1FL3B

Crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
214
Chain Sequence
b'AALTQSPVSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPNRFSSSGSGTDFTLRINTVEAEDVGVYYCAQNLELPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLUE FLUORESCENT ANTIBODY (19G2)-HEAVY CHAIN
publication title Blue-fluorescent antibodies.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2000-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3B01
1G9NH 2E9WA 4PJ9A 4KGJA 5JLZB 1DBJH 3EO0B 3BH8B 2IEPA 5ICXA 1R5VB 2AV7B 2XG5A 1A47A 1EEQA 3PNWA 3TLRA 2HVJA 2R39A 4OTXH 3W2DH 5KS9E 3H9HA 4LARH 3TBTA 4P4KA 1WWCA 2M2DA 3F12A 4P5MA 4YDVB 4HS3B 1SY6L 3C5ZC 2QADB 2EKJA 1A4JA 4Z7QE 3O3UN 2JELH 3I6LD 3ULVD 1KPVB 3VXUB 1IGMH 1MFAH 3UJIL 6FABH 1CBVL 2GK0A 4FQQA 4JANB 3D39E 4YK4C 3WN5A 3LPFA 5DJAA 3CVIH 3CXDL 3RL1A 3N06B 1A1OB 4XNMA 5GGTH 5TFSH 1FZOA 5E2WL 4XCEA 2YS4A 1I9RH 2W9EH 3N85H 2JCCB 1BGXL 5F89B 1BIIA 1LEKB 3C60B 5K9JL 1AI1L 3ZKMC 5H94A 4S2SA 4L1HA 2PF6A 5MHSD 2XKUA 3WFCH 4LKXA 4W6WB 1NCCH 1IQWL 4LU5L 3UCRA 2XA3A 4PRPD 1MIEL 4ZO9A 1BHGA 2LAAA 1X5GA 3FOLB 3QHZH 4WGWB 2WUCH 4TSAL 4S1DC 3T4YA 5I19L 4M5YH 2WBJB 1ZEAL 4LIQE 5FF6B 5J11C 5EO9B 32C2B 4M8VA 4LDOB 3B9KC 5DD6B 5IBTH 1TJIH 2J5LC 5E2TL 4XB7A 1CLCA 2NY6C 1MFEH 4JCMA 4NN5C 3GI9L 2G2RA 3VI4F 1FL6B 2V5TA 5EOQH 2W07A 1G0YR 4MSWB 1N64L 4PJGA 4XNXH 3S3PA 4AL8H 1VACB 3GSWB 4LSPL 5AD0B 1EK3A 4MQXC 3MRNA 3NZ8A 2O93L 2VAJA 5L8LB 2BK8A 4YHIA 4ODUB 4DK3A 3BKYH 4XPHL 2VR5A 1WBXB 3BX7C 3NFPA 4O2FB 5GS1B 1VEPA 1S9KC 2DWEA 1WZ1H 4P2CG 1Z5LA 4H25A 5HHPA 1JGUH 3TO4D 2DTMH 5C09A 3NAAL 4PGEB 5D7JC 3D69A 5FB8B 4F7TB 4HDIA 4HS6B 1F4WH 4Z7OE 5EC1B 3C8DA 4O2CA 4DFHA 3VWJD 5IV2A 3LEXB 1ZGLA 2YC1A 1N8ZA 3BZFB 1FYHB 4Q9RH 3SO5A 5AYUL 1A21A 1DEEA 1OD7A 1G7PB 3L5WB 4L4VE 1JFQL 3MRKA 1YDPA 1WBYB 4XC3L 4OZIB 1FGVH 3BZ4A 4GRWE 1OCWL 3AS1A 5E95B 1RHHA 1UB6B 4AMKH 4JFEE 2OZ4H 5DS8B 4YX2H 3MA9L 4OZHE 4MD0B 4NKDA 3LIZL 1KACB 3EO1A 1CIUA 2Y36L 5EO1B 1EH9A 2X4OA 3SGJC 1NEZA 5E8OA 1J05B 4P59L 1FFPB 3MJGX 2QKIA 4G80A 5J6GB 2APBA 2EE6A 4Y2DD 4JQIL 3DRQA 2HMIC 4KMTL 5HDBF 4GQ9L 2Y23A 4KI5D 3G6JF 1J8HD 3PWLB 3RZWA 4OZGA 3QFJE 5HY9B 5HHOA 1D5MB 4KGLA 4OSUH 1RIHL 5CEZH 1NKRA 1QEWA 3LHPH 3HZMB 3HUJB 4PREA 1URLA 4PJFE 2VDKH 2P48B 4HC1L 3GSXA 4ZUVB 5J89A 5ESVA 1IBGH 4JHWH 3SKMA 2ZOLA 5JA9A 3SDDC 1L6XA 2VXUL 5GSRA 3KPSA 4X6DE 5I8CB 2AJUH 4H0GA 5DJXB 2F5BL 2OI9C 1GC1H 3ALPA 1JTTA 1JPST 2P5EA 4L3EE 1H5BA 3HS0A 3S98A 1A6UL 5DHYB 3ULUD 3QUXA 3O4LD 1RK0B 4CW1A 1V3KA 1GL4B 4A6YL 1F3RB 3LEVH 3CFDB 1LWRA 4PRHE 1ITCA 2O5YL 5CEYA 5EA0L 1YMME 4HV8A 1KTRL 3UTTB 1TVDA 1WBZA 1MREL 3IXTB 3EGSB 1NCWH 3IDNB 2WP3O 2VH5H 5E6IB 5BRZE 3FQUA 2P5WB 2O5ZL 1S7QB 3DSNA 1JNHB 4PTTA 1FDLL 5SWSD 5LKNA 1JYVA 1L0YA 1YQ2A 3EOAB 1LP9F 3DMMA 3TP4A 3VD5A 1ZT4A 2EH7H 3O9WB 2AXFB 3CJJA 1JF1B 1ZLUH 2C7UB 4ZFGL 4XWOC 3G5ZB 4HMCA 4XP4L 3VXME 2FZ3A 3TF7C 2L7JA 3IDGA 3RQ3A 3BE1H 4ORGA 4P46A 2ILLA 3C6SB 1QTYT 2BCKB 3MO1A 4UOJA 3W0WA 3ZT6A 4QRRD 4UU9A 4PB9H 1V7NL 4X99A 3QDMA 5AZEH 4NQUA 1ZS8B 4PLKD 1N0XL 5D2LA 4OT1L 5L2JB 3V5DA 4LQFL 4OKVA 2YPLB 4HUUB 4WJ5A 3QXVA 2E6PA 1L4IA 2HTLC 3NA9H 1JV5A 4XP6L 4LLUB 3H3KA 4WUUE 3V8OA 1JHLL 3BYYA 2BXZA 4FQ1L 4MNQD 4FXLA 1ZHLB 5JO5B 2UWEF 3FOMA 1WITA 1QBBA 1QR1B 1RUPH 