1FL3B

Crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
214
Chain Sequence
AALTQSPVSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPNRFSSSGSGTDFTLRINTVEAEDVGVYYCAQNLELPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Blue-fluorescent antibodies.
pubmed doi rcsb
molecule tags Immune system
molecule keywords BLUE FLUORESCENT ANTIBODY (19G2)-HEAVY CHAIN
total genus 40
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2000-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3B01
4WTZG 3CSBA 3O2VH 1R3LB 2EDNA 4GRMA 5C9KA 2DQUH 4MJIB 1CFTA 1A7NH 1C16B 4NWUH 2KZWA 1PKQE 3KPRA 1PJ9A 5DMIH 3T0ED 3MGTA 4P2CG 5JW3H 2AQ2A 4P4RB 1UA6L 4NNYB 5IR1B 3LEXB 3QIWC 4NM4L 1TZGL 2QR0B 4L4TD 3CXDH 1DBBH 3CU1A 2VDPH 1T5WB 5DK2A 5I0DA 4NJ9H 4LSUH 2X5PA 4S1QL 1MCOL 3DXAA 4UINL 3ILQC 5D7LD 3EYFA 4Z7VB 5DA4A 1AGEA 1F4WH 4F3FA 1CTOA 4MJ5B 2VZUA 3MJ9H 4NM8L 3OBAA 2J3SA 3T4YB 4CGTA 2DQGL 1I75A 1I7ZB 3EO9L 2RQ8A 1MI5B 4M9OA 5B4MC 2J8OA 1QLFB 1OB1B 9CGTA 4PJ8D 4POZC 4FRWA 1ZTXH 5D9SA 2APXA 2GJZB 3WLWD 5CUSH 4HDIA 4ODSH 1B88A 4X99A 1B90A 3TN0A 1N64L 1QEWA 2G5BA 1CFVH 1RZGA 2X4SB 2J8UF 3QUZA 1NAML 1ACYH 4W6XB 1ZVSA 4ZUSB 2LE9A 3QWQB 4UT6L 5CEYA 2R0ZH 4P9HC 3QNYB 1U8IA 3F7QA 2AJUL 2I27N 4N0CD 1T03L 2AJVH 2NY5C 3CSYA 4HT1H 3RX7A 3C6LA 2VWEC 4WY7L 1VFAB 3VXUD 4APQC 2HG5B 2GJ6A 2H2PC 1FO0H 3TNNA 3WIFB 1KJ2H 4LLWA 3EYFB 1TJHH 4MGXA 3BRFA 3AGVA 1EEYA 1R3HA 5EFIA 3QZWA 4PRDA 4XWOC 1BIIA 4PGEA 5DJ2A 4GKNA 4PJ9D 2FHFA 5GZOC 1BQLL 3PGCA 5HHQB 1FZMA 1Q1JH 5KW9L 4I0PD 5FM8A 4IRZL 3BE1L 3EDKA 4PJHF 1DLFH 3N1MC 4L4VA 3GSOB 3UDWC 1T0NB 1TZIB 2AJXL 3TA3A 2CDGB 3LQZA 5ABDE 4ZNEE 4NZTL 4JO2L 4WFGE 2FO4A 3REWA 2AGJH 3HS0A 3U82B 4PJAF 1ORSB 1MPAH 4Z18A 5IVOA 1JZ7A 1G9NC 2QADB 3BJ91 4Q9QL 3NN8B 2Z31A 1B0RA 4BH8B 4I48A 3SBWC 3G6JA 5IVXB 12E8H 1RY7B 4Y4HC 1KEGL 3U79A 3BH9A 2EXYC 1W0WB 4OFDA 1RMFL 3MRRB 3WJLC 3BO8B 5I8OL 1FPTL 3S35X 1VFMA 3RL2A 5I6XC 3HMXH 5IROC 1HYSC 4I0KA 3ZHDA 5AZ2L 4NQVB 5GRUH 4Y4HB 1IEAB 2DLFH 3W5NA 1A3RH 3DYPA 3RKDD 4U1HB 2OR9L 1MRCH 1NCTA 1RZKL 5JUEH 5DR5L 4XP9H 2OTPA 1CDYA 2VDLL 3BEWB 5ANMB 5FHAH 3U2SA 3TBTA 5IHUH 2LQRA 3NZHH 5BQ7B 1GGCL 4WEBL 3KS0J 2VXSH 1EUTA 4NC1E 5D7KE 5T1KA 1UA6H 1XIWC 3H9SE 2DQCL 1BZ9A 3GRWH 4JZJA 5EZLB 4JANA 4R26H 3TGXA 4HWUA 4XCEA 1NBVH 1EO7A 2BY0A 3TBVB 3EYUL 3JVGC 2FJHA 2FSEB 1FN4B 3RZCA 3DIFB 5CINL 1Q9OA 2D03H 4DW2L 3FONA 4X4XA 3GM8A 5I71B 4MSWA 3BIBX 2Q8AH 1JV5B 3GMMA 4LIQH 1A6VH 2HVJA 1U3HB 2M8XA 3TFKD 3HC3H 1HXYA 1DSFL 3MYJB 5E5RB 2IPUK 1ADQL 1NGZA 2MOVA 3ARYA 4YHOH 5J1TC 5LAXB 3AY4C 3KPNA 5LCVH 5E08H 5KOMC 1H15A 2CUIA 3V5HA 1GL4B 3QO1B 1ZMYA 2P8MB 4WCYL 1HWGB 1F4YL 3O6FB 4G80A 1B6DA 4GS7B 3EYSL 5DUPL 5C9JB 5KZCB 4HS8L 3DTXA 4P3CL 3IFLL 1ZHKA 4G43A 4OQTH 5DRZA 1QFWM 2EXWD 4Q2ZA 4BQ9A 2ATKA 4XAKE 2WINA 2QL1A 1PY9A 5IIEA 4JQVC 3LN4A 2R0ZL 3VXMB 2YRPA 1DL7L 4JRXB 1H3TA 1ZT1B 4YHML 4C56A 4FXKA 3IDMA 4ZSOA 4E5XA 5FYJL 3NCEB 4OZFH 4LVHC 1UXSB 1T04B 1ZLUH 3B9VA 4NN6C 3PGDB 3D18B 1NMCB 2AEPL 3BKYH 4G43B 3MBXH 4JFDE 3Q2CA 3QXTA 3NCBB 5IEKA 5IFAL 5GGSB 4OV6F 3BZFB 4L5FL 3PWUB 3TZVD 2G5RA 3MJGX 4F7MB 5ICYB 4KROB 1F3JA 4ODHL 3OKOB 2EEBA 1KPUB 3P77B 1WBXA 1Z5LA 4M8QB 4WTXA 2H9GB 1MCSA 2EE6A 1XF4A 2UWEA 5ITBL 2C1OA 3QEGH 5CIPA 2V2WB 3VXPB 3ROOB 4OLZH 2W07A 1SYVB 1WCBA 3IFNL 3K7UA 3WD5L 4ZFOB 2BFVH 4PBXA 1H8OA 5ALBH 3BQUC 3H7BA 4POYA 3MRLA 3NN8A 1YJDH 3GB7B 4PGCB 1SEBB 1S7UA 4OLYL 2Y4SA 1TNMA 1A02N 1WAAE 5D1XC 3UPAA 5C0DA 1KLGB 2EDDA 1J0HA 3C6SB 2AK1L 2ZCHL 1A3LL 3D87B 4I0CC 5I15L 5KTEH 1U91A 3OAZH 3MBEC 3SDCD 3TNMB 4IRSD 4D0CA 5F9JA 1CDUA 4S0TD 2RFXA 2XZCL 4WHDA 4PJGA 3WHXB 5EBLA 2QHRH 3SGEH 2A73B 4U1IB 1KFAL 4Y2DD 5CZVH 5EO0A 5HD8D 5CJ8A 3QXVA 3CSPA 4OLVH 1AXTL 4M9PA 3FMGL 1AI1L 1INDL 4DKFL 3EGSB 4I13B 4HFWB 3RWJA 4CU7A 2P43B 1VFBB 5BOPA 4BQ8A 3SE3A 4KRPB 4LP5A 3QDGA 4G6KL 1YECH 1ETZB 2OJEA 2XKUA 4DAGL 1LEKB 1ZT4A 3G6JB 5IVXA 4LIQL 4Z0BL 1F2QA 3Q6FB 3V5DA 2Q7NA 1JGLL 5HPMA 5FECA 3LKPA 4NIKB 2K7QA 4YK4B 3PGCB 4XXDA 4JPIB 1TENA 4OTXH 1FNSH 4GAYA 4OF6A 2P5WD 1YEKL 4R97B 1BPVA 2H45A 3QJHB 3G6AB 4FQ1L 1E4WL 2EC9T 2Q87A 4AG4H 1KIUA 1ORQB 3B2UD 1MVUB 5FO9B 1FDLL 2PR4H 5I1GH 1BAFH 1H3UA 4R97C 3F7YB 4EDWL 4H5SA 3MLSH 4P2QA 1A7RH 1XF5B 5C0CE 1TJIH 3J7HA 4ZPVB 4JQIH 5DWUL 4PJGB 3OAYK 3WKNA 1KTDB 1CS6A 1QSFA 3MJ9A 2GJJA 4ZFFB 3O11A 3DYOA 4KZDH 3U7WL 4R26L 1UGNA 4G9FD 1ZS8A 1FH5H 3D85B 4P57B 5E8PA 4ONFH 4KDTA 3MCG1 4JVPA 1LK3H 1NC2B 4XCFL 3I84A 5LXGH 2NY6D 1MF2H 5B22A 3FFCA 5C0CA 2J7LA 1T2JA 3L3DB 3D3VD 1UC6A 4UUJA 1OD7A 2J1KA 3MROB 3S5LG 4RAUA 3CZFA 4HBCL 1Q9WB 3S37X 4GAJL 1HZHH 3DMMD 6CGTA 4D2NA 3MQIA 1E4JA 5SWZA 4XNQB 3BD5A 3H7LA 3O9WC 5EH1A 3LH2L 3WS6A 1DQJA 2MPAH 2H32A 4ZPVA 5LCVL 3CFCH 5D5MA 2EDWA 2V2XB 1RI8A 2N7AA 3LN5B 5LGKA 1WAAF 3RZCD 1N64H 2Z4QB 4PJEA 2B1AL 3MGAA 1CGWA 3R06A 1NGWB 1FCGA 2EDKA 3KPSB 5HHXL 5IVZB 3GMOB 3GI8L 2EYTA 1QD0A 5D6DC 5E8DL 1FYTE 4Q2ZB 2R1XA 4RGNC 3M8OL 4H26A 4UT9H 5F89B 2WUBH 3DHMA 5HPOA 2IGFH 5IG7B 1FQ9C 3W5MA 4WI7A 2VXSL 3U0PA 2H2SD 3FQNB 4OD2A 3QEQA 2QSCH 4XB8A 1GGYA 1TMCB 4LSVH 1HHKB 1NAKH 