4FN2A 4J4OA 3VAWA 3UQAA 1D7HA 2PV2A
chains in the Genus database with same CATH superfamily
2XP5A 1WAWA 1W9UA 3CHCA 2P4VA 2B5UB 3O5JA 3WKZA 5HW7A 2EULA 3UQIA 1JNTA 4NNRA 2A3AA 1J4IA 4W9PA 4TX0A 1FKSA 3AS0A 5B8IC 4KR0B 1EQ3A 3O5QA 1QPLA 4TNSA 4BF8A 1D6OA 2XP7A 3ARVA 1EYMA 4L72B 3KAGA 5HBFA 1FKKA 2DSVA 3RMEA 1ZK6A 2PPNA 4Z2GA 4NZCA 3WL1A 4O2TA 2FDMA 1H0GA 1NMVA 4P8WA 1JCHB 1FKDA 2DSUA 1EDQA 1ZB5A 2G41A 2MLXA 4ITZA 1FD9A 2XPBA 1JNSA 1D2KA 4U84A 3BXWA 4J4NA 1R9HA 1VF8A 2ETNA 2KGJA 3EY6A 1Y0OA 1QPFA 1W1YA 1HJXA 3GTYX 2XP4A 3WL0A 5J6EA 3O5MA 1B6CA 1FFRA 3FY1A 1WNOA 2IF4A 2DT3A 3I6CA 4LAXA 1W1VA 1E6NA 4NSBA 3ALFA 3CGNA 3O5OA 4DRQA 3ARZA 3CGMA 4DRMA 1N1AA 1FKIA 2DT0A 1NMWA 2MF9A 4DRKA 1KT0A 4QT3A 1J6YA 2ZR4A 4Z2HA 3RFWA 4Z2JA 1M5YA 5HWCA 4DRPA 1LL7A 3CH9A 4DIPA 2L2SA 3ARSA 1FKRA 1NSGA 3NTPA 4IT4A 1UR8A 3IK8A 4WKHA 3WD2A 1K9TA 1LG1A 2A3CA 4FN2A 3UQAA 1D7HA 1W26A 4P8UA 2RUQA 1D7JA 1A7XA 1FKGA 3AROA 1KT1A 2OFNA 1HJVA 1HXVA 2WM0A 4MNMA 3KCEA 3WIJA 4W9QA 2UZ5A 1NWTA 4ZS6A 1ZBCA 3ARUA 3NI6A 5HT1A 3G6MA 4URIA 2PV3A 1F40A 1FKFA 1TCOC 1PINA 2VN1A 5JH8A 2N87A 2PPOA 2ESCA 1HKIA 2F23A 4AY1A 4U86A 1HKMA 2F21A 1ZL1A 3H9RB 1IX5A 1BKFA 1PBKA 2KO7A 2JZVA 4DRIA 4KQZA 3CHEA 3KABA 1T11A 4QT2A 3BMBA 4MNJA 2DG4A 1HKJA 1E6ZA 1JNDA 3PR9A 1KFWA 4DWSC 2XP6A 5D75A 5I98A 1Q6IA 1SR0A 2RSEA 4JFJA 3B8SA 4G2PA 1BL4A 3IHZA 2OLHA 3RGCA 1GOIA 1NWSA 2D9FA 4MSPA 2PV1A 3ARQA 3O5LA 4DRJA 2M1IA 3ARTA 3CHFA 4XAKA 3ARYA 4R0XA 2MLYA 2LGOA 2F4EA 3O5IA 1JVWA 3KAIA 4IQ2A 2WLZA 2DG3A 3WQWA 5DO2A 3B9DA 4UDMA 2ZR6A 4GIVA 1TFVA 3ARXA 3ARRA 4ODLA 5HW6A 1ZU8A 3G6LA 1D7IA 4W9OA 3UI5A 1Q6UA 1SYTA 5HWBA 1FJDA 2O92A 1E15A 4DWSD 4WKAA 4LAYA 1JNEA 2RURA 3B9EA 2PN0A 4DWSB 1ZCNA 3O5DA 3VAWA 4J4OA 4DH0A 3AS1A 1J4HA 1E44A 1HJWA 4MTVA 5DITA 3ARWA 2ZQUA 5DIUA 2AOSA 1ZBVA 2KI3A 2MPHA 1H0IA 4WKFA 1NH6A 3O5PA 4DRHA 2RQSA 4DWSA 3MDYB 3B9AA 1E6PA 4JFKA 3TCZA 3UF8A 2O9OA 2KE0A 5DEZA 5HW8A 3RM4A 5DIVA 2LPVA 5HTGA 1FKBA 3AS2A 2PBCA 2QF8A 1X6LA 1QZ2A 2RUCA 3GU0A 3O5RA 4DROA 2B31A 4Q7NA 3JXVA 4G50A 4C02B 1OWQA 1X6NA 4HARA 4TW7A 4U85A 2VCDA 2XP8A 3ODKA 1W1TA 4HBEA 4PTMA 4WJXA 3KACA 3W4RA 3QOKA 3O5EA 1LL4A 1EIBA 2DT2A 4MGVA 4ODPA 4ZPWR 4ZPTR 3WD3A 4ODOA 4MNLA 5HUAA 3OA5A 4DZ3A 4JFMA 1NWRA 2FAPA 1Q6HA 3ARPA 3O5KA 2M08A 4N19A 1F8AB 2F2DA 2DSWA 4QIBA 4GGQA 3FXYA 4P8VA 3WH0A 3CHDA 3NRKA 4Q22A 1O6IA 3RM9A 1FKJA 4S3JA 4ODMA 