1FKLA

Atomic structure of fkbp12-rapaymycin, an immunophilin-immunosuppressant complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
pubmed doi rcsb
molecule tags Rotamase
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fklA00
1KT1A 1D7IA 3UF8A 4DZ2A 4W9OA 4U85A 4DRNA 4DRHA 4DRPA 2Q5AA 2KO7A 3I6CA 4J4OA 4W9QA 1JNTA 1PBKA 4JFJA 1PINA 4QT3A 2AWGA 4ODQA 2MF9A 3JYJA 2XP6A 1JNSA 2ZR6A 2Y78A 3O5MA 1BKFA 1ZCNA 5HUAA 4FAPA 4G50A 4W9PA 3O5FA 1FKIA 5I98A 1FKBA 2DG9A 2FKEA 2IF4A 4ODKA 2MNTA 4U86A 2LGOA 4JFIA 5HWBA 3ODKA 2RURA 2PBCA 2M08A 4R0XA 4DRMA 1FJDA 1FKTA 2ZR5A 4ODRA 1QZ2A 1M5YA 3TCZA 3IK8A 4IQ2A 1EQ3A 1HXVA 1FKLA 2XPBA 4N19A 2ZQVA 1J4RA 1W26A 3PRBA 4NNRA 1QPFA 5HKGA 1FAPA 4TW7A 1Q6UA 1FKRA 2JZVA 4FN2A 1JVWA 4JFMA 1FKJA 2ZR4A 2F21A 1FKDA 5HW7A 3O5RA 4DROA 4ITZA 2RQSA 2XP3A 1A7XA 2PPOA 2L2SA 2LPVA 2XP8A 4ODNA 5DITA 2MPHA 1FKKA 2FAPA 2UZ5A 1KT0A 4C02B 3KAFA 3O5DA 3KAHA 4MSPA 1Q6HA 1EYMA 1J6YA 4IPXA 2KI3A 3NTPA 5DIUA 3VAWA 4ODPA 2KGJA 4LAVA 4LAXA 4GGQA 4DZ3A 2MLYA 1YW5A 3TC5A 1L1PA 4DRIA 1D6OA 4J4NA 2VCDA 3UQBA 3MDYB 2M1IA 2F2DA 5DIVA 3UQIA 4DRJA 3TDBA 4QIBA 3KACA 1Y0OA 3JXVA 2M2AA 2RUCA 1BL4A 3CGMA 1U79A 3GPKA 4DRQA 3NI6A 3PA7A 2LKNA 4JYSA 3IHZA 2D9FA 4JFLA 1Q6IA 4U84A 4DT4A 5BXJA 1R9HA 3KZ7A 3UI5A 2DG4A 1NMWA 4DH0A 2KE0A 5B8IC 4G2PA 2LJ4A 1FD9A 5HWCA 2N87A 3OOBA 4TW6A 4ODMA 2OFNA 2XPAA 3O5KA 1F8AB 3O5IA 2XP9A 4IQCA 4MGVA 4TW8A 1QPLA 3RFWA 3O5EA 1B6CA 3JYMA 3IKDA 3H9RB 3UI6A 3RGCA 2ITKA 4LAYA 2RUQA 4ODOA 1ROTA 2KFWA 3CGNA 1N1AA 3O5GA 2K8IA 2PPPA 3KADA 2MLXA 1TCOC 2XP7A 2F4EA 4LAWA 1FKFA 1FKSA 3FAPA 4QT2A 4BF8A 1P5QA 4TX0A 3IKGA 4GIVA 5HW8A 4O2TA 1J4HA 1ZK6A 2MLZA 1J4IA 2RSEA 3KABA 3KAGA 4TYOA 5HTGA 2ZQUA 1Q1CA 3B7XA 3KAIA 2PV2A 1T11A 2DG3A 3UQAA 3UI4A 1ROUA 1FKHA 3KCEA 3O5OA 2XP4A 3O5PA 2PV3A 3PRDA 3O5QA 2KR7A 5D75A 2PV1A 1C9HA 1D7JA 3NRKA 2RUDA 1NMVA 2PPNA 5J6EA 5HW6A 3O5LA 1NSGA 1YATA 2ZQTA 3EY6A 4ODLA 3WH0A 1FKGA 3LUOA 4DRKA 2VN1A 4TNSA 5GPGA 4JFKA 5HT1A 4DIPA 3O5JA 1F40A 1D7HA 2XP5A 2ZQSA
chains in the Genus database with same CATH superfamily
1KT1A 1W1PA 2AOSA 3AQUA 2A3EA 1LL4A 5DF0A 3WQWA 2G8ZA 4DRNA 4DRPA 1W1VA 1PBKA 4QT3A 1PINA 3QOKA 2XP6A 2DSVA 4FAPA 3O5FA 2WM0A 2DG9A 1UR9A 4U86A 1TFVA 4JFIA 1JCHB 4R0XA 2M08A 3BMBA 1HJWA 1HXVA 1FKLA 1W26A 4P8UA 1FKRA 3ARVA 1RD6A 4FN2A 1JVWA 1K9TA 2F21A 1FKDA 2OLHA 3O5RA 2XP3A 1A7XA 2MPHA 1FKKA 5HBFA 1Q6HA 4IPXA 3ARQA 2A3CA 2VCDA 2M1IA 2F2DA 1LL7A 3KACA 3JXVA 1D2KA 3CGMA 4DRQA 1U79A 3B9EA 3NI6A 2LKNA 2DSZA 4JFLA 4S3JA 1NMWA 1W9VA 2KE0A 5B8IC 4ML4A 2LJ4A 1NWSA 5HWCA 2N87A 3O5KA 2XP9A 3RFWA 1B6CA 3UI6A 2ITKA 4LAYA 3ARPA 2RUQA 