1UKSA 4KUZH 3SKNA 5E8NB 1AXIB 4XHQA 5JHDD 2GSGA 2R0LH 4OFVA 5IWLA 4MB5A 4PV9B 1KJ2B 2Q3ZA 4OCNC 3TBYA 4HPYH 4FZEH 3QHZL 4YUEL 2DWEA 2A73A 4U1IA 5D1QB 4I4WA 3HC3L 4OGZA 1RUPH 3HI5L 5HDQH 1T21A 4YXLL 2RFXB 5DFWH 2Z4QA 3DETC 5IJKA 3HN3A 4UOW1 4QEGA 5E24E 3IKKA 1FL3B 1PZ5A 2XPGB 2I25N 4LEOA 2X4QA 4R2GC 1S3KH 4RMQA 3CSGA 2YEZB 2PTTB 3EYSH 5DUPH 2X4RB 3DOSA 5KVMC 1A9BB 1XF3A 5ESVA 4FQXA 1UVQB 4ZYKA 4Z0BH 3TIEB 1NANI 3NIGF 3JV4B 5GGTA 4FZ8L 3JV5A 2ORBH 1SY6A 3MJ8B 1QRNE 3MRLB 3ULUF 4X8XA 3I75A 5KSBA 4YJZL 1Z9LA 5D6DA 4G6JH 3MRKB 1ZANL 1F11B 1X4YA 1ZS8B 2MMXA 3NCYP 2IWGA 3CFJB 5MEPB 1KTKE 3RU8L 1DVFA 4RCAA 2DD8H 5JNYA 3BP4B 2ZUYA 1NAMA 3ILPA 4HKZB 3HPLB 3WIIH 1ZA6B 3VG9B 4KV5E 5GHWH 2IPUG 2X4OB 2D7OA 3GSRB 4HCRA 1NCCH 3VXNA 1OAYL 1FNLA 3QZWG 3EFDL 3CFKB 4LPYA 5EBWA 3BHBB 4PJEF 1A7RL 2NY7L 2F53E 5GS0L 1GRWA 1A1NA 1MVUA 2DKSA 3HE6C 4IHOA 4N8VB 3NACH 4MMZC 3NZ8B 1UYWH 1DQML 3SBWA 2HRLA 3O6KL 5C0AD 4ONFL 3UO1H 1IGFH 2ESVB 3BP6B 1FFPA 5FUCE 3QRFM 1T83C 1GGBL 4X5WA 3QUXC 4Q9CA 5KAQF 5J57B 1FYTD 3CZFB 3SDDA 1RULL 3D39D 4GUPB 3OZ9H 3LQMA 5IBUG 5I8CB 5M7QA 1V7MH 1OM3H 5EZJB 3L9RA 1A6PA 3WS6C 1ED3B 2P7TA 3WD5H 4X7SL 4QHLB 2IADA 5F1SA 2E7BA 1WTGT 5D1ZB 1TFHA 1KEML 1LE5A 1R5IB 1CDCA 1U93A 2BSSB 4RGND 1W8NA 2ZCLL 2PYEB 1N59A 5MEOA 3QG7L 3FRPA 5I1GL 3O2DL 4NFCA 5D2LE 4IOIB 4LVNC 4X9IA 4YHMH 4TNWF 4YFEA 2AEQH 3IDGA 3V6FB 4XCNA 5KSAD 3OKKA 1R3LA 3JTSB 3RZCC 3I85A 5EC2A 4ZMAT 4CVXB 2YMXH 1NBZB 3FKUS 1IZJA 1ZGLB 1BQHA 4D9RD 1CD9B 1JI1A 1X4XA 2I9TB 1G84A 4PUBL 4DKFH 3A6BH 3VXUE 4OLWH 4LCYA 3TZVC 3RWIA 1BLNA 3VG0H 1EBPA 1ZAGA 3FT3B 3HB3D 4J3WA 3C09C 2PTUA 5CBEA 3BPLB 2W0FA 4JLRA 4HBQA 3RP1A 5IV2B 2AQ3A 3UJTH 4M4RA 3B5TA 1B0GA 4U33A 5TDNA 3MLTA 1G9ML 3RTQD 4UOJA 3GNMH 2XACC 3WHXA 2HN7B 1KCRL 4ZQKB 5DD5H 1CLOL 4D9QD 5B8CA 3CX5K 3QEHA 3QEUA 1QFWL 1SVZA 3MACH 1Z3GL 3KWWA 2JCCF 2HP4A 1YEKH 2YPVH 4I0PB 4BFBD 4JVWA 1KXVC 1F3RB 2D31B 2XRAH 4WFGD 3SKOA 2IAND 4Y4HA 5I1EH 4G8IA 3BYYA 4WU5A 3VGHA 5HHPA 1TTUA 3C5ZA 2ZUUA 4JDVB 4U6VL 3PQYE 3MROA 5FYJD 3VXRE 4RMRA 1FCCA 4JM2C 3NIGE 1M1SA 4UV4H 1U8IB 3VRLE 1LD9A 4AIZB 3T65B 3CMOH 5TE7L 2PXYC 1FHGA 4UQ3B 5CHNA 1P1ZA 4Y2OA 1WBZB 2R69H 4KUZL 1OLLA 1KJ3H 2MWCA 1FAIH 5LGHL 3P9MB 4G9DB 5KBNC 4MWFB 3S4SG 2DQIH 2QSCL 4QNPE 3GSNH 4HMDA 3BSZL 3U0TB 3BZ4A 4J8RB 4W6WB 3HUJA 4WJ5A 1LNUA 1RUKL 4MMXC 4UB0H 1CICA 3D69B 3FRUA 5J13B 4G8EB 2R8SL 3ECBB 3RPKA 2GTZA 5AWNH 4JDVA 2HH0H 1EAJA 1R24A 5HGDB 4PRPA 3U30B 2YC1B 1QVOA 3RIAK 1H3PL 3WFCH 3QHZH 4YUEH 3VXTA 2DQEH 3CDCA 5CUSL 2DBJA 1KIQA 4ZO8A 3ZZ1A 1PLGH 4Z7OE 1YEFL 2E5EA 1FGVL 4HKBA 1BOGB 4JFYB 5ID0B 2RIKA 1BFVH 15C8H 2X7LA 3QUZC 4A2MA 2DN7A 3UTSE 1T5WA 4XVSL 5DK2B 4K8RC 4M1GL 3NMEA 4MDJA 5FGBC 2A6DA 3DLQR 1KCKA 4K3EL 3CUPA 1KOAA 5D72H 1SY6L 4HWBL 2FX8H 3VWJD 1JF6A 3ZKQD 5EOQL 1HSBA 1MHCA 4EOWH 3GDBA 1DCLA 1KB5L 3EGSA 1N6QH 2BNRA 4OUUB 3K2UL 3B6SB 4DWHA 1HHJA 5DJCB 2H6PB 1XT5A 4UIKL 5H37H 3D2UA 5JW4R 1X5YA 1KLUB 4NJ9L 4Y4FD 1D5XA 3WHE1 5T1MA 3F7VB 2BSSA 4KKCC 3IJYB 3U7YL 1KCSH 5K9OA 2EYRB 3DVIA 3VFSA 1II4E 2K7PA 2OJZH 5FYKE 3TPUA 4EI5B 5DK0B 3SCMA 3SHSA 4YHLH 3RWGB 1A5FH 3KDMA 4OCWH 1N0XH 1BLNB 4XCEB 1CVRA 1MPAL 4XRCA 4TVPL 2ITDA 5GJTL 5DD3L 1FNAA 1TJGH 5DO2D 3TA3C 4PBWD 1AC0A 1Q9OB 4BJLA 1U8PA 3O81A 2Z31B 2D0HA 4XI5C 5BVPH 1FYTA 3MPCA 3P0VH 2IJ0C 2BCKA 4JRXD 2PXYD 3ETBF 4HWEL 4RNRA 1IQWH 5DVLA 2J8HA 2EICA 5DHVA 4JM2D 5L8JB 2R2BB 4JN2A 4FQHB 1JNHA 3P9WB 4LLMB 3SDAA 5T33L 1ONQA 5CEZH 4N0YL 1T3FB 4YHKH 4YX2L 5JOPD 4YBHA 2VQ1A 2AKRA 3JWDC 1EDQA 4KJYB 3PDOB 5ESAA 3DUHA 5C86A 1T20A 1U8PB 2X4UA 1TVBA 4RWHA 4GKSB 1RSFA 1G7IB 5IBTL 4X4XB 2ZUQB 3CC5A 1F6LL 2H8PA 4S1QH 3VFTB 3UJJL 2VR9A 3G6JF 4WI3A 4H0GA 5HHOB 1F4WL 3DETD 3QYCA 2AJXH 4OBSA 2Y25A 1CFQB 1PKOA 1OOAA 1AR2A 3H3KA 4QXGH 3DSFH 2JB5L 5HDBE 1WITA 2DQTH 1OY3B 2A2QT 5E5UB 2P8PA 2K3TA 4QWWD 5L8LB 5GGUA 5GGTH 1CBVL 4LAJH 2YD2A 3PIQA 4G8GB 4LSQH 2PO6B 2Y07H 5EBMB 5ID1B 3L3JA 1U8JB 2LTQB 4YXKL 1EIBA 4XHJD 2W9DL 3EYQC 3K4DA 3GNML 5EU4A 3GI9L 3CCHB 1VACB 4QTHB 3ECBA 4IRSA 2IANB 3HRZB 5I1EL 1U42A 1SJHB 1P4IL 2F54D 4UU9A 2F74B 3MRHB 1WGOA 1I8KA 5CBAB 1Q72L 1YEGH 1UM4L 1IL1B 1XH3A 2COQA 5I0ZA 5DQDL 3R1GL 5FM5O 3BT2H 3UC0L 3QJFB 1MY5A 3KPSD 4JG1H 3GMMB 3I6GA 4F9LC 4WUUA 1DBJH 5ESAB 4BSVA 5H8DA 4NUJB 5H94A 1JCKA 5K9OB 1BOGA 3G5ZB 1AKJA 2ARJQ 4XP9L 1LD9B 4YFLI 5CD5C 4X98B 4ISVA 4X83A 2GFBB 2XZZA 4Y4HD 2I5YH 4MCYB 3WFBL 1F02I 5LGHH 1DEEB 1HH9B 1WLHA 5L7XH 1YEHH 1F6FB 3LPGA 3TVMB 5JMOC 1ACZA 5DJAA 3U0WH 4ODWA 4IRJA 2XTJE 1J0JA 4R3SA 5JLZB 4LSSH 3U7YH 4G7VL 2QQKL 1U8MA 1YDPA 2QHLA 1LWRA 1U8QA 5CKGA 3VFGH 1B2WH 2F5AL 1CGYA 1J1OH 1PX4A 2NY2C 3GKWL 4N0UA 2OQJA 2G60H 4QO1A 4WW1A 1VERA 4JO4H 3H9SB 4RBPK 2HJLB 5D2NC 1AY1H 1IFHH 3PV6B 1ROWA 4ONHB 1UWEL 1NGWA 3GGWA 5E2TL 3S96B 2JB6A 4DTGL 1JHKH 3C08H 1PD6A 4QXTA 1G7HA 3K4ZA 3NCJH 5D96B 1MLBA 4P2RE 4H8WH 2WK2A 2H26A 3SDXF 2CK0L 15C8L 1NFDB 1PY4A 1JHTB 4XVSH 3PWLB 1E6OL 3RIAF 4MXVF 4FQPA 5H37G 3EUUA 4CKVX 1FYTB 2RAMA 3KYOA 4NRXA 1TVDA 2N56A 2HRPH 2A77L 4NO3A 4F2MA 3QSKB 4MHHG 4G6MH 5I1IL 3GMPB 4QGTA 2AV7A 