1FKLA

Atomic structure of fkbp12-rapaymycin, an immunophilin-immunosuppressant complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
pubmed doi rcsb
molecule tags Rotamase
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fklA00
5HWCA 5HKGA 2L2SA 4MSPA 4TX0A 4BF8A 2UZ5A 2DG4A 2MLXA 3UF8A 1ROTA 2K8IA 1D7HA 2XP3A 2XP7A 2Q5AA 1D6OA 4O2TA 4DZ2A 1Q6IA 1P5QA 4W9QA 5HTGA 3EY6A 1EQ3A 5DITA 4C02B 2JZVA 2ZR4A 2XP5A 2LJ4A 3CGNA 4JFIA 4DRNA 3OOBA 2KE0A 2KO7A 2RUDA 2RUQA 4ODPA 4ODQA 1HXVA 2DG9A 3FAPA 3GPKA 3O5KA 4TW6A 3UI6A 1A7XA 1ZCNA 2ZQVA 2M08A 1FAPA 2KFWA 1JNSA 3TC5A 1J6YA 3O5IA 4JFLA 2VN1A 1YW5A 1EYMA 3JYMA 3KAHA 3KCEA 2D9FA 2F21A 4ODNA 2VCDA 1FKDA 3LUOA 4DIPA 4DROA 1L1PA 4MGVA 4ODMA 1JNTA 1QZ2A 4IQCA 3O5MA 1F8AB 2FKEA 1FKGA 4R0XA 4NNRA 3IHZA 5I98A 5D75A 4QT2A 1FD9A 4DRKA 4DRHA 2KI3A 1FKFA 5HW8A 2MF9A 4TYOA 3KAGA 4W9PA 3NI6A 1J4HA 1Q6UA 2MLYA 1D7IA 3NRKA 1YATA 4LAXA 3KACA 4GIVA 4TW8A 3UI4A 1FKBA 3H9RB 3NTPA 3O5FA 2ZQTA 3WH0A 2ZQUA 2Y78A 3O5OA 1F40A 3VAWA 4U85A 1W26A 4IPXA 2XP9A 4DRMA 5DIVA 5HW6A 3I6CA 2PV1A 3RFWA 2RQSA 2LGOA 2XP8A 1TCOC 5HT1A 2AWGA 1PINA 4ODLA 4DZ3A 4DRQA 4LAYA 1NMWA 3O5LA 4DH0A 3KAFA 2ZR6A 1FKLA 3JYJA 3KAIA 3TCZA 5HWBA 4U86A 1N1AA 1D7JA 2OFNA 3O5PA 2ITKA 2LKNA 3CGMA 1NSGA 3O5EA 2FAPA 2PPOA 2XP6A 5B8IC 1FJDA 1KT1A 3O5GA 2ZQSA 2XPAA 1FKRA 4ITZA 1JVWA 3KADA 3PRBA 1ZK6A 5HUAA 3IKGA 4G2PA 4J4OA 1FKIA 2DG3A 1FKTA 3KABA 1Q6HA 3UQBA 5HW7A 4JYSA 4GGQA 1Q1CA 3O5RA 1KT0A 4ODKA 2M1IA 5GPGA 1BKFA 4ODOA 4J4NA 4JFJA 4N19A 4FN2A 4DRJA 1B6CA 4IQ2A 2F2DA 1FKSA 1QPLA 1FKHA 3O5QA 5J6EA 1C9HA 1U79A 2KR7A 2F4EA 2MPHA 4TW7A 5DIUA 2PPPA 2MLZA 1R9HA 3JXVA 3UI5A 3PA7A 4JFKA 2MNTA 1Y0OA 2PPNA 4ODRA 4QT3A 4U84A 1J4RA 2XPBA 4DRIA 1M5YA 1T11A 2RUCA 3IKDA 3O5DA 1QPFA 2M2AA 2XP4A 1NMVA 3KZ7A 4LAWA 3B7XA 4G50A 2KGJA 2PV3A 4FAPA 2ZR5A 4TNSA 2PV2A 3RGCA 3IK8A 2N87A 4W9OA 1FKKA 2RSEA 4DT4A 4DRPA 4LAVA 5BXJA 2LPVA 1J4IA 1PBKA 3O5JA 3ODKA 3PRDA 3UQIA 1ROUA 2RURA 1BL4A 3MDYB 3TDBA 4JFMA 2PBCA 2IF4A 4QIBA 1FKJA 3UQAA
chains in the Genus database with same CATH superfamily
3QOKA 5HWCA 3B9DA 1D7HA 1EHNA 4LGXA 4DZ2A 1D6OA 1Q6IA 1W1PA 3CHDA 2ZR4A 3CGNA 3AS1A 3CH9A 2KE0A 2DSZA 2RUQA 3FAPA 1E6PA 3O5KA 3UI6A 1WAWA 4HARA 1FAPA 2KFWA 4MNMA 1XRVA 3O5IA 4Z2JA 2F21A 1L1PA 4DROA 4MTVA 3O5MA 2FKEA 1X6NA 1FKGA 4R0XA 5D75A 4QT2A 2KI3A 4TYOA 3NI6A 1YATA 1W9PA 1FKBA 2ZQTA 1F40A 3O5OA 3VAWA 4U85A 3FXYA 3G6MA 1WB0A 1W26A 3ARZA 4IPXA 4L72B 4MNJA 2AWGA 4HBEA 3WD1A 4DZ3A 4LAYA 4DH0A 3KAFA 2ZR6A 3KAIA 1NWSA 2XP6A 3O5GA 1LL7A 1FKRA 3PRBA 3KADA 1X6LA 4J4OA 3G6LA 1KFWA 3KABA 1Q1CA 3BMBA 2M1IA 3PR9A 5GPGA 4ODOA 4J4NA 