2YBUA 2G8ZA 1FKLA 4R5EA 2MLZA 3CZ8A 4IQCA 3KAFA 4Z2KA 1E9LA 3WD4A 3RM8A 1UR9A 1ROTA 4JFLA 2KFWA 2PI6A 3O5FA 2DG9A 1GPFA 2FKEA 1C9HA 3B7XA 1YW5A 4L3NA 5HKGA 4ODRA 4ODNA 1FAPA 3IKDA 2PV2A 3AQUA 1E6RA 4MNKA 3WD1A 1CTNA 3UQBA 4IPXA 4ZPVR 1W1PA 3LUOA 3UI4A 2MNTA 1OGBA 1FKTA 2ZR5A 4TW8A 4TYOA 4WK9A 3TC5A 1LL6A 2ZQSA 3EIPA 4MPKA 4TW6A 3O5GA 1ZBWA 4Z2IA 1FKHA 2RUDA 2YBTA 2A3BA 2ZQTA 2ZQVA 2ITKA 4LAVA 3PRDA 4JYSA 4Z2LA 2IUZA 4QZVB 1L1PA 1J4RA 4ODKA 1Q1CA 2AWGA 3FAPA 1GRJA 4WIWA 3ALGA 1ROUA 4JFIA 5GQBA 3AS3A 3PA7A 2M2AA 1OGGA 4LGXA 2XP3A 1W9PA 3OOBA 1LG2A 2A3EA 3PRAA 3KAHA 3IKGA 3JYJA 4ODQA 3UI6A 1RD6A 1LQ0A 2Y78A 3GPKA 1EHNA 2DSZA 1ZBKA 2Q5AA 4DRNA 2XP9A 4DZ2A 4FAPA 2PPPA 5DF0A 1P5QA 1XRVA 1WB0A 2K8IA 1NWUA 1HKKA 2LKNA 2LJ4A 2KR7A 4IT6A 4MAVA 1LJYA 2XPAA 4P8XA 3WQVA 4ML4A 4DT4A 2WLYA 3JYMA 3KADA 1W9VA 3PRBA 5BXJA 5GPGA 1XHGA 1ITXA 1GUVA 3KZ7A 2WK2A 1YATA 2DPEA 3WD0A 1U79A 3TDBA 1FFQA 4LAWA 5GPRA 4S3KA 2DT1A 4W5UA 4HBOA
chains in the Genus database with same CATH topology
2XP5A 1WAWA 1W9UA 3CHCA 3O5JA 3WKZA 5HW7A 3UQIA 1JNTA 4NNRA 2A3AA 1J4IA 4W9PA 4TX0A 1FKSA 3AS0A 5B8IC 4KR0B 1EQ3A 3O5QA 1QPLA 4TNSA 4BF8A 1D6OA 2XP7A 3ARVA 1EYMA 4L72B 3KAGA 5HBFA 1FKKA 2DSVA 3RMEA 1ZK6A 2PPNA 4Z2GA 4NZCA 3WL1A 4O2TA 2FDMA 1H0GA 1NMVA 4P8WA 1FKDA 2DSUA 1EDQA 1ZB5A 2G41A 2MLXA 4ITZA 1FD9A 2XPBA 1JNSA 1D2KA 4U84A 3BXWA 4J4NA 1R9HA 1VF8A 2KGJA 3EY6A 1Y0OA 1QPFA 1W1YA 1HJXA 5J6EA 2XP4A 3WL0A 3O5MA 1B6CA 1FFRA 3FY1A 1WNOA 2IF4A 2DT3A 3I6CA 4LAXA 1W1VA 1E6NA 4NSBA 3ALFA 3CGNA 3O5OA 4DRQA 3ARZA 3CGMA 4DRMA 1N1AA 1FKIA 2DT0A 1NMWA 2MF9A 4DRKA 1KT0A 4QT3A 1J6YA 2ZR4A 4Z2HA 3RFWA 4Z2JA 1M5YA 5HWCA 4DRPA 1LL7A 3CH9A 4DIPA 2L2SA 3ARSA 1FKRA 1NSGA 3NTPA 4IT4A 1UR8A 3IK8A 4WKHA 3WD2A 1K9TA 1LG1A 2A3CA 4FN2A 3UQAA 1D7HA 1W26A 4P8UA 2RUQA 1D7JA 1A7XA 1FKGA 3AROA 1KT1A 2OFNA 1HJVA 1HXVA 2WM0A 4MNMA 3KCEA 3WIJA 4W9QA 2UZ5A 1NWTA 4ZS6A 1ZBCA 3ARUA 3NI6A 5HT1A 3G6MA 4URIA 2PV3A 1F40A 1FKFA 1TCOC 1PINA 2VN1A 5JH8A 2N87A 2PPOA 2ESCA 1HKIA 4AY1A 4U86A 1HKMA 2F21A 1ZL1A 3H9RB 1IX5A 1BKFA 1PBKA 2KO7A 2JZVA 4DRIA 4KQZA 3CHEA 3KABA 1T11A 4QT2A 4MNJA 2DG4A 1HKJA 1E6ZA 1JNDA 3PR9A 1KFWA 4DWSC 2XP6A 5D75A 5I98A 1Q6IA 1SR0A 2RSEA 4JFJA 3B8SA 4G2PA 1BL4A 3IHZA 2OLHA 3RGCA 1GOIA 1NWSA 2D9FA 4MSPA 2PV1A 3ARQA 3O5LA 4DRJA 2M1IA 3ARTA 3CHFA 4XAKA 3ARYA 4R0XA 2MLYA 2LGOA 2F4EA 3O5IA 1JVWA 3KAIA 4IQ2A 