1FKLA

Atomic structure of fkbp12-rapaymycin, an immunophilin-immunosuppressant complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
pubmed doi rcsb
molecule tags Rotamase
molecule keywords FK506 BINDING PROTEIN
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fklA00
4LAYA 2XP9A 2PPOA 2LJ4A 2UZ5A 4JFIA 1FJDA 2PV2A 4ODQA 2ZR5A 1P5QA 3O5RA 2Q5AA 3OOBA 4DROA 4DZ2A 3O5JA 1BL4A 2D9FA 3TC5A 2K8IA 1Y0OA 2ZR4A 5BXJA 4IQCA 2JZVA 1Q6HA 3KAGA 2F21A 4GGQA 1FAPA 2ITKA 2KR7A 2MLXA 3TCZA 1FKKA 4NNRA 3UI6A 3O5EA 2RUDA 1FKGA 3O5OA 1PBKA 2LGOA 2RUQA 3NRKA 3KAFA 1JNSA 2XP6A 1ROUA 2Y78A 3NI6A 3FAPA 4MGVA 1D6OA 2AWGA 1J6YA 3KADA 1FKSA 3TDBA 4DZ3A 1F40A 4LAVA 1ROTA 2MF9A 2FKEA 3IKDA 4W9QA 2KGJA 3NTPA 1D7HA 2DG4A 4N19A 1EQ3A 4LAWA 2M1IA 2LPVA 3UI4A 1PINA 3RGCA 3PA7A 1FKRA 1FKFA 4J4NA 5HW8A 4W9OA 3H9RB 1FKLA 1J4IA 2XP4A 3IKGA 4J4OA 3I6CA 4ODKA 4ODLA 5I98A 1T11A 2F2DA 1NSGA 2RSEA 3UQAA 1D7JA 1FKBA 1Q6UA 4ODPA 3UI5A 2MPHA 1N1AA 2KFWA 2XPBA 2XP5A 4JFJA 3KCEA 2OFNA 3JYJA 1C9HA 1FD9A 5DIUA 2FAPA 3MDYB 3O5PA 4DRMA 5DIVA 1J4RA 3VAWA 2VCDA 2XPAA 1Q6IA 1R9HA 5B8IC 4G50A 4MSPA 4TW7A 5GPGA 3UQBA 1Q1CA 4JFLA 4DRIA 3JXVA 3LUOA 4U84A 5HKGA 4W9PA 4DRQA 4QIBA 4ODRA 3WH0A 1FKJA 3JYMA 4IPXA 2ZR6A 4JFMA 2PV1A 4JYSA 1JVWA 2PPNA 2DG3A 4C02B 4DRKA 1TCOC 1W26A 1YATA 1A7XA 4TNSA 2M2AA 3O5GA 3UQIA 2LKNA 1NMVA 1M5YA 2M08A 2PV3A 3KACA 3UF8A 4DH0A 1L1PA 2MLZA 2PBCA 2ZQUA 4ITZA 3CGMA 4ODMA 4U86A 1KT0A 1FKTA 3PRBA 4QT2A 1YW5A 3B7XA 4GIVA 5J6EA 4TW8A 3O5FA 3O5QA 1ZK6A 2RURA 4ODNA 3PRDA 2KE0A 2XP7A 2ZQTA 2KI3A 3IK8A 3ODKA 1QPFA 1B6CA 3CGNA 3KABA 4TW6A 1QPLA 4U85A 1KT1A 4G2PA 4BF8A 2MLYA 4FN2A 4DT4A 5DITA 1U79A 4JFKA 1FKIA 1JNTA 4QT3A 5D75A 5HT1A 5HUAA 1HXVA 2DG9A 2ZQVA 4R0XA 4ODOA 4O2TA 5HW6A 2F4EA 3O5KA 2RQSA 2PPPA 1F8AB 5HWCA 1D7IA 3O5IA 2L2SA 1J4HA 3KZ7A 4LAXA 4IQ2A 5HW7A 3O5DA 1FKDA 2XP8A 3RFWA 3KAIA 1QZ2A 4TX0A 4DRNA 4DRPA 2XP3A 4TYOA 4FAPA 2VN1A 2ZQSA 4DRJA 2MNTA 1BKFA 1ZCNA 2N87A 3GPKA 5HTGA 5HWBA 2RUCA 3IHZA 4DRHA 4DIPA 2KO7A 3O5LA 1EYMA 1FKHA 3KAHA 2IF4A 3EY6A 3O5MA 1NMWA
chains in the Genus database with same CATH superfamily
2XP9A 2PPOA 3RM8A 4HARA 4ODQA 4DZ2A 4AY1A 3CHEA 1NWRA 4P8UA 1BL4A 1LL4A 5BXJA 1FFRA 3KAGA 1FAPA 2ITKA 2KR7A 3G6LA 4NNRA 1E6PA 3UI6A 3O5OA 1PBKA 1ZB5A 3NRKA 5DF0A 2XP6A 2Y78A 4MGVA 1D6OA 2AWGA 1GPFA 1FKSA 4DZ3A 2MF9A 3WD2A 2DG4A 2G8ZA 4N19A 2LPVA 3QOKA 2A3AA 1LG1A 1HJVA 3H9RB 4J4OA 2ETNA 2F2DA 2ESCA 4ODPA 3ARVA 3UI5A 1N1AA 2DSVA 3WIJA 2A3CA 1JNEA 1CTNA 1C9HA 4DRMA 3MDYB 2XPAA 1Q6IA 3AQUA 1OGBA 5GPGA 3UQBA 4JFLA 4HBEA 4U84A 3LUOA 5HKGA 4W9PA 2EULA 1GOIA 4Z2LA 1E44A 2PPNA 5GPRA 1W26A 4ZPTR 