1MRFL 1NKOA 1CFQA 2ZUXA 3OAZH 4MVBC 5DDHB 4CN1A 2BVPB 1MHHB 1T1YA 2JIXD 3FONA 4FFWD 1KIRA 2EXYD 1RZKH 2H3NB 3PQYA 1N6QH 3FB7A 3HB3C 1Z3GH 4ELMA 4PJ9D 3CX5J 3FQTA 4EZMA 1D5ZA 4PJAA 3RWDA 2EE3A 4R4BA 1G9ML 4R4ND 5IEHB 3VMNA 4LBEB 4WI2A 3TESA 5MEOA 4P4KD 4FQIH 1JMZA 5HHXH 3DPBA 4DKDC 1S7SB 2VLRB 3DETD 2BX5A 3DYMA 3U0WH 2DWDA 1IGIL 4TSCH 3VXRB 1O5DT 5FECB 3HI6H 1RAMA 2NXZC 1S7XB 2ZUSA 4QHMA 4TUOA 2QSCL 5J13C 2JCCF 1KGCD 1MCWM 4PJ8C 4WU5A 3EKCA 5JOPE 3VGGA 1YEDB 5CJ5A 3F7QA 6CGTA 1N59B 4YHOL 3K0WA 3VGFA 4TUKL 5GGSA 5FUZL 2F5AL 2B20A 4O9HH 3LS5H 3L95B 2CDGB 5FHAL 3RNQB 1DQLH 3OQ3B 4K3GA 1MH5A 1WIOA 2ID5A 4JFOB 5EIQA 1HYRC 2NYYD 4R96A 5CILH 4LIQH 4JPIA 5I8EA 3TFKC 2H2SD 1CDGA 1ONQA 3BIAX 4M7KH 3C5JB 1IARB 1QQDA 3S34H 3C5ZA 1EV2E 1NGPH 3ARFC 4AG4H 5KS9B 3RGVB 3SE9H 4F7CA 2GJZA 1J0ZA 2LTQC 1X44A 3U46B 1WIPA 3OJDB 2CDFA 2ATPB 4YAQB 4K3DL 5KSUA 4X6EA 3MFFA 4YDIH 5EBWB 1P4LB 4Z18A 4FQCL 2AS5M 3E6FA 2EIZA 1F45A 3BKMH 4XAKD 3S36H 3EYVB 4TVPD 4Y4KB 5GJTH 1JZ3A 1MUJB 2Z8RA 3D39B 3P11H 2KH2B 1L9NA 4HJJL 5GRUL 4M7LH 3BVNB 4U6YA 4LP4A 1IKNC 5F3BA 2CLRB 3HNTH 5C09D 5IB4A 5A2IH 1AGEA 2X4RB 3LN9A 2P24A 2R1YA 4AQ1B 2HLAA 1RZJC 4JDZA 2SEBA 3QIWC 3WKML 4QF1A 1OOAA 5ID0B 1ZSDB 3P77B 4UNVA 2EO9A 3QEGH 2N56A 4U1HB 4BYHA 1QBAA 2BMKB 3LB6D 1N2RB 2BRRL 2FJGA 4Y19E 3MLZH 4ODBD 3B9KA 4EJ1C 5M95B 4N90D 3VW3L 3JXAA 4OZIF 1IT9H 1PG7H 4GRWH 3RWIA 1TQCC 1UZ8B 4GBXC 1SMAA 2B2XH 1WTGT 2CMRL 2ZKHH 4LVOB 1L7TH 4JRYA 3I75A 1FFOA 2ADFH 1J18A 4XC1L 2BVQA 4YHKH 4NC0B 4BFIA 5DJDA 1JCKA 4PJDE 3WIIL 2VXSH 5JW3L 3QUMA 1NFDA 3IDXL 4OV5B 1NCBH 3S36X 5D7JA 5F1NB 5KG9A 1VHPA 2XY2A 5LQBH 2IH1A 1M1SA 1IL1A 5TGBA 5EWIH 1FRGL 3RNKA 2FX7L 5HHOD 3QDHA 3BT2H 3HUJF 1W2KT 4U1NA 3KPQB 5DMJB 2XQBH 5TQ2L 3OR7B 5GGQL 5DVMA 1F13A 1AGBA 2DBLL 1A9EB 2ICEB 3SDAB 3BGAA 3BIBX 1I7ZB 5CP3A 3TBWA 5GS0L 5L88H 1FN4B 3BPNC 4MJ2A 1DDHB 3KPSD 3OKKA 4L4VB 4EOWL 3L5XH 4NKOB 1IAOA 4KDWA 2PYEE 2P5ED 5EH1A 4LLVB 5J1AA 1C5BL 1DZBA 4KJWC 3VG9C 4D0DB 5KSBA 4X4ZA 2NXYD 4P57A 2CDEA 5F6HI 4GRWB 4CADB 2Z8VC 3DBXA 3QUXD 3GBNH 1U8PB 1XT5A 2OXGA 3JTTB 4MLSA 4LPWA 3SDYL 3BHBA 4JFEB 4JVPA 5IM7A 4MXWH 4OZHB 1FFQA 3SGJA 3O3EB 5JXEC 1DBKL 2RQ8A 2W65B 4I5BA 2N7AA 4WEMB 2VLKE 3Q3GB 5TQ0L 3ZKSD 3KS0H 2X7LA 5CGYC 5C9JB 1IEHA 4R7DB 4XAWH 3AXLA 2AJSL 1HHKA 1WC7A 5AEAA 1NGZB 2J7LA 3FO0L 4X8JA 3T0XA 1G9EA 3D3VE 4JREB 4WW1A 5JUEH 3QEQE 2YPKB 2BZDA 5HHME 3RVUC 2AK4A 3U7WL 5JPMA 3UTQB 4U1GC 3QFJB 4NIKB 5BXFB 3DMMD 3BD5A 1A6VL 2EDRA 2QQLH 1NGQH 2UUDK 4GXVH 3BP7B 4Q2ZB 1KJ3H 2DTSA 2R4RL 4CVZB 4D94A 4PJFB 3RPKA 1Z9SA 3U0TA 3PIQA 1CCZA 3TH2T 5IVNA 2R56H 3SDDA 3EOBA 3INUL 5IJKC 5J7CC 3EO9L 2LU3A 3DYOA 3V79C 2CK2A 3BO8A 1FG9C 1N5YL 1RFDH 4P46D 2X4QB 3NCFB 1S7RB 2G75A 4O51A 1HYSC 2ZNWA 5KJRH 4QHKI 4L3EB 4H8WH 3W0WD 1GZPA 5DQ9A 1A4KA 1HI6A 5I66B 5MEQB 1F3JA 1YNKL 3QDMD 4I4WA 3O11B 1JYXA 1II4E 1J8KA 2R1WB 3GIVB 4PGDB 4PRHB 5HHVL 2FJFA 1JZ2A 1JPGA 3QG6B 1YMMB 4UT9L 4U1MA 4H20L 5ANMA 4OF0A 1MEXH 1A3QA 2Y4SA 1NUDA 4XXDB 3RVWC 3CZJA 5EORH 2OR8A 5BRZB 1IC7H 2G9HB 1U95A 1EEZA 5HGBA 5H35A 1FCGA 3FJTA 3O4OC 1ND0A 4M93B 4MQ7B 2AJZA 1QFUH 4LLMA 4NNPL 1JUFB 1NC2A 4L8DA 4P5TB 1V05A 2CJUH 1C7SA 4UB0H 1S7WA 3F58L 3NIDE 3PQYD 2A73A 2ARWA 3VXMB 2FWOA 1NLDH 4KPHL 1ACYL 2D4FA 4QEGA 