1G0YR 1MFAL 2BSTA 2CRIA 2VNCA 4Y88A 5GISL 1U3HC 3DRTA 3CK0H 4R7NB 3VXSD 1UH2A 5JQHC 1YJDC 1M05B 4Y5YB 2GY5A 1EHAA 1AHWA 5CD3A 4Y2DB 1UJ3B 4MAYC 1F58H 4HIIB 5HDOA 2XN9A 4OCWL 2MHAB 4AIXA 4I3RH 1F5WA 4PB0L 2YN3A 3G5VA 4D9LH 1BWMA 3VXOB 4RX4A 3O6FC 3QI9C 2ED8A 3DUSB 4XGZA 3OG6B 1FIEA 3C60A 4FXLA 4ELME 4DAGH 4TQEH 5MEND 3O3AB 1BFVL 4GLRH 1ZT4B 2EDRA 4WVRA 4ONGL 3SDAD 2A6KA 2FYYA 1I3GL 3BUTA 3BWUC 3FB6B 1D5BB 4ZODA 1Q94A 5DMKB 1Q0XH 1I1FB 2VLKD 1XCTB 1DFBH 4L9DA 4IIQB 2VISB 2I9LB 1A1OA 3MZGB 1Z9SA 2UYLB 3QCUL 1R0AH 2MHAA 4GBXA 2KQNA 5IKCA 3V4UH 5DGRA 5CP3A 5E2UH 3VRIA 4U6VH 4PRHE 2BVYA 4RDQF 1FDLH 1RZ8A 4F7TB 1MLCA 3PHQB 1D7FA 5HXMA 4JJ5A 1P84K 3QFJE 4NBXB 2DKUA 3PP4L 4F9PA 4JY5H 1QLEL 1ADQA 5BVJB 1LP9E 3BQUB 4NKMB 5DRXB 4PRBA 4WNQA 1KN4L 5I1AB 1FAIL 4NZDA 4ZOBA 1LEKA 3MV7B 4PJBB 3ES6B 5HHVL 1O0VA 2DDQH 3H9HB 2AI0H 3KPOB 3LEXA 2BY2A 4KRMB 3SDDD 4M6AA 3ZTNH 4J3UA 3WJJC 4NJAH 1GGTA 2NX5D 5GRVL 3RHWF 1X5LA 4Z5RB 2R56L 2ZOLA 3B9EA 3CVHH 5TE4H 1F8TL 5C2BL 1RQ5A 1KIPA 4LGPB 3WFCL 4R4FL 5F3HA 4JY6A 2H3NA 4OB5H 3VGBA 2DOCA 1RPQA 1FVCA 3LEVL 1L0QA 3LKOA 1IAKB 1T83A 3ZDZF 3H2WA 4XMKH 1XR8B 4LSRL 3DARA 5I1HL 1IAIL 1ODAA 1HI6A 2NR6C 4TNVF 4TSCL 2HVKB 5JOEA 5F1NB 1G7JA 2JLLA 3F58L 2BRRL 4FQQA 1SEBA 3O2DA 4OCRL 1ZWIA 4Y16A 1FV1B 1DBMH 4B41A 5L2KB 3MV8D 3MOBL 4FQXB 5EUKB 2B5IB 1BGXL 1J88A 4H8WL 3WSQL 2VZOA 2KPNA 4JEGB 4OGAC 3QQ3A 1KUMA 3EO0B 3P11H 2KDGA 1RZ7L 4Y4KD 3RJDA 3J8F7 5DHVB 5C0BB 3WNOA 1DE4A 4EKXA 2E8ZA 4JDTL 4AEHH 3KPSA 4M3JA 4OZFA 2EDLA 4IOSD 4P2RB 5TGBA 2EDJA 3WCYA 1OWRM 4U1SA 4O2CA 4LRNH 4WENB 3GHEL 1RUQL 3N1GC 3U4BL 3E8UH 1CD1A 4EDXB 3NH7L 4XPTL 1FZJA 4CJ1A 4PD4J 1DANU 1B0WA 5KVEL 5EOCJ 2JCCB 1QBLH 2P46B 2X4UB 4HUMB 4NWTL 4OQTA 5I75C 1UQSA 25C8H 5SV4A 4EBQH 4ODTH 2N1KA 3GIVB 2VLJD 3NZ8A 3LQAH 1KLFA 3HZYA 4XMPL 1ZSDB 3RWHB 1XIWD 2CMRL 2ADJA 5JA8B 3RUGA 4JHWL 3DPBA 3EBAA 5D1XD 2GIYA 5GRXG 2P8LA 5GGUB 3VFRA 2Y5EA 3HFML 4IJ3B 4LBEB 2DQGH 1OTTC 5EZJA 3TEUA 5IEHA 4TPRH 5DUML 4ACPA 3TLRA 3O4OB 1Q9LA 2ADFH 3RKDC 5KVDH 4XTRC 4AM0B 1A6WL 4UT7L 1U2HA 2WWKO 4IS6A 2R29H 1OP5H 3ZE1F 1NLDH 1A6ZB 2GKIA 4XCYB 5DJ0B 3RWHA 2NR6D 2OMBA 5EB9A 3RDTA 1OAUL 2APFA 4IDJH 1CFVL 1AH1A 4NC0B 3DV4B 4G6ML 4P4KD 3U7WH 1CDGA 5CMAA 1Q1JL 4QF1A 5T1LB 4TOYH 5D7KD 1J87A 3ZT6A 4MZ3A 3TT1H 1MQKL 1RK0B 2VLLB 4QOKE 2IH3A 3X14A 1BZ7A 4UDTA 2APTA 2ENYA 3DGCR 3PJSA 4X6CE 1IGYA 3VJ6B 1HCVA 1T1ZB 2PNDA 5KVGL 2P5WE 2Z8SA 32C2A 1MY7A 5D6CB 4BYHA 4NCC2 4XNUH 5BO1L 5GGRB 3CFJA 4G3YL 2GSIA 4K7PL 4N5UA 1I4FA 4GW5A 1E4XH 4CMMB 4M7LT 3LEVH 5HGAB 3ARTA 4U4BA 2ADIB 4M6ML 4GG8B 3RA7H 1FBIH 1U92B 2C1PB 3FOMB 4RFNB 4R4NC 2ZPKH 1A4KB 1N5AA 1OWWA 4YR6B 2YD4A 3D2UD 4HWZB 4U1LA 4JFQA 2YD7A 4DQOH 1OSPL 1DBML 4PJ5D 3ZTJG 5C0AB 4M7JL 5C0IB 1KN4H 2YPLA 2WWMD 2IBZX 4L3CB 1NAKL 3IKCA 2LFGA 5KZCD 3MRPA 5H35A 1TTFA 4MS8C 4X4YB 2BVPB 2XNAA 5LGJA 2FR4A 2IFGA 4K94H 3L3OA 5L0QC 1A7OH 4UINH 5ENWA 3P73A 1G7PB 4NRXB 2X44D 4QHLA 1CXEA 1P4LB 2CGRH 5FYJE 2GJ6D 1MRDH 2CDGA 3LQZB 1E27A 3T08A 2OR9H 1YEDA 1DDHB 4L4TE 3RGVC 3U6RA 1J05A 3LEYL 3UTZA 3ARBB 4HJJH 3TP4A 4WFHD 3GSVB 4F8QA 3U7AA 4MQXC 3LQAL 4M93C 3LV3A 1QA9B 5CGTA 3VXTB 3C08L 3IU3A 3KXFE 4P2OC 2Y5TA 2Z0BA 3KPLA 1A14H 3P73B 4U05A 1R24B 5HGDA 3SKMA 1CN4A 2CD0A 4DJMA 2HG5A 3QH3B 3RDTB 2X4NB 1L4IA 3KPPB 1MFBL 3T0VA 2XKNA 4PY8J 1EEUA 5D70H 4QKXB 2AGJL 2WUCL 2X4OA 1GZQB 4JO3L 4DZ8A 1GGIH 1Q0YH 4DN3H 1RUMH 2FYYB 3BKML 1HYSD 4PREA 4HHAA 3ARED 2E6PA 3QUZB 4JLRB 1T1XB 1R3JB 3QQNA 2XQYK 5T1DH 1ITCA 2IH3B 1G9NH 1PSKL 3D3VA 2NCMA 3P11L 3PP3K 5F3BA 5SX4I 2F5BH 1EXUA 4M4PA 4P5MA 5F1KC 1MAMH 4X4ZA 2BOCB 4WWKD 5IBUB 5EA0H 3GRWL 3GUTA 3C8KA 2NY2D 1NCDH 2FBOJ 5KSBF 1YNTA 2BNQA 5EIQA 2BOBB 3KPQB 1WF5A 3RUGF 3Q48A 3NPSB 1FFOB 2FDBP 3GHEH 2JTDA 3GBLA 3U4BH 1WWAX 1BIHA 2HKFH 5KSVA 3R4DA 3V6OA 1RFDH 1X44A 1GPOH 1YYML 1IE5A 1ZHBB 3QIWA 4JCMA 3VI3F 3P40A 3T3ME 1NMAL 3SKJH 5DFVD 3ZT7A 3CCHA 1T1ZA 3OF6D 4PJFA 4YFDB 4ZNEA 3MNZB 1FVDA 1OARL 4MXWH 1LQSR 2PYED 5T5FL 3VFVB 2FIRT 4JFED 4PJ5E 2C4FT 5C1MB 3E6HA 3PWNA 1GIGH 4UZGA 1RMFH 1MFEL 3D9AL 1KEMH 4QOKD 1B4JL 4NT6B 3DTXB 5FYLH 3MX0A 5C9JA 1KB5B 4KJPC 4KK9C 4AY0A 1R6VA 2YUXA 1RZ7H 1XGTB 1VFUA 3GBNL 2PO6D 4UV4L 3KS0H 1AC6A 4GW1B 4URTB 1OAUH 5ACMA 5C0JB 3INUL 3H3PL 1INEL 2WW8A 4DUVA 5B39A 3BN9D 3H6JA 4YHZL 1DBKL 3MRNA 1MCCA 4TTDD 3MR9B 1NUGA 3P0YL 1ZKAA 4XHJC 4C4KO 4FTVD 3WXVL 1C08A 1S7SB 2ICEA 2OYPA 4Z7QF 5L2JB 4PJ8C 4PRPD 1T5XA 1RIVH 2P8LB 4LLYA 2VR4A 5AYUH 3UTTE 4U0RC 1QR4A 4L8BB 2WIIA 3T2OA 4IIQA 4OZGB 5EO9A 4CN4A 3ARRA 1P6AB 4ZXBC 4NNXB 1OW0A 2O5YL 1ZK9A 1AXSA 2X1XR 4AMKH 3A67H 2IALA 3T2QA 4OB5L 1QFUL 3KG5A 3C2AL 1TJGL 4MZ2A 2XZQH 1HEZA 1G9MH 3FQNA 4G6KH 2CXKA 4KZEL 3IDYC 4YDVB 2DBLH 5AAMA 1FPTH 2BRQA 3QIUA 4I9WD 3RL1B 3MJ6A 1YPZA 3EO1A 3BX7C 3QNZB 2GK0A 2Q20A 1U58B 2ICES 4KAQL 3QDGE 1JJUA 3QZWB 4TUJA 4TUKH 5ITFB 2EIDA 1MNUH 3MCKA 4PGDA 5CZVL 4M62L 2WBKA 5JHLL 2CDFB 4OCRH 3D85A 1D6VL 4HMCA 4FNLH 2NY1B 1FZMB 3MO1A 3EOYG 1WSST 4L4TB 2VLRA 4P2OB 1QSFB 1T21B 3EAKA 2MKLC 2BJML 4OQTL 5D71H 1YNLL 4UIKH 43C9B 5AEAA 3MGOB 2DTML 4YFLF 