3RMEA 1ROTA 1ZL1A 5JH8A 2K8IA 3KADA 1TCOC 2XP7A 1FKSA 3FAPA 1ZBCA 4QT2A 1P5QA 3IKGA 4GIVA 2A3BA 1ZK6A 4NSBA 4Z2IA 4HARA 1UR8A 4DWSC 3UQAA 4HBEA 4MNMA 3UI4A 1ROUA 1W1YA 3KCEA 3O5OA 2XP4A 3GU0A 2PV3A 3FY1A 3O5QA 2KR7A 3PRDA 2PV1A 2WLYA 1D7JA 1NMVA 2PPNA 3ARRA 3BXWA 4QZVB 5HUAA 4AY1A 1XRVA 3RM9A 3CHDA 3OA5A 4IT4A 3UF8A 4P8WA 4DZ2A 4U85A 1EHNA 2Q5AA 1ZB5A 4J4OA 1JNTA 1EIBA 3B9AA 1XHGA 4ODQA 2Y78A 3WD4A 2IF4A 2LGOA 4MPKA 3ODKA 3WQVA 1FKTA 2DT2A 4ODRA 1QZ2A 1M5YA 3TCZA 1LL6A 1CTNA 4N19A 1J4RA 4NNRA 1Q6UA 4HBOA 5HW7A 4IT6A 4MNKA 4MNJA 2PPOA 2L2SA 5DITA 2G41A 4ZPVR 2UZ5A 1KT0A 3ARUA 3KAFA 1EYMA 4WKHA 1W9UA 3FXYA 3VAWA 4WJXA 4GGQA 4J4NA 4KQZA 5GPRA 3WL1A 3WIJA 3UQIA 4QIBA 4Z2KA 3WKZA 2RUCA 1BL4A 3PA7A 3WD0A 4JYSA 3IHZA 4DT4A 1ZBKA 2DG4A 4DH0A 1FFRA 3CZ8A 4G2PA 3B9DA 3WD3A 1SR0A 2OFNA 4TW8A 3AS3A 2B31A 3ARTA 3O5EA 3JYMA 3G6LA 3RGCA 1N1AA 3O5GA 2PPPA 3ARYA 2DSWA 3B8SA 4BF8A 4TX0A 4O2TA 1J4HA 3ALGA 3WL0A 1JNDA 3KAGA 1ZBWA 1ZU8A 3AS1A 1ITXA 1WNOA 1Q1CA 4WKFA 1WB0A 1C9HA 2P4VA 3CHFA 2RUDA 5J6EA 5HW6A 1NSGA 1YATA 4ODLA 1OGBA 3WH0A 1LQ0A 2VN1A 4DIPA 4JFKA 4DRJA 4Z2LA 3O5JA 1D7HA 5DEZA 1E44A 4W9OA 2KO7A 3I6CA 4Q7NA 3EIPA 3O5MA 4G50A 4W9PA 1FKIA 1E6RA 5HWBA 2PBCA 1FJDA 2ZR5A 3PRAA 3CHEA 1EQ3A 2QF8A 1HKMA 1HKJA 2XPBA 1HKKA 3RM4A 5HKGA 2IUZA 4TW7A 4WKAA 2JZVA 4WIWA 4JFMA 1FKJA 4ZS6A 2ZR4A 4DROA 1ZBVA 4Z2JA 4MAVA 4C02B 3KAHA 4Z2GA 1J6YA 1GPFA 3NTPA 3ARZA 1NH6A 4LAVA 4LAXA 1YW5A 4DRIA 1D6OA 2F23A 3AROA 3UQBA 2A3AA 1LG2A 3MDYB 2B5UB 1X6LA 2PI6A 4ZPTR 1JNEA 4L72B 4XAKA 1H0IA 1SYTA 2DT3A 4MNLA 1E6PA 4DWSD 4URIA 1LJYA 1HKIA 4ODMA 5DIVA 3O5IA 1F8AB 4MGVA 2YBTA 3IKDA 3H9RB 4UDMA 2O92A 1W1TA 4W5UA 1E15A 3ARWA 4ODOA 2KFWA 3CGNA 1KFWA 2MLXA 2F4EA 1E6ZA 1FKFA 1NWTA 1OGGA 4L3NA 1O6IA 5HW8A 4P8VA 2MLZA 1NWRA 2RSEA 3KABA 4TYOA 2ZQUA 2ETNA 3B7XA 2DG3A 1WAWA 2FDMA 4WK9A 1OWQA 3CHCA 3ALFA 3NRKA 3ARXA 3ARSA 4Z2HA 2WK2A 3EY6A 1LG1A 1FKGA 3LUOA 4DRKA 4NZCA 5GPGA 3CH9A 4U84A 1D7IA 1GRJA 4DRHA 3WD2A 3PR9A 4W9QA 5GQBA 2PN0A 1NWUA 4JFJA 2AWGA 2MF9A 2DT1A 3JYJA 1JNSA 2ZR6A 1BKFA 1ZCNA 1X6NA 5I98A 1FKBA 2FKEA 4KR0B 4ODKA 2MNTA 2RURA 4DRMA 3IK8A 4IQ2A 5DO2A 2ZQVA 3PRBA 1QPFA 1FAPA 4R5EA 3W4RA 1VF8A 1E9LA 4ITZA 2RQSA 2LPVA 2XP8A 4ODNA 1FFQA 2FAPA 2ESCA 3O5DA 4MSPA 1EDQA 1HJXA 1GOIA 2KI3A 3G6MA 5DIUA 4ODPA 2KGJA 4DZ3A 1L1PA 2MLYA 3TC5A 4PTMA 2DSUA 1IX5A 4MTVA 3AS2A 3TDBA 1Y0OA 2M2AA 3GPKA 1W9PA 2DT0A 3WD1A 1H0GA 1E6NA 5BXJA 2D9FA 1Q6IA 3GTYX 1R9HA 4ZPWR 3KZ7A 3UI5A 1FD9A 3OOBA 4TW6A 2XPAA 4IQCA 3RM8A 1QPLA 4P8XA 1HJVA 4LGXA 4LAWA 4DWSA 2WLZA 4Q22A 1GUVA 2DPEA 4DWSB 2O9OA 1J4IA 5HTGA 3KAIA 2PV2A 1T11A 2EULA 1FKHA 3O5PA 5D75A 3AS0A 3O5LA 2ZQTA 2YBUA 5HT1A 4TNSA 1F40A 4S3KA 2XP5A 2ZQSA