1D5XA 1KJVA 3HHRB 4NO2A 3FB5A 1AQKL 3PXJA 2ORBL 5TDOA 3EHBC 4JPWL 3VFSA 2DI9A 5EU4B 5C0AA 3CK0H 4BZ2L 5C6WH 3L3OA 4FG6C 1OTTC 1ZHBB 2ZG1A 3MOAH 1UC6A 1QLEL 4HXAH 1MHPH 3LOWA 3AS0A 1FIEA 4RAUA 3AREC 2H2PC 2KKQA 4PYGA 2H41A 4U3CA 2BOCB 5D2NC 1AP2A 1F42A 1I9JH 3U48A 3WD5L 4LPVA 1AJ7L 4J6RL 5J12C 4BZ1L 1NQBA 3JUZA 4N0UA 4WUUB 1X5AA 1WV7T 4IOSD 1NC4A 4X4XB 2BSRB 5I74C 5DSCA 2P8PA 5GS0C 1MI5A 1IGJB 3T3ME 3PGFL 4FFZL 4RBPK 2WK2A 4ISVA 3ARBC 1Z0MA 1J1XL 3JV4A 4U1JB 3ZDYE 4LAQH 3CU7A 1NLBL 1RIVH 3GKZA 3MUJA 1Y0LB 5C07E 5ABDE 5KS9F 4CKVX 2YN5A 1JPTL 1XIWC 4RNRA 4XVJL 1LEGA 3C5ZD 5HI4C 4K3EH 4X5XA 1EFXB 4LCWE 4X80L 5T5FL 2I9LB 4Z7QF 5H2BB 4NQEA 4C83A 2AAVA 2VMFA 3SKOA 5BV7H 4K3JL 2C3HA 2ZG2A 3RI5K 4M1DH 3WXVH 5DLMH 5L0QC 2DQCH 5E0QA 3L3JA 4PJ8A 4YFDB 2NY1B 4G6JL 4BFGA 5ACZB 1OPGL 3IDYC 5ALCH 2D7NA 3QJHA 3REWA 4HC1A 2BNRA 5D96C 4OF5A 3VFNB 1T2XA 5LBSH 3ZKMD 2VISB 4DGVL 2XWBA 3VFOA 2FRGP 1BQSA 3FFDB 5I15H 3MREA 4WEBL 43C9A 5TE6L 1YJDC 2H6PB 5CSZA 3ZTNL 4PR5B 3K4ZA 4OLUL 2VXVH 1QFWL 3GSNH 4P4RA 5D9SA 4NC1E 4S1DD 4JVUA 4Y4FC 1YPZA 1HKLL 2EYTB 3HRZB 1UACL 2XA8L 3R06B 4PGZA 3ARFA 4LGPB 3IFPA 3B9KD 5FOBB 4I77H 3U4BH 3LRSB 3DURA 3DI2B 4F57L 2NY6D 1MSPA 1OP9A 1U3JA 5IQ7L 5DD0H 1HXYB 2ITCA 5GRJL 5AWNL 1D5BB 2PUQT 4XBEL 3V6OC 4KHTL 2Q86A 2VTFA 3O3BB 4MQXD 1ZHNA 3PWNA 5SWZA 4Y8AA 5DZLA 1RZ8B 2E8YA 4JRYD 1A2YA 5BV7B 1BBJA 1K4CA 3TCLA 4PD4K 2IAMB 4PJHA 3IJYA 1Q9LB 2NY3B 1HSAA 1IKNA 1Q38A 1WSST 1A1NA 3JVGC 3MGAA 1A7OH 4GRMB 4I18C 4XHJC 1JPSL 5DC9B 3X17A 1ZANL 1CE1L 2GCYA 3MRDA 2VLLB 3SY0A 1JGDA 4JKKA 3AS2A 4ZQKA 5D7JD 5D7KD 2GJ6A 1FJ1A 5FKAA 3BYTA 3QIWA 4Z7OF 3K46A 4YHNA 2GTWB 3GMRB 1C1EL 2D7OA 2D7MA 4QTIL 3O0RL 3CX2A 1FFRA 4NT6A 3LAFA 4AIXA 1Q1JL 3WDIA 4XX1G 1KPUA 5C0FB 4JRXE 4P9HC 2V2TB 2MMXA 3GSNB 3KYOA 4ZOBA 1U3HC 5I1JH 4JAMB 4BQ8A 1P9MC 3MRMB 2HAZA 5JDSB 3DARA 4Y19B 1ZVSA 3QJFB 4GBXA 3HZYA 3CZFB 5HVHB 3W5NA 1CFTA 3P0GB 4GRWF 4XP1H 4M02A 2NZ9C 4F8TA 4GG6E 2GI7A 2PR4H 4QRTB 1WTLA 4OZHF 5HDQL 3TZVC 3QFDB 4OAWB 5AUMB 3K3QA 4NRXB 3MR9A 1OWWA 1SEQL 3QCUH 3L3IB 2H9GB 4NZTH 1UYWL 4KRPC 2J6EH 4LSRL 4PJDB 2GSIB 4XVSH 2HMID 1ITBB 2EKSA 2IC2A 1EJOH 1TVHA 2RIKA 4WW2B 3MV9A 2P42B 1QSFE 5ILTL 3MRBB 1E4XI 2RFXA 2E7CA 3RGHA 4DAGL 3HLAB 4NRYB 3HZVA 2AK4D 3LQMA 4ONOA 4Z0XB 2BXYA 4PJFF 5KVGH 1DBAH 1ZLWK 3ES6A 1CG9A 1KLGB 3GK8H 2CK0H 2NNAA 4MXVF 4R90L 4OF3A 3ME0A 1S7UA 2AEQH 1G0XA 5INCB 4YDLB 1OP5K 4OBRA 2VLME 3SDDD 4D0CB 2I60L 3HZKB 5DQJA 3KYKL 5F3HA 4P2RA 2W0FB 2DL2A 5IFJA 4GSDL 4F33B 1RULL 3M1BA 4PJ5B 2BY0A 2ADIA 4JZNA 4OD2B 2PYEB 4TOYH 1N7MH 1T1XA 1E4JA 4ONFH 3WO4C 2VDNL 5TPWL 1IQDA 3AUVA 4NM4L 1DN0B 4PB0H 2QSQA 5JXEA 4NZUL 1RURH 4WFFD 4JO2L 1EO7A 4IOIA 1KOAA 2IGFH 5FUOH 5J57B 1YMHB 1P2CB 2LABA 2VLKB 4ODXA 5I75C 4X7DC 2XZCL 4OD3H 2DDQH 4R2GB 3I9GL 3IAGC 2O5XL 3EYOA 3D3VB 4IRSC 1MAML 5KSAC 3QEQB 1G7MA 4OFYA 1JJUA 2IALB 2XZAL 4Z7WE 3ZYZA 4LCIL 4Y5XB 5HXMA 3FMGL 1VFAA 3G04B 3VFTA 5J06A 3KPMB 4URTB 2AGJL 3PV6B 5JHLL 4XWOD 2A9ML 2Q6WB 5IJKA 1NC2D 4KV5E 3MRCB 5EB9A 3LKPA 5F9JB 3J8F7 4GKNB 1WAAE 5I30H 4IMKC 5C3TA 4OQTA 4YE4L 2DM4A 3D85B 4NKMB 4EXPX 4J8RB 1AKJA 1MFBL 1YEGL 3ROLB 2DQEL 4GKZA 5C0AD 5IHZB 1S7TA 1OF2B 1J0HA 1JF5A 1UJTA 1TZGH 3S4SB 5IOPA 3KPRA 4ONHA 4NNYA 5KVEL 1KBGL 1E6OH 2DJSA 1MCNA 