4DRJA 2F2DA 1FKHA 1U79A 3ARPA 4ZPWR 4S3JA 3UI5A 4S3KA 3PA7A 2MNTA 4QT3A 4U84A 1M5YA 4URIA 2XP4A 4WK9A 1W9VA 1W1YA 4G50A 2KGJA 2DSVA 4DT4A 4LAVA 2LPVA 1J4IA 3ODKA 3UQIA 2RURA 4JFMA 2DSWA 2FDMA 4P8UA 3UQAA 1NWUA 4MSPA 2UZ5A 2DG4A 2MLXA 3UF8A 2XP3A 3WD4A 4W9QA 3ALFA 3ARRA 5DITA 1LG1A 2DT1A 2XP5A 1E6NA 4P8XA 4DRNA 3ARQA 4WJXA 2DT0A 3GPKA 2B5UB 2O92A 4IT6A 4ZPVR 1JNSA 4WKFA 3TC5A 4XAKA 1FKDA 4WKHA 3RM4A 1HKKA 4DWSC 1F8AB 1JNDA 4MAVA 1HKIA 3RM9A 3IHZA 3ARSA 1FD9A 3WKZA 3KAGA 2OLHA 1J4HA 2G8ZA 1IX5A 1D7IA 4GIVA 3WH0A 4DRPA 3NTPA 1ITXA 3O5FA 4P8WA 4DWSB 4DRMA 1ZBCA 1E9LA 5DIVA 5HW6A 2PV1A 3RM8A 5JH8A 4ZPTR 2XP8A 5GPRA 1TCOC 1HJXA 3PRAA 5HWBA 2WLZA 4U86A 2OFNA 2YBTA 3CGMA 4R5EA 1NWTA 4ITZA 3IKGA 1EDQA 4G2PA 1W9UA 1ZU8A 2B31A 4Q22A 4MNLA 5HW7A 1KT0A 4ODKA 1H0GA 3WD2A 1FKSA 1QPLA 2KR7A 1O6IA 2MPHA 1R9HA 2A3AA 2PPNA 1J4RA 2DT2A 4AY1A 4L3NA 1QPFA 2M2AA 3B7XA 2PV3A 2ZR5A 2N87A 5BXJA 1PBKA 4MPKA 3MDYB 3ARYA 4HBOA 2IF4A 4Z2KA 3WQWA 5HKGA 1CTNA 1ROTA 2XP7A 4O2TA 1HJVA 1ZBKA 1ZBWA 3EY6A 1EQ3A 2LJ4A 2KO7A 2RUDA 4ODPA 4ODQA 4TW6A 1A7XA 1ZCNA 3EIPA 4JFLA 2VN1A 1EYMA 3JYMA 3KAHA 2D9FA 4ODNA 1WNOA 3LUOA 4DIPA 4MGVA 4IQCA 1ZB5A 1ZL1A 2A3BA 4NNRA 4ZS6A 4DRHA 1FKFA 2MF9A 4Q7NA 1Q6UA 3UI4A 1SR0A 4TW8A 3H9RB 2ZQUA 2QF8A 2XP9A 5DF0A 1OWQA 4UDMA 2LGOA 5HT1A 1PINA 4DRQA 1NMWA 2DT3A 1D7JA 1HKJA 1NSGA 3O5EA 2FAPA 2PPOA 2WK2A 1KT1A 4NSBA 2G41A 2XPAA 3RMEA 4Z2HA 1GRJA 1JVWA 4Z2GA 3CZ8A 5HUAA 4WKAA 5DO2A 3W4RA 3CHFA 1EIBA 2DG3A 1W1VA 1FKTA 3UQBA 3B9EA 4GGQA 4DWSD 1E44A 3B8SA 1K9TA 3GU0A 3AROA 3CHCA 4JFJA 4N19A 3CHEA 1GPFA 1B6CA 4IQ2A 5J6EA 2ETNA 2MLZA 3JXVA 3AS3A 4JFKA 1HKMA 2P4VA 4MNKA 4DRIA 3ARXA 3WIJA 3KZ7A 1E6ZA 1E15A 2WLYA 2O9OA 2A3CA 4FAPA 3RGCA 3IK8A 3AS0A 1TFVA 4W9OA 2RSEA 5DEZA 3TDBA 1LJYA 4QZVB 3ARWA 2PBCA 1JCHB 4QIBA 2WM0A 2L2SA 4TX0A 4BF8A 2K8IA 5HTGA 2Q5AA 1NWRA 1P5QA 4C02B 2JZVA 3WD3A 2F23A 1GUVA 4JFIA 1LQ0A 3OOBA 1HXVA 1SYTA 4IT4A 2DG9A 2ESCA 1RD6A 1FFQA 2ZQVA 2M08A 4DWSA 5GQBA 3ARTA 2IUZA 1J6YA 1LL6A 1LG2A 1YW5A 3KCEA 2EULA 1HJWA 2VCDA 1UR9A 1OGGA 4ODMA 1JNTA 1QZ2A 3ARUA 5I98A 5HBFA 4DRKA 5HW8A 3B9AA 4W9PA 2MLYA 3NRKA 4LAXA 3KACA 1VF8A 1H0IA 1ZBVA 4KR0B 1D2KA 2Y78A 4ML4A 2YBUA 3WD0A 4Z2IA 3WQVA 3I6CA 3RFWA 2RQSA 4ODLA 3O5LA 1FKLA 3JYJA 1XHGA 3TCZA 1N1AA 3O5PA 2ITKA 2LKNA 5B8IC 3AS2A 1FJDA 1UR8A 2ZQSA 4W5UA 1FFRA 1ZK6A 2PN0A 1FKIA 4WIWA 1NH6A 3ALGA 1Q6HA 1JNEA 2DPEA 3GTYX 4JYSA 1OGBA 4KQZA 3O5RA 3WL1A 2DSUA 1BKFA 2PI6A 4P8VA 4FN2A 4NZCA 1W1TA 3O5QA 1C9HA 3ARVA 4TW7A 2F4EA 5DIUA 2PPPA 1LL4A 1Y0OA 2A3EA 4ODRA 2XPBA 1T11A 2RUCA 3IKDA 4PTMA 3O5DA 1NMVA 3FY1A 4LAWA 2AOSA 4Z2LA 4TNSA 2PV2A 3AQUA 1FKKA 3OA5A 1GOIA 3PRDA 3O5JA 1ROUA 1BL4A 3WL0A 3BXWA 1E6RA 1FKJA