5D7JC 3AB0B 1PAMA 1S5HB 1OTSC 5D8JH 1QKZH 4JPWL 3PABB 3OQ3B 4XI5D 3P9LA 4K07A 1NL0L 5DFVC 5IROA 4KDTC 43CAB 3P0GB 4YAQB 2FD6H 4QXGL 4NO0A 2VYRE 1HHKA 5JHDE 3G5VB 3I75B 2Z91A 2WBJB 1BWWA 4PGJA 3E6FA 3FZUC 4U1NA 3LY6A 5DVMA 2Y7QA 5I1CL 1EXUB 3PWNB 5INDA 3VFWB 4L5FH 5EC1A 3QDGB 2X7LB 3MTRA 3T2NH 2CR6A 5GS0D 4HK0B 4KKCD 1MIMH 1JFQH 3U4EA 1XZ0B 1E28A 2YUVA 1WZKA 3QAZC 4OGXL 5I17B 5HYEA 2Z35A 1NBYA 3FRPG 5CD5D 4JPKL 1JZ2A 2CO6B 3EZJB 3VCLB 4H88L 3BZEB 3V9FA 4F7PA 1HHIB 4XP5H 1JNHB 3NGBB 4GAYB 1HHJB 5DJCA 4N0FB 2IAMA 1S7TB 2ZCKL 4JRYD 1WIUA 4YHIB 3BKMH 5JDJA 3QWOB 1YEIL 2V5TA 2J5LC 1I1YA 3TZVB 4FQJL 5FUZH 3RIFF 1KNOB 3JV0A 3LS4H 4X6FA 4FQCH 2UZYB 5IB1B 1OT2A 1S9XA 2E27H 3U6RB 4GKNB 3DGGA 5E1HB 1TPXB 4LLUA 4DN3L 4OFYA 1FZOB 3UZQA 1AGBB 4K23H 1D9KB 5K59F 4FS0A 1P6FA 4S1DD 1C5BH 2GTWA 1MCWM 2CKBB 3IDXL 4L8SC 4PV8A 1DBKH 1LK3L 5LXGL 3EFFA 4F80A 4MNGB 5EUOB 1N26A 1V05A 2DMKA 1BEYH 2FH6A 2VAAA 3OB0H 2WWKT 4Y5XA 5A40E 4NBZB 4RZCA 2X4NA 3KJ4B 4Q6IB 2DQJH 3KPMA 4MD4A 3ULVH 4KI5D 3VXSA 4RX4D 5F9JB 1BAFL 2UUDK 5EU6A 1RZIA 2Q86B 3VRJB 1U36A 4NO5A 3JUZA 5T5NG 1UM6H 5DDHA 1OPGH 2EH7H 2XN9D 3OGOE 5F96L 3WNNA 2PW1A 4HUKB 1NGPL 4LAQH 5F7WC 4I9WE 3T0AA 1GSMA 2EE2A 5I8EB 1FAKT 3HI6L 3FQWA 2OR8A 4M7ZC 5ADPL 4GMTL 1BF2A 2CH8A 2JJUA 5JZ7C 1KYOK 5D2NA 1CFBA 2CK0H 3UYOD 3EFFB 3ARBA 3CMGA 1ZA3A 5D5ME 4QRTA 2LAGB 5LJYH 4FFWD 1GGIL 1P69B 3WS3A 3PUCA 1I1FA 1PBYA 1HXMB 1CGTA 1HHHB 4P46A 4QRSB 4Z76B 3RTQB 3UX9B 4OIBA 2UYLA 4YBQC 1A1OB 3LHPL 4JKKA 2IEPA 4Y1AE 1MHEB 4XPHL 4BZYA 4ZO9A 4TVPE 2FO4B 2E7MA 4QHKJ 1M4KA 2E9WA 3T04D 4P4RA 5EA0L 1W72L 3MUY1 3UCRA 1CGUA 4Z8FL 1MH5B 3SY0B 3SE4C 1INDH 1PW3A 1VEPA 4LPXA 4W81A 1LE9A 3WUWA 3O6ML 1NSNH 1YY8A 3MZTA 2NY3C 3AFLA 4LSSL 1FL5B 2OZ4H 2CKNA 3QPXL 2QADC 1KTRL 2QQQA 2WANA 2R1WA 4JJ5B 3OJMB 1U8JA 5C6TH 4C57C 2C1PA 3FOMA 1I7ZA 3PE9A 1JRHH 5I17A 2G60L 3W0WB 1BIIB 4PGEB 2AXFA 3ZSTA 3O41B 1JYWA 2APWA 5DD1L 1T4KB 4TULL 4EUPG 1CL7I 4O4YH 1AY1L 1IFHL 1NGYA 5ELIA 3WUWG 4KC3B 5D1ZA 5C08A 4B0MM 2EKSB 1OAYH 3RVWC 5I30H 3ARFD 1CZ8L 3VFWA 1YPZB 3EO1B 4LSUL 3ZKMC 1QG3A 3GI9H 5KSAC 3E6FB 3LOWA 5IB1A 5DJDA 1R3KB 2FNBA 5BRZA 5E8OB 4XP4H 1G0XA 1UXWA 1Q9LB 2FX7H 3KYKL 3QPQC 2I9TA 2YOCA 5T1KB 3W2DH 3SGKC 4XTRD 5EU3B 2FEDC 1PQZB 4TTGA 5DTFA 4NFBA 1HHIA 1K2DB 2VLMD 5C0FB 3C6LC 4Z7NF 4GW4A 2D7QA 3VXRD 1LDPL 1F4AA 1CR9H 2C7UA 4XVJL 5CAYB 1BBJA 1F6AB 3HG1D 1D5MB 3GSRA 3VA6A 4M5YH 1AGFB 3VD4A 3FT4B 1A7BA 5TFSH 2X9YA 5DD6A 4NM4H 1U8QB 1AGDA 5DJDB 1A8JH 2CLVA 2P24B 2V5MA 1JWMB 4NHCL 5CSZB 4MD0B 1XEDA 4IBLT 3PXJA 4WGVB 3MCKB 2D7TH 3A67L 2EDTA 5AZ2H 3QG7H 1YYLL 1REIA 4LPTA 1RZFH 1JPSH 5C08B 3UBXA 4LGSB 2DBLL 4HZLA 3WKMH 2PTVA 4P3WA 1U8HA 4TQEL 3JTSA 2OL3H 1R3IL 5FYKU 2EDFA 2R2EA 2V5SA 1EBAA 4NNXA 3CNKA 1Z0NA 4KTDL 1VGKB 5EU3A 4AL8H 2AVGA 2JELH 3QCUH 2WSKA 3GIVA 3HI6H 1OTUD 2EO1A 1NLBH 1R5IA 1T22A 1A21A 1LNUB 4RBPH 3WN5C 2YD1A 2NLJB 4PJDA 3HE7A 2VN4A 2W65A 4ZNCD 1JWSA 4ZTPH 1TZGH 3EYVA 3I9GL 3UJIL 3DMMA 3H9ZA 3H3PH 4B53A 1CGVA 2O26U 3OZ9L 3ZYZA 1VB9A 5HYJE 4X0KA 3AU1A 5DXWA 1EVUA 2CLVB 3FQUB 2MNUA 2W0KA 1ND0B 1KIQB 4OZFB 5HHVH 1KJ2L 5F88B 5GHWL 2A83B 3DO7A 1BM3L 3RJQB 1RUQH 3IF1A 2R2BA 2I07A 4LVOB 2Q8BL 1LP9A 4M6OH 4F9LA 4LVHB 4FXGA 3MRJA 2DIJA 3ULVL 5ERWB 4OGYH 3GSUB 4EJ1C 4YDKH 4EBQL 2FECI 3SPVB 3STLB 2J2ZA 5D93B 4LVOC 2R15A 1EAPA 5IOPB 1DTUA 1QOKA 1EFXD 3B3IB 3WFZA 4NPYB 4O58L 5ADPH 4CU6A 5FHBL 4YHNA 2E9JA 5MERB 3NZHL 1SBBA 5B39B 4NZRH 1NFIA 4NOFA 4JQXA 3Q6GH 5IB4B 4DVRL 2FL5A 5DJZA 2EIZA 3GJFK 5FYKH 5IWLC 2HMIC 5T3XD 3BIKB 1WFUA 3DBXB 1ZHLB 2X40A 1Y6NR 3NA4A 4GSDL 1YEIH 4R96B 4Y4KA 2WP3O 2XFXB 5IW6A 5FYKD 5FM4A 5T3XH 1BGXH 1P84J 3G5XB 2A0LD 5E0QA 4HKXB 4Y0GA 1NMBH 1F97A 1KGCE 3ET9F 4E0RB 1AO7B 3OGCB 3G9VA 4N5EC 5FGBA 3QDJA 2YXMA 1EH9A 1URLA 1G7MB 3QUMB 4PTTA 4ZXBA 4JFDB 2F8XC 5JORB 3JV6B 5TJWK 2A9MH 2WIMA 3EDJA 3V0AC 1M71A 5DR5H 4FQXC 2FB4L 3EYQD 1MCPL 2W60A 3DX6A 1MUJA 3DX8B 3EHBC 4JFPB 3P4LA 1KJVB 4PJCA 4ERSH 4CNIB 1YN7B 4JAMA 5CP7A 1E6JH 3PWPB 4L9LB 3X3GH 2A6IB 1A5FL 3JVGA 4JY4B 4OV5A 4MXQC 4ODUA 4X6DB 5DRWB 5TE7H 1BF8A 3QDME 3GSQB 4H25A 4OZIA 5JPMA 4DVBB 4K2UL 5F6HI 3S35H 4JPVL 2AK1H 1J05B 4TULH 4UV7L 1I4FB 4IRJB 7CGTA 1IAIH 5C0GA 5LG1A 3TN0B 3S36L 1L7TL 2Y36H 1E27B 2R1XB 4KQ4L 3VFPA 1VFBA 4KTEH 4LCIH 4GG6E 2HLFD 2F54E 3MJ7A 3HNSH 5DDHB 3CJJA 2ZCKH 1HSAA 2DI8A 5JIKA 1F4XL 2YD5A 2NMSA 4FG6C 4N8VA 4HKJA 5E6IA 1JVKA 1HSBB 3IKCB 4DEPB 5TPWL 2HLFC 5H35B 2NNAA 2VZVA 5JDSA 5DMYA 4TVPH 5GJTH 5JPNA 4P5TB 5AUMB 4OZGF 4GBXD 1A6TA 2JCCE 3GSNB 4IJ3C 4XC1H 1A2YA 5C0IA 4XAWL 3QULA 1DQDH 3UTQB 5M94B 2EKSA 5ITBH 3B43A 2CLZB 4LPUA 5J6GB 1MI5D 3O4OC 4CVUA 3BVNB 5DZLA 5ISZE 4P5TC 3IJYA 4JFZL 1IM3B 1KPVA 3NTCL 4UQ2A 1UZ8B 4GOSA 2ILLA 1D3CA 5E4EC 3FCTB 4F7EB 3L95A 3QUXB 4KJQC 3L5WB 4JZOA 5SX5H 1KG0A 3BSZH 1QVOB 3PL6C 4CBPA 5TDOA 3DSFL 1MCLA 4JFEA 5DD5L 3VXME 1VKXA 3RGVA 5IJVA 5JIHA 2VXVL 4JGMA 4V1DD 2AEPH 1LO3H 4L4JA 1W0YT 1IVLA 3PGFL 2EIZB 4ZO7A 1MH5A 4GKZB 4LCWA 5BMFL 3T0EB 5DS8B 3I50H 5FA4B 5H94B 1N7ML 4X99B 3ZDXE 1ZLSL 2E7LA 5IBTH 5HTSA 5BS0E 4JE4B 4N5ED 