2WLZA 2DG3A 3WQWA 5DO2A 3B9DA 2ZR6A 4GIVA 1TFVA 3ARXA 3ARRA 4ODLA 5HW6A 1ZU8A 3G6LA 1D7IA 4W9OA 3UI5A 1Q6UA 1SYTA 5HWBA 1FJDA 2O92A 1E15A 4DWSD 4WKAA 4LAYA 1JNEA 2RURA 3B9EA 4DWSB 1ZCNA 3O5DA 3VAWA 4J4OA 4DH0A 3AS1A 1J4HA 1HJWA 4MTVA 5DITA 3ARWA 2ZQUA 5DIUA 2AOSA 1ZBVA 2KI3A 2MPHA 1H0IA 4WKFA 1NH6A 3O5PA 4DRHA 2RQSA 4DWSA 3MDYB 3B9AA 1E6PA 4JFKA 3TCZA 3UF8A 2O9OA 2KE0A 5DEZA 5HW8A 3RM4A 5DIVA 2LPVA 5HTGA 1FKBA 3AS2A 2PBCA 2QF8A 1X6LA 1QZ2A 2RUCA 3O5RA 4DROA 2B31A 4Q7NA 3JXVA 4G50A 4C02B 1OWQA 1X6NA 4HARA 4TW7A 4U85A 2VCDA 2XP8A 3ODKA 1W1TA 4HBEA 4PTMA 4WJXA 3KACA 3W4RA 3QOKA 3O5EA 1LL4A 1EIBA 2DT2A 4MGVA 4ODPA 4ZPWR 4ZPTR 3WD3A 4ODOA 4MNLA 5HUAA 3OA5A 4DZ3A 4JFMA 1NWRA 2FAPA 1Q6HA 3ARPA 3O5KA 2M08A 4N19A 1F8AB 2F2DA 2DSWA 4QIBA 4GGQA 3FXYA 4P8VA 3WH0A 3CHDA 3NRKA 4Q22A 1O6IA 3RM9A 1FKJA 4S3JA 4ODMA 2YBUA 2G8ZA 1FKLA 4R5EA 2MLZA 3CZ8A 4IQCA 3KAFA 4Z2KA 1E9LA 3WD4A 3RM8A 1UR9A 1ROTA 4JFLA 2KFWA 2PI6A 3O5FA 2DG9A 1GPFA 2FKEA 1C9HA 3B7XA 1YW5A 4L3NA 5HKGA 4ODRA 4ODNA 1FAPA 3IKDA 2PV2A 3AQUA 1E6RA 4MNKA 3WD1A 1CTNA 3UQBA 4IPXA 4ZPVR 1W1PA 3LUOA 3UI4A 2MNTA 1OGBA 1FKTA 2ZR5A 4TW8A 4TYOA 4WK9A 3TC5A 1LL6A 2ZQSA 4MPKA 4TW6A 3O5GA 1ZBWA 4Z2IA 1FKHA 2RUDA 2YBTA 2A3BA 2ZQTA 2ZQVA 2ITKA 4LAVA 3PRDA 4JYSA 4Z2LA 2IUZA 4QZVB 1L1PA 1J4RA 4ODKA 1Q1CA 2AWGA 3FAPA 4WIWA 3ALGA 1ROUA 4JFIA 5GQBA 3AS3A 3PA7A 2M2AA 1OGGA 4LGXA 2XP3A 1W9PA 3OOBA 1LG2A 2A3EA 3PRAA 3KAHA 3IKGA 3JYJA 4ODQA 3UI6A 1RD6A 1LQ0A 2Y78A 3GPKA 1EHNA 2DSZA 1ZBKA 2Q5AA 4DRNA 2XP9A 4DZ2A 4FAPA 2PPPA 5DF0A 1P5QA 1XRVA 1WB0A 2K8IA 1NWUA 1HKKA 2LKNA 2LJ4A 2KR7A 4IT6A 4MAVA 1LJYA 2XPAA 4P8XA 3WQVA 4ML4A 4DT4A 2WLYA 3JYMA 3KADA 1W9VA 3PRBA 5BXJA 5GPGA 1XHGA 1ITXA 1GUVA 3KZ7A 2WK2A 1YATA 2DPEA 3WD0A 1U79A 3TDBA 1FFQA 4LAWA 5GPRA 4S3KA 2DT1A 4W5UA 4HBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W26 A;  4DH0 A;  2RUQ A;  1D7J A;  1A7X A;  1FKG A;  2XP5 A;  3UQB A;  4IPX A;  1J4H A;  1KT1 A;  3O5J A;  2OFN A;  5DIT A;  5HW7 A;  3LUO A;  3UI4 A;  2MNT A;  2ZQU A;  3UQI A;  5DIU A;  1HXV A;  1JNT A;  2ZR5 A;  1FKT A;  4NNR A;  4TW8 A;  4TYO A;  2KI3 A;  3TC5 A;  2MPH A;  3KCE A;  2ZQS A;  4W9Q A;  2UZ5 A;  1J4I A;  4W9P A;  4TX0 A;  1FKS A;  5B8I C;  3NI6 A;  5HT1 A;  4TW6 A;  3O5P A;  3O5G A;  1EQ3 A;  4DRH A;  2RQS A;  3O5Q A;  3MDY B;  1FKH A;  1QPL A;  2RUD A;  2PV3 A;  1F40 A;  4JFK A;  1FKF