5BOZG 2IADA 3VGAB 4ODTL 5KW9L 2HTLD 5DJ0B 1CXKA 2YD7A 2AEPH 3MGTB 1MJJA 3IDUA 3UX9B 2RCSL 3SE8H 1AE6L 2XPGB 4D0BA 1X5XA 1PVHA 3O45B 3HMXH 3HTLX 4CJ1A 1NC4D 4MVBD 2D0FA 1M7XA 1J12A 1MCQA 1LO2L 3P9LA 4DOHB 1DE4A 4LFHD 1MI5D 4QT5B 3WUZA 5ITBL 4DVRH 3HB3D 1VGEH 2IMMA 4P5KA 2B39A 3BMVA 4JR9L 5HYSA 5EN2B 5DK0A 1F8TH 4RISL 1KCKA 1NFIB 4F7MB 1BLNB 2F8OA 5AYQA 1KG0A 3A67H 2BOBA 4NQED 3AREA 2CSPA 1KENH 3MOBH 1OGAA 5F7LB 4GUPA 1X5JA 4JVWA 4KK9C 1U8HB 4XMLH 2NXZD 2QR0A 1JVKA 5EOTA 1QRNA 1NPUA 3DX7B 1DQJB 4PJ8D 4EDXA 3UPRB 3SQBA 3UJJL 4G8FA 1MVFA 5SX5H 4NHUA 4Y88A 2ARJA 4KRMB 3LMJL 2GUOA 3QNYB 2BNRD 4YIQB 4QXTA 3IGAB 3CGTA 2YD8A 2DLTA 1H3WM 3HG1E 4NN6B 3U4EB 1TJHH 5E08L 4GRLB 1SHMA 3UMTA 5GISH 5T1KA 3VGEA 3NN8A 3O8XC 5CIPA 4KK8C 2FDBP 3ARBA 3D25B 5DRNA 5KN5A 4UV4L 4NDMB 4QHLB 4M7JL 4MNGE 2ZOKB 3G5YA 2V7NB 3TFKD 3FTGA 1XIWA 2OMBA 4WNQB 4XMKL 3ARFD 5C07B 1S9YA 3ZKXB 1DJSA 1LE5A 5GXBB 4HWBH 3MRPB 3MBEB 2IH3A 2NW3A 3H7BB 3BAEL 2YN3A 1QRKA 2DLEA 4PJIA 1QUNA 3W81A 1RZIA 2BSED 5LJYH 4HGWB 3TT1L 4R9HA 5SWZD 3T08A 1CTNA 2WANA 3CFIC 5I1AA 2A0LC 2XWTB 3JV0A 4JHAL 2H26A 3TV3H 1RJLB 3QT2A 1IC1A 3QG7L 2FYYB 1CN4A 4JFZH 4AEHL 3PHOA 4NFBA 4YHPB 4G8GB 5JW5B 5L8JB 3L1OH 3CFJB 1NMBH 2XZQL 3NZHL 3U79A 1QNZL 3BN3B 3VDCA 2YSSA 5DRXA 3M17A 2GJ6D 1XGPA 3KJ6L 3V95A 4C56A 1Q9OB 2VL5A 5I1GL 1WWAX 3QIWD 4JZJC 4LCCC 4MCYA 3BPOB 1HQ4A 4PJEE 5CZKA 4YQXL 4Y4FA 5KTEH 4LMQE 1Z0NA 5E56A 2R23B 4Y16B 2XXCB 4RMVA 4JG0H 1RZ7H 4G3YL 4I0CC 4GMTH 3JTSB 4R8WH 4OCSH 5EZOH 1FL5B 5JOFB 4RAVA 3BP6B 1OWRM 2CO6B 4H88H 4GBXD 2K9UA 4QRUA 3WS3B 5GS2D 3C87A 3FN0H 3EFDL 5MENA 1AD0B 3HE6B 2GTZA 3P4NB 3V6OA 1YECH 4K9EC 4Z7NF 1K6QH 4EN3A 2QBWA 1XGRB 3WDHA 1G1CA 4POYA 4EI5B 1KTDA 3HC0B 5F21B 3QZWB 4U6XA 3RJQB 3GMQB 4IJ3B 3SO3C 5KZCD 3TNMB 3V5KA 4XH2A 4WUKL 1EUUA 1YEEL 3RDTA 5E8NB 2VDOH 4PJDF 1T4KA 3VRJA 4I18A 5SV4A 1BFOA 2BVEA 4WW2F 2AQ3A 1KCVH 3NCJL 4HKXB 4HZLA 1FORL 3IYLW 1UA6L 3MV9D 2WINB 4AEEA 2NY0B 5FKPA 4L8SC 5DWUL 3QEUA 3Q6GH 3VFMB 3DTXB 1IGCH 4MB3A 4HSQA 4WHDA 4PJ7E 1UM4L 2FO1A 3PL6B 1A6ZB 5M94B 2A6IB 1DVFB 3KNBB 4NQSA 1U3HA 4NOFA 5BZWA 5GGRA 3H9YA 1P9MA 1EGJH 4JRXB 1EO5A 3KWWA 3G9VA 4KWUA 3QXAA 1F4XL 2FX8H 3OKYA 3LDBC 4P2RD 3B5TA 1J7VR 1QLRB 4KJWD 1MQKH 4MD5B 3UPAA 1ZMYA 2XV6B 1U92B 2VZSA 2GT9A 3AFLA 1LVEA 2ZPKL 3TZVA 3JV6A 1J1PH 4KJQC 3VFVA 4JGJA 2Y1VA 3LRGA 3S4SG 4LNRB 5JXED 2FBJH 5IVOA 4R7NB 2D2OA 4PG2C 1UM6H 3C8KA 3ET9F 4UBDC 1CS6A 5CGYD 2UZIL 2IPKB 5E94B 4NUGL 2DQTL 4L9DA 5D71H 1LNUB 4ZD3L 3O41A 1GPOH 4QO1A 3HI1B 1B4JL 1TZHA 1CLOH 3RVUD 1KEML 3S5LA 2VLJE 2FJHB 1QSFB 1FHGA 4OFYD 1T2JA 3ECBA 2ZWLT 4M7LT 4Y1AB 4PJXE 3WSQL 3UTOA 3ZSSA 3CFCL 4RFNB 4WV1C 4K94H 5DI8B 1C08A 4RWHA 5HGHA 4OI9A 2X4NA 1N6UA 1IE5A 1T5XB 5F1SA 4I2XA 1HCFX 2VWEC 3B3IA 4HIIB 3OL2A 5E00B 1HYSD 1AD9B 5JMOC 1RJYA 3D2UA 1JPFA 4JO1L 3QEHA 4NQCA 4KY1H 1ORQB 3PGDB 1Y18A 1AKJD 5HGAB 1JGVL 4UI2A 4PRPE 4ZTOH 4WI8A 4LK4A 3CH1A 4H1LA 1XMWA 2Z93A 3KPRD 3IRZA 1CFNB 5C86A 4NQDA 4ERSH 5C6TL 1EJ6A 2PCPA 2FHFA 3OHXA 1TPXC 3GMPA 3RVWD 1B90A 3DUSB 1BVKA 1A8JH 1P7KA 3IETA 4IRSA 5F7WC 3MUY1 5KSAA 1G84A 1H9VA 1KN2H 5JXAH 5LWYH 4HWNA 1BM3H 3S37H 2V2XA 3G6DL 4ALAH 4RRPA 4Z7WB 5ITFA 1UG9A 3TIEB 5C2UB 3DVGA 5CINL 4YBLB 2F74A 5JHDE 4EI6B 5D72H 4OCYL 4PYHA 3EJYC 