chains in the Genus database with same CATH topology
1KT1A 1W1PA 2AOSA 3AQUA 2A3EA 1LL4A 5DF0A 3WQWA 2G8ZA 4DRNA 4DRPA 1W1VA 1PBKA 4QT3A 1PINA 3QOKA 2XP6A 2DSVA 4FAPA 3O5FA 2WM0A 2DG9A 1UR9A 4U86A 1TFVA 4JFIA 4R0XA 2M08A 1HJWA 1HXVA 1FKLA 1W26A 4P8UA 1FKRA 3ARVA 1RD6A 4FN2A 1JVWA 1K9TA 2F21A 1FKDA 2OLHA 3O5RA 2XP3A 1A7XA 2MPHA 1FKKA 5HBFA 1Q6HA 4IPXA 3ARQA 2A3CA 2VCDA 2M1IA 2F2DA 1LL7A 3KACA 3JXVA 1D2KA 3CGMA 4DRQA 1U79A 3B9EA 3NI6A 2LKNA 2DSZA 4JFLA 4S3JA 1NMWA 1W9VA 2KE0A 5B8IC 4ML4A 2LJ4A 1NWSA 5HWCA 2N87A 3O5KA 2XP9A 3RFWA 1B6CA 3UI6A 2ITKA 4LAYA 3ARPA 2RUQA 3RMEA 1ROTA 1ZL1A 5JH8A 2K8IA 3KADA 1TCOC 2XP7A 1FKSA 3FAPA 1ZBCA 4QT2A 1P5QA 3IKGA 4GIVA 2A3BA 1ZK6A 4NSBA 4Z2IA 4HARA 1UR8A 4DWSC 3UQAA 4HBEA 4MNMA 3UI4A 1ROUA 1W1YA 3KCEA 3O5OA 2XP4A 2PV3A 3FY1A 3O5QA 2KR7A 3PRDA 2PV1A 2WLYA 1D7JA 1NMVA 2PPNA 3ARRA 3BXWA 4QZVB 5HUAA 4AY1A 1XRVA 3RM9A 3CHDA 3OA5A 4IT4A 3UF8A 4P8WA 4DZ2A 4U85A 1EHNA 2Q5AA 1ZB5A 4J4OA 1JNTA 1EIBA 3B9AA 1XHGA 4ODQA 2Y78A 3WD4A 2IF4A 2LGOA 4MPKA 3ODKA 3WQVA 1FKTA 2DT2A 4ODRA 1QZ2A 1M5YA 3TCZA 1LL6A 1CTNA 4N19A 1J4RA 4NNRA 1Q6UA 4HBOA 5HW7A 4IT6A 4MNKA 4MNJA 2PPOA 2L2SA 5DITA 2G41A 4ZPVR 2UZ5A 1KT0A 3ARUA 3KAFA 1EYMA 4WKHA 1W9UA 3FXYA 3VAWA 4WJXA 4GGQA 4J4NA 4KQZA 5GPRA 3WL1A 3WIJA 3UQIA 4QIBA 4Z2KA 3WKZA 2RUCA 1BL4A 3PA7A 3WD0A 4JYSA 3IHZA 4DT4A 1ZBKA 2DG4A 4DH0A 1FFRA 3CZ8A 4G2PA 3B9DA 3WD3A 1SR0A 2OFNA 4TW8A 3AS3A 2B31A 3ARTA 3O5EA 3JYMA 3G6LA 3RGCA 1N1AA 3O5GA 2PPPA 3ARYA 2DSWA 3B8SA 4BF8A 4TX0A 4O2TA 1J4HA 3ALGA 3WL0A 1JNDA 3AS1A 1ZBWA 1ZU8A 3KAGA 1ITXA 1WNOA 1Q1CA 4WKFA 1WB0A 1C9HA 3CHFA 2RUDA 5J6EA 5HW6A 1NSGA 1YATA 4ODLA 1OGBA 3WH0A 1LQ0A 2VN1A 4DIPA 4JFKA 4DRJA 4Z2LA 3O5JA 1D7HA 5DEZA 4W9OA 2KO7A 3I6CA 4Q7NA 3O5MA 4G50A 4W9PA 1FKIA 1E6RA 5HWBA 2PBCA 1FJDA 2ZR5A 3PRAA 3CHEA 1EQ3A 2QF8A 1HKMA 1HKJA 2XPBA 1HKKA 3RM4A 5HKGA 2IUZA 4TW7A 4WKAA 2JZVA 4WIWA 4JFMA 1FKJA 4ZS6A 2ZR4A 4DROA 1ZBVA 4Z2JA 4MAVA 4C02B 3KAHA 4Z2GA 1J6YA 1GPFA 3NTPA 3ARZA 1NH6A 4LAVA 4LAXA 1YW5A 4DRIA 1D6OA 3AROA 3UQBA 2A3AA 1LG2A 3MDYB 1X6LA 2PI6A 4ZPTR 1JNEA 4L72B 4XAKA 1H0IA 1SYTA 2DT3A 4MNLA 1E6PA 4DWSD 4URIA 1LJYA 1HKIA 4ODMA 5DIVA 3O5IA 1F8AB 4MGVA 2YBTA 3IKDA 3H9RB 2O92A 1W1TA 4W5UA 1E15A 3ARWA 4ODOA 2KFWA 3CGNA 1KFWA 2MLXA 2F4EA 1E6ZA 1FKFA 1NWTA 1OGGA 4L3NA 1O6IA 5HW8A 4P8VA 2MLZA 1NWRA 2RSEA 3KABA 4TYOA 2ZQUA 3B7XA 2DG3A 1WAWA 2FDMA 4WK9A 1OWQA 3CHCA 3ALFA 3NRKA 3ARXA 3ARSA 4Z2HA 2WK2A 3EY6A 1LG1A 1FKGA 3LUOA 4DRKA 4NZCA 5GPGA 3CH9A 4U84A 1D7IA 4DRHA 3WD2A 3PR9A 4W9QA 5GQBA 1NWUA 4JFJA 2AWGA 2MF9A 