A;  3TCZ A;  1TCO C;  3UF8 A;  4TNS A;  1PIN A;  2KE0 A;  2VN1 A;  4BF8 A;  1D6O A;  2N87 A;  5HW8 A;  2XP7 A;  2PPO A;  1EYM A;  5DIV A;  2LPV A;  5HTG A;  2ZQT A;  3KAG A;  1FKB A;  4U86 A;  2PBC A;  2ZQV A;  1FKK A;  2ITK A;  4LAV A;  2F21 A;  1ZK6 A;  2PPN A;  3H9R B;  3PRD A;  1QZ2 A;  2RUC A;  3O5R A;  4DRO A;  1BKF A;  4JYS A;  4O2T A;  3JXV A;  1PBK A;  4G50 A;  1NMV A;  2KO7 A;  4C02 B;  2JZV A;  1L1P A;  1FKD A;  4DRI A;  4TW7 A;  4U85 A;  3KAB A;  2VCD A;  1J4R A;  2XP8 A;  3ODK A;  4ODK A;  1Q1C A;  1T11 A;  2AWG A;  2MLX A;  3FAP A;  3KAC A;  4ITZ A;  1FD9 A;  4QT2 A;  2DG4 A;  2XPB A;  3O5E A;  1ROU A;  4JFI A;  1JNS A;  3PA7 A;  2M2A A;  2XP6 A;  5D75 A;  2XP3 A;  3OOB A;  4MGV A;  5I98 A;  4U84 A;  1Q6I A;  4J4N A;  3KAH A;  3IKG A;  2RSE A;  3JYJ A;  4JFJ A;  4ODP A;  4ODQ A;  3UI6 A;  1R9H A;  4G2P A;  1BL4 A;  2Y78 A;  3IHZ A;  2KGJ A;  3EY6 A;  1Y0O A;  3GPK A;  4ODO A;  2Q5A A;  3RGC A;  1QPF A;  2D9F A;  2XP9 A;  4MSP A;  4DRN A;  4DZ2 A;  4FAP A;  5HUA A;  2PV1 A;  2PPP A;  3O5L A;  4DRJ A;  5J6E A;  2XP4 A;  2M1I A;  4R0X A;  4DZ3 A;  3O5M A;  4JFM A;  1B6C A;  2MLY A;  1P5Q A;  1Q6H A;  2FAP A;  2IF4 A;  2LGO A;  2F4E A;  3I6C A;  3O5I A;  4LAX A;  2K8I A;  1JVW A;  3O5K A;  3KAI A;  2M08 A;  4IQ2 A;  4N19 A;  1F8A B;  2DG3 A;  2F2D A;  2LKN A;  3CGN A;  2LJ4 A;  2KR7 A;  3O5O A;  4QIB A;  4DRQ A;  4GGQ A;  3CGM A;  2ZR6 A;  4GIV A;  3WH0 A;  3IKD A;  2XPA A;  4DRM A;  4ODL A;  3NRK A;  1N1A A;  4DT4 A;  5HW6 A;  1FKI A;  1NMW A;  2MF9 A;  4DRK A;  1FKJ A;  1KT0 A;  1D7I A;  4QT3 A;  2ZR4 A;  4ODM A;  1J6Y A;  4W9O A;  3JYM A;  3UI5 A;  1Q6U A;  1FKL A;  3RFW A;  2MLZ A;  5HWB A;  3KAD A;  4IQC A;  3KAF A;  3PRB A;  1M5Y A;  5HWC A;  1FJD A;  5BXJ A;  4DRP A;  5GPG A;  4DIP A;  1ROT A;  2L2S A;  1FKR A;  4LAY A;  4JFL A;  1NSG A;  2KFW A;  2RUR A;  3NTP A;  3IK8 A;  3O5F A;  3KZ7 A;  1YAT A;  1U79 A;  2DG9 A;  3TDB A;  2FKE A;  1C9H A;  3B7X A;  1ZCN A;  1YW5 A;  4LAW A;  5HKG A;  3O5D A;  4ODR A;  4ODN A;  1FAP A;  4FN2 A;  4J4O A;  3VAW A;  3UQA A;  1D7H A;  2PV2 A; 
#chains in the Genus database with same CATH topology