3NIDF 4DTGL 1AIFB 3REVB 3S35L 1SYVB 1A7RH 1FQ9C 3KPLA 2XG4A 3PWPA 3N0PB 5IB5B 3GNML 1I4FB 4HK3J 1I1AC 2AKRB 3MLRH 4IMKA 4XBGB 3F7VB 5EUOB 1RUML 2L4OA 2BJML 1SJHA 2WBKA 4HKJB 4LLWA 2MQCA 1SY6H 3P4MA 1GAFH 4HBCL 4FTVA 2YR3A 4I3SH 3EHBD 5CWSA 2ADGA 1BZ7A 4Z7UA 4FG6D 4GAJL 1OTTD 4RFEA 3NACH 3BEVB 1KFAL 4QRPB 4NWTH 4OGXL 4BKLB 3ARED 3MRQA 2H2PD 1X7QA 1OGAD 3AS3A 3B83A 1ED3B 3TPUA 3RWGB 1VKXB 3C5SB 2E27H 3HNVH 4L8BB 5E2WH 2VRAA 1NFKA 5IWLC 4ENEC 1YYLL 4RGMB 1QRND 5F7FA 4E9LA 5K9JH 1AI1H 3KYMA 3OGCB 5T1MB 2QQNH 3CSGA 4HUVA 2P8LA 3TVMC 4I3GA 1ZKAA 2OCFD 5B38A 1IQWH 1MFDH 5GS0D 5MERA 1MIEH 3ARDB 1RZFL 1DLFL 4DKEH 5T3ZD 5T1KD 1N6VA 4BSVB 1MRDH 3GSVB 1Q0YH 1ZA6B 4ZNEE 3QUKB 3ARBD 3S37X 5JA8B 1ZEAH 2B1HL 2J8HA 4QRSB 3EAKA 3AM8C 3RL2A 4JDVB 1T20A 2UUDH 3T2NL 3ELAT 4HBQA 3VXOA 3QYCA 3ZDYF 2WW8A 1TJGH 3CDYA 2VUYA 3FHAA 4NHCL 2VOTA 5IIEA 1XIWD 1Q94A 4WFGE 3VFPA 3SGKC 5LGJB 1YC7A 5HI4D 2HJKA 2DKMA 1FNEB 2IQ9L 2X89A 2F58L 1I7RA 3RFZC 3T8XB 1WCBB 2GIYA 4M1GH 5DUML 5IW1B 4UIMB 3L6FB 3QNZA 3VFGL 1R0AL 2VZVA 1FVEA 3CCHB 3QDJE 1F90H 3U9UB 4GAFB 4NBYB 1YY9C 3HPLB 2IPTL 4NKIH 1AQDB 1ETZB 1H8SA 2MCPH 4EQ2A 3EW3B 1G9NL 1AHWC 1EHAA 3IVKB 1DBJL 4M5ZH 5D1QC 4UTBH 3T0EC 4C56D 2HFEB 3HG1B 3O8XA 3PUCA 3W2DL 2BFVH 4OTXL 2AJ3B 1H3XA 2P47B 4LARL 5LG1A 4QHNA 5F1KC 3DHJA 4LP5A 3OX8A 5T33H 5INDB 4OF8A 2IANA 4Y4FD 2JELL 1QSEE 1OLZA 1TZIB 2AJXL 1W0WB 1F02I 5C0NC 3LN4B 3OR6A 4MNGB 1MFAL 3N1FC 4XC3H 5DJ2B 4LHUG 1I8KB 5IMKB 2CKBA 1OCWH 1BQLH 1TDQA 25C8H 4L9LC 2FR4A 3CVIL 3EFFB 1LO5B 5TFSL 3LIZH 5GGTL 3UTSE 4QRQB 5MEND 3BP5B 1AC0A 1R3JB 1I9RL 3N85L 3RP1A 3WUWB 3BDXA 3D0LA 3DX8B 4JFYA 3B2UC 4NJ9H 3DROB 4ZUWA 1I8IB 4CVWA 3NCEB 2EDEA 4JQIH 1KXQE 2FCBA 5IVXA 2NLJA 4HFWA 5D6DC 3WFCL 4XHJD 2YK1H 4UQ3A 1RIHH 4LLYB 1BD2A 2WUCL 4HIJA 4JZJA 4LCCA 4FXKB 1T0PB 3P2TA 5IBTL 1TJIL 5TE4L 3UO1H 5F9OH 5FUCE 4F15B 3K2UH 4L4TA 1MFEL 4PJEB 3WJJC 5A2FA 4C4KO 1RZGA 4HF5H 5EOQL 3MRHA 1T0MA 1U3HD 4XNXL 3N1QC 5DHVH 4RBPH 5ICZB 1HDMB 1ZA3A 4QYOB 5SWQB 4Z78A 3C2AH 1JGEA 4YUEH 4MB5A 3GUTB 2NZ9D 3BKYL 3OTTA 2LU4A 1MCOH 2NY4B 3TZVD 1JGUL 5I6XB 3U2SA 2DTML 4RWYH 3WLWC 2DI8A 3D5OF 3QISA 4OFIA 4CVXB 3TN0B 1F4WL 4KRPD 4N8VA 2H32H 3GJEA 5DHXB 2QADC 3LKSB 3W5MA 1RUAH 1FNGA 1XR8A 1MRCL 5FA4B 2DLFH 4Q9RL 1LK3H 2IPUG 4HX1B 2ZUTA 4K3HA 3MCKB 1YEJL 3I85A 4Q6IB 3D18B 1U41A 4PP2A 5I71C 4OI8A 2G5BA 3CLFH 3IFNH 4XP4H 4OZFH 5JIIA 3QXUA 1KNOB 2OTUA 1TTFA 4U05A 4PJ7B 1MWAH 4NSKB 1FGVL 4YJZL 3BXNB 2DBJA 1XH3B 4LSUL 2MJWA 1ZAGA 3ABZA 4AMKL 4YX2L 4YNYB 4BZYA 4PRDB 1F58H 3C60C 1H3PH 3DX9A 3VH8A 5DHVB 4X7TB 2VAAA 5BQ7A 3GRWL 3D2UD 4NQCD 3V2AR 4OQ1A 3VI3E 3IU3B 3X11A 4PG2A 4PPTA 4W6YB 1G9NC 2K7QA 1LMKA 2WBJC 5F97E 3EYUL 1P4BH 1F11B 4NQDD 4OSUL 5CEZL 1UXSB 4H0HB 4WVRA 3LHPL 4KDVA 5T5NG 2E9BA 3MRFB 1FE8H 4FQ1H 1XZ0A 2VDKL 4P49A 3C6LC 3VRLE 2H32B 3GDBA 3CSYA 4OF7A 4IRSD 4JM4H 4U2YA 5KSAD 1IBGL 4JHWL 4Z7WF 1IEAA 2VLJB 2AJUL 3HA0A 1DP0A 1GC1L 1NGYB 4WV1A 4CVUA 3QQ3A 2XT1B 4QKXB 4PJXB 1DUYB 1K2DB 4X6CE 4OZFB 3QXDB 5DFTA 5DFWH 5EUOF 1MWAB 3LEVL 4J2XA 3OF6A 3PWPD 1G9MH 1EEYB 4M03A 5I16B 1WAAF 1IVLA 3QWRA 3VE0A 3PWUA 4KU1A 1XF2B 4Z7VE 3I02A 4E42B 4FTVD 4MAUH 1BWWA 4PY8J 3VXSA 1NCWL 3CC5B 3WLBA 4O2EB 5IQ9A 5BVPH 4ZUTB 1OSPL 2HRPH 1D6VL 1PFCA 1BFVH 2OQJA 5J6HB 