2FX7L 3O9WB 1YQ2A 1WT5A 5E7FA 2HJLA 5GS2D 1I1AA 1LP9F 5DHYA 5GZNC 1KT2A 4KVCH 5DD0H 1LK2A 3RVVC 3RWEB 3WO4B 5A2KH 1IM9D 3GSVA 4JFQB 1T3FA 3P3YA 4HLZG 3OX8B 1I8LA 1CCZA 2VJXA 5EU6B 4KKLC 4XNZB 4QRRA 2R29L 3DWTA 1I85A 2AW2A 3FQUA 3KYMB 5MHSD 4GRLC 2PW1B 4MDIA 5KANI 4PS4L 3FFDB 1TNNA 3QCTL 5L9DH 2BNQE 3A6CH 1RV6X 3RVWD 3ZDXF 3RVUD 3WNMA 2AJSL 4KQ3H 3BPLC 4ZD3H 3VFUA 5T3XE 1CDHA 5KAQG 1UM4H 3VFTA 4QHMA 3I6LD 3QHFH 4OCSL 4Q97A 3NIFE 2OTUA 4PRIA 4C58B 1CFQA 2VOTA 2RBLA 4NP4H 4GMSH 1KIRA 4YX2H 3GM0A 4MCZA 3SJVA 1YEJL 4ELMB 2GHWB 1TIUA 1MWAB 4D0CB 1T80A 4KK6C 5KSVB 4YHPA 5J1AA 1MJ7H 4HZAA 3W82A 5I66A 3CPLA 4KY1H 4NPYA 2LVEA 2FZ3B 2JJTA 5IHZB 1UCBH 1OARH 4MXWL 5D7LE 2VERN 2PUQT 4G3YH 1YEHL 4PJIE 5I1LA 1AIFB 1RJYA 1NGZB 3EJZC 1P9MC 1YUHA 2BDNL 2OL3A 1A14L 1X6NA 5EOQH 3UEZA 4BSWA 5C0RH 3AS2A 4LDLB 3UBXB 1WWBX 1P7QB 3OKMA 2M26A 4XCFH 1QSEA 5IFJA 1IEBA 4M00A 2WUCH 5TH2A 3PGDA 4DZBA 3KXFA 3S36H 4OF5A 1DBJL 3IDYB 1N0LA 3UPCA 4WHYG 3AY4A 4HC1H 5C0BD 4EIGB 5EN2B 2DAVA 5E99H 2NZ9C 2XA8L 4YNYB 1S5IL 2VLRB 4LKXB 3TYFA 5I75B 4MXVE 2NYYC 2AJ3A 2CUMA 5GRJH 4S1SL 3QUYB 1PSKH 4FTVE 4MA3A 4R4BB 4PGDB 5MENE 4XP1H 3Q3GB 5LBSH 1PG7H 3MRMA 1AD0A 4PJDB 5JIIA 1JHLH 5DO2C 2XWTA 5MEQB 2VDOL 4M1DL 1RIUL 1ZWIB 1QUNA 4Y16B 5E8NA 5E00B 1F3DJ 1JMXA 4U3CA 4OCYH 1OAXH 4CW1A 4Z7QE 2CO7B 4MNHB 1DJSA 1CFNA 4ZUWA 4LQ1A 5CJOH 5HHNB 4RFEA 2WUBL 1S5HA 1WV7T 3NAAH 3HE6B 1J8KA 2VRAA 3TO4C 4P23C 5FAAA 3F7RA 1EJOL 4PJ9A 4YDLC 2GK2A 3MBED 3OHXB 1T66D 4PRNA 4TVSa 4L4TA 3X17A 1QYGH 4PJ7B 3Q3GA 1MJUL 5HI4C 4PPTA 4ZO6A 5F3HB 3ZYIA 2Y06H 4QYOA 3RPIA 5E5MA 3DJ9A 5T3XL 2YD3A 4QY8B 3C6LD 3ARGD 1J10A 3VI4F 4XPGH 4MDIB 1XCQA 1CE6B 3EDFA 3HLAB 3Q1SH 1I8MB 2XYCA 5D5MB 1KXTB 3QPQD 3QWRD 4D0DB 5DFTA 4NGHL 2OZ4A 4JO3H 1FL6B 1OSZA 1GGBH 3ARDB 3HCVA 4NQVA 4OZ4B 5C09E 4YHZH 4QT5A 3MYJA 3KLSA 3UJJH 4WO4D 4Z95L 4LOUD 4NQTA 2XY2A 1EO8H 4Q9QH 2V9TA 5HHMB 3C09B 5MI0B 1LE9B 2H1PL 3ARUA 2DQFB 1NL0H 2BSTB 5IB5B 3ULVD 4NO2B 2ICEB 2IH1A 1QQDB 3QA3B 5GGQH 2D4DA 2VLKB 4JM2A 1A7NL 2GTZB 3T0BA 2DQDL 1IT9L 5C09A 4QRRD 3OG4B 3CSYB 3QIWB 2DM7A 2HFFB 3OAZK 1BZQK 3GO1H 2YKLL 4NN7C 5CJQL 4QCIB 1S9YA 4U1KB 1RJZA 3PL6D 3DI3B 4GAGL 5DS8A 4HPYL 4WI2A 1MREL 1OCWH 4KJQD 1EEZB 2ZZUT 1YMHA 4YBLB 1LO0H 2EYSB 4IMKC 5I1AA 1OAZH 3UXFA 3MRBA 1HIML 4QRPE 4JFFE 5L2KA 5DQ9B 2Y6SC 3MLVL 5DF0A 5HHQA 4LCIL 1UWEH 3QUKB 4ZOAA 4JO2H 1ES0B 5I1JH 3HTLX 4S10A 4U6YA 3ZT5A 1J8HE 4GBXB 5IKCB 3ZTJH 4HS3B 5I1KH 4YHIA 4N0CC 5B8CB 4GRWE 5FV1L 1GC1L 4Y4FA 5J12B 3UAJD 5GRZA 1OP9A 3S34L 4FQCL 4JR9L 1X5FA 5CEZD 1EGJL 1TTGA 4J4PA 1FNFA 5F7UA 1BFOA 2AQ1A 5F7YC 2B8OT 2V17L 3MRIA 4OFYD 5T3ZL 3EJZD 4GW5B 1I1RA 4RZCB 4NUGL 4JRXA 4HK0A 5EOCH 1VEMA 1UWXH 2FJFA 3P0YH 4PLOB 5D2LA 2Z92A 4BUGA 4QTIL 2H32B 1ERNA 3IFOB 4K71C 2Q76A 3E8UL 3OTTA 2Q7YA 3PDDA 5B4MD 5I16B 3RVXC 5JUEL 5FB8B 1Q9KB 1VHPA 2UVEA 2HTKC 3QUMH 4HWZA 5C0EA 4HIXL 4WO4B 3Q5TA 1BQLH 3QJFA 1NDMB 4FOMA 3O6KH 4U2ZA 1QHOA 5J13C 4ODSL 4I5BA 1AO7D 1XCQB 1XZ0A 3S3PA 4TRPH 5FUOL 2RJMA 1GHFH 5ILTL 5JO5A 3QFDB 2XNAB 3BN9C 3QEUB 2VISA 5LGJB 2FR4B 2W9EH 4JDZA 1GCFA 3GMLA 3QG6A 4Q6YA 2BHUA 4G7YH 3V2AR 2PKDA 5GPRA 3ARGB 4NQED 1GZPB 3OWEA 5J06A 1DVFC 4U49A 3A6BL 1WICA 3HNVL 3QJHA 3ZO0A 2W60B 1BP3B 4FMKA 5DRNB 4HX1B 3L7EB 4LHUA 2BDNH 2VXTH 1IRAY 3O0RH 4OSUH 4ZUVB 3QHTC 2MQCA 2KBGA 4ZOEA 5DQJB 5EN2A 4GJTB 1WQVT 1BZ7B 1G1CA 3UMTA 2ZCLH 1QNZL 4GRLA 3NPSC 4YDIH 3T09A 4H1LG 1NC4D 2CJUL 3W0WD 4JRYB 1CQKA 1DSFH 1OGTA 5HDLA 4P57A 5E8PB 2GJ6E 4H0HB 5TQ0H 1PKQA 3MREA 5KS9F 2P8MA 2XWTB 5I1LB 5D7IF 1VADB 2EDYA 5FOBB 4LNRA 3SDYH 1XH3B 4MNHA 1DL7H 2VLME 4O2FA 5I8KH 3IVKB 1NFDE 5GGQL 3QR2A 3B3IA 5C09B 3LKOB 3OJDB 3VG0L 3OR6A 4LCUA 2QV2A 2NW2A 4XMPH 3VMOA 3LRSB 5EU4B 4BK5A 3MOAH 2KZ1B 4N1HB 2B2XL 4LSPH 4M1CD 3T1FB 3LIZH 1AE6H 1U92A 2VL5B 1FFQA 3ULVE 3G5YB 4OFKA 1X5JA 1NQBA 4L1HA 5TE6H 1U8HB 2EDOA 1P7KB 5DJAB 3V4UL 1X6LA 5JW5A 2BY1A 3BISA 1BFTA 4R96A 5GIRB 3V52L 1V3LA 4LMQE 4RSVA 5FV2A 4LFHD 4CAGA 3VH8A 3KYNA 4KHXL 2NW3B 5GRJL 3VWKA 1G6RB 3HG1E 4BUHA 4WW1B 5FUZL 1SJVA 5A1AA 3CLFL 2KKQA 4ORGA 1JN6B 2YD8A 2NLJA 1J18A 4QRPD 4Y5YC 2NY1D 1U8LA 1UM5L 1NDGB 4MNQD 1OL0A 1B9ZA 2Z8VC 4L3AA 1ONQB 2VDRH 5IB2B 4Z95H 1N4XH 5KG9B 3SE8H 4M6MH 4X9HA 1F8TH 4Y5VA 3C5SB 4KGLA 4NUGH 4TPRL 4UNUA 5FKAA 2EC9U 3AC0A 3QT2A 3HZMA 4ENED 4OI7A 2UZIL 3FOLB 3IXTA 3ESVF 1YJDL 3FN0L 2NW3A 3WEXB 3PWPE 3C8KB 3C60D 2XT1B 3IT8D 4KY1L 2E8YA 2OL3L 3CGTA 4QOKA 3NIFF 5F96H 4YHOL 3UROR 2X89A 4JO1L 5K59E 3HE7B 3OB0K 1TZHB 2H2SC 1NEUA 4R7NA 4P3CH 3RHWK 4WW2F 2AAVA 4EI5A 2ZG2A 4D9RE 2ZNXA 2PXYA 2QHRL 1MEXL 2PETA 3HE7C 4XPFL 2NNAB 3TJEH 4GXVL 2DWEB 4PJIF 5JPNB 1LO4L 4PJ7A 1YPZF 1IGJA 2VSCA 5HGBA 1HINL 1FFOA 3OR7A 3JUYA 1KN2H 3EOAA 5E2VH 1U8KB 2HJKB 5B38B 3HR6A 3U46B 4K7FB 5J4MA 5DJ8A 4MJ2A 1YECL 1RIHL 1N6UA 2ZSVA 5C0CB 3SGEI 3WXWL 1UCTA 4O5LL 4CDHA 3AXLB 4PJXA 4D9QE 3NPZB 1NEZG 1BQUA 3LKPB 1MAML 1QEWB 2HFGH 1ZT7B 1MFCH 2OR7A 3CH1B 3EIFA 3U1SL 5HHXH 3HNTH 4I77H 3QAZB 5ANME 5D1XB 2UVFA 4BZ2L 5T33H 2HAZA 2D7PA 4X7EC 2IBZY 4F57H 2DQEL 2VUYA 3ARDD 5DVNA 3T77B 2FJHB 4ODVH 