1FKRA 4XAKA 3RM9A 2LKNA 1L1PA 3G6MA 4U86A 1KT0A 1FKTA 4GIVA 2DT2A 3O5QA 3WQWA 1ITXA 2KI3A 3ARUA 1QPFA 1B6CA 3CGNA 1WB0A 4U85A 4G2PA 3FXYA 1U79A 1VF8A 4QT3A 1HXVA 3WKZA 4R0XA 4ZPWR 3ARTA 3W4RA 5HW6A 3ARSA 4Z2JA 1F8AB 3PR9A 3KZ7A 2YBUA 5DO2A 2XP3A 4P8VA 2DSWA 2VN1A 1NWTA 2MNTA 1BKFA 1ZCNA 2DSZA 2KO7A 3AS1A 1FKHA 2A3BA 3EY6A 4LAYA 2UZ5A 1FJDA 2PV2A 3GTYX 4Z2KA 2DSUA 2Q5AA 3O5JA 2D9FA 4URIA 4IT4A 2F21A 1WAWA 4S3KA 3TCZA 2WK2A 2DT3A 2WLYA 4DWSB 2RUQA 1JNSA 4MNLA 2IUZA 3FAPA 3ARPA 2WLZA 3KADA 4W9QA 2KGJA 1W9PA 3NTPA 1GRJA 1ZBCA 3UI4A 3PA7A 4J4NA 5HW8A 1FKLA 1W1VA 1HJXA 2XP4A 5I98A 1NSGA 2RSEA 1D7JA 1Q6UA 2MPHA 3WL1A 4S3JA 4UDMA 2QF8A 3KCEA 1W1TA 1E9LA 5DIUA 2A3EA 4PTMA 1NH6A 1ZBWA 2VCDA 4G50A 3ARZA 4MSPA 4WKHA 4TW7A 3ARXA 4DRIA 1LL7A 1RD6A 1O6IA 4DRQA 3JYMA 4IPXA 2PV1A 4JYSA 4C02B 1JCHB 1TCOC 3UQAA 2M2AA 3O5GA 5GQBA 3UQIA 1NMVA 1TFVA 1HKMA 2MLZA 3CGMA 4ODMA 4QT2A 4TW8A 3O5FA 3WD4A 1ZK6A 4ODNA 2KE0A 2ZQTA 3ODKA 3KABA 1KT1A 2MLYA 4WJXA 5HBFA 5HUAA 2O92A 3BMBA 4O2TA 1HKIA 3O5KA 5HWCA 4HBOA 2L2SA 2F23A 4IQ2A 1W9VA 3O5DA 1FKDA 1NWSA 1QZ2A 4DRNA 2ZQSA 5HWBA 2N87A 1LJYA 3VAWA 3O5MA 3ARQA 3CZ8A 2LJ4A 4JFIA 1IX5A 2ZR5A 1P5QA 3OOBA 4DROA 4KR0B 2K8IA 1Y0OA 2ZR4A 4Z2IA 2JZVA 1Q6HA 1XHGA 4Z2HA 3ARWA 4GGQA 3CHCA 3O5EA 3CH9A 1FKGA 3KAFA 4ZS6A 1J6YA 1W1PA 3ARRA 4Q22A 1F40A 1E15A 1EDQA 3ARYA 1D7HA 1E6NA 4WKAA 4QZVB 4LAWA 1PINA 1FKFA 1J4IA 2G41A 4ODKA 4ODLA 1T11A 2FDMA 4DWSA 1FKBA 1E6ZA 2KFWA 5JH8A 4IT6A 2XP5A 4JFJA 1W9UA 4NZCA 1H0IA 3JYJA 1FD9A 3O5PA 1H0GA 5B8IC 1ZBKA 1HKKA 3ALGA 3JXVA 4QIBA 4ODRA 2ZR6A 4JFMA 4MNJA 1YATA 1A7XA 4LGXA 4Q7NA 4TNSA 4WKFA 3KACA 2PBCA 3WD3A 1UR8A 1SR0A 3PRBA 1NWUA 3B7XA 5J6EA 2PI6A 3IK8A 3CHDA 1QPLA 4BF8A 5DITA 1EIBA 1WNOA 1JNTA 2DG9A 1FFQA 2ZQVA 4ODOA 3OA5A 1KFWA 3AROA 2PPPA 1D7IA 4Z2GA 4LAXA 5HW7A 2DPEA 3KAIA 4TX0A 4TYOA 3ALFA 3RMEA 5HTGA 2RUCA 4DIPA 3KAHA 1NMWA 3B9AA 4L72B 1OGGA 3O5RA 4WK9A 4ZPVR 3TC5A 1UR9A 4IQCA 4MNMA 1SYTA 1X6NA 3GU0A 1XRVA 2MLXA 1FKKA 2RUDA 3WL0A 2LGOA 1ROUA 3NI6A 3TDBA 1E6RA 3EIPA 4LAVA 1ROTA 3IKDA 2FKEA 1ZL1A 1EQ3A 1OWQA 1JNDA 2M1IA 3RGCA 4DWSC 4DWSD 4W9OA 1HKJA 3IKGA 4W5UA 1EHNA 2P4VA 3I6CA 1D2KA 4NSBA 4MAVA 5DEZA 2XPBA 2DT1A 2OFNA 4P8WA 3WQVA 2FAPA 5DIVA 1J4RA 3FY1A 3AS3A 1R9HA 3RM4A 1Q1CA 3AS2A 1HJWA 2OLHA 3WH0A 1FKJA 4L3NA 1ZU8A 3WD0A 1JVWA 2DG3A 3BXWA 4DRKA 2DT0A 4DRJA 2O9OA 1M5YA 2M08A 2PV3A 4DH0A 3UF8A 2ZQUA 4ITZA 4WIWA 4R5EA 3B9EA 1LG2A 1YW5A 2B5UB 3CHFA 1GUVA 2RURA 1ZBVA 3PRDA 2XP7A 4TW6A 2AOSA 2YBTA 2PN0A 1K9TA 4FN2A 4DT4A 4ML4A 4JFKA 1FKIA 2IF4A 4MNKA 5D75A 5HT1A 2F4EA 1LL6A 2RQSA 3O5IA 4KQZA 2WM0A 1J4HA 2B31A 3WD1A 1LQ0A 2XP8A 3B9DA 3RFWA 4FAPA 4DRPA 3PRAA 3B8SA 3GPKA 3IHZA 4DRHA 4P8XA 3O5LA 1EYMA 1W1YA 4MPKA 3AS0A 1X6LA 4MTVA