1ZVHA 4PRPB 4HGKC 3B2VH 3KLAA 3QO1B 2YZ8A 5DRZA 3FRPA 5T5NF 2W59A 4KROB 2ZSWA 4KK6C 5IF0A 1ZK9A 3AB0B 2VKWA 4E5XA 2V2WA 4LSSH 3A6OA 1QBMH 1HH9A 2EH7L 4J3UA 4AIZA 4YHOH 5DJ6A 1T6WA 2PW1A 3E3QE 3WS6C 5DURB 4TRPL 4FFYL 4JJ5B 5F7KC 3BE1L 4MZ2A 3FT4A 1XF4B 2HLFC 4XRCA 4AJ0A 1VSCA 2VITA 2FD6H 4L8CB 5JHDB 1KCSH 4BH8B 1I1AA 1HQRA 3C9NB 3AGVA 3DVIA 4PB9L 4G43B 5EZLA 5AZEL 4F7PB 5I17A 1I1FB 1M7IB 3T1WA 5DK2A 3TO4B 4LRIC 3LD8B 1E27B 4ZSOE 5BS0E 2O61B 1OP5H 3BDYH 2QTEA 5I1LB 5FDWA 1T22B 5I8OH 4KRNA 1HH6A 2EYRA 2X89D 3I2CH 4QY8A 1UXWA 4F9LC 4JFDE 3V4UH 3WUWG 2VUOA 4KK9D 1FLRL 2R0LL 2OL3H 5EO0B 5IWLA 1RUPL 2Y6SC 4X6BB 3DHMA 1E28A 3MROA 3KPSE 5GRUH 2NMSA 4JQXC 4K7PY 2E8ZA 4CDHA 2DJ4A 4PGJA 4L3CB 3OPZH 4OZ4B 4NN7B 4Q0XH 1MLBB 1U8JB 2V5MA 5FYLE 1VFBB 3TVMA 4U1IB 1BQUA 1Z3GL 2F15A 1CXFA 4EDWH 5ESQB 1MCEA 4XCYA 1BOGB 4MJ6B 3O2VH 3O8XD 1OVZA 1G7QB 1DBML 5EFIA 4KK8D 1UCTA 3EYFB 1W0YT 5A16B 4FABH 3GM8A 1P69B 3AM8A 5E6IC 2DQGH 4L5FH 1CDBA 5HHXL 4YPGA 2IAND 1BX2B 4WIQA 3OKOB 3U0WL 4LRNH 2V7HA 3SGKA 3VXQA 1S9XB 3KG5A 4E41A 3SGEI 1FYTE 1PKQA 3IS0X 3HI6L 3OB0K 5J1SC 5C0GB 4IS6A 4JM2B 4U1KB 3O9WC 4Y5YB 4TN9A 3T4AA 2X1WL 3BRFA 1SBBA 4I48B 1WICA 1ZT1A 2W0PA 5D8JH 2NX5A 1UWEH 1A6AB 3WIIH 2A0LD 1S7VA 1MCSA 1TMCB 3GBMH 4IMLB 4JDTH 3RBSA 3MV7E 3QDJB 2HJFA 2OL3B 2Z4QB 4GKSB 3JWDH 2GW5A 3ETBF 4O9HL 3LS5L 4X4ME 2JE8A 4WWID 3TH3T 1QD0A 3ESVF 1DQLL 5GGVY 1AHWA 2OYPA 4GMSH 4MGXA 2APWA 2FX7H 5FK9A 3S8WA 1HOCA 5D1QA 3CVHA 5FYKL 4YDKH 3U7YH 1BD2D 3T0EA 2IWGA 2MKLC 2QJDA 4LIQL 3RVVC 4PBXA 4LF3B 3CDGA 1OAYH 5ALBH 2VE6B 4M7KL 4OUUA 3S34L 1NGPL 4PJEF 2DBLH 2GK2A 4HWZB 1H8OA 4PV8B 1D9KB 3SE9L 4XB8A 3PHQB 4L4TD 3MMEB 1ZHKB 5BZDA 1Z9MA 5HYJE 4EQ3A 4U0RC 5CCKH 4YDIL 4H26B 1QSEB 3V6BR 4X0KB 1OD9A 3W39B 2GITB 4L9LA 5HPOA 3BKML 3S36L 2KDGA 3BWAA 2C1OB 3P9MA 5GJTL 4BQCA 3MJ9A 3H9ZA 4HG4J 4HAFA 4ZFFA 4D8PB 2P7TB 5I0DA 2ICWJ 2GSGB 4M7LL 3UTSB 3HNTL 4LEOB 1QPXA 1MAJA 1XGTB 4EEEA 4P3DB 4G9DB 5D6DA 4LPTA 2ICCA 1J11A 1GGCH 1JWMA 2DQUH 5E8EA 1RUKH 2X4PB 3UEZA 4N68A 1U8NA 1DQQB 1SJVA 2ITDB 2Q3AA 3MRGB 3H7LA 5C8JA 5FGRA 4XCNA 3MLZL 1J87A 4F3FA 1FIGH 4PJ7F 4CU7A 1A0QH 3WJJA 1IT9L 1PG7L 3T2PA 3IDMB 5E4EB 3EO9H 2B2XL 4OZFG 2VQTA 3DOSA 2PN5A 1KTKE 2FECI 2ZG3A 3WHXB 2D7QA 1A1MA 4WHTA 1CF8H 3CFEA 3BGFB 4YHKL 3TYFA 1ULVA 3EYSH 4HJGB 1X5FA 1XR9A 3NCBB 3EOYG 2VXSL 5IW6B 4KJQD 5JLZA 3E8UH 2JIXB 4DFIA 1NCBL 2NTFB 1EFQA 5LQBL 1RZKC 4PJ9B 4UBDD 5EWIL 3CPLB 1SQ2N 4UTAL 2VXTH 5BMFH 3BT2L 4YDVA 4HS3A 5C0BE 4PRIE 4V1DA 3CX5K 1GVIA 2HVJB 2XQBL 3QIBB 5DR5H 4QHUA 1QYGH 3H9HB 3TBTB 4P4KB 1KPVA 4P5MB 1L9MA 2X9YA 1F2XK 4Z5RB 2DM2A 3P30H 3MNZB 1MF2H 4JANA 4O02H 4N1CA 5KANG 2YBRB 1M05A 4PJXF 4Y4KC 5FA3A 1A1OA 1NCNA 4FQQB 1DCLA 2W0KA 4KPHH 3RL1B 1ACYH 5DEFB 1LEKA 5C0CD 4XNMB 1FZOB 3TM6A 3C60A 4XCEB 3OF6D 2ORBH 4MXWL 4JPWH 3VFUB 3QWRD 3MRRB 2XKSA 5EOCH 3BZEA 4Y0GA 3D9AL 4M61B 2DQDL 4S2SB 3VXSD 2XTLA 3FOLA 1XGYH 1QSZA 3O6LH 3H42H 5JUEL 2WBJA 2MTPA 3ZT7A 5EO9A 5ICYB 1CK0H 5DD6A 4NQTA 3ZT5A 3C6LA 2QQLL 2E6JA 1NGQL 2E6QA 1FL6A 1KJ3L 4MSWA 2EYSB 3GSWA 7FABL 2B8OT 3D0VB 3IFOB 2G2RB 1RFDL 4ODUA 3PGFH 4O2FA 2B0SL 3C09B 5KJRL 3BKCH 3EJYD 4DW2L 4DCQA 4H8WL 3MXVH 2FL5A 1I1AD 4TPRH 2J4WH 2DWEB 2QHRL 5D7KE 4G8EB 5C09B 4HS6A 1T1ZB 2CD0A 5CKAA 4Z7VB 3D69B 