chains in the Genus database with same CATH topology
3QOKA 5HWCA 3B9DA 1D7HA 1EHNA 4LGXA 4DZ2A 1D6OA 1Q6IA 1W1PA 3CHDA 2ZR4A 3CGNA 3AS1A 3CH9A 2KE0A 2DSZA 2RUQA 3FAPA 1E6PA 3O5KA 3UI6A 1WAWA 4HARA 1FAPA 2KFWA 4MNMA 1XRVA 3O5IA 4Z2JA 2F21A 1L1PA 4DROA 4MTVA 3O5MA 2FKEA 1X6NA 1FKGA 4R0XA 5D75A 4QT2A 2KI3A 4TYOA 3NI6A 1YATA 1W9PA 1FKBA 2ZQTA 1F40A 3O5OA 3VAWA 4U85A 3FXYA 3G6MA 1WB0A 1W26A 3ARZA 4IPXA 4L72B 4MNJA 2AWGA 4HBEA 3WD1A 4DZ3A 4LAYA 4DH0A 3KAFA 2ZR6A 3KAIA 1NWSA 2XP6A 3O5GA 1LL7A 1FKRA 3PRBA 3KADA 1X6LA 4J4OA 3G6LA 1KFWA 3KABA 1Q1CA 3PR9A 2M1IA 5GPGA 4ODOA 4J4NA 4DRJA 2F2DA 1FKHA 1U79A 3ARPA 4ZPWR 4S3JA 3UI5A 4S3KA 3PA7A 2MNTA 4QT3A 4U84A 1M5YA 4URIA 2XP4A 4WK9A 1W9VA 1W1YA 4G50A 2KGJA 2DSVA 4DT4A 4LAVA 2LPVA 1J4IA 3ODKA 3UQIA 2RURA 4JFMA 2DSWA 2FDMA 4P8UA 3UQAA 1NWUA 4MSPA 2UZ5A 2DG4A 2MLXA 3UF8A 2XP3A 3WD4A 4W9QA 3ALFA 3ARRA 5DITA 1LG1A 2DT1A 2XP5A 1E6NA 4P8XA 4DRNA 3ARQA 4WJXA 2DT0A 3GPKA 2O92A 4IT6A 4ZPVR 1JNSA 4WKFA 3TC5A 4XAKA 1FKDA 4WKHA 3RM4A 1HKKA 4DWSC 1F8AB 1JNDA 4MAVA 1HKIA 3RM9A 3IHZA 3ARSA 1FD9A 3WKZA 3KAGA 2OLHA 1J4HA 2G8ZA 1IX5A 1D7IA 4GIVA 3WH0A 4DRPA 3NTPA 1ITXA 3O5FA 4P8WA 4DWSB 4DRMA 1ZBCA 1E9LA 5DIVA 5HW6A 2PV1A 3RM8A 5JH8A 4ZPTR 2XP8A 5GPRA 1TCOC 1HJXA 3PRAA 5HWBA 2WLZA 4U86A 2OFNA 2YBTA 3CGMA 4R5EA 1NWTA 4ITZA 3IKGA 1EDQA 4G2PA 1W9UA 1ZU8A 2B31A 4Q22A 4MNLA 5HW7A 1KT0A 4ODKA 1H0GA 3WD2A 1FKSA 1QPLA 2KR7A 1O6IA 2MPHA 1R9HA 2A3AA 2PPNA 1J4RA 2DT2A 4AY1A 4L3NA 1QPFA 2M2AA 3B7XA 2PV3A 2ZR5A 2N87A 5BXJA 1PBKA 4MPKA 3MDYB 3ARYA 4HBOA 2IF4A 4Z2KA 3WQWA 5HKGA 1CTNA 1ROTA 2XP7A 4O2TA 1HJVA 1ZBKA 1ZBWA 3EY6A 1EQ3A 2LJ4A 2KO7A 2RUDA 4ODPA 4ODQA 4TW6A 1A7XA 1ZCNA 4JFLA 2VN1A 1EYMA 3JYMA 3KAHA 2D9FA 4ODNA 1WNOA 3LUOA 4DIPA 4MGVA 4IQCA 1ZB5A 1ZL1A 2A3BA 4NNRA 4ZS6A 4DRHA 1FKFA 2MF9A 4Q7NA 1Q6UA 3UI4A 1SR0A 4TW8A 3H9RB 2ZQUA 2QF8A 2XP9A 5DF0A 1OWQA 2LGOA 5HT1A 1PINA 4DRQA 1NMWA 2DT3A 1D7JA 1HKJA 1NSGA 3O5EA 2FAPA 2PPOA 2WK2A 1KT1A 4NSBA 2G41A 2XPAA 3RMEA 4Z2HA 1JVWA 4Z2GA 3CZ8A 5HUAA 4WKAA 5DO2A 3W4RA 3CHFA 1EIBA 2DG3A 1W1VA 1FKTA 3UQBA 3B9EA 4GGQA 4DWSD 3B8SA 1K9TA 3AROA 3CHCA 4JFJA 4N19A 3CHEA 1GPFA 1B6CA 4IQ2A 5J6EA 2MLZA 3JXVA 3AS3A 4JFKA 1HKMA 4MNKA 4DRIA 3ARXA 3WIJA 3KZ7A 1E6ZA 1E15A 2WLYA 2O9OA 2A3CA 4FAPA 3RGCA 3IK8A 3AS0A 1TFVA 4W9OA 2RSEA 5DEZA 3TDBA 1LJYA 4QZVB 3ARWA 2PBCA 4QIBA 2WM0A 2L2SA 4TX0A 4BF8A 2K8IA 5HTGA 2Q5AA 1NWRA 1P5QA 4C02B 2JZVA 3WD3A 1GUVA 4JFIA 1LQ0A 3OOBA 1HXVA 1SYTA 4IT4A 2DG9A 2ESCA 1RD6A 1FFQA 2ZQVA 2M08A 4DWSA 5GQBA 3ARTA 2IUZA 1J6YA 1LL6A 1LG2A 1YW5A 3KCEA 