chains in the Genus database with same CATH topology
2XP9A 2PPOA 3RM8A 4HARA 4ODQA 4DZ2A 4AY1A 3CHEA 1NWRA 4P8UA 1BL4A 1LL4A 5BXJA 1FFRA 3KAGA 1FAPA 2ITKA 2KR7A 3G6LA 4NNRA 1E6PA 3UI6A 3O5OA 1PBKA 1ZB5A 3NRKA 5DF0A 2XP6A 2Y78A 4MGVA 1D6OA 2AWGA 1GPFA 1FKSA 4DZ3A 2MF9A 3WD2A 2DG4A 2G8ZA 4N19A 2LPVA 3QOKA 2A3AA 1LG1A 1HJVA 3H9RB 4J4OA 2F2DA 2ESCA 4ODPA 3ARVA 3UI5A 1N1AA 2DSVA 3WIJA 2A3CA 1JNEA 1CTNA 1C9HA 4DRMA 3MDYB 2XPAA 1Q6IA 3AQUA 1OGBA 5GPGA 3UQBA 4JFLA 4HBEA 4U84A 3LUOA 5HKGA 4W9PA 1GOIA 4Z2LA 2PPNA 5GPRA 1W26A 4ZPTR 1FKRA 4XAKA 3RM9A 2LKNA 1L1PA 3G6MA 4U86A 1KT0A 1FKTA 4GIVA 2DT2A 3O5QA 3WQWA 1ITXA 2KI3A 3ARUA 1QPFA 1B6CA 3CGNA 1WB0A 4U85A 4G2PA 3FXYA 1U79A 1VF8A 4QT3A 1HXVA 3WKZA 4R0XA 4ZPWR 3ARTA 3W4RA 5HW6A 3ARSA 4Z2JA 1F8AB 3PR9A 3KZ7A 2YBUA 5DO2A 2XP3A 4P8VA 2DSWA 2VN1A 1NWTA 2MNTA 1BKFA 1ZCNA 2DSZA 2KO7A 3AS1A 1FKHA 2A3BA 3EY6A 4LAYA 2UZ5A 1FJDA 2PV2A 4Z2KA 2DSUA 2Q5AA 3O5JA 2D9FA 4URIA 4IT4A 2F21A 1WAWA 4S3KA 3TCZA 2WK2A 2DT3A 2WLYA 4DWSB 2RUQA 1JNSA 4MNLA 2IUZA 3FAPA 3ARPA 2WLZA 3KADA 4W9QA 2KGJA 1W9PA 3NTPA 1ZBCA 3UI4A 3PA7A 4J4NA 5HW8A 1FKLA 1W1VA 1HJXA 2XP4A 5I98A 1NSGA 2RSEA 1D7JA 1Q6UA 2MPHA 3WL1A 4S3JA 2QF8A 3KCEA 1W1TA 1E9LA 5DIUA 2A3EA 4PTMA 1NH6A 1ZBWA 2VCDA 4G50A 3ARZA 4MSPA 4WKHA 4TW7A 3ARXA 4DRIA 1LL7A 1RD6A 1O6IA 4DRQA 3JYMA 4IPXA 2PV1A 4JYSA 4C02B 1TCOC 3UQAA 2M2AA 3O5GA 5GQBA 3UQIA 1NMVA 1TFVA 1HKMA 2MLZA 3CGMA 4ODMA 4QT2A 4TW8A 3O5FA 3WD4A 1ZK6A 4ODNA 2KE0A 2ZQTA 3ODKA 3KABA 1KT1A 2MLYA 4WJXA 5HBFA 5HUAA 2O92A 4O2TA 1HKIA 3O5KA 5HWCA 4HBOA 2L2SA 4IQ2A 1W9VA 3O5DA 1FKDA 1NWSA 1QZ2A 4DRNA 2ZQSA 5HWBA 2N87A 1LJYA 3VAWA 3O5MA 3ARQA 3CZ8A 2LJ4A 4JFIA 1IX5A 2ZR5A 1P5QA 3OOBA 4DROA 4KR0B 2K8IA 1Y0OA 2ZR4A 4Z2IA 2JZVA 1Q6HA 1XHGA 4Z2HA 3ARWA 4GGQA 3CHCA 3O5EA 3CH9A 1FKGA 3KAFA 4ZS6A 1J6YA 1W1PA 3ARRA 4Q22A 1F40A 1E15A 1EDQA 3ARYA 1D7HA 1E6NA 4WKAA 4QZVB 4LAWA 1PINA 1FKFA 1J4IA 2G41A 4ODKA 4ODLA 1T11A 2FDMA 4DWSA 1FKBA 1E6ZA 2KFWA 5JH8A 4IT6A 2XP5A 4JFJA 1W9UA 4NZCA 1H0IA 3JYJA 1FD9A 3O5PA 1H0GA 5B8IC 1ZBKA 1HKKA 3ALGA 3JXVA 4QIBA 4ODRA 2ZR6A 4JFMA 4MNJA 1YATA 1A7XA 4LGXA 4Q7NA 4TNSA 4WKFA 3KACA 2PBCA 3WD3A 1UR8A 1SR0A 3PRBA 1NWUA 3B7XA 5J6EA 2PI6A 3IK8A 3CHDA 1QPLA 4BF8A 5DITA 1EIBA 1WNOA 1JNTA 2DG9A 1FFQA 2ZQVA 4ODOA 3OA5A 1KFWA 3AROA 2PPPA 1D7IA 4Z2GA 4LAXA 5HW7A 2DPEA 3KAIA 4TX0A 4TYOA 3ALFA 3RMEA 5HTGA 2RUCA 4DIPA 3KAHA 1NMWA 3B9AA 4L72B 1OGGA 3O5RA 4WK9A 4ZPVR 3TC5A 1UR9A 4IQCA 4MNMA 1SYTA 1X6NA 1XRVA 2MLXA 1FKKA 2RUDA 3WL0A 2LGOA 1ROUA 3NI6A 3TDBA 1E6RA 