1EIBA 3LEXA 3L3DB 1QFOA 3WIFB 1MEXL 2DQJH 4HDIB 4FMFA 2C26A 5EORL 1RJCA 3BSZL 5CJOH 3L5WA 1IC7L 2AXJA 2ZCKH 4MMXC 1N8ZB 3SDAC 2OXHA 1WBYA 1IAKA 2V9RA 1DEEB 1JTPA 4ENED 2DKSA 4OZIA 1T1WB 3MRKB 1YDPB 2B4CH 4BQ6A 5FYLH 1UB6A 3WS6A 4HD9A 3HKFA 4F80A 2CJUL 4UB0L 5GQBA 4MD0A 4XPAH 4DJMA 3TVMD 4XCCH 4RA0C 1LEIA 3AC0A 4B53A 3ZTNH 5IGXL 4OLUH 1FFPA 4FZ8H 5J6GA 1QFWH 3EO1B 4U1LB 4OGAC 2X4OB 3MXWL 5GHWL 4G80B 3MOAL 4LRIA 4KI5F 4JREC 3DRQB 3PWLA 1MHPL 2X1OA 3O3DA 4HXAL 2HYMA 5HY9A 4F57H 3OKNB 3P0VH 3CD4A 4JM2F 3HZMA 5BS0B 1TENA 4E41D 5IQ7H 5GRJH 3HUJA 5AWNH 3V4PH 1BJ1J 4KHTH 4QOKE 4F9LA 1QEWB 3SHSA 4OGYH 3KHQA 3KDMA 4P2OC 1AY1L 3EDEA 4JFDB 2IBZX 3GMNB 5I8CA 1X4ZA 2NX5D 3GSXB 3DVFA 4JQXA 2VQUA 1YY9D 5ESVB 3VU2A 4JFXB 3SKMB 1I3RB 2PW2B 1LO3H 5DEGB 1CE1H 1XF1A 3KPSB 4S0TD 1ZLVK 1NJ9B 2AXGB 4K71B 2P5EB 3DUHA 3HS0B 3SKJH 4JB9H 4YXLH 5ADPH 2OZ4A 1EMTH 2E3VA 4JHBA 3H6JA 4CW1B 5D1QD 3QO0B 3T0ED 3UTTA 2W91A 4B7LA 4LAQL 1LD9B 2F53E 2MPAH 3EGSA 3IDNA 3IJSB 4R26L 1Q0XH 5E6IA 5ANME 3VI4E 1MVUA 2V17L 5DUBB 1JTOA 1JNHA 1H3GA 1XF3B 3IF1B 5C0ND 4N9GA 4LVNC 3SEPA 5BV7L 5K9OB 3EOAA 4JKLA 1WLHA 1ZWIB 4L29B 4TYUA 1W72L 1O7VA 3GZKA 5DO2C 3WXVL 5DLML 1N5AB 3O9WA 4CAGA 4DVBB 2DQCL 1T5WB 5TE7H 1JF1A 1FYTB 3S9DB 2CUMA 4M93C 4YFEA 5HDQH 3DMMB 2C7UA 3BD3A 4IBLT 4P5TC 3KGRA 3VD7A 1PYWB 5ALCL 2J8UE 3B2UD 3C6SA 5LBSL 3IFLH 3IDGB 3MV01 4UV7H 4M4PA 2X41A 4WFED 2VXVL 3C08H 4HUKB 3MO1B 3GSNL 4DAGH 1ZS8A 1KN4L 1U8QA 4X83A 1I7UB 5L2JA 4GT7A 4X99B 4HUUA 3DV6B 4KAQH 5CSGA 2XRAH 4Y2OA 3U4BL 4OKVB 3UBXA 4K07A 8FABB 2I60H 5FYJD 2WBWB 1HXMB 3KYKH 1LO4H 1ZHLA 3QQ9C 4W68A 5IFAH 1HE7A 3TBYB 1JV5B 2FB4L 1QR1A 3PDGA 3RWEB 3VDBA 5FO9B 1G7HB 2NCMA 1B3JA 2C1PB 4KQ3L 5DDHA 1JN6A 2EDQA 1J10A 2BVPA 2VDNH 2IQAB 1MHHA 5TPWH 5EU5A 1JYNA 1T89C 3BW9B 4XNZB 3OAZK 1MI5E 4N0FA 3U30B 1A7OL 4MS8C 3WFHB 3RY5A 2A1WH 3WLWD 3FONB 1JHTB 2Z31B 4PV9B 3LN5B 5IG7A 5IMOA 3FB7B 4XPFH 2ED7A 3NCMA 4LBEA 3KXFE 3RWDB 4C55A 2QADD 4R4BB 4V1DD 2O5XH 1NSNH 1DLHB 3L5JA 1JWSA 1S7SA 4U49A 1M7DB 1H0DB 2CQVA 3FMGH 2D9CA 3RUGA 4NQEE 5JIPA 5FECA 4GAYB 2XACC 1S7XA 2HWZH 4NCC1 4KHXH 2DWDB 2C5DC 1E4KC 2Y06L 1HN1A 2NY1C 4XP1L 1YEDA 5EZIH 1IGFH 4QHMB 1N59A 4TUOB 3STBA 4YHYB 1FAIH 1CL7H 2ENYA 3S96B 3STLB 3DVNB 4WWKB 4YE4H 3SDXE 4WU5B 3C60D 3P73B 4G9FE 1EX0A 4U6TA 1OB1B 3LQAL 3C2SA 5GGSB 4NZTL 3L95A 4IIQB 4S1QH 3RNQA 5GS3A 2J6EL 3L7EA 4XVSL 3ARGB 1OAQH 2FO4B 1T83C 1L0QA 4CL7A 3JBG7 3VI3F 2HFFB 5KSVA 1EJOL 1QZ1A 1QVOA 5JMRA 3LKOB 2WBJD 3IJHA 3WDJA 1OY3B 1YPZE 3C5JA 5FO8B 1A7QH 4R96B 2DYPB 3CH8A 3RKPA 4JPIB 3ZYOA 3TJHC 1KXTB 1ONQB 2RCSH 5C0BB 4PRIB 3U46A 2ATPA 3C6LD 5KVGL 3KR3H 1AE6H 3C5ZB 3VRLF 3GK8L 2CK0L 1L0XA 2C4FT 1P4LA 4GG8A 2AEQL 1HINH 3EYVA 4Y4KA 3P40A 1MUJA 1PJ9A 3RVXC 3D39A 2IBBA 2DRUA 4YK4B 1CD9B 2IAMC 4GKOA 3E6FB 2EIZB 3BVNA 2NY3C 4TOYL 1N7ML 4HUXB 3TH4T 3QUMH 4WDIB 2YA1A 2CLRA 2R0ZH 4JR9H 2WWKO 2CRYA 2EIEA 2X4RA 4MCZB 3PWJB 4PY7B 5F3BB 4Z7VF 1U9KA 4JFHE 5GSVB 3BPLC 2IGFL 5FUOL 7CGTA 5ID0A 4LSQL 1ZSDA 3X13B 3P77A 5JPNA 2HLAB 3FB6B 2DDQL 4JDZB 4U1HA 1VGKB 2BMKA 2UWEE 2YPVH 2OP4H 1N2RA 3GGWB 5EULV 3GSUB 1FG2A 4N1EA 5JR1L 4KK6D 1NEUA 2OM5A 4LSTH 2FJGB 5HVHC 2J5LB 1MPAL 2NY6B 2YRLA 5DQDH 2I9TB 4OLXL 4NN5B 5I2IB 4ORZC 1KEGH 4DN3L 4JGUA 4I3RH 3IKKA 