2DT1A 3JYJA 1JNSA 2ZR6A 1BKFA 1ZCNA 1X6NA 5I98A 1FKBA 2FKEA 4KR0B 4ODKA 2MNTA 2RURA 4DRMA 3IK8A 4IQ2A 5DO2A 2ZQVA 3PRBA 1QPFA 1FAPA 4R5EA 3W4RA 1VF8A 1E9LA 4ITZA 2RQSA 2LPVA 2XP8A 4ODNA 1FFQA 2FAPA 2ESCA 3O5DA 4MSPA 1EDQA 1HJXA 1GOIA 2KI3A 3G6MA 5DIUA 4ODPA 2KGJA 4DZ3A 1L1PA 2MLYA 3TC5A 4PTMA 2DSUA 1IX5A 4MTVA 3AS2A 3TDBA 1Y0OA 2M2AA 3GPKA 1W9PA 2DT0A 3WD1A 1H0GA 1E6NA 5BXJA 2D9FA 1Q6IA 1R9HA 4ZPWR 3KZ7A 3UI5A 1FD9A 3OOBA 4TW6A 2XPAA 4IQCA 3RM8A 1QPLA 4P8XA 1HJVA 4LGXA 4LAWA 4DWSA 2WLZA 4Q22A 1GUVA 2DPEA 4DWSB 2O9OA 1J4IA 5HTGA 3KAIA 2PV2A 1T11A 1FKHA 3O5PA 5D75A 3AS0A 3O5LA 2ZQTA 2YBUA 5HT1A 4TNSA 1F40A 4S3KA 2XP5A 2ZQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT1 A;  1D7I A;  3UF8 A;  4DZ2 A;  4W9O A;  4U85 A;  4DRN A;  4DRH A;  4DRP A;  2Q5A A;  2KO7 A;  3I6C A;  4J4O A;  4W9Q A;  1JNT A;  1PBK A;  4JFJ A;  1PIN A;  4QT3 A;  2AWG A;  4ODQ A;  2MF9 A;  3JYJ A;  2XP6 A;  1JNS A;  2ZR6 A;  2Y78 A;  3O5M A;  1BKF A;  1ZCN A;  5HUA A;  4FAP A;  4G50 A;  4W9P A;  3O5F A;  1FKI A;  5I98 A;  1FKB A;  2DG9 A;  2FKE A;  2IF4 A;  4ODK A;  2MNT A;  4U86 A;  2LGO A;  4JFI A;  5HWB A;  3ODK A;  2RUR A;  2PBC A;  2M08 A;  4R0X A;  4DRM A;  1FJD A;  1FKT A;  2ZR5 A;  4ODR A;  1QZ2 A;  1M5Y A;  3TCZ A;  3IK8 A;  4IQ2 A;  1EQ3 A;  1HXV A;  1FKL A;  2XPB A;  4N19 A;  2ZQV A;  1J4R A;  1W26 A;  3PRB A;  4NNR A;  1QPF A;  5HKG A;  1FAP A;  4TW7 A;  1Q6U A;  1FKR A;  2JZV A;  4FN2 A;  1JVW A;  4JFM A;  1FKJ A;  2ZR4 A;  2F21 A;  1FKD A;  5HW7 A;  3O5R A;  4DRO A;  4ITZ A;  2RQS A;  2XP3 A;  1A7X A;  2PPO A;  2L2S A;  2LPV A;  2XP8 A;  4ODN A;  5DIT A;  2MPH A;  1FKK A;  2FAP A;  2UZ5 A;  1KT0 A;  4C02 B;  3KAF A;  3O5D A;  3KAH A;  4MSP A;  1Q6H A;  1EYM A;  1J6Y A;  4IPX A;  2KI3 A;  3NTP A;  5DIU A;  3VAW A;  4ODP A;  2KGJ A;  4LAV A;  4LAX A;  4GGQ A;  4DZ3 A;  2MLY A;  1YW5 A;  3TC5 A;  1L1P A;  4DRI A;  1D6O A;  4J4N A;  2VCD A;  3UQB A;  3MDY B;  2M1I A;  2F2D A;  5DIV A;  3UQI A;  4DRJ A;  3TDB A;  4QIB A;  3KAC A;  1Y0O A;  3JXV A;  2M2A A;  2RUC A;  1BL4 A;  3CGM A;  1U79 A;  3GPK A;  4DRQ A;  3NI6 A;  3PA7 A;  2LKN A;  4JYS A;  3IHZ A;  2D9F A;  4JFL A;  1Q6I A;  4U84 A;  4DT4 A;  5BXJ A;  1R9H A;  3KZ7 A;  3UI5 A;  2DG4 A;  1NMW A;  4DH0 A;  2KE0 A;  5B8I C;  4G2P A;  2LJ4 A;  1FD9 A;  5HWC A;  2N87 A;  3OOB A;  4TW6 A;  4ODM A;  2OFN A;  2XPA A;  3O5K A;  1F8A B;  3O5I A;  2XP9 A;  4IQC A;  4MGV A;  4TW8 A;  1QPL A;  3RFW A;  3O5E A;  1B6C A;  3JYM A;  3IKD A;  3H9R B;  3UI6 A;  3RGC A;  2ITK A;  4LAY A;  2RUQ A;  4ODO A;  1ROT A;  2KFW A;  3CGN A;  1N1A A;  3O5G A;  