4LAVA 1ROTA 3IKDA 2FKEA 1ZL1A 1EQ3A 1OWQA 1JNDA 2M1IA 3RGCA 4DWSC 4DWSD 4W9OA 1HKJA 3IKGA 4W5UA 1EHNA 3I6CA 1D2KA 4NSBA 4MAVA 5DEZA 2XPBA 2DT1A 2OFNA 4P8WA 3WQVA 2FAPA 5DIVA 1J4RA 3FY1A 3AS3A 1R9HA 3RM4A 1Q1CA 3AS2A 1HJWA 2OLHA 3WH0A 1FKJA 4L3NA 1ZU8A 3WD0A 1JVWA 2DG3A 3BXWA 4DRKA 2DT0A 4DRJA 2O9OA 1M5YA 2M08A 2PV3A 4DH0A 3UF8A 2ZQUA 4ITZA 4WIWA 4R5EA 3B9EA 1LG2A 1YW5A 3CHFA 1GUVA 2RURA 1ZBVA 3PRDA 2XP7A 4TW6A 2AOSA 2YBTA 1K9TA 4FN2A 4DT4A 4ML4A 4JFKA 1FKIA 2IF4A 4MNKA 5D75A 5HT1A 2F4EA 1LL6A 2RQSA 3O5IA 4KQZA 2WM0A 1J4HA 2B31A 3WD1A 1LQ0A 2XP8A 3B9DA 3RFWA 4FAPA 4DRPA 3PRAA 3B8SA 3GPKA 3IHZA 4DRHA 4P8XA 3O5LA 1EYMA 1W1YA 4MPKA 3AS0A 1X6LA 4MTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAY A;  2XP9 A;  2PPO A;  2LJ4 A;  2UZ5 A;  4JFI A;  1FJD A;  2PV2 A;  4ODQ A;  2ZR5 A;  1P5Q A;  3O5R A;  2Q5A A;  3OOB A;  4DRO A;  4DZ2 A;  3O5J A;  1BL4 A;  2D9F A;  3TC5 A;  2K8I A;  1Y0O A;  2ZR4 A;  5BXJ A;  4IQC A;  2JZV A;  1Q6H A;  3KAG A;  2F21 A;  4GGQ A;  1FAP A;  2ITK A;  2KR7 A;  2MLX A;  3TCZ A;  1FKK A;  4NNR A;  3UI6 A;  3O5E A;  2RUD A;  1FKG A;  3O5O A;  1PBK A;  2LGO A;  2RUQ A;  3NRK A;  3KAF A;  1JNS A;  2XP6 A;  1ROU A;  2Y78 A;  3NI6 A;  3FAP A;  4MGV A;  1D6O A;  2AWG A;  1J6Y A;  3KAD A;  1FKS A;  3TDB A;  4DZ3 A;  1F40 A;  4LAV A;  1ROT A;  2MF9 A;  2FKE A;  3IKD A;  4W9Q A;  2KGJ A;  3NTP A;  1D7H A;  2DG4 A;  4N19 A;  1EQ3 A;  4LAW A;  2M1I A;  2LPV A;  3UI4 A;  1PIN A;  3RGC A;  3PA7 A;  1FKR A;  1FKF A;  4J4N A;  5HW8 A;  4W9O A;  3H9R B;  1FKL A;  1J4I A;  2XP4 A;  3IKG A;  4J4O A;  3I6C A;  4ODK A;  4ODL A;  5I98 A;  1T11 A;  2F2D A;  1NSG A;  2RSE A;  3UQA A;  1D7J A;  1FKB A;  1Q6U A;  4ODP A;  3UI5 A;  2MPH A;  1N1A A;  2KFW A;  2XPB A;  2XP5 A;  4JFJ A;  3KCE A;  2OFN A;  3JYJ A;  1C9H A;  1FD9 A;  5DIU A;  2FAP A;  3MDY B;  3O5P A;  4DRM A;  5DIV A;  1J4R A;  3VAW A;  2VCD A;  2XPA A;  1Q6I A;  1R9H A;  5B8I C;  4G50 A;  4MSP A;  4TW7 A;  5GPG A;  3UQB A;  1Q1C A;  4JFL A;  4DRI A;  3JXV A;  3LUO A;  4U84 A;  5HKG A;  4W9P A;  4DRQ A;  4QIB A;  4ODR A;  3WH0 A;  1FKJ A;  3JYM A;  4IPX A;  2ZR6 A;  4JFM A;  2PV1 A;  4JYS A;  1JVW A;  2PPN A;  2DG3 A;  4C02 B;  4DRK A;  1TCO C;  1W26 A;  1YAT A;  1A7X A;  4TNS A;  2M2A A;  3O5G A;  3UQI A;  2LKN A;  1NMV A;  1M5Y A;  2M08 A;  2PV3 A;  3KAC A;  3UF8 A;  4DH0 A;  1L1P A;  2MLZ A;  2PBC A;  2ZQU A;  4ITZ A;  3CGM A;  4ODM A;  4U86 A;  1KT0 A;  1FKT A;  3PRB A;  4QT2 A;  1YW5 A;  3B7X A;  4GIV A;  5J6E A;  4TW8 A;  3O5F A;  3O5Q A;  1ZK6 A;  2RUR A;  4ODN A;  3PRD A;  2KE0 A;  2XP7 A;  2ZQT A;  2KI3 A;  