1HJWA 2VCDA 1UR9A 1OGGA 4ODMA 1JNTA 1QZ2A 3ARUA 5I98A 5HBFA 4DRKA 5HW8A 3B9AA 4W9PA 2MLYA 3NRKA 4LAXA 3KACA 1VF8A 1H0IA 1ZBVA 4KR0B 1D2KA 2Y78A 4ML4A 2YBUA 3WD0A 4Z2IA 3WQVA 3I6CA 3RFWA 2RQSA 4ODLA 3O5LA 1FKLA 3JYJA 1XHGA 3TCZA 1N1AA 3O5PA 2ITKA 2LKNA 5B8IC 3AS2A 1FJDA 1UR8A 2ZQSA 4W5UA 1FFRA 1ZK6A 1FKIA 4WIWA 1NH6A 3ALGA 1Q6HA 1JNEA 2DPEA 4JYSA 4KQZA 1OGBA 3O5RA 3WL1A 2DSUA 1BKFA 2PI6A 4P8VA 4FN2A 4NZCA 1W1TA 3O5QA 1C9HA 3ARVA 4TW7A 2F4EA 5DIUA 2PPPA 1LL4A 1Y0OA 2A3EA 4ODRA 2XPBA 1T11A 2RUCA 3IKDA 4PTMA 3O5DA 1NMVA 3FY1A 4LAWA 2AOSA 4Z2LA 4TNSA 2PV2A 3AQUA 1FKKA 3OA5A 1GOIA 3PRDA 3O5JA 1ROUA 1BL4A 3WL0A 3BXWA 1E6RA 1FKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWC A;  5HKG A;  2L2S A;  4MSP A;  4TX0 A;  4BF8 A;  2UZ5 A;  2DG4 A;  2MLX A;  3UF8 A;  1ROT A;  2K8I A;  1D7H A;  2XP3 A;  2XP7 A;  2Q5A A;  1D6O A;  4O2T A;  4DZ2 A;  1Q6I A;  1P5Q A;  4W9Q A;  5HTG A;  3EY6 A;  1EQ3 A;  5DIT A;  4C02 B;  2JZV A;  2ZR4 A;  2XP5 A;  2LJ4 A;  3CGN A;  4JFI A;  4DRN A;  3OOB A;  2KE0 A;  2KO7 A;  2RUD A;  2RUQ A;  4ODP A;  4ODQ A;  1HXV A;  2DG9 A;  3FAP A;  3GPK A;  3O5K A;  4TW6 A;  3UI6 A;  1A7X A;  1ZCN A;  2ZQV A;  2M08 A;  1FAP A;  2KFW A;  1JNS A;  3TC5 A;  1J6Y A;  3O5I A;  4JFL A;  2VN1 A;  1YW5 A;  1EYM A;  3JYM A;  3KAH A;  3KCE A;  2D9F A;  2F21 A;  4ODN A;  2VCD A;  1FKD A;  3LUO A;  4DIP A;  4DRO A;  1L1P A;  4MGV A;  4ODM A;  1JNT A;  1QZ2 A;  4IQC A;  3O5M A;  1F8A B;  2FKE A;  1FKG A;  4R0X A;  4NNR A;  3IHZ A;  5I98 A;  5D75 A;  4QT2 A;  1FD9 A;  4DRK A;  4DRH A;  2KI3 A;  1FKF A;  5HW8 A;  2MF9 A;  4TYO A;  3KAG A;  4W9P A;  3NI6 A;  1J4H A;  1Q6U A;  2MLY A;  1D7I A;  3NRK A;  1YAT A;  4LAX A;  3KAC A;  4GIV A;  4TW8 A;  3UI4 A;  1FKB A;  3H9R B;  3NTP A;  3O5F A;  2ZQT A;  3WH0 A;  2ZQU A;  2Y78 A;  3O5O A;  1F40 A;  3VAW A;  4U85 A;  1W26 A;  4IPX A;  2XP9 A;  4DRM A;  5DIV A;  5HW6 A;  3I6C A;  2PV1 A;  3RFW A;  2RQS A;  2LGO A;  2XP8 A;  1TCO C;  5HT1 A;  2AWG A;  1PIN A;  4ODL A;  4DZ3 A;  4DRQ A;  4LAY A;  1NMW A;  3O5L A;  4DH0 A;  3KAF A;  2ZR6 A;  1FKL A;  3JYJ A;  3KAI A;  3TCZ A;  5HWB A;  4U86 A;  1N1A A;  1D7J A;  2OFN A;  3O5P A;  2ITK A;  2LKN A;  3CGM A;  1NSG A;  3O5E A;  2FAP A;  2PPO A;  2XP6 A;  5B8I C;  1FJD A;  1KT1 A;  3O5G A;  2ZQS A;  2XPA A;  1FKR A;  4ITZ A;  1JVW A;  3KAD A;  3PRB A;  1ZK6 A;  5HUA A;  3IKG A;  4G2P A;  4J4O A;  1FKI A;  2DG3 A;  1FKT A;  3KAB A;  1Q6H A;  3UQB A;  5HW7 A;  4JYS A;  4GGQ A;  1Q1C A;  3O5R A;  1KT0 A;  4ODK A;  2M1I A;  5GPG A;  1BKF A;  4ODO A;  4J4N A;  4JFJ A;  4N19 A;  4FN2 A;  4DRJ A;  