 2XP5 A;  1WAW A;  1W9U A;  3CHC A;  2P4V A;  2B5U B;  3O5J A;  3WKZ A;  5HW7 A;  2EUL A;  3UQI A;  1JNT A;  4NNR A;  2A3A A;  1J4I A;  4W9P A;  4TX0 A;  1FKS A;  3AS0 A;  5B8I C;  4KR0 B;  1EQ3 A;  3O5Q A;  1QPL A;  4TNS A;  4BF8 A;  1D6O A;  2XP7 A;  3ARV A;  1EYM A;  4L72 B;  3KAG A;  5HBF A;  1FKK A;  2DSV A;  3RME A;  1ZK6 A;  2PPN A;  4Z2G A;  4NZC A;  3WL1 A;  4O2T A;  2FDM A;  1H0G A;  1NMV A;  4P8W A;  1JCH B;  1FKD A;  2DSU A;  1EDQ A;  1ZB5 A;  2G41 A;  2MLX A;  4ITZ A;  1FD9 A;  2XPB A;  1JNS A;  1D2K A;  4U84 A;  3BXW A;  4J4N A;  1R9H A;  1VF8 A;  2ETN A;  2KGJ A;  3EY6 A;  1Y0O A;  1QPF A;  1W1Y A;  1HJX A;  3GTY X;  2XP4 A;  3WL0 A;  5J6E A;  3O5M A;  1B6C A;  1FFR A;  3FY1 A;  1WNO A;  2IF4 A;  2DT3 A;  3I6C A;  4LAX A;  1W1V A;  1E6N A;  4NSB A;  3ALF A;  3CGN A;  3O5O A;  4DRQ A;  3ARZ A;  3CGM A;  4DRM A;  1N1A A;  1FKI A;  2DT0 A;  1NMW A;  2MF9 A;  4DRK A;  1KT0 A;  4QT3 A;  1J6Y A;  2ZR4 A;  4Z2H A;  3RFW A;  4Z2J A;  1M5Y A;  5HWC A;  4DRP A;  1LL7 A;  3CH9 A;  4DIP A;  2L2S A;  3ARS A;  1FKR A;  1NSG A;  3NTP A;  4IT4 A;  1UR8 A;  3IK8 A;  4WKH A;  3WD2 A;  1K9T A;  1LG1 A;  2A3C A;  4FN2 A;  3UQA A;  1D7H A;  1W26 A;  4P8U A;  2RUQ A;  1D7J A;  1A7X A;  1FKG A;  3ARO A;  1KT1 A;  2OFN A;  1HJV A;  1HXV A;  2WM0 A;  4MNM A;  3KCE A;  3WIJ A;  4W9Q A;  2UZ5 A;  1NWT A;  4ZS6 A;  1ZBC A;  3ARU A;  3NI6 A;  5HT1 A;  3G6M A;  4URI A;  2PV3 A;  1F40 A;  1FKF A;  1TCO C;  1PIN A;  2VN1 A;  5JH8 A;  2N87 A;  2PPO A;  2ESC A;  1HKI A;  2F23 A;  4AY1 A;  4U86 A;  1HKM A;  2F21 A;  1ZL1 A;  3H9R B;  1IX5 A;  1BKF A;  1PBK A;  2KO7 A;  2JZV A;  4DRI A;  4KQZ A;  3CHE A;  3KAB A;  1T11 A;  4QT2 A;  3BMB A;  4MNJ A;  2DG4 A;  1HKJ A;  1E6Z A;  1JND A;  3PR9 A;  1KFW A;  4DWS C;  2XP6 A;  5D75 A;  5I98 A;  1Q6I A;  1SR0 A;  2RSE A;  4JFJ A;  3B8S A;  4G2P A;  1BL4 A;  3IHZ A;  2OLH A;  3RGC A;  1GOI A;  1NWS A;  2D9F A;  4MSP A;  2PV1 A;  3ARQ A;  3O5L A;  4DRJ A;  2M1I A;  3ART A;  3CHF A;  4XAK A;  3ARY A;  4R0X A;  2MLY A;  2LGO A;  2F4E A;  3O5I A;  1JVW A;  3KAI A;  4IQ2 A;  2WLZ A;  2DG3 A;  3WQW A;  5DO2 A;  3B9D A;  4UDM A;  2ZR6 A;  4GIV A;  1TFV A;  3ARX A;  3ARR A;  4ODL A;  5HW6 A;  1ZU8 A;  3G6L A;  1D7I A;  4W9O A;  3UI5 A;  1Q6U A;  1SYT A;  5HWB A;  1FJD A;  2O92 A;  1E15 A;  4DWS D;  4WKA A;  4LAY A;  1JNE A;  2RUR A;  3B9E A;  2PN0 A;  4DWS B;  1ZCN A;  3O5D A;  3VAW A;  4J4O A;  4DH0 A;  3AS1 A;  1J4H A;  1E44 A;  1HJW A;  4MTV A;  5DIT A;  3ARW A;  2ZQU A;  5DIU A;  2AOS A;  1ZBV A;  2KI3 A;  2MPH