3IK8 A;  3ODK A;  1QPF A;  1B6C A;  3CGN A;  3KAB A;  4TW6 A;  1QPL A;  4U85 A;  1KT1 A;  4G2P A;  4BF8 A;  2MLY A;  4FN2 A;  4DT4 A;  5DIT A;  1U79 A;  4JFK A;  1FKI A;  1JNT A;  4QT3 A;  5D75 A;  5HT1 A;  5HUA A;  1HXV A;  2DG9 A;  2ZQV A;  4R0X A;  4ODO A;  4O2T A;  5HW6 A;  2F4E A;  3O5K A;  2RQS A;  2PPP A;  1F8A B;  5HWC A;  1D7I A;  3O5I A;  2L2S A;  1J4H A;  3KZ7 A;  4LAX A;  4IQ2 A;  5HW7 A;  3O5D A;  1FKD A;  2XP8 A;  3RFW A;  3KAI A;  1QZ2 A;  4TX0 A;  4DRN A;  4DRP A;  2XP3 A;  4TYO A;  4FAP A;  2VN1 A;  2ZQS A;  4DRJ A;  2MNT A;  1BKF A;  1ZCN A;  2N87 A;  3GPK A;  5HTG A;  5HWB A;  2RUC A;  3IHZ A;  4DRH A;  4DIP A;  2KO7 A;  3O5L A;  1EYM A;  1FKH A;  3KAH A;  2IF4 A;  3EY6 A;  3O5M A;  1NMW A; 
#chains in the Genus database with same CATH topology
 2XP9 A;  2PPO A;  3RM8 A;  4HAR A;  4ODQ A;  4DZ2 A;  4AY1 A;  3CHE A;  1NWR A;  4P8U A;  1BL4 A;  1LL4 A;  5BXJ A;  1FFR A;  3KAG A;  1FAP A;  2ITK A;  2KR7 A;  3G6L A;  4NNR A;  1E6P A;  3UI6 A;  3O5O A;  1PBK A;  1ZB5 A;  3NRK A;  5DF0 A;  2XP6 A;  2Y78 A;  4MGV A;  1D6O A;  2AWG A;  1GPF A;  1FKS A;  4DZ3 A;  2MF9 A;  3WD2 A;  2DG4 A;  2G8Z A;  4N19 A;  2LPV A;  3QOK A;  2A3A A;  1LG1 A;  1HJV A;  3H9R B;  4J4O A;  2ETN A;  2F2D A;  2ESC A;  4ODP A;  3ARV A;  3UI5 A;  1N1A A;  2DSV A;  3WIJ A;  2A3C A;  1JNE A;  1CTN A;  1C9H A;  4DRM A;  3MDY B;  2XPA A;  1Q6I A;  3AQU A;  1OGB A;  5GPG A;  3UQB A;  4JFL A;  4HBE A;  4U84 A;  3LUO A;  5HKG A;  4W9P A;  2EUL A;  1GOI A;  4Z2L A;  1E44 A;  2PPN A;  5GPR A;  1W26 A;  4ZPT R;  1FKR A;  4XAK A;  3RM9 A;  2LKN A;  1L1P A;  3G6M A;  4U86 A;  1KT0 A;  1FKT A;  4GIV A;  2DT2 A;  3O5Q A;  3WQW A;  1ITX A;  2KI3 A;  3ARU A;  1QPF A;  1B6C A;  3CGN A;  1WB0 A;  4U85 A;  4G2P A;  3FXY A;  1U79 A;  1VF8 A;  4QT3 A;  1HXV A;  3WKZ A;  4R0X A;  4ZPW R;  3ART A;  3W4R A;  5HW6 A;  3ARS A;  4Z2J A;  1F8A B;  3PR9 A;  3KZ7 A;  2YBU A;  5DO2 A;  2XP3 A;  4P8V A;  2DSW A;  2VN1 A;  1NWT A;  2MNT A;  1BKF A;  1ZCN A;  2DSZ A;  2KO7 A;  3AS1 A;  1FKH A;  2A3B A;  3EY6 A;  4LAY A;  2UZ5 A;  1FJD A;  2PV2 A;  3GTY X;  4Z2K A;  2DSU A;  2Q5A A;  3O5J A;  2D9F A;  4URI A;  4IT4 A;  2F21 A;  1WAW A;  4S3K A;  3TCZ A;  2WK2 A;  2DT3 A;  2WLY A;  4DWS B;  2RUQ A;  1JNS A;  4MNL A;  2IUZ A;  3FAP A;  3ARP A;  2WLZ A;  3KAD A;  4W9Q A;  2KGJ A;  1W9P A;  3NTP A;  1GRJ A;  1ZBC A;  3UI4 A;  3PA7 A;  4J4N A;  5HW8 A;  1FKL A;  1W1V A;  1HJX A;  2XP4 A;  5I98 A;  1NSG A;  2RSE A;  1D7J A;  1Q6U A;  2MPH A;  3WL1 A;  4S3J A;  4UDM A;  2QF8 A;  3KCE A;  1W1T A;  1E9L A;  5DIU A;  2A3E A;  4PTM A;  