2K8I A;  2PPP A;  3KAD A;  2MLX A;  1TCO C;  2XP7 A;  2F4E A;  4LAW A;  1FKF A;  1FKS A;  3FAP A;  4QT2 A;  4BF8 A;  1P5Q A;  4TX0 A;  3IKG A;  4GIV A;  5HW8 A;  4O2T A;  1J4H A;  1ZK6 A;  2MLZ A;  1J4I A;  2RSE A;  3KAB A;  3KAG A;  4TYO A;  5HTG A;  2ZQU A;  1Q1C A;  3B7X A;  3KAI A;  2PV2 A;  1T11 A;  2DG3 A;  3UQA A;  3UI4 A;  1ROU A;  1FKH A;  3KCE A;  3O5O A;  2XP4 A;  3O5P A;  2PV3 A;  3PRD A;  3O5Q A;  2KR7 A;  5D75 A;  2PV1 A;  1C9H A;  1D7J A;  3NRK A;  2RUD A;  1NMV A;  2PPN A;  5J6E A;  5HW6 A;  3O5L A;  1NSG A;  1YAT A;  2ZQT A;  3EY6 A;  4ODL A;  3WH0 A;  1FKG A;  3LUO A;  4DRK A;  2VN1 A;  4TNS A;  5GPG A;  4JFK A;  5HT1 A;  4DIP A;  3O5J A;  1F40 A;  1D7H A;  2XP5 A;  2ZQS A; 
#chains in the Genus database with same CATH topology
 1KT1 A;  1W1P A;  2AOS A;  3AQU A;  2A3E A;  1LL4 A;  5DF0 A;  3WQW A;  2G8Z A;  4DRN A;  4DRP A;  1W1V A;  1PBK A;  4QT3 A;  1PIN A;  3QOK A;  2XP6 A;  2DSV A;  4FAP A;  3O5F A;  2WM0 A;  2DG9 A;  1UR9 A;  4U86 A;  1TFV A;  4JFI A;  1JCH B;  4R0X A;  2M08 A;  3BMB A;  1HJW A;  1HXV A;  1FKL A;  1W26 A;  4P8U A;  1FKR A;  3ARV A;  1RD6 A;  4FN2 A;  1JVW A;  1K9T A;  2F21 A;  1FKD A;  2OLH A;  3O5R A;  2XP3 A;  1A7X A;  2MPH A;  1FKK A;  5HBF A;  1Q6H A;  4IPX A;  3ARQ A;  2A3C A;  2VCD A;  2M1I A;  2F2D A;  1LL7 A;  3KAC A;  3JXV A;  1D2K A;  3CGM A;  4DRQ A;  1U79 A;  3B9E A;  3NI6 A;  2LKN A;  2DSZ A;  4JFL A;  4S3J A;  1NMW A;  1W9V A;  2KE0 A;  5B8I C;  4ML4 A;  2LJ4 A;  1NWS A;  5HWC A;  2N87 A;  3O5K A;  2XP9 A;  3RFW A;  1B6C A;  3UI6 A;  2ITK A;  4LAY A;  3ARP A;  2RUQ A;  3RME A;  1ROT A;  1ZL1 A;  5JH8 A;  2K8I A;  3KAD A;  1TCO C;  2XP7 A;  1FKS A;  3FAP A;  1ZBC A;  4QT2 A;  1P5Q A;  3IKG A;  4GIV A;  2A3B A;  1ZK6 A;  4NSB A;  4Z2I A;  4HAR A;  1UR8 A;  4DWS C;  3UQA A;  4HBE A;  4MNM A;  3UI4 A;  1ROU A;  1W1Y A;  3KCE A;  3O5O A;  2XP4 A;  3GU0 A;  2PV3 A;  3FY1 A;  3O5Q A;  2KR7 A;  3PRD A;  2PV1 A;  2WLY A;  1D7J A;  1NMV A;  2PPN A;  3ARR A;  3BXW A;  4QZV B;  5HUA A;  4AY1 A;  1XRV A;  3RM9 A;  3CHD A;  3OA5 A;  4IT4 A;  3UF8 A;  4P8W A;  4DZ2 A;  4U85 A;  1EHN A;  2Q5A A;  1ZB5 A;  4J4O A;  1JNT A;  1EIB A;  3B9A A;  1XHG A;  4ODQ A;  2Y78 A;  3WD4 A;  2IF4 A;  2LGO A;  4MPK A;  3ODK A;  3WQV A;  1FKT A;  2DT2 A;  4ODR A;  1QZ2 A;  1M5Y A;  3TCZ A;  1LL6 A;  1CTN A;  4N19 A;  1J4R A;  4NNR A;  1Q6U A;  4HBO A;  5HW7 A;  4IT6 A;  4MNK A;  4MNJ A;  2PPO A;  2L2S A;  5DIT A;  2G41 A;  4ZPV R;  2UZ5 A;  1KT0 A;  3ARU A;  3KAF A;  1EYM A;  4WKH A;  1W9U A;  3FXY A;  3VAW A;  4WJX A;  4GGQ A;  4J4N A;  4KQZ A;  5GPR A;  3WL1 A;  3WIJ A;  3UQI A;  4QIB A;  4Z2K A;  3WKZ A;  2RUC A;  1BL4 A;  3PA7 A;  3WD0 A;  4JYS A;  3IHZ A;  4DT4 A;  1ZBK A;  2DG4 A;  4DH0 A;  1FFR A;  3CZ8 A;  4G2P A;  3B9D A;  3WD3 A;  1SR0 A;  2OFN A;  4TW8 A;  3AS3 A;  2B31 A;  3ART A;  3O5E A;  3JYM A;  3G6L A;  3RGC A;  1N1A A;  3O5G A;  2PPP A;  3ARY A;  2DSW A;  3B8S A;  4BF8 A;  4TX0 A;  4O2T A;  1J4H A;  3ALG A;  3WL0 A;  1JND A;  3KAG A;  1ZBW A;  1ZU8 A;  3AS1 A;  1ITX A;  1WNO A;  1Q1C A;  4WKF A;  1WB0 A;  1C9H A;  2P4V A;  3CHF A;  2RUD A;  5J6E A;  5HW6 A;  1NSG A;  1YAT A;  4ODL A;  1OGB A;  3WH0 A;  1LQ0 A;  2VN1 A;  4DIP A;  4JFK A;  4DRJ A;  4Z2L A;  3O5J A;  1D7H A;  5DEZ A;  1E44 A;  4W9O A;  2KO7 A;  3I6C A;  4Q7N A;  3EIP A;  3O5M A;  4G50 A;  4W9P A;  1FKI A;  1E6R A;  5HWB A;  2PBC A;  1FJD A;  2ZR5 A;  3PRA A;  3CHE A;  1EQ3 A;  2QF8 A;  1HKM A;  1HKJ A;  2XPB A;  1HKK A;  3RM4 A;  5HKG A;  2IUZ A;  4TW7 A;  4WKA A;  2JZV A;  4WIW A;  4JFM A;  1FKJ A;  4ZS6 A;  2ZR4 A;  4DRO A;  1ZBV A;  4Z2J A;  4MAV A;  4C02 B;  3KAH A;  4Z2G A;  1J6Y A;  1GPF A;  3NTP A;  3ARZ A;  1NH6 A;  4LAV A;  4LAX A;  1YW5 A;  4DRI A;  1D6O A;  2F23 A;  3ARO A;  3UQB A;  2A3A A;  1LG2 A;  3MDY B;  2B5U B;  1X6L A;  2PI6 A;  4ZPT R;  1JNE A;  4L72 B;  4XAK A;  1H0I A;  1SYT A;  2DT3 A;  4MNL A;  1E6P A;  4DWS D;  4URI A;  1LJY A;  1HKI A;  4ODM A;  5DIV A;  3O5I A;  1F8A B;  4MGV A;  2YBT A;  3IKD A;  3H9R B;  4UDM A;  2O92 A;  1W1T A;  4W5U A;  1E15 A;  3ARW A;  4ODO A;  2KFW A;  3CGN A;  1KFW A;  2MLX A;  2F4E A;  1E6Z A;  1FKF A;  1NWT A;  1OGG A;  4L3N A;  1O6I A;  5HW8 A;  4P8V A;  2MLZ A;  1NWR A;  2RSE A;  3KAB A;  4TYO A;  2ZQU A;  2ETN A;  3B7X A;  2DG3 A;  1WAW A;  2FDM A;  4WK9 A;  1OWQ A;  3CHC A;  3ALF A;  3NRK A;  3ARX A;  3ARS A;  4Z2H A;  2WK2 A;  3EY6 A;  1LG1 A;  1FKG A;  3LUO A;  4DRK A;  4NZC A;  5GPG A;  3CH9 A;  4U84 A;  1D7I A;  1GRJ A;  4DRH A;  3WD2 A;  3PR9 A;  4W9Q A;  5GQB A;  2PN0 A;  1NWU A;  4JFJ A;  2AWG A;  2MF9 A;  2DT1 A;  3JYJ A;  1JNS A;  2ZR6 A;  1BKF A;  1ZCN A;  1X6N A;  5I98 A;  1FKB A;  2FKE A;  4KR0 B;  4ODK A;  2MNT A;  2RUR A;  4DRM A;  3IK8 A;  4IQ2 A;  5DO2 A;  2ZQV A;  3PRB A;  1QPF A;  1FAP A;  4R5E A;  3W4R A;  1VF8 A;  1E9L A;  4ITZ A;  2RQS A;  2LPV A;  2XP8 A;  4ODN A;  1FFQ A;  2FAP A;  2ESC A;  3O5D A;  4MSP A;  1EDQ A;  1HJX A;  1GOI A;  2KI3 A;  3G6M A;  5DIU A;  4ODP A;  2KGJ A;  4DZ3 A;  1L1P A;  2MLY A;  3TC5 A;  4PTM A;  2DSU A;  1IX5 A;  4MTV A;  3AS2 A;  3TDB A;  1Y0O A;  2M2A A;  3GPK A;  1W9P A;  2DT0 A;  3WD1 A;  1H0G A;  1E6N A;  5BXJ A;  2D9F A;  