1B6C A;  4IQ2 A;  2F2D A;  1FKS A;  1QPL A;  1FKH A;  3O5Q A;  5J6E A;  1C9H A;  1U79 A;  2KR7 A;  2F4E A;  2MPH A;  4TW7 A;  5DIU A;  2PPP A;  2MLZ A;  1R9H A;  3JXV A;  3UI5 A;  3PA7 A;  4JFK A;  2MNT A;  1Y0O A;  2PPN A;  4ODR A;  4QT3 A;  4U84 A;  1J4R A;  2XPB A;  4DRI A;  1M5Y A;  1T11 A;  2RUC A;  3IKD A;  3O5D A;  1QPF A;  2M2A A;  2XP4 A;  1NMV A;  3KZ7 A;  4LAW A;  3B7X A;  4G50 A;  2KGJ A;  2PV3 A;  4FAP A;  2ZR5 A;  4TNS A;  2PV2 A;  3RGC A;  3IK8 A;  2N87 A;  4W9O A;  1FKK A;  2RSE A;  4DT4 A;  4DRP A;  4LAV A;  5BXJ A;  2LPV A;  1J4I A;  1PBK A;  3O5J A;  3ODK A;  3PRD A;  3UQI A;  1ROU A;  2RUR A;  1BL4 A;  3MDY B;  3TDB A;  4JFM A;  2PBC A;  2IF4 A;  4QIB A;  1FKJ A;  3UQA A; 
#chains in the Genus database with same CATH topology
 3QOK A;  5HWC A;  3B9D A;  1D7H A;  1EHN A;  4LGX A;  4DZ2 A;  1D6O A;  1Q6I A;  1W1P A;  3CHD A;  2ZR4 A;  3CGN A;  3AS1 A;  3CH9 A;  2KE0 A;  2DSZ A;  2RUQ A;  3FAP A;  1E6P A;  3O5K A;  3UI6 A;  1WAW A;  4HAR A;  1FAP A;  2KFW A;  4MNM A;  1XRV A;  3O5I A;  4Z2J A;  2F21 A;  1L1P A;  4DRO A;  4MTV A;  3O5M A;  2FKE A;  1X6N A;  1FKG A;  4R0X A;  5D75 A;  4QT2 A;  2KI3 A;  4TYO A;  3NI6 A;  1YAT A;  1W9P A;  1FKB A;  2ZQT A;  1F40 A;  3O5O A;  3VAW A;  4U85 A;  3FXY A;  3G6M A;  1WB0 A;  1W26 A;  3ARZ A;  4IPX A;  4L72 B;  4MNJ A;  2AWG A;  4HBE A;  3WD1 A;  4DZ3 A;  4LAY A;  4DH0 A;  3KAF A;  2ZR6 A;  3KAI A;  1NWS A;  2XP6 A;  3O5G A;  1LL7 A;  1FKR A;  3PRB A;  3KAD A;  1X6L A;  4J4O A;  3G6L A;  1KFW A;  3KAB A;  1Q1C A;  3BMB A;  2M1I A;  3PR9 A;  5GPG A;  4ODO A;  4J4N A;  4DRJ A;  2F2D A;  1FKH A;  1U79 A;  3ARP A;  4ZPW R;  4S3J A;  3UI5 A;  4S3K A;  3PA7 A;  2MNT A;  4QT3 A;  4U84 A;  1M5Y A;  4URI A;  2XP4 A;  4WK9 A;  1W9V A;  1W1Y A;  4G50 A;  2KGJ A;  2DSV A;  4DT4 A;  4LAV A;  2LPV A;  1J4I A;  3ODK A;  3UQI A;  2RUR A;  4JFM A;  2DSW A;  2FDM A;  4P8U A;  3UQA A;  1NWU A;  4MSP A;  2UZ5 A;  2DG4 A;  2MLX A;  3UF8 A;  2XP3 A;  3WD4 A;  4W9Q A;  3ALF A;  3ARR A;  5DIT A;  1LG1 A;  2DT1 A;  2XP5 A;  1E6N A;  4P8X A;  4DRN A;  3ARQ A;  4WJX A;  2DT0 A;  3GPK A;  2B5U B;  2O92 A;  4IT6 A;  4ZPV R;  1JNS A;  4WKF A;  3TC5 A;  4XAK A;  1FKD A;  4WKH A;  3RM4 A;  1HKK A;  4DWS C;  1F8A B;  1JND A;  4MAV A;  1HKI A;  3RM9 A;  3IHZ A;  3ARS A;  1FD9 A;  3WKZ A;  3KAG A;  2OLH A;  1J4H A;  2G8Z A;  1IX5 A;  1D7I A;  4GIV A;  3WH0 A;  4DRP A;  3NTP A;  1ITX A;  3O5F A;  4P8W A;  4DWS B;  4DRM A;  1ZBC A;  1E9L A;  5DIV A;  5HW6 A;  2PV1 A;  3RM8 A;  5JH8 A;  4ZPT R;  2XP8 A;  5GPR A;  1TCO C;  1HJX A;  3PRA A;  5HWB A;  2WLZ A;  4U86 A;  2OFN A;  2YBT A;  3CGM A;  4R5E A;  1NWT A;  4ITZ A;  3IKG A;  1EDQ A;  4G2P A;  1W9U A;  1ZU8 A;  2B31 A;  4Q22 A;  4MNL A;  5HW7 A;  1KT0 A;  4ODK A;  1H0G A;  3WD2 A;  1FKS A;  1QPL A;  2KR7 A;  1O6I A;  2MPH A;  1R9H A;  2A3A A;  2PPN A;  1J4R A;  2DT2 A;  4AY1 A;  4L3N A;  1QPF A;  2M2A A;  3B7X A;  2PV3 A;  2ZR5 A;  2N87 A;  5BXJ A;  1PBK A;  4MPK A;  3MDY B;  3ARY A;  4HBO A;  2IF4 A;  4Z2K A;  3WQW A;  5HKG A;  1CTN A;  1ROT A;  2XP7 A;  4O2T A;  1HJV A;  1ZBK A;  1ZBW A;  3EY6 A;  1EQ3 A;  2LJ4 A;  2KO7 A;  2RUD A;  4ODP A;  4ODQ A;  4TW6 A;  1A7X A;  1ZCN A;  3EIP A;  4JFL A;  2VN1 A;  1EYM A;  3JYM A;  3KAH A;  2D9F A;  4ODN A;  1WNO A;  3LUO A;  4DIP A;  4MGV A;  4IQC A;  1ZB5 A;  1ZL1 A;  2A3B A;  4NNR A;  4ZS6 A;  4DRH A;  1FKF A;  2MF9 A;  4Q7N A;  1Q6U A;  3UI4 A;  1SR0 A;  4TW8 A;  3H9R B;  2ZQU A;  2QF8 A;  2XP9 A;  5DF0 A;  1OWQ A;  4UDM A;  2LGO A;  5HT1 A;  1PIN A;  4DRQ A;  1NMW A;  2DT3 A;  1D7J A;  1HKJ A;  1NSG A;  3O5E A;  2FAP A;  2PPO A;  2WK2 A;  1KT1 A;  4NSB A;  2G41 A;  2XPA A;  3RME A;  4Z2H A;  1GRJ A;  1JVW A;  4Z2G A;  3CZ8 A;  5HUA A;  4WKA A;  5DO2 A;  3W4R A;  3CHF A;  1EIB A;  2DG3 A;  1W1V A;  1FKT A;  3UQB A;  3B9E A;  4GGQ A;  4DWS D;  1E44 A;  3B8S A;  1K9T A;  3GU0 A;  3ARO A;  3CHC A;  4JFJ A;  4N19 A;  3CHE A;  1GPF A;  1B6C A;  4IQ2 A;  5J6E A;  2ETN A;  2MLZ A;  3JXV A;  3AS3 A;  4JFK A;  1HKM A;  2P4V A;  4MNK A;  4DRI A;  3ARX A;  3WIJ A;  3KZ7 A;  1E6Z A;  1E15 A;  2WLY A;  2O9O A;  2A3C A;  4FAP A;  3RGC A;  3IK8 A;  3AS0 A;  1TFV A;  4W9O A;  2RSE A;  5DEZ A;  3TDB A;  1LJY A;  4QZV B;  3ARW A;  2PBC A;  1JCH B;  4QIB A;  2WM0 A;  2L2S A;  4TX0 A;  4BF8 A;  2K8I A;  5HTG A;  2Q5A A;  1NWR A;  1P5Q A;  4C02 B;  2JZV A;  3WD3 A;  2F23 A;  1GUV A;  4JFI A;  1LQ0 A;  3OOB A;  1HXV A;  1SYT A;  4IT4 A;  2DG9 A;  2ESC A;  1RD6 A;  1FFQ A;  2ZQV A;  2M08 A;  4DWS A;  5GQB A;  3ART A;  2IUZ A;  1J6Y A;  1LL6 A;  1LG2 A;  1YW5 A;  3KCE A;  2EUL A;  1HJW A;  2VCD A;  1UR9 A;  1OGG A;  4ODM A;  1JNT A;  1QZ2 A;  3ARU A;  5I98 A;  5HBF A;  4DRK A;  5HW8 A;  3B9A A;  4W9P A;  2MLY A;  3NRK A;  4LAX A;  3KAC A;  1VF8 A;  1H0I A;  1ZBV A;  4KR0 B;  1D2K A;  2Y78 A;  4ML4 A;  2YBU A;  3WD0 A;  4Z2I A;  3WQV A;  3I6C A;  3RFW A;  2RQS A;  4ODL A;  3O5L A;  1FKL A;  3JYJ A;  1XHG A;  3TCZ A;  1N1A A;  3O5P A;  2ITK A;  2LKN A;  5B8I C;  3AS2 A;  1FJD A;  1UR8 A;  2ZQS A;  4W5U A;  1FFR A;  1ZK6 A;  2PN0 A;  1FKI A;  4WIW A;  1NH6 A;  3ALG A;  1Q6H A;  1JNE A;  2DPE A;  3GTY X;  4JYS A;  1OGB A;  4KQZ A;  3O5R A;  3WL1 A;  