1XIWB 1KJVA 1T1XA 4PJCB 4GFTB 4G8IB 4WU5B 4CNIA 1F2XK 1UKQA 4OJFL 4F7CA 3MLVH 3PNWA 5D2LF 4YIQA 5SWSB 3CXHK 5DZOA 3L1OH 2G2RB 4XNUL 3GJFA 3L5XH 3QQ3B 1P7HL 3S7GA 2ID5A 4LSVL 3TA3B 3MOAL 4PJBA 3T4AB 1ZVSB 1Z9OA 3AREC 4FQ2L 5DSCA 5ACZA 4XX1G 1VEOA 3JWDL 4JG0H 1CFTB 3KPLB 4Y5XC 4X7TB 3D1MC 3DX9B 4NNYA 3L3DA 4U1HA 3R8BB 4MWFA 4RAUB 1P4BL 1RU9H 3VE0B 3AREB 4X5XB 3ARQA 5E4IA 3ALPA 5GRVK 1OTTD 5TQ2H 4CMHB 3P30L 4PRAA 3TN0C 3BDYL 5KJRL 1R3JA 5IMOA 4XX1E 2DF3A 4KUCD 2DLTA 5IMKB 1MOEA 5CJXC 4ZUTA 3SOBH 3L7FA 1C5DB 3JTTB 2CJUH 1IKNA 4HS3A 4F15B 4JY4A 4OT1L 1YEEL 2F74A 1S9VB 3HC4H 4DEPC 3M17A 4UI2A 1C1EL 1T0NA 5HI3D 1PZUB 3CDYA 1FE8H 1U2CA 3F6LA 1BHGA 2Q3AA 4PRHD 1U8OB 4UT6H 2X1QA 4U1GB 1JPSL 3MLUL 4JZOB 2OSLB 1EZVX 4Y2DC 4WI5A 4MCYA 3X11B 4JFDA 5I74B 4G6FD 3WN5B 1IM3A 1SYSB 4JZNB 1MHCB 2UZXB 1AHWB 5CD3B 1JZ5A 3SDCC 3FT2A 1P7QD 1DQLL 3B2VL 4YXHL 3QO0A 3ULUE 1YEDB 2OTWB 3WXVH 1UB6B 2CIIB 2EDXA 4KK8D 1FNSL 4DN4H 1T0MA 2V7NA 4JFXA 5ALCH 2EH8L 2MCPH 1E4KC 4N0YH 3IS1X 3TYGH 4R4ND 3FQXA 1XAUA 4NO0B 5SWSD 1GXEA 3OKLA 5EU6D 1CL7L 3LKSA 4HJ0D 1DQQA 2XWBB 1RFDL 2VXQL 3D39A 3HZVB 4W4OC 3V4PH 2BMKA 1X7QA 5ISZA 5BJTA 3KR3L 3S5LB 1H5BC 3UZVB 1QPPA 5ACLA 4FP8H 1SYSA 4JZNA 4YQXH 3O8XC 4L4VB 4PLNC 2QLVB 4Z7VE 4P3DA 5F1OB 3FQWB 1KCUH 5T1KD 1G7HB 5C0DB 5SV3A 1IKFL 1NFDF 3HUJB 4WJ5B 2FGWH 1H15B 4P2QE 3V5HB 5GS0C 5FYLD 3DRTB 3OR7B 1F3DH 1HQ4B 4N68A 3VI3E 1BVLB 4LCWE 4YEEA 5DMGC 4NQDB 1UJ3A 4JAMB 5CP7B 5F7DA 3DXAE 3MFGB 2HVJB 4AMKL 3FB8B 4LCYB 3BDXA 5DC4B 3CXDL 1CI5A 1DR9A 4LLVB 1I9IL 2AXJA 5GS3A 1LO2H 1JRHI 2BNQD 2FSEA 1MCNA 2ITCA 5C0AE 1AGCB 2XN9E 1YYMH 2V2WA 2AABL 3ZHKA 1G6VK 1BBDH 4D3CH 4S11A 4PJ9C 7FABL 1HKFA 3QISA 1T89A 4HFUL 1OAQL 5IHZA 4OLEA 3NCMA 2FZ3A 1OTSD 2ARJA 4WEBH 1FL5A 5DRZB 4XP5L 5ICYA 3BUYB 3OKKB 4ZFZB 4KVNL 2UUDH 3BH8A 4XPBH 3PV6A 5FKAB 4EDXA 2ZG3A 3SDAB 1NBVL 2H6PA 1JGVL 2XZQL 1PX3A 4Y5XB 3BWAB 2F54A 3ESUF 4IEFB 1A7QL 4MSWB 3MMEA 1KEGH 3A6OA 4G42A 4XPAH 3MV9A 1EX0A 1OAKL 3SDAC 1JK8A 2YZ1A 2ORBL 2GCYA 4JPKH 1K5NB 2R1YA 1MIEH 4HC1A 4KKBD 3IGAB 4JDZB 1I85C 2AJYH 1V8HA 3E3QE 4POZD 3SOBL 4XXCA 4RMTA 4Z0XA 3P4NA 1GPOL 3DUUB 3KDMB 4MHHI 4PJGE 3RNKA 4QRQB 4C55A 3DNKA 2DQUL 1I1YB 3TZVA 1AIFA 1ZHKB 5DMIL 4PJIA 5K9JH 4BZ2H 2IQAA 4RIRB 2FATH 5HGHB 4N0RA 1U8OA 4NQSA 5I66B 3D2UB 4XNYL 4ZDHA 4S1DC 1YMMD 4Y5VB 4JKPL 1GIGL 1IAKA 5T1MB 3NCJL 5CZKA 4QHNB 1C5BL 3VD7A 3V6OE 3NOIA 4XVUD 2DIBA 4IMKA 2DDQL 5K9QI 3MO1B 3MRRA 2C3VA 4LFHG 3GMNA 4M03A 1E6OH 2QBWA 4RDQG 3T0EC 1KIRB 1BEYL 2D2OA 1MNUL 2AJUH 3CVHA 4JCLA 1LO5B 3IRZA 4BH7B 1HQRA 4M48H 4UB0L 2GT9A 2JKXA 5I1CH 2VQ1B 1XF1A 4KK9D 3TT3H 3HZKB 5HVGB 1I7UB 2A6DB 2F8OA 3NFSH 3MV9B 3O3EA 4ZUUB 3PHOB 2OTWA 3T2NL 1UADC 1UENA 4R8WH 1SJXA 1HQ4A 4QRRB 1Y0LA 3X12B 2VUOA 3EDEA 4Y19B 5F7DB 2R4SL 3GIZL 3I6KA 5TQ2L 5JIPA 4JPWH 1U8NB 4NZUH 8CGTA 4ODXA 2VL5A 3V6BR 1ADQH 3ARWA 4F58H 5HHMD 2D31A 1S9KC 5C6PB 4YWGH 5CFHA 3ARDC 1JPTH 5C92A 2BMKB 3MRFB 5MP6L 2YD9A 4HUVA 5CJOL 1S7QA 4HIJB 1JGEB 1XGUB 4WWKB 2V7HA 3S37L 5CP3H 5HVFB 4Q6IA 1NCWH 1FC1A 4N8CL 3HHRB 3KPMB 4MD4B 1DLHB 4PJHA 2AKRB 3L1OL 5E2WL 4O4YL 4BKLA 3HC0A 4G8GD 4LLVA 3MLRH 1RUKH 5DHYB 5I1DA 4XWOD 3BKYL 4UUJB 2P5WA 2Q1EA 4C56D 2YEZA 4G9FB 4JGUA 4H26B 3HS0B 1KNOA 2OJZL 4X6FB 5BV7H 3UTTB 2ARJB 1S9XB 2EH8H 1VFOA 1G7PA 3K2MC 2XA8H 4NKIH 5DJXB 3P30H 2WAHA 5T3ZE 5JXAL 1VSCA 1WEJL 1SMOA 1WFTA 2HT2D 2XN9B 3BEVA 4XPHH 4C54A 4K9EC 4Y16D 1DBAH 5D1QC 4P2OD 2H1PH 2EYTB 4U0RB 5I73C 1PVHA 3OKDB 4AIOA 3RY6C 3OPZH 5FOBA 1E4XL 4HXAL 4B7LA 4MQXD 4YGVB 4Z7WF 3D0VA 3WE6A 1U3YA 1QA9A 1C7TA 2R0KH 2YA0A 3LD8B 3WJLA 3MMEB 4YK4C 4ENEC 3V5KB 4HKXA 4FABH 3VWKD 5IMKA 1JRHL 4XCCH 5I76A 4OZFG 5EORL 1IGTB 1U6AL 4RA3A 4U6HA 1KCRH 5CEYB 2FJGB 4OUUA 3CAFA 3CXHJ 4R7DA 4GKOA 4ZPTB 4ZAKD 1HOCA 1KLUA 2XZCH 1A4JB 4IMLB 3SJVE 4LCCB 4PREB 2W38A 1VPOL 3MRBB 1HH9A 1YN6A 5FM5M 4TTDC 5D1QD 4K3HA 2HH0L 3T0DA 4K94L 1QPXA 1R3KA 4FTVB 1H3PH 2OM5A 1YN7A 2AK4E 5J0BA 1XF5A 4H8WC 4NDMA 4PJ5B 5JHDB 3SO5A 3V4PL 4RMSA 1GZPA 3TBWA 4MVBD 1DP0A 1EZVY 3MLZH 4QXUL 1U93B 3SN6N 4I2XE 5FCSH 3VMPA 4P46C 2ADFL 4ZG1A 3GMPA 5AZEH 1CR9L 1YY9C 2NY5L 3IJHA 5F72S 1Q8MA 4WDIB 1CICC 3FO1B 2DS4A 3P4OA 2BFVL 5ALBL 3RL1A 3TO4B 1JF1A 1EPFA 2ZOKA 2ADIA 4UBDD 1V3JA 1A9BA 1XF3B 4Q58C 4Z7UB 3GK8L 4BSVB 3V0WH 1BJ1H 1GOHA 2HWZL 3QDMD 3RA7L 5ENWB 3LPWA 1L7IL 2XWJA 2NY0D 1FFPB 4FHBD 1YC8A 3B83A 2YBRB 3H9SD 4H1LB 4HQQL 4J1UB 5C07B 4F7PB 4ALAH 1E4WH 4AQ1B 3VXNB 1EUUA 5FGRA 1PYWA 2VDNL 3S88H 3AU1B 3RPIB 2B0SL 4X4MA 3C5JA 4WWKC 1HIMH 5DD1H 4PRAB 1TZHA 5EBGA 4JFEE 4N0UB 3NCCB 5F93C 3SE9H 3AAZA 1M6OB 4AT6A 3IJSA 5JOFB 2Y06L 2P44B 4WI8A 4HH9A 3FB5B 1N0XL 1KENH 4K94C 4XXDB 4P2OA 3KLDA 1IBGH 3SKNB 5IGXL 3BW9B 5GSVA 1ZVYA 1LEIA 4R90L 2BERA 3ZHLA 4YXKH 2BVTA 4OD2B 3NFSL 3S34H 1RJCA 2R4RL 1EGJH 3VGEA 2ESVA 3IJHB 3UJIH 1QO3B 1FZKA 3LDBC 3P9LB 5IF0A 2VH5L 1A22B 1HZHL 2BVQB 1A3LH 4HSQA 3AMKA 4X0KB 4PJCF 1HEZB 1NBQA 3CH8A 1N2RA 1CE1L 3CFCL 5INCA 1WZ1L 2XPGA 4Z78A 4WV1B 4RA0C 2JELL 2HFFA 4FMFA 1NKRA 1JHKL 1TVHB 2BVUA 1ZGLP 4LARH 4QRPB 4KDWA 5C0AA 2HTKD 4N8CH 2E6JA 