1NH6 A;  1ZBW A;  2VCD A;  4G50 A;  3ARZ A;  4MSP A;  4WKH A;  4TW7 A;  3ARX A;  4DRI A;  1LL7 A;  1RD6 A;  1O6I A;  4DRQ A;  3JYM A;  4IPX A;  2PV1 A;  4JYS A;  4C02 B;  1JCH B;  1TCO C;  3UQA A;  2M2A A;  3O5G A;  5GQB A;  3UQI A;  1NMV A;  1TFV A;  1HKM A;  2MLZ A;  3CGM A;  4ODM A;  4QT2 A;  4TW8 A;  3O5F A;  3WD4 A;  1ZK6 A;  4ODN A;  2KE0 A;  2ZQT A;  3ODK A;  3KAB A;  1KT1 A;  2MLY A;  4WJX A;  5HBF A;  5HUA A;  2O92 A;  3BMB A;  4O2T A;  1HKI A;  3O5K A;  5HWC A;  4HBO A;  2L2S A;  2F23 A;  4IQ2 A;  1W9V A;  3O5D A;  1FKD A;  1NWS A;  1QZ2 A;  4DRN A;  2ZQS A;  5HWB A;  2N87 A;  1LJY A;  3VAW A;  3O5M A;  3ARQ A;  3CZ8 A;  2LJ4 A;  4JFI A;  1IX5 A;  2ZR5 A;  1P5Q A;  3OOB A;  4DRO A;  4KR0 B;  2K8I A;  1Y0O A;  2ZR4 A;  4Z2I A;  2JZV A;  1Q6H A;  1XHG A;  4Z2H A;  3ARW A;  4GGQ A;  3CHC A;  3O5E A;  3CH9 A;  1FKG A;  3KAF A;  4ZS6 A;  1J6Y A;  1W1P A;  3ARR A;  4Q22 A;  1F40 A;  1E15 A;  1EDQ A;  3ARY A;  1D7H A;  1E6N A;  4WKA A;  4QZV B;  4LAW A;  1PIN A;  1FKF A;  1J4I A;  2G41 A;  4ODK A;  4ODL A;  1T11 A;  2FDM A;  4DWS A;  1FKB A;  1E6Z A;  2KFW A;  5JH8 A;  4IT6 A;  2XP5 A;  4JFJ A;  1W9U A;  4NZC A;  1H0I A;  3JYJ A;  1FD9 A;  3O5P A;  1H0G A;  5B8I C;  1ZBK A;  1HKK A;  3ALG A;  3JXV A;  4QIB A;  4ODR A;  2ZR6 A;  4JFM A;  4MNJ A;  1YAT A;  1A7X A;  4LGX A;  4Q7N A;  4TNS A;  4WKF A;  3KAC A;  2PBC A;  3WD3 A;  1UR8 A;  1SR0 A;  3PRB A;  1NWU A;  3B7X A;  5J6E A;  2PI6 A;  3IK8 A;  3CHD A;  1QPL A;  4BF8 A;  5DIT A;  1EIB A;  1WNO A;  1JNT A;  2DG9 A;  1FFQ A;  2ZQV A;  4ODO A;  3OA5 A;  1KFW A;  3ARO A;  2PPP A;  1D7I A;  4Z2G A;  4LAX A;  5HW7 A;  2DPE A;  3KAI A;  4TX0 A;  4TYO A;  3ALF A;  3RME A;  5HTG A;  2RUC A;  4DIP A;  3KAH A;  1NMW A;  3B9A A;  4L72 B;  1OGG A;  3O5R A;  4WK9 A;  4ZPV R;  3TC5 A;  1UR9 A;  4IQC A;  4MNM A;  1SYT A;  1X6N A;  3GU0 A;  1XRV A;  2MLX A;  1FKK A;  2RUD A;  3WL0 A;  2LGO A;  1ROU A;  3NI6 A;  3TDB A;  1E6R A;  3EIP A;  4LAV A;  1ROT A;  3IKD A;  2FKE A;  1ZL1 A;  1EQ3 A;  1OWQ A;  1JND A;  2M1I A;  3RGC A;  4DWS C;  4DWS D;  4W9O A;  1HKJ A;  3IKG A;  4W5U A;  1EHN A;  2P4V A;  3I6C A;  1D2K A;  4NSB A;  4MAV A;  5DEZ A;  2XPB A;  2DT1 A;  2OFN A;  4P8W A;  3WQV A;  2FAP A;  5DIV A;  1J4R A;  3FY1 A;  3AS3 A;  1R9H A;  3RM4 A;  1Q1C A;  3AS2 A;  1HJW A;  2OLH A;  3WH0 A;  1FKJ A;  4L3N A;  1ZU8 A;  3WD0 A;  1JVW A;  2DG3 A;  3BXW A;  4DRK A;  2DT0 A;  4DRJ A;  2O9O A;  1M5Y A;  2M08 A;  2PV3 A;  4DH0 A;  3UF8 A;  2ZQU A;  4ITZ A;  4WIW A;  4R5E A;  3B9E A;  1LG2 A;  1YW5 A;  2B5U B;  3CHF A;  1GUV A;  2RUR A;  1ZBV A;  