1Q6I A;  3GTY X;  1R9H A;  4ZPW R;  3KZ7 A;  3UI5 A;  1FD9 A;  3OOB A;  4TW6 A;  2XPA A;  4IQC A;  3RM8 A;  1QPL A;  4P8X A;  1HJV A;  4LGX A;  4LAW A;  4DWS A;  2WLZ A;  4Q22 A;  1GUV A;  2DPE A;  4DWS B;  2O9O A;  1J4I A;  5HTG A;  3KAI A;  2PV2 A;  1T11 A;  2EUL A;  1FKH A;  3O5P A;  5D75 A;  3AS0 A;  3O5L A;  2ZQT A;  2YBU A;  5HT1 A;  4TNS A;  1F40 A;  4S3K A;  2XP5 A;  2ZQS A; 
#chains in the Genus database with same CATH homology
 1KT1 A;  1W1P A;  2AOS A;  3AQU A;  2A3E A;  1LL4 A;  5DF0 A;  3WQW A;  2G8Z A;  4DRN A;  4DRP A;  1W1V A;  1PBK A;  4QT3 A;  1PIN A;  3QOK A;  2XP6 A;  2DSV A;  4FAP A;  3O5F A;  2WM0 A;  2DG9 A;  1UR9 A;  4U86 A;  1TFV A;  4JFI A;  4R0X A;  2M08 A;  1HJW A;  1HXV A;  1FKL A;  1W26 A;  4P8U A;  1FKR A;  3ARV A;  1RD6 A;  4FN2 A;  1JVW A;  1K9T A;  2F21 A;  1FKD A;  2OLH A;  3O5R A;  2XP3 A;  1A7X A;  2MPH A;  1FKK A;  5HBF A;  1Q6H A;  4IPX A;  3ARQ A;  2A3C A;  2VCD A;  2M1I A;  2F2D A;  1LL7 A;  3KAC A;  3JXV A;  1D2K A;  3CGM A;  4DRQ A;  1U79 A;  3B9E A;  3NI6 A;  2LKN A;  2DSZ A;  4JFL A;  4S3J A;  1NMW A;  1W9V A;  2KE0 A;  5B8I C;  4ML4 A;  2LJ4 A;  1NWS A;  5HWC A;  2N87 A;  3O5K A;  2XP9 A;  3RFW A;  1B6C A;  3UI6 A;  2ITK A;  4LAY A;  3ARP A;  2RUQ A;  3RME A;  1ROT A;  1ZL1 A;  5JH8 A;  2K8I A;  3KAD A;  1TCO C;  2XP7 A;  1FKS A;  3FAP A;  1ZBC A;  4QT2 A;  1P5Q A;  3IKG A;  4GIV A;  2A3B A;  1ZK6 A;  4NSB A;  4Z2I A;  4HAR A;  1UR8 A;  4DWS C;  3UQA A;  4HBE A;  4MNM A;  3UI4 A;  1ROU A;  1W1Y A;  3KCE A;  3O5O A;  2XP4 A;  2PV3 A;  3FY1 A;  3O5Q A;  2KR7 A;  3PRD A;  2PV1 A;  2WLY A;  1D7J A;  1NMV A;  2PPN A;  3ARR A;  3BXW A;  4QZV B;  5HUA A;  4AY1 A;  1XRV A;  3RM9 A;  3CHD A;  3OA5 A;  4IT4 A;  3UF8 A;  4P8W A;  4DZ2 A;  4U85 A;  1EHN A;  2Q5A A;  1ZB5 A;  4J4O A;  1JNT A;  1EIB A;  3B9A A;  1XHG A;  4ODQ A;  2Y78 A;  3WD4 A;  2IF4 A;  2LGO A;  4MPK A;  3ODK A;  3WQV A;  1FKT A;  2DT2 A;  4ODR A;  1QZ2 A;  1M5Y A;  3TCZ A;  1LL6 A;  1CTN A;  4N19 A;  1J4R A;  4NNR A;  1Q6U A;  4HBO A;  5HW7 A;  4IT6 A;  4MNK A;  4MNJ A;  2PPO A;  2L2S A;  5DIT A;  2G41 A;  4ZPV R;  2UZ5 A;  1KT0 A;  3ARU A;  3KAF A;  1EYM A;  4WKH A;  1W9U A;  3FXY A;  3VAW A;  4WJX A;  4GGQ A;  4J4N A;  4KQZ A;  5GPR A;  3WL1 A;  3WIJ A;  3UQI A;  4QIB A;  4Z2K A;  3WKZ A;  2RUC A;  1BL4 A;  3PA7 A;  3WD0 A;  4JYS A;  3IHZ A;  4DT4 A;  1ZBK A;  2DG4 A;  4DH0 A;  1FFR A;  3CZ8 A;  4G2P A;  3B9D A;  3WD3 A;  1SR0 A;  2OFN A;  4TW8 A;  3AS3 A;  2B31 A;  3ART A;  3O5E A;  3JYM A;  3G6L A;  3RGC A;  1N1A A;  3O5G A;  2PPP A;  3ARY A;  2DSW A;  3B8S A;  