A;  1H0I A;  4WKF A;  1NH6 A;  3O5P A;  4DRH A;  2RQS A;  4DWS A;  3MDY B;  3B9A A;  1E6P A;  4JFK A;  3TCZ A;  3UF8 A;  2O9O A;  2KE0 A;  5DEZ A;  5HW8 A;  3RM4 A;  5DIV A;  2LPV A;  5HTG A;  1FKB A;  3AS2 A;  2PBC A;  2QF8 A;  1X6L A;  1QZ2 A;  2RUC A;  3GU0 A;  3O5R A;  4DRO A;  2B31 A;  4Q7N A;  3JXV A;  4G50 A;  4C02 B;  1OWQ A;  1X6N A;  4HAR A;  4TW7 A;  4U85 A;  2VCD A;  2XP8 A;  3ODK A;  1W1T A;  4HBE A;  4PTM A;  4WJX A;  3KAC A;  3W4R A;  3QOK A;  3O5E A;  1LL4 A;  1EIB A;  2DT2 A;  4MGV A;  4ODP A;  4ZPW R;  4ZPT R;  3WD3 A;  4ODO A;  4MNL A;  5HUA A;  3OA5 A;  4DZ3 A;  4JFM A;  1NWR A;  2FAP A;  1Q6H A;  3ARP A;  3O5K A;  2M08 A;  4N19 A;  1F8A B;  2F2D A;  2DSW A;  4QIB A;  4GGQ A;  3FXY A;  4P8V A;  3WH0 A;  3CHD A;  3NRK A;  4Q22 A;  1O6I A;  3RM9 A;  1FKJ A;  4S3J A;  4ODM A;  2YBU A;  2G8Z A;  1FKL A;  4R5E A;  2MLZ A;  3CZ8 A;  4IQC A;  3KAF A;  4Z2K A;  1E9L A;  3WD4 A;  3RM8 A;  1UR9 A;  1ROT A;  4JFL A;  2KFW A;  2PI6 A;  3O5F A;  2DG9 A;  1GPF A;  2FKE A;  1C9H A;  3B7X A;  1YW5 A;  4L3N A;  5HKG A;  4ODR A;  4ODN A;  1FAP A;  3IKD A;  2PV2 A;  3AQU A;  1E6R A;  4MNK A;  3WD1 A;  1CTN A;  3UQB A;  4IPX A;  4ZPV R;  1W1P A;  3LUO A;  3UI4 A;  2MNT A;  1OGB A;  1FKT A;  2ZR5 A;  4TW8 A;  4TYO A;  4WK9 A;  3TC5 A;  1LL6 A;  2ZQS A;  3EIP A;  4MPK A;  4TW6 A;  3O5G A;  1ZBW A;  4Z2I A;  1FKH A;  2RUD A;  2YBT A;  2A3B A;  2ZQT A;  2ZQV A;  2ITK A;  4LAV A;  3PRD A;  4JYS A;  4Z2L A;  2IUZ A;  4QZV B;  1L1P A;  1J4R A;  4ODK A;  1Q1C A;  2AWG A;  3FAP A;  1GRJ A;  4WIW A;  3ALG A;  1ROU A;  4JFI A;  5GQB A;  3AS3 A;  3PA7 A;  2M2A A;  1OGG A;  4LGX A;  2XP3 A;  1W9P A;  3OOB A;  1LG2 A;  2A3E A;  3PRA A;  3KAH A;  3IKG A;  3JYJ A;  4ODQ A;  3UI6 A;  1RD6 A;  1LQ0 A;  2Y78 A;  3GPK A;  1EHN A;  2DSZ A;  1ZBK A;  2Q5A A;  4DRN A;  2XP9 A;  4DZ2 A;  4FAP A;  2PPP A;  5DF0 A;  1P5Q A;  1XRV A;  1WB0 A;  2K8I A;  1NWU A;  1HKK A;  2LKN A;  2LJ4 A;  2KR7 A;  4IT6 A;  4MAV A;  1LJY A;  2XPA A;  4P8X A;  3WQV A;  4ML4 A;  4DT4 A;  2WLY A;  3JYM A;  3KAD A;  1W9V A;  3PRB A;  5BXJ A;  5GPG A;  1XHG A;  1ITX A;  1GUV A;  3KZ7 A;  2WK2 A;  1YAT A;  2DPE A;  3WD0 A;  1U79 A;  3TDB A;  1FFQ A;  4LAW A;  5GPR A;  4S3K A;  2DT1 A;  4W5U A;  4HBO A; 
#chains in the Genus database with same CATH homology