3PRD A;  2XP7 A;  4TW6 A;  2AOS A;  2YBT A;  2PN0 A;  1K9T A;  4FN2 A;  4DT4 A;  4ML4 A;  4JFK A;  1FKI A;  2IF4 A;  4MNK A;  5D75 A;  5HT1 A;  2F4E A;  1LL6 A;  2RQS A;  3O5I A;  4KQZ A;  2WM0 A;  1J4H A;  2B31 A;  3WD1 A;  1LQ0 A;  2XP8 A;  3B9D A;  3RFW A;  4FAP A;  4DRP A;  3PRA A;  3B8S A;  3GPK A;  3IHZ A;  4DRH A;  4P8X A;  3O5L A;  1EYM A;  1W1Y A;  4MPK A;  3AS0 A;  1X6L A;  4MTV A; 
#chains in the Genus database with same CATH homology
 2XP9 A;  2PPO A;  3RM8 A;  4HAR A;  4ODQ A;  4DZ2 A;  4AY1 A;  3CHE A;  1NWR A;  4P8U A;  1BL4 A;  1LL4 A;  5BXJ A;  1FFR A;  3KAG A;  1FAP A;  2ITK A;  2KR7 A;  3G6L A;  4NNR A;  1E6P A;  3UI6 A;  3O5O A;  1PBK A;  1ZB5 A;  3NRK A;  5DF0 A;  2XP6 A;  2Y78 A;  4MGV A;  1D6O A;  2AWG A;  1GPF A;  1FKS A;  4DZ3 A;  2MF9 A;  3WD2 A;  2DG4 A;  2G8Z A;  4N19 A;  2LPV A;  3QOK A;  2A3A A;  1LG1 A;  1HJV A;  3H9R B;  4J4O A;  2F2D A;  2ESC A;  4ODP A;  3ARV A;  3UI5 A;  1N1A A;  2DSV A;  3WIJ A;  2A3C A;  1JNE A;  1CTN A;  1C9H A;  4DRM A;  3MDY B;  2XPA A;  1Q6I A;  3AQU A;  1OGB A;  5GPG A;  3UQB A;  4JFL A;  4HBE A;  4U84 A;  3LUO A;  5HKG A;  4W9P A;  1GOI A;  4Z2L A;  2PPN A;  5GPR A;  1W26 A;  4ZPT R;  1FKR A;  4XAK A;  3RM9 A;  2LKN A;  1L1P A;  3G6M A;  4U86 A;  1KT0 A;  1FKT A;  4GIV A;  2DT2 A;  3O5Q A;  3WQW A;  1ITX A;  2KI3 A;  3ARU A;  1QPF A;  1B6C A;  3CGN A;  1WB0 A;  4U85 A;  4G2P A;  3FXY A;  1U79 A;  1VF8 A;  4QT3 A;  1HXV A;  3WKZ A;  4R0X A;  4ZPW R;  3ART A;  3W4R A;  5HW6 A;  3ARS A;  4Z2J A;  1F8A B;  3PR9 A;  3KZ7 A;  2YBU A;  5DO2 A;  2XP3 A;  4P8V A;  2DSW A;  2VN1 A;  1NWT A;  2MNT A;  1BKF A;  1ZCN A;  2DSZ A;  2KO7 A;  3AS1 A;  1FKH A;  2A3B A;  3EY6 A;  4LAY A;  2UZ5 A;  1FJD A;  2PV2 A;  4Z2K A;  2DSU A;  2Q5A A;  3O5J A;  2D9F A;  4URI A;  4IT4 A;  2F21 A;  1WAW A;  4S3K A;  3TCZ A;  2WK2 A;  2DT3 A;  2WLY A;  4DWS B;  2RUQ A;  1JNS A;  4MNL A;  2IUZ A;  3FAP A;  3ARP A;  2WLZ A;  3KAD A;  4W9Q A;  2KGJ A;  1W9P A;  3NTP A;  1ZBC A;  3UI4 A;  3PA7 A;  4J4N A;  5HW8 A;  1FKL A;  1W1V A;  1HJX A;  2XP4 A;  5I98 A;  1NSG A;  2RSE A;  1D7J A;  1Q6U A;  2MPH A;  3WL1 A;  4S3J A;  2QF8 A;  3KCE A;  1W1T A;  1E9L A;  5DIU A;  2A3E A;  4PTM A;  1NH6 A;  1ZBW A;  2VCD A;  4G50 A;  3ARZ A;  4MSP A;  4WKH A;  4TW7 A;  3ARX A;  4DRI A;  1LL7 A;  1RD6 A;  1O6I A;  4DRQ A;  3JYM A;  4IPX A;  2PV1 A;  4JYS A;  4C02 B;  1TCO C;  3UQA A;  2M2A A;  3O5G A;  5GQB A;  3UQI A;  1NMV A;  1TFV A;  1HKM A;  2MLZ A;  3CGM A;  4ODM A;  4QT2 A;  4TW8 A;  3O5F A;  3WD4 A;  1ZK6 A;  4ODN A;  2KE0 A;  2ZQT A;  3ODK A;  3KAB A;  1KT1 