2DSU A;  1BKF A;  2PI6 A;  4P8V A;  4FN2 A;  4NZC A;  1W1T A;  3O5Q A;  1C9H A;  3ARV A;  4TW7 A;  2F4E A;  5DIU A;  2PPP A;  1LL4 A;  1Y0O A;  2A3E A;  4ODR A;  2XPB A;  1T11 A;  2RUC A;  3IKD A;  4PTM A;  3O5D A;  1NMV A;  3FY1 A;  4LAW A;  2AOS A;  4Z2L A;  4TNS A;  2PV2 A;  3AQU A;  1FKK A;  3OA5 A;  1GOI A;  3PRD A;  3O5J A;  1ROU A;  1BL4 A;  3WL0 A;  3BXW A;  1E6R A;  1FKJ A; 
#chains in the Genus database with same CATH homology
 3QOK A;  5HWC A;  3B9D A;  1D7H A;  1EHN A;  4LGX A;  4DZ2 A;  1D6O A;  1Q6I A;  1W1P A;  3CHD A;  2ZR4 A;  3CGN A;  3AS1 A;  3CH9 A;  2KE0 A;  2DSZ A;  2RUQ A;  3FAP A;  1E6P A;  3O5K A;  3UI6 A;  1WAW A;  4HAR A;  1FAP A;  2KFW A;  4MNM A;  1XRV A;  3O5I A;  4Z2J A;  2F21 A;  1L1P A;  4DRO A;  4MTV A;  3O5M A;  2FKE A;  1X6N A;  1FKG A;  4R0X A;  5D75 A;  4QT2 A;  2KI3 A;  4TYO A;  3NI6 A;  1YAT A;  1W9P A;  1FKB A;  2ZQT A;  1F40 A;  3O5O A;  3VAW A;  4U85 A;  3FXY A;  3G6M A;  1WB0 A;  1W26 A;  3ARZ A;  4IPX A;  4L72 B;  4MNJ A;  2AWG A;  4HBE A;  3WD1 A;  4DZ3 A;  4LAY A;  4DH0 A;  3KAF A;  2ZR6 A;  3KAI A;  1NWS A;  2XP6 A;  3O5G A;  1LL7 A;  1FKR A;  3PRB A;  3KAD A;  1X6L A;  4J4O A;  3G6L A;  1KFW A;  3KAB A;  1Q1C A;  3PR9 A;  2M1I A;  5GPG A;  4ODO A;  4J4N A;  4DRJ A;  2F2D A;  1FKH A;  1U79 A;  3ARP A;  4ZPW R;  4S3J A;  3UI5 A;  4S3K A;  3PA7 A;  2MNT A;  4QT3 A;  4U84 A;  1M5Y A;  4URI A;  2XP4 A;  4WK9 A;  1W9V A;  1W1Y A;  4G50 A;  2KGJ A;  2DSV A;  4DT4 A;  4LAV A;  2LPV A;  1J4I A;  3ODK A;  3UQI A;  2RUR A;  4JFM A;  2DSW A;  2FDM A;  4P8U A;  3UQA A;  1NWU A;  4MSP A;  2UZ5 A;  2DG4 A;  2MLX A;  3UF8 A;  2XP3 A;  3WD4 A;  4W9Q A;  3ALF A;  3ARR A;  5DIT A;  1LG1 A;  2DT1 A;  2XP5 A;  1E6N A;  4P8X A;  4DRN A;  3ARQ A;  4WJX A;  2DT0 A;  3GPK A;  2O92 A;  4IT6 A;  4ZPV R;  1JNS A;  4WKF A;  3TC5 A;  4XAK A;  1FKD A;  4WKH A;  3RM4 A;  1HKK A;  4DWS C;  1F8A B;  1JND A;  4MAV A;  1HKI A;  3RM9 A;  3IHZ A;  3ARS A;  1FD9 A;  3WKZ A;  3KAG A;  2OLH A;  1J4H A;  2G8Z A;  1IX5 A;  1D7I A;  4GIV A;  3WH0 A;  4DRP A;  3NTP A;  1ITX A;  3O5F A;  4P8W A;  4DWS B;  4DRM A;  1ZBC A;  1E9L A;  5DIV A;  5HW6 A;  2PV1 A;  3RM8 A;  5JH8 A;  4ZPT R;  2XP8 A;  5GPR A;  1TCO C;  1HJX A;  3PRA A;  5HWB A;  2WLZ A;  4U86 A;  2OFN A;  2YBT A;  3CGM A;  4R5E A;  1NWT A;  4ITZ A;  3IKG A;  1EDQ A;  4G2P A;  1W9U A;  1ZU8 A;  2B31 A;  4Q22 A;  4MNL A;  5HW7 A;  1KT0 A;  4ODK A;  1H0G A;  3WD2 A;  1FKS A;  1QPL A;  2KR7 A;  1O6I A;  2MPH A;  1R9H A;  2A3A A;  2PPN A;  1J4R A;  2DT2 A;  4AY1 A;  4L3N A;  1QPF A;  2M2A A;  3B7X A;  2PV3 A;  