 2XP5 A;  1WAW A;  1W9U A;  3CHC A;  3O5J A;  3WKZ A;  5HW7 A;  3UQI A;  1JNT A;  4NNR A;  2A3A A;  1J4I A;  4W9P A;  4TX0 A;  1FKS A;  3AS0 A;  5B8I C;  4KR0 B;  1EQ3 A;  3O5Q A;  1QPL A;  4TNS A;  4BF8 A;  1D6O A;  2XP7 A;  3ARV A;  1EYM A;  4L72 B;  3KAG A;  5HBF A;  1FKK A;  2DSV A;  3RME A;  1ZK6 A;  2PPN A;  4Z2G A;  4NZC A;  3WL1 A;  4O2T A;  2FDM A;  1H0G A;  1NMV A;  4P8W A;  1FKD A;  2DSU A;  1EDQ A;  1ZB5 A;  2G41 A;  2MLX A;  4ITZ A;  1FD9 A;  2XPB A;  1JNS A;  1D2K A;  4U84 A;  3BXW A;  4J4N A;  1R9H A;  1VF8 A;  2KGJ A;  3EY6 A;  1Y0O A;  1QPF A;  1W1Y A;  1HJX A;  5J6E A;  2XP4 A;  3WL0 A;  3O5M A;  1B6C A;  1FFR A;  3FY1 A;  1WNO A;  2IF4 A;  2DT3 A;  3I6C A;  4LAX A;  1W1V A;  1E6N A;  4NSB A;  3ALF A;  3CGN A;  3O5O A;  4DRQ A;  3ARZ A;  3CGM A;  4DRM A;  1N1A A;  1FKI A;  2DT0 A;  1NMW A;  2MF9 A;  4DRK A;  1KT0 A;  4QT3 A;  1J6Y A;  2ZR4 A;  4Z2H A;  3RFW A;  4Z2J A;  1M5Y A;  5HWC A;  4DRP A;  1LL7 A;  3CH9 A;  4DIP A;  2L2S A;  3ARS A;  1FKR A;  1NSG A;  3NTP A;  4IT4 A;  1UR8 A;  3IK8 A;  4WKH A;  3WD2 A;  1K9T A;  1LG1 A;  2A3C A;  4FN2 A;  3UQA A;  1D7H A;  1W26 A;  4P8U A;  2RUQ A;  1D7J A;  1A7X A;  1FKG A;  3ARO A;  1KT1 A;  2OFN A;  1HJV A;  1HXV A;  2WM0 A;  4MNM A;  3KCE A;  3WIJ A;  4W9Q A;  2UZ5 A;  1NWT A;  4ZS6 A;  1ZBC A;  3ARU A;  3NI6 A;  5HT1 A;  3G6M A;  4URI A;  2PV3 A;  1F40 A;  1FKF A;  1TCO C;  1PIN A;  2VN1 A;  5JH8 A;  2N87 A;  2PPO A;  2ESC A;  1HKI A;  4AY1 A;  4U86 A;  1HKM A;  2F21 A;  1ZL1 A;  3H9R B;  1IX5 A;  1BKF A;  1PBK A;  2KO7 A;  2JZV A;  4DRI A;  4KQZ A;  3CHE A;  3KAB A;  1T11 A;  4QT2 A;  4MNJ A;  2DG4 A;  1HKJ A;  1E6Z A;  1JND A;  3PR9 A;  1KFW A;  4DWS C;  2XP6 A;  5D75 A;  5I98 A;  1Q6I A;  1SR0 A;  2RSE A;  4JFJ A;  3B8S A;  4G2P A;  1BL4 A;  3IHZ A;  2OLH A;  3RGC A;  1GOI A;  1NWS A;  2D9F A;  4MSP A;  2PV1 A;  3ARQ A;  3O5L A;  4DRJ A;  2M1I A;  3ART A;  3CHF A;  4XAK A;  3ARY A;  4R0X A;  2MLY A;  2LGO A;  2F4E A;  3O5I A;  1JVW A;  3KAI A;  4IQ2 A;  2WLZ A;  2DG3 A;  3WQW A;  5DO2 A;  3B9D A;  2ZR6 A;  4GIV A;  1TFV A;  3ARX A;  3ARR A;  4ODL A;  5HW6 A;  1ZU8 A;  3G6L A;  1D7I A;  4W9O A;  3UI5 A;  1Q6U A;  1SYT A;  5HWB A;  1FJD A;  2O92 A;  1E15 A;  4DWS D;  4WKA A;  4LAY A;  1JNE A;  2RUR A;  3B9E A;  4DWS B;  1ZCN A;  3O5D A;  3VAW A;  4J4O A;  4DH0 A;  3AS1 A;  1J4H A;  1HJW A;  4MTV A;  5DIT