A;  2MLY A;  4WJX A;  5HBF A;  5HUA A;  2O92 A;  4O2T A;  1HKI A;  3O5K A;  5HWC A;  4HBO A;  2L2S A;  4IQ2 A;  1W9V A;  3O5D A;  1FKD A;  1NWS A;  1QZ2 A;  4DRN A;  2ZQS A;  5HWB A;  2N87 A;  1LJY A;  3VAW A;  3O5M A;  3ARQ A;  3CZ8 A;  2LJ4 A;  4JFI A;  1IX5 A;  2ZR5 A;  1P5Q A;  3OOB A;  4DRO A;  4KR0 B;  2K8I A;  1Y0O A;  2ZR4 A;  4Z2I A;  2JZV A;  1Q6H A;  1XHG A;  4Z2H A;  3ARW A;  4GGQ A;  3CHC A;  3O5E A;  3CH9 A;  1FKG A;  3KAF A;  4ZS6 A;  1J6Y A;  1W1P A;  3ARR A;  4Q22 A;  1F40 A;  1E15 A;  1EDQ A;  3ARY A;  1D7H A;  1E6N A;  4WKA A;  4QZV B;  4LAW A;  1PIN A;  1FKF A;  1J4I A;  2G41 A;  4ODK A;  4ODL A;  1T11 A;  2FDM A;  4DWS A;  1FKB A;  1E6Z A;  2KFW A;  5JH8 A;  4IT6 A;  2XP5 A;  4JFJ A;  1W9U A;  4NZC A;  1H0I A;  3JYJ A;  1FD9 A;  3O5P A;  1H0G A;  5B8I C;  1ZBK A;  1HKK A;  3ALG A;  3JXV A;  4QIB A;  4ODR A;  2ZR6 A;  4JFM A;  4MNJ A;  1YAT A;  1A7X A;  4LGX A;  4Q7N A;  4TNS A;  4WKF A;  3KAC A;  2PBC A;  3WD3 A;  1UR8 A;  1SR0 A;  3PRB A;  1NWU A;  3B7X A;  5J6E A;  2PI6 A;  3IK8 A;  3CHD A;  1QPL A;  4BF8 A;  5DIT A;  1EIB A;  1WNO A;  1JNT A;  2DG9 A;  1FFQ A;  2ZQV A;  4ODO A;  3OA5 A;  1KFW A;  3ARO A;  2PPP A;  1D7I A;  4Z2G A;  4LAX A;  5HW7 A;  2DPE A;  3KAI A;  4TX0 A;  4TYO A;  3ALF A;  3RME A;  5HTG A;  2RUC A;  4DIP A;  3KAH A;  1NMW A;  3B9A A;  4L72 B;  1OGG A;  3O5R A;  4WK9 A;  4ZPV R;  3TC5 A;  1UR9 A;  4IQC A;  4MNM A;  1SYT A;  1X6N A;  1XRV A;  2MLX A;  1FKK A;  2RUD A;  3WL0 A;  2LGO A;  1ROU A;  3NI6 A;  3TDB A;  1E6R A;  4LAV A;  1ROT A;  3IKD A;  2FKE A;  1ZL1 A;  1EQ3 A;  1OWQ A;  1JND A;  2M1I A;  3RGC A;  4DWS C;  4DWS D;  4W9O A;  1HKJ A;  3IKG A;  4W5U A;  1EHN A;  3I6C A;  1D2K A;  4NSB A;  4MAV A;  5DEZ A;  2XPB A;  2DT1 A;  2OFN A;  4P8W A;  3WQV A;  2FAP A;  5DIV A;  1J4R A;  3FY1 A;  3AS3 A;  1R9H A;  3RM4 A;  1Q1C A;  3AS2 A;  1HJW A;  2OLH A;  3WH0 A;  1FKJ A;  4L3N A;  1ZU8 A;  3WD0 A;  1JVW A;  2DG3 A;  3BXW A;  4DRK A;  2DT0 A;  4DRJ A;  2O9O A;  1M5Y A;  2M08 A;  2PV3 A;  4DH0 A;  3UF8 A;  2ZQU A;  4ITZ A;  4WIW A;  4R5E A;  3B9E A;  1LG2 A;  1YW5 A;  3CHF A;  1GUV A;  2RUR A;  1ZBV A;  3PRD A;  2XP7 A;  4TW6 A;  2AOS A;  2YBT A;  1K9T A;  4FN2 A;  4DT4 A;  4ML4 A;  4JFK A;  1FKI A;  2IF4 A;  4MNK A;  5D75 A;  5HT1 A;  2F4E A;  1LL6 A;  2RQS A;  3O5I A;  4KQZ A;  2WM0 A;  1J4H A;  2B31 A;  3WD1 A;  1LQ0 A;  2XP8 A;  3B9D A;  3RFW A;  4FAP A;  4DRP A;  3PRA A;  3B8S A;  3GPK A;  3IHZ A;  4DRH A;  4P8X A;  3O5L A;  1EYM A;  1W1Y A;  4MPK A;  3AS0 A;  1X6L A;  4MTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...