2ZR5 A;  2N87 A;  5BXJ A;  1PBK A;  4MPK A;  3MDY B;  3ARY A;  4HBO A;  2IF4 A;  4Z2K A;  3WQW A;  5HKG A;  1CTN A;  1ROT A;  2XP7 A;  4O2T A;  1HJV A;  1ZBK A;  1ZBW A;  3EY6 A;  1EQ3 A;  2LJ4 A;  2KO7 A;  2RUD A;  4ODP A;  4ODQ A;  4TW6 A;  1A7X A;  1ZCN A;  4JFL A;  2VN1 A;  1EYM A;  3JYM A;  3KAH A;  2D9F A;  4ODN A;  1WNO A;  3LUO A;  4DIP A;  4MGV A;  4IQC A;  1ZB5 A;  1ZL1 A;  2A3B A;  4NNR A;  4ZS6 A;  4DRH A;  1FKF A;  2MF9 A;  4Q7N A;  1Q6U A;  3UI4 A;  1SR0 A;  4TW8 A;  3H9R B;  2ZQU A;  2QF8 A;  2XP9 A;  5DF0 A;  1OWQ A;  2LGO A;  5HT1 A;  1PIN A;  4DRQ A;  1NMW A;  2DT3 A;  1D7J A;  1HKJ A;  1NSG A;  3O5E A;  2FAP A;  2PPO A;  2WK2 A;  1KT1 A;  4NSB A;  2G41 A;  2XPA A;  3RME A;  4Z2H A;  1JVW A;  4Z2G A;  3CZ8 A;  5HUA A;  4WKA A;  5DO2 A;  3W4R A;  3CHF A;  1EIB A;  2DG3 A;  1W1V A;  1FKT A;  3UQB A;  3B9E A;  4GGQ A;  4DWS D;  3B8S A;  1K9T A;  3ARO A;  3CHC A;  4JFJ A;  4N19 A;  3CHE A;  1GPF A;  1B6C A;  4IQ2 A;  5J6E A;  2MLZ A;  3JXV A;  3AS3 A;  4JFK A;  1HKM A;  4MNK A;  4DRI A;  3ARX A;  3WIJ A;  3KZ7 A;  1E6Z A;  1E15 A;  2WLY A;  2O9O A;  2A3C A;  4FAP A;  3RGC A;  3IK8 A;  3AS0 A;  1TFV A;  4W9O A;  2RSE A;  5DEZ A;  3TDB A;  1LJY A;  4QZV B;  3ARW A;  2PBC A;  4QIB A;  2WM0 A;  2L2S A;  4TX0 A;  4BF8 A;  2K8I A;  5HTG A;  2Q5A A;  1NWR A;  1P5Q A;  4C02 B;  2JZV A;  3WD3 A;  1GUV A;  4JFI A;  1LQ0 A;  3OOB A;  1HXV A;  1SYT A;  4IT4 A;  2DG9 A;  2ESC A;  1RD6 A;  1FFQ A;  2ZQV A;  2M08 A;  4DWS A;  5GQB A;  3ART A;  2IUZ A;  1J6Y A;  1LL6 A;  1LG2 A;  1YW5 A;  3KCE A;  1HJW A;  2VCD A;  1UR9 A;  1OGG A;  4ODM A;  1JNT A;  1QZ2 A;  3ARU A;  5I98 A;  5HBF A;  4DRK A;  5HW8 A;  3B9A A;  4W9P A;  2MLY A;  3NRK A;  4LAX A;  3KAC A;  1VF8 A;  1H0I A;  1ZBV A;  4KR0 B;  1D2K A;  2Y78 A;  4ML4 A;  2YBU A;  3WD0 A;  4Z2I A;  3WQV A;  3I6C A;  3RFW A;  2RQS A;  4ODL A;  3O5L A;  1FKL A;  3JYJ A;  1XHG A;  3TCZ A;  1N1A A;  3O5P A;  2ITK A;  2LKN A;  5B8I C;  3AS2 A;  1FJD A;  1UR8 A;  2ZQS A;  4W5U A;  1FFR A;  1ZK6 A;  1FKI A;  4WIW A;  1NH6 A;  3ALG A;  1Q6H A;  1JNE A;  2DPE A;  4JYS A;  4KQZ A;  1OGB A;  3O5R A;  3WL1 A;  2DSU A;  1BKF A;  2PI6 A;  4P8V A;  4FN2 A;  4NZC A;  1W1T A;  3O5Q A;  1C9H A;  3ARV A;  4TW7 A;  2F4E A;  5DIU A;  2PPP A;  1LL4 A;  1Y0O A;  2A3E A;  4ODR A;  2XPB A;  1T11 A;  2RUC A;  3IKD A;  4PTM A;  3O5D A;  1NMV A;  3FY1 A;  4LAW A;  2AOS A;  4Z2L A;  4TNS A;  2PV2 A;  3AQU A;  1FKK A;  3OA5 A;  1GOI A;  3PRD A;  3O5J A;  1ROU A;  1BL4 A;  3WL0 A;  3BXW A;  1E6R A;  1FKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...