4BF8 A;  4TX0 A;  4O2T A;  1J4H A;  3ALG A;  3WL0 A;  1JND A;  3AS1 A;  1ZBW A;  1ZU8 A;  3KAG A;  1ITX A;  1WNO A;  1Q1C A;  4WKF A;  1WB0 A;  1C9H A;  3CHF A;  2RUD A;  5J6E A;  5HW6 A;  1NSG A;  1YAT A;  4ODL A;  1OGB A;  3WH0 A;  1LQ0 A;  2VN1 A;  4DIP A;  4JFK A;  4DRJ A;  4Z2L A;  3O5J A;  1D7H A;  5DEZ A;  4W9O A;  2KO7 A;  3I6C A;  4Q7N A;  3O5M A;  4G50 A;  4W9P A;  1FKI A;  1E6R A;  5HWB A;  2PBC A;  1FJD A;  2ZR5 A;  3PRA A;  3CHE A;  1EQ3 A;  2QF8 A;  1HKM A;  1HKJ A;  2XPB A;  1HKK A;  3RM4 A;  5HKG A;  2IUZ A;  4TW7 A;  4WKA A;  2JZV A;  4WIW A;  4JFM A;  1FKJ A;  4ZS6 A;  2ZR4 A;  4DRO A;  1ZBV A;  4Z2J A;  4MAV A;  4C02 B;  3KAH A;  4Z2G A;  1J6Y A;  1GPF A;  3NTP A;  3ARZ A;  1NH6 A;  4LAV A;  4LAX A;  1YW5 A;  4DRI A;  1D6O A;  3ARO A;  3UQB A;  2A3A A;  1LG2 A;  3MDY B;  1X6L A;  2PI6 A;  4ZPT R;  1JNE A;  4L72 B;  4XAK A;  1H0I A;  1SYT A;  2DT3 A;  4MNL A;  1E6P A;  4DWS D;  4URI A;  1LJY A;  1HKI A;  4ODM A;  5DIV A;  3O5I A;  1F8A B;  4MGV A;  2YBT A;  3IKD A;  3H9R B;  2O92 A;  1W1T A;  4W5U A;  1E15 A;  3ARW A;  4ODO A;  2KFW A;  3CGN A;  1KFW A;  2MLX A;  2F4E A;  1E6Z A;  1FKF A;  1NWT A;  1OGG A;  4L3N A;  1O6I A;  5HW8 A;  4P8V A;  2MLZ A;  1NWR A;  2RSE A;  3KAB A;  4TYO A;  2ZQU A;  3B7X A;  2DG3 A;  1WAW A;  2FDM A;  4WK9 A;  1OWQ A;  3CHC A;  3ALF A;  3NRK A;  3ARX A;  3ARS A;  4Z2H A;  2WK2 A;  3EY6 A;  1LG1 A;  1FKG A;  3LUO A;  4DRK A;  4NZC A;  5GPG A;  3CH9 A;  4U84 A;  1D7I A;  4DRH A;  3WD2 A;  3PR9 A;  4W9Q A;  5GQB A;  1NWU A;  4JFJ A;  2AWG A;  2MF9 A;  2DT1 A;  3JYJ A;  1JNS A;  2ZR6 A;  1BKF A;  1ZCN A;  1X6N A;  5I98 A;  1FKB A;  2FKE A;  4KR0 B;  4ODK A;  2MNT A;  2RUR A;  4DRM A;  3IK8 A;  4IQ2 A;  5DO2 A;  2ZQV A;  3PRB A;  1QPF A;  1FAP A;  4R5E A;  3W4R A;  1VF8 A;  1E9L A;  4ITZ A;  2RQS A;  2LPV A;  2XP8 A;  4ODN A;  1FFQ A;  2FAP A;  2ESC A;  3O5D A;  4MSP A;  1EDQ A;  1HJX A;  1GOI A;  2KI3 A;  3G6M A;  5DIU A;  4ODP A;  2KGJ A;  4DZ3 A;  1L1P A;  2MLY A;  3TC5 A;  4PTM A;  2DSU A;  1IX5 A;  4MTV A;  3AS2 A;  3TDB A;  1Y0O A;  2M2A A;  3GPK A;  1W9P A;  2DT0 A;  3WD1 A;  1H0G A;  1E6N A;  5BXJ A;  2D9F A;  1Q6I A;  1R9H A;  4ZPW R;  3KZ7 A;  3UI5 A;  1FD9 A;  3OOB A;  4TW6 A;  2XPA A;  4IQC A;  3RM8 A;  1QPL A;  4P8X A;  1HJV A;  4LGX A;  4LAW A;  4DWS A;  2WLZ A;  4Q22 A;  1GUV A;  2DPE A;  4DWS B;  2O9O A;  1J4I A;  5HTG A;  3KAI A;  2PV2 A;  1T11 A;  1FKH A;  3O5P A;  5D75 A;  3AS0 A;  3O5L A;  2ZQT A;  2YBU A;  5HT1 A;  4TNS A;  1F40 A;  4S3K A;  2XP5 A;  2ZQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...