A;  3ARW A;  2ZQU A;  5DIU A;  2AOS A;  1ZBV A;  2KI3 A;  2MPH A;  1H0I A;  4WKF A;  1NH6 A;  3O5P A;  4DRH A;  2RQS A;  4DWS A;  3MDY B;  3B9A A;  1E6P A;  4JFK A;  3TCZ A;  3UF8 A;  2O9O A;  2KE0 A;  5DEZ A;  5HW8 A;  3RM4 A;  5DIV A;  2LPV A;  5HTG A;  1FKB A;  3AS2 A;  2PBC A;  2QF8 A;  1X6L A;  1QZ2 A;  2RUC A;  3O5R A;  4DRO A;  2B31 A;  4Q7N A;  3JXV A;  4G50 A;  4C02 B;  1OWQ A;  1X6N A;  4HAR A;  4TW7 A;  4U85 A;  2VCD A;  2XP8 A;  3ODK A;  1W1T A;  4HBE A;  4PTM A;  4WJX A;  3KAC A;  3W4R A;  3QOK A;  3O5E A;  1LL4 A;  1EIB A;  2DT2 A;  4MGV A;  4ODP A;  4ZPW R;  4ZPT R;  3WD3 A;  4ODO A;  4MNL A;  5HUA A;  3OA5 A;  4DZ3 A;  4JFM A;  1NWR A;  2FAP A;  1Q6H A;  3ARP A;  3O5K A;  2M08 A;  4N19 A;  1F8A B;  2F2D A;  2DSW A;  4QIB A;  4GGQ A;  3FXY A;  4P8V A;  3WH0 A;  3CHD A;  3NRK A;  4Q22 A;  1O6I A;  3RM9 A;  1FKJ A;  4S3J A;  4ODM A;  2YBU A;  2G8Z A;  1FKL A;  4R5E A;  2MLZ A;  3CZ8 A;  4IQC A;  3KAF A;  4Z2K A;  1E9L A;  3WD4 A;  3RM8 A;  1UR9 A;  1ROT A;  4JFL A;  2KFW A;  2PI6 A;  3O5F A;  2DG9 A;  1GPF A;  2FKE A;  1C9H A;  3B7X A;  1YW5 A;  4L3N A;  5HKG A;  4ODR A;  4ODN A;  1FAP A;  3IKD A;  2PV2 A;  3AQU A;  1E6R A;  4MNK A;  3WD1 A;  1CTN A;  3UQB A;  4IPX A;  4ZPV R;  1W1P A;  3LUO A;  3UI4 A;  2MNT A;  1OGB A;  1FKT A;  2ZR5 A;  4TW8 A;  4TYO A;  4WK9 A;  3TC5 A;  1LL6 A;  2ZQS A;  4MPK A;  4TW6 A;  3O5G A;  1ZBW A;  4Z2I A;  1FKH A;  2RUD A;  2YBT A;  2A3B A;  2ZQT A;  2ZQV A;  2ITK A;  4LAV A;  3PRD A;  4JYS A;  4Z2L A;  2IUZ A;  4QZV B;  1L1P A;  1J4R A;  4ODK A;  1Q1C A;  2AWG A;  3FAP A;  4WIW A;  3ALG A;  1ROU A;  4JFI A;  5GQB A;  3AS3 A;  3PA7 A;  2M2A A;  1OGG A;  4LGX A;  2XP3 A;  1W9P A;  3OOB A;  1LG2 A;  2A3E A;  3PRA A;  3KAH A;  3IKG A;  3JYJ A;  4ODQ A;  3UI6 A;  1RD6 A;  1LQ0 A;  2Y78 A;  3GPK A;  1EHN A;  2DSZ A;  1ZBK A;  2Q5A A;  4DRN A;  2XP9 A;  4DZ2 A;  4FAP A;  2PPP A;  5DF0 A;  1P5Q A;  1XRV A;  1WB0 A;  2K8I A;  1NWU A;  1HKK A;  2LKN A;  2LJ4 A;  2KR7 A;  4IT6 A;  4MAV A;  1LJY A;  2XPA A;  4P8X A;  3WQV A;  4ML4 A;  4DT4 A;  2WLY A;  3JYM A;  3KAD A;  1W9V A;  3PRB A;  5BXJ A;  5GPG A;  1XHG A;  1ITX A;  1GUV A;  3KZ7 A;  2WK2 A;  1YAT A;  2DPE A;  3WD0 A;  1U79 A;  3TDB A;  1FFQ A;  4LAW A;  5GPR A;  4S3K A;  2DT1 A;  4W5U A;  4HBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...