3R1GH 3IYLW 1JYXA 3DI2B 1BVKA 5F7KC 1CF8H 2I24N 2YXFA 4NWUL 5L0QB 4BH7A 3MLSL 3K3QA 2VLJB 2CDFA 5FDWA 2VKXA 2ZUQC 3BDBA 1VCAA 3T1WA 2M2DA 4DFHA 4PJCE 3TIEA 5FUOH 3OJ2C 4MS8D 3LEYH 2ZUSA 4UNTA 1T2XA 4KDVA 4D3CL 1A6AA 3BH9B 3LAFA 3G5YA 3HUJF 2LVCA 4JRYA 1ZEAH 4NKDA 5BZWB 3BN3B 2DQTL 3QNXA 4OIIH 5SWZE 4XCYA 1FN4A 1WISA 4KKNA 3DVNB 2EDHA 5C6WH 4HBCH 1JZ6A 5AD0A 1WZMA 2LTQC 5I8CA 1P53A 1CU4H 1BVLA 2YA1A 1J9CT 3QULB 1X5GA 1OSPH 1BFOB 1XF2B 3TC9A 1J1XH 3K8KA 4GG6F 2ERJC 1JGVH 1JNJA 2HKFL 2P48B 5DLML 3FB7A 2ENSA 3MNWA 2OK0H 1J8HA 1CQYA 4PJFB 3OJDA 1CXLA 5IQ7L 1FORL 1R5VB 2NXYC 3MLWL 3CX2A 1NGQL 1FC2D 4YDLB 1U9KA 4PFEA 4DTGH 1TCRB 1VENA 1WAAA 2JCCA 3OKEB 1DANT 2AK4B 2NTSP 2LU4A 2ZSVB 2DLEA 1ZANH 1FRGH 4AG4L 3DIFA 3UTSB 5C3LD 3HB3C 3PABA 1T89C 1JV5A 1Y18B 5E94A 4HGKC 5F3BB 2F8VA 5KSAB 3MNWB 1CD8A 1G1YA 2OTUB 5EUOE 2Z8RA 4PRIB 5EU5A 3LQAC 3QUYA 3ULVC 2A77H 3O8XD 5I6XB 1INEH 3ARGA 3MRDB 2ZOLB 3LN9A 4KRLB 3VMNA 2ITDB 3HI1B 4PY7A 3FQRA 2KUTA 2MFNA 1XGYH 5TF1H 5AD0B 3W9EA 3I2CL 1FVEA 1QO3A 4MDJB 3QQ9C 2HT4D 3CFEA 2OBGA 3ARPA 3B8YA 2ED9A 4MQTB 4PY8I 3RWCA 3MLZL 4QXUH 4HJ0C 4K8RH 4EN3C 3TV3H 2V2TB 2EO9A 4I3SL 4LLQB 2FIKB 4P0DA 4PJXF 4BSWB 3VGAC 1RULH 5AZEL 3LB6C 2I26N 3OB8A 1G7QA 2IPTH 3TJHC 4PR5A 1IGFL 1AP2B 1JL8A 4RRPA 5GS1A 3V79C 5MENB 3GSNA 4BSJA 1A6TB 3IDJA 4H20H 3HAEG 3MUHL 4KK8C 4OM0L 4PJDE 5DJYA 3WIFA 4OD1H 3FQRB 1KF9B 3UTQA 2VDRL 4Z5RA 2A74B 4M61A 1R0AL 1LVEA 5L88H 5DK3A 2F19H 4JN1L 4UILL 4YWGL 1X9QA 5FGSA 3QNYA 1CGSH 1A3RL 3BEVB 3JTTA 4FTVA 4UT9L 4TSAH 1KELL 4FFVC 5E1AB 1IGYB 5I1IH 5J3HC 1NCWL 3EJJX 4MLSA 4GLRI 2HWZH 5CEXA 5L8KB 4Z7WE 3T4AA 3OKOA 2WBWB 5DUBB 5J89A 3PP4H 3MLRL 1QFUH 3P4MA 4D0BB 1AQKL 1U3HD 4PYGA 4PRPB 3PWPA 4L9LA 2B0SH 3DV4A 3R0MA 5HJ3B 2YMXL 4D9LL 4RMWA 1FG2A 5DZNA 4W68A 1ND0A 3RAJH 1T04A 2RGSA 2JJSA 4NZTH 3GBNH 4BFEA 2VLJE 3BZ4B 4J8RA 4QXWA 1IGIH 5IVNA 2PYEA 3F12A 5A43C 1JBJA 5GGVL 2VO5A 3KPPA 2BNRD 2VDQH 5CEXB 3D48R 4QY8A 1UZ6F 3BDYH 1A9EA 1XFPA 3BXNB 2ZUTA 1G0DA 3UYRL 4CL7A 4HUUA 4S1SH 1V7NL 3VFRB 4XC1L 4MAUH 1OQOA 5SWZB 5BV7B 4LL9A 3AB0C 1DUYA 2DJUA 1D9KA 4QT5B 3MUJA 2MKWA 1KTLB 4EI6B 1A3QA 2DM2A 1QSFE 5IB4A 4JFDD 3BRGC 4FABL 1TCRA 5J11C 5HYJA 4RQQB 1EEQA 3HR5B 1EHLH 5A3ID 1XIWA 3NCYS 4HWBH 4X6BB 5E70A 5FHAL 4OJFH 2F15A 3SDDC 4EOWL 3PQYD 3FFCE 1BD2E 1I3GH 1VPOH 3B9KB 4LNVA 4FFYL 1RHHB 4YXHH 1S9YB 2HLAA 1CE6A 1Q0XL 4PJAB 1S7VB 3MXVH 4F37K 4AEHL 4LCWD 3FO0H 4JZJB 2VDOH 1MJ8H 4XT1C 4LKCA 1KCVH 1I9EA 4MVBC 1QBMH 4HG4J 1MCEA 3GMRA 4UDUB 3BP6A 4FQLL 4MQSB 3BKCH 4G80B 2R4RH 1LMKA 5E8EA 4KU1A 4A6YA 1VESA 4X5WB 5TH2B 4LDOB 3U46A 4GQPH 1PDKA 4KRNA 2J88L 3MC0A 3PHOA 1ZLVK 5EO1A 5H2BA 2JJWA 3BUYA 4PJ9B 4X98A 4QF1B 4I8DA 1X7QB 5BJTB 3FB5A 4X6DE 2A83A 4HPOL 3MCLH 4WU7B 4H1LH 1KXQE 2XIDA 4BELD 4HCRH 4M1GH 4HIEA 3HC4L 4D8PB 5D1ZD 4U6XB 1CLCA 5DUMH 4H20L 3ZKNC 3LKQB 3RL2B 3HRZA 4G42B 5MEQA 4R3SB 4JM4H 5JLZA 1NC2D 1UB6A 2CIIA 2M1KA 3ROLA 3V0VA 2DLFL 3CVHL 5TE4L 4JN2B 3TIDA 1YMMB 4MX7B 5CJQH 5ITFA 1J5OL 4IDJL 1CLYH 3W0WA 5DGQA 5E95B 4K7PY 4NQEE 3BEWA 3X11A 5HYSA 4NKOB 5IB3B 4QRQA 1UJ3C 4ODWB 4OGXH 4BK4A 3K2UH 1F11A 3MXWH 4XBPA 4KKAC 1QYGL 3ME0A 2C4FU 2HA1A 1GJIA 1A4KA 2NX5E 3BPCA 1Z3GH 3MACL 5BZDB 2MCPL 2RHEA 3ULUC 4PD4K 3EZ8A 3AS3A 4NQEA 1A7OL 5JMRA 3B2UC 4DOHE 4ZFOA 4Z7WB 3UJTL 4IRSB 3OKLB 1K4DB 1OGAA 4LVEA 1YMMA 3ARBD 2C3VB 4G5ZH 2YK1L 3MV01 1PLGL 3U36B 5F8QC 3MA7B 3TF7C 1X4ZA 2GJ6B 3CMOL 4M1CC 1NJ9A 5HVHB 4X9BA 5F8RC 5EZLA 2R69L 2HJFB 3H42H 1ZA3B 1HWHB 3REWB 3BPCB 2YUZA 1F6AA 1JYVA 5FA4A 1C08B 4JN1H 2YPVL 2ZPKL 3WDJA 1OF2A 5IB5A 5CCKH 2IQAB 1MWAL 4EI5D 1C5CL 5EBMA 4OCXL 2NXZC 3G04B 1U8NA 4AK1A 5CLTA 4FFZH 3KPOA 2HLAB 2QQLH 2LU3A 4XGZB 4WFHE 2KH2B 4UNVA 3BT2L 5BW7A 4P9MH 1LO2L 3MLPA 1KT2B 4MB3A 3W9DB 2DYPA 2E7HA 3R06B 5CLWA 2QSQA 4PRID 5IT2L 2V17H 5C07D 5GXBB 2DMCA 1IL1A 3RIFK 3RY5A 5C0NC 2ZNWA 4U7MA 4ZUVA 4JVUA 1JNNH 1GZQA 4OLUH 4DZ8B 3REVB 4NFDA 1AGEB 4F3FB 2R39A 3VWJB 2V9RA 2WINB 4Z77A 4MJ5A 2AXFB 3O45A 1RZKC 3HNVH 5E6IB 1AGBA 3EYUH 4HWBA 2BY3A 1J0IA 1WBYA 3MV7E 4PJBE 4KMTH 1A6WH 1H8SA 2Y07L 1DVFD 2BC4B 2XTJC 4O2FB 1DEEA 2FWOA 5CWSB 1IM9A 1MJJA 4HIHB 4DKEL 4G9FA 3V4VL 3L3IA 3DUSA 3GEWB 1I7RB 4RAVB 2H26B 1VADA 4UAOC 4NQDE 3ARSA 4LKCB 4KI5F 4PJAE 5CZXD 3MRIB 5E8OA 1C7SA 1CXIA 4YHPB 1LDPH 2AV1A 1U95A 2EDQA 2ZG1A 5IESL 4OZIB 1KG0B 1WK0A 3UC0H 3BKJH 4KTDH 2NY4D 3GGWB 4HXBH 2ZUXA 4LMQI 4KUCF 5MP6H 5D72L 3SKMB 4F37F 4MQ7A 4PJHE 5IMLA 1MCQA 3A0OA 1NEZB 4QWWC 3VGGA 4XBEL 1Q72H 2DYPB 4NHCH 1F13A 4R6UA 1VFAA 5INDB 2GQHA 1G9NL 3F12B 3NA9H 4WO4A 3KJ6L 1MJUH 3SPVA 1ZHNB 1RUML 4YE4L 5JXEA 1RZFL 5ID1A 2BZDA 2E9IA 4L9LC 3S9DB 5KVFL 3QXAB 5A16A 3O4LB 3P0VL 3AXLA 4AH2A 1IAMA 1QFOA 3QRGH 4C56E 4R7DB 4ZFZA 2DWDB 2R0LL 4U1KA 3MJ9L 1T1YB 1MCPH 3AROA 3GHBH 4KJWC 4LCCA 2J4WH 1IEAA 4ODXB 4PLKD 3KYAA 4X6DA 2BK8A 2O5XH 1AFVH 4OGYL 3VG9C 3THML 1RUPL 3HI5H 4NYLB 2GT9B 2CPCA 3ZL4L 3K46A 3X3GL 2W9DH 4MAYB 4G7VH 2EE9A 1MWAA 4LLUB 1WT5C 4J23A 3VFGL 3HAEA 2EZ0D 2AV1B 1FG2B 4KXZH 4PJHB 5EC2B 5FHBH 3I9GH 3TCLB 1MFEH 1E0OB 3D9AH 3OKNA 4J12A 2MQ3A 1IQWL 3O3AA 1I7TA 2VABA 1T1YA 3AS0A 2HKHH 4DGYL 4IM8A 4Y5VC 3CDGA 2AJYL 3N1QC 1K4CB 3S37H 3QEQE 4JRXE 5CCKL 3RWCB 1V3MA 4PP2A 4LASL 4NO5B 4GRMB 1OAZL 3WFDH 2FO1A 3Q6FA 1AO7A 1JGDA 2V9QA 3L9RB 1MFAH 3RWEA 3LRSA 4Q0XL 4XC3H 3M1BA 4GG6B 4CVWA 2IFFH 4G9DA 2RR3A 1AQKH 4EIZC 1O7SA 3S6CA 1MJ8L 2H9GA 5CIPH 2NY7H 3T77A 4EUPH 5DC0A 1QBML 5CIPB 3ZYOA 4C83A 4X9GA 4F7MA 1GHFL 5ILTH 4LVNB 1CTNA 4M8QA 4U1NB 4P59H 3U9PL 4RGNE 5D70L 1DN0B 4Y19D 5DJ8B 4KGJA 4DGIH 2YPLD 3WEXA 4GXVH 4YHNB 3VWJC 2SEBA 1WIPA 5E6IC 3MNVB 1OT1A 1K2DA 1KN2L 5DURB 4F33A 4L8CB 4N0FA 2D9QB 1KULA 3OV6A 4N9GA 3LMJL 5JW4N 4NN5C 2CXGA 4L8DA 4YIQB 5SWSA 5JR1H 1CLZH 4HZLB 5CBEB 1T66C 5E5MB 3CUPB 5A2FA 1IAOB 3WE6B 4YDKL 4B5EA 5HHOD 3MLTB 4MD5B 4YC2C 3QIBC 2ATPA 4TUOB 3OMZA 1BQHB 5HI3C 1T4KA 1QKZL 4K3GA 2ATKB 4LHJB 5FA3B 1AD9B 1JPGA 2DD8L 1CGXA 4TRPL 2ESVD 4M43H 1WWCA 4D8PA 2ICWB 4YDJB 3SE4A 2I60H 1EK3A 4I0PC 4LNRB 1PEZA 4QRUA 1QSFD 2AJZA 2HFTA 5I2IA 3BAEH 3SKOB 1TETL 1GC1C 2W9LA 5FDWB 5GZOD 5JW5B 5I9QB 4LLDB 4MJ6B 1F58L 3KPRD 5DI8A 4HGMA 1HKLH 3IU4H 1FH5L 2APBA 2DQCH 4ZD3L 3QBTB 4NQUA 4ELMA 3O4LA 3RGHA 1Z0MA 1VA9A 2R56H 4POUB 3Q0HA 4ODBD 3IXAA 4P4KA 5DTFB 5J8OA 2PXYB 5J9PB 4KJWD 4ORGB 4CADA 1UEMA 2FRGP 1A6VL 4L4VE 2CKBH 2ICWA 4YDJA 2X9XA 4P2RA 3FO9A 3GRWA 2MPAL 1DN2A 5CILH 1ZLSH 3CLFH 3DROB 4H88H 5IESH 3SGDH 5DD6B 5IFJB 3L5IA 3TH4T 5CGMA 4MD0A 4HXAH 5HY9B 1SMAA 1ZT7A 1IQDA 3OSKA 3QIBD 4FN0A 1LK2B 3IXTB 4FZ8H 5JOFA 3KHOA 3O2DH 5EOTA 5IK3A 5BW7C 5D7LB 5CJXA 2ADGB 3F65A 2B2XH 4LSPL 5GQBA 1JGUL 4NKDB 3CFBA 1AE6L 3IDNA 5IB2A 2D9CA 4GRLD 2Z93A 3SY0A 4Z7UF 3IFPA 4XMLH 5ICXA 1QRNB 5FYJH 1DN0A 4OLUL 5ISZB 4Z78B 1UACH 4YE4H 2XZAL 5E6ID 2P49B 1I3UA 4KQ3L 1KENL 2BVQA 2ED7A 2GTWB 3MRPB 3V7MA 1T22B 3V95A 2PYFB 4KHXH 5CSZA 1RZJL 4WWID 5ECJE 4RGMB 4NO2A 4XBGA 3O41A 2YPLE 3T0WA 4OZHE 4ZS7H 4MAYA 5HYQA 2C3HA 5FF6B 5C0EB 5KVEH 1S9WA 4JO4L 2F53B 5HGHA 1AFVL 3NFNB 2ZWLT 1JF1B 2VC2H 1HINH 1FFRA 1GGCH 4JHWH 3CIQA 1ACYL 2JK5A 1FNGB 4JHZA 2ESVE 3HFMH 2YWYA 4N9GB 4DN4L 4OZHA 1DFBL 1XGPA 3EOTL 2GITA 2BNRE 1FO0A 2QKIA 3K8LA 5CINH 5DVKA 2VDKH 4HX1A 5MI0C 3MRDA 4WEUD 1X5ZA 1BMGA 1JIBA 5TDPA 3G6AA 5GGRA 3NA9L 3BP5A 2EC8A 1GGUA 3SQBA 1HXMA 1Z2KA 3D39B 4KI1A 4Q0XH 2W65B 2AERT 3LZFL 1MCOH 1W72H 3TWCL 4I48B 2BNUB 3WIIL 5IT2H 3MJ8A 4L8SB 5CHNB 4WHYH 3LV3B 5FO8B 5HGGS 2VDLH 3DX7A 1DQTA 3GSQA 1OGTB 4LSRH 1OHQA 1DDHA 3MUGB 1FSKB 3BH8B 3RDTD 3OKEA 1B6UA 2GJZA 2R23A 3CZJA 3I02A 4LLMA 4RGOH 4NNPH 1TDQA 4XPFH 3BAEL 1WUNT 1IGML 3BZDA 3O2WH 4XH2A 2FEEI 4X8JA 5C0GB 1P5UA 1KB5A 1ZLWH 4APQD 2CLZA 1RZGB 5FOJA 1J8HD 3IDGB 1XGRB 2JJVA 4D94A 3CFKA 1J0ZA 4FG6D 2X4PA 2Z8WC 2MCG1 1MQKH 3HLAA 2VITA 3FQTB 5CEZE 3ZLQC 3VXUB 3L7FB 5I19L 1FORH 5JORA 1S78C 4ZXBB 3IETA 1T7WA 5HJ3A 3SEPA 1NCUA 3CU7A 4J3SA 4JHAL 1UKTA 4MXQD 4PYHA 1CE1H 3D39E 2FHBA 1MIEL 2HT3D 2FEEL 2CUHA 1INQB 4ELKA 4EVNB 3ZE0E 4M8VA 4UT7H 4E9LA 5B3JF 4LARL 3L5HA 1JHLL 4Y4KB 1DUYB 1KB5H 1UH3A 1CL7H 5EUOF 2BNUA 3TCXA 5C0FA 3RI5K 4HUUB 3JBG7 5IP4A 3DO3A 2FWOB 4JR9H 5CWSA 4LAQL 2PYFA 1TJIL 2BSRB 1HNGA 1EEZA 4XNYH 2WBJC 4DKDC 1AKJB 3U9UA 3QIWD 4IOIA 4WI6A 1W72A 2IH1B 4KWUA 1ZGLM 1N6VA 3U4EB 3ZTNL 1NCAH 3SGDI 4I18A 2CLRA 3B9KA 3MV11 4V2BA 2P45B 2Z35B 4M6NH 25C8L 1MSPA 4HAGA 1LE5B 5AWNL 3CH1A 4Y19A 1MCHA 1I9IH 3RI5F 4YR6A 5IFAH 1ED3A 2P7TB 4WWKA 4GAGH 5SWQA 4PR5B 4RGMC 2JJSC 4XB7A 3C8HA 3LS5H 3B8SA 4WFFE 3RWFA 4O9HL 4QHUA 3QNZA 1KB9K 2WBJD 4JKPH 4UTBL 4XPAL 1H5BA 3NFNA 3I3EA 5H2BB 1T7VA 1ZHLA 5CILL 1YEGL 4NZRL 3VGAB 4BQ6A 4ZQKA 4YAQA 4X4YA 2C26A 1AQDA 5F97E 2K9UA 5SX4H 3FMGH 3ARZA 3HG1A 2Z92B 4ZTPL 5E8DH 3H3BC 1R5WB 1FO0B 3LSOA 1S7VA 1KPUA 3P77A 1BOYA 1D9KC 1J1PH 1ORQA 2YUWA 2VZ3A 1T5XB 1JNLH 3DMMB 3ZE2F 3ZMRA 1IEBB 1FGNH 3IFPB 1WCQA 4GKSA 5DEGA 1UEYA 2ICCA 5B3NA 3DRQB 1QLRA 1HXYB 1CDIA 3KJ4C 4Q6IC 5D7SL 2ZOKB 3VFOB 2NY6B 1MCIA 5DVOA 2XXMB 3C2SA 3OXSB 2MTPA 2V2TA 4S0SD 1TPXC 1VACA 1AJ7H 4J3XA 4BZ1H 4BFIA 3W39A 4R4BA 43CAA 1IQDB 4MNQB 4HS6A 2F5AH 2CSPA 2JJTC 3ULUD 4I2XB 1SHMA 4TSBH 2E7LC 5IB3A 4QHUB 5HDQL 2CRYA 4DQOL 3D0LB 5JA9A 5JXAH 2VLRD 3HZMB 4KKAD 1JZ3A 4FQIH 3BJLA 2Y6SD 4LEXL 5T5FH 5L2JA 5J12C 3UTOA 1MCJA 4PLJC 3V0VB 2Z93B 3VFUB 2B1AH 3ARXA 1X5XA 2FCBA 4OF0A 1IGCH 4OD1L 4OZGA 1CLZL 3PF2A 5D7JA 2CKBA 3EJYD 4PG2A 5J9PA 2J6EA 3RWIB 5FEBA 5MEPA 3RNQA 1CG9A 4HG4K 3TFKC 2Z91B 4OLYH 2A6KB 1T2QL 5KVDL 3O4LD 3EW3B 3VXQB 4QTIH 1HYRC 3QXUA 4K3JL 5T5NF 5I15H 5KTEL 1EV2E 2VDKL 4NN6B 1WEJH 1N5YL 5IG7A 4KFZC 3MRQA 4IHOB 3U4AA 4MJID 2VIRB 1IGJB 1UH4A 2WLYA 5HGBB 3U0PB 3U30C 1UZ8A 2J12B 4WO4C 2VWEE 3MGOA 3STZA 3UPRA 4O2CB 1NGYB 5GGSY 3V7AG 1NCDL 5D7JB 3BMWA 4YGVA 2VE6B 1L9MA 4C56B 2UWEB 1YA5A 3SDXE 1H3VA 3QQ4B 4H0IA 4DZBB 3TIDB 4V1DE 4GKZA 4LCWB 3O8XB 3B9KC 4G5ZL 3OR6B 1YPZE 4Q7DA 2FEDD 3TVMC 3S35L 4LP4A 1L6ZA 3OAUL 5DJXA 4X5LA 2O5ZL 5DD3H 1CDBA 3KLAB 2W91A 1IC7H 8FABA 1PQZA 3TT3L 3K81A 5DK0A 3L5WA 5C0JA 2Q6WA 2ZJSH 1S7UB 4QRUB 3P9MA 4HWNA 3ZKMD 1KTLA 4TUKL 1RZ8B 2EXYD 4V1DA 3RNQB 3EOTH 4V2CB 1LHZA 3FO2B 5FO8A 2F5BL 5A3IC 3ARFC 4MAUL 1BBJB 1TQCB 4LU5L 1QRKA 2R4SH 3GIZH 2VTFA 3N1PC 4ELKB