2HLFD 2VZTA 5I76A 3CFBB 1OW0C 4HIHB 1TETH 3I75B 1S78C 4QXWA 2BVQB 4BFIB 12E8H 3IDIB 5F1NA 2A83B 4NO5A 4IRZL 1TZGL 3QUMB 4XGZA 2WQRA 3QULB 5D7JB 2NY2B 4NOBA 1E6OL 3BAEH 2BVUA 2JCCE 4LHJB 3RNKB 2ZCLH 1I1CA 4NQXB 2AEPL 3PGCA 1A9EA 1JGLH 1YNLH 3SDAA 2OR7A 4YDLC 4UINH 3SE8L 4U33A 1FN4A 4KH2A 1DDHA 2Q76B 2Y6SD 4FOMA 1AGBB 3HMXL 4NKOA 1GGIH 2R2CA 2XOTA 4P2RE 4LLVA 2ICWA 4D0DA 5DGQA 1JRHI 4YHML 1IAOB 4CADA 1QNZH 4IDLA 3RWCB 1U8PA 3JTTA 3VXPB 4DVRL 1YN6B 4NNXA 1QLFB 4OZHA 5I1GH 2AV1B 1VGEL 3O3EA 4P57B 1FVDB 4OCXH 2W65A 3Q3GA 3UTTD 5IFHH 4YQXH 2BHYA 5C3LD 4A2MA 3W9EB 2WWMC 4RIRB 1NGZA 4HS8H 5E6ID 2Q20A 1SJXA 3A67L 2X7LB 1U2HA 4R2GC 5F7HA 3A0OA 3IKCB 2E5EA 4BUGA 1KENL 3MOBL 3HE7B 3UTQA 4X8JB 2C4FU 2VO5A 2HG5B 4XMLL 4Y5XC 1G7IB 3O9WD 3V0WH 1F4AA 4RMWA 4FXGA 3BP7A 4CVZA 4PJFA 3LQZA 5IEKB 4P2OA 1GOHA 2GEEA 1HHHA 4DGIH 1KYOK 3B5HA 5M7QA 5HBBA 3OJMB 4P3WA 5E70A 3U0TB 2X4QA 1S7RA 4X6DA 3EOBB 1HEZA 4L3EA 1Y6MR 2P4AB 5GISL 1FORH 1WIUA 1UA6H 4O51B 1VERA 5I66A 1UM5L 3O11A 1Z6JT 3NPSB 4DEPB 2R1WA 3GIVA 4PGDA 3RVVD 3QG6A 1YMMA 3DV4B 1F3JB 1I85C 1IAII 4LDLB 3RKDC 3PABB 3VGAC 1PZ5B 5EIIB 4HWBL 3X14B 1HSBA 5ANMB 2G9HA 1YN7B 3MYZA 4JY4B 1B0GA 4CMMB 4M6OH 4ZPVA 5C0GA 1C5CH 1KV3A 4WGVB 4MQ7A 2X6MA 2ZPKH 1JUFA 1U95B 5HGBB 5H35B 1KPRB 2I07A 1ND0B 2A38A 4LLMB 3VCLB 4DUVA 1I8MA 3L1OL 1NMBL 2J8UB 1NGXA 2EC8A 1E4XL 3QXWA 2A73B 1RD6A 2FWOB 1CDYA 1V5JA 1EHLL 2JTDA 1WGOA 2WM0A 1I1YA 3WFZA 1KEMH 3FB5B 3KYNB 5KTEL 1BF8A 1J0IA 3MUZ1 5BVJB 5IB1A 1M71B 4JG0L 1RZ7L 1MJUH 2EDNA 3WSQH 4OCSL 4I9WE 2P1YA 5EZOL 4AIOA 3UTPE 4RAUB 2BOCA 1RQ5A 2HKFL 4H88L 3FN0L 4IHOB 4CJ0A 5B22A 3CLEH 5DD1L 1YECL 1K6QL 1JZ4A 2BY2A 1BOYA 1G1YA 4X4XA 3IT8D 2BSRA 1A9BA 1F97A 3FQWA 3WHE0 4NN6C 4N0UB 1N3NB 4XPTH 4GW1A 2VDOL 2P5WE 1T89A 3FB8B 1IGJA 5F7EL 4TQEL 4YHLH 3OB0H 2P8PB 2WLZA 3OKLB 1MI5B 3TNNB 1TTUA 4U1JA 3VFRA 1Y0LA 2X44D 3QAZB 4ISVB 3Q6GL 1IGCL 1K5NB 3JV4B 3ZKXC 1EFXA 2I9LA 3P9WB 1GRWA 3MBEC 1GYAA 5E8DH 4HH9A 2ADJB 4PJIE 1EGJL 4NQEB 4C83B 5E8PB 2V5RA 4Y4KD 2FX8L 1E4KA 3D39D 3N1MC 2W9DH 2CPCA 1MQKL 5ACZA 3SPVB 2K3TA 3LPWA 4ZPTB 5E99H 1R5IB 1RUMH 4X5WB 4RZCB 3VFNA 5J13B 5I1DA 2AERT 1ZLSH 5MP6H 1J1PL 1IEBA 2VISA 3BUTA 3C8HA 4ZFOB 2YXMA 3SDXB 2FBJL 1RZJH 4G9FB 2VJXA 5L9DH 1UM6L 4XCFH 1V3LA 1UH2A 4PR5A 4ODHH 3WFBH 4QXGL 3MCG1 4JPKH 5JNYA 1T83A 3VFOB 4K8RL 3BPOC 1G7LA 3MREB 1IRAY 5HI3C 5D71L 4GS7B 5JZ7C 1GPOL 2EEBA 2EYTA 2XI9A 2VSDA 2R69H 3HRZA 5I18L 5D9SB 1CLOL 2MWCA 1YYLH 1YPZB 3PV7A 1S5IH 1U3ZA 4PBVC 1JRHH 3IFPB 1NCAH 3I3EA 1D5BA 5DC0A 5HJ3B 4K94L 3HE6C 3DURB 3PDOA 2C3VB 3O3BA 2RBLA 3V6OE 2ICES 5MENE 4G42B 1RZ8A 1KJMB 1KSRA 4JFPA 4Z9KB 2IAMA 2Q86B 2APVA 3PWNB 2EE2A 1UJ3C 2VN7A 1EA9C 1RHFA 4KY1L 2Q8BH 3T2NH 2P46B 2E9IA 2VLLA 3IJYB 4ODVH 1A1NB 1KT2A 2NY7H 2XKNB 3D6GA 3S3JA 1QP1A 3BOVA 2NY0C 3SY0B 3DGGB 2GTWA 1V8HA 4X98B 4ZQKB 4ERSL 1FJ1B 5FKAB 3QXTA 4FQJH 1DR9A 1NUGA 2AI0H 3PL6C 4R6UA 1VCAA 1DVFC 4NT6B 1FZMA 2VDQL 3ZMRA 3SDAD 4JAMA 1MCKA 4EBQH 3MRMA 3O2DA 1A6WH 1KN2L 5JXAL 1TQBB 3QJFA 4L4VD 1BM3L 3S37L 4ALAL 3KYOB 2QSVA 4J3VA 4KTDH 1P4IH 2Y07H 2A6DA 4GBXB 5D72L 4QRTA 3HZYB 4XP5L 1RMFH 3QFDA 4BSWB 1A7RL 1DTUA 5AUMA 1NBQA 4NRXA 2OK0H 3MLRL 1OW0A 4IRJB 3L3IA 3QQ4A 3JWOH 4EIGB 5D6CA 2WIIB 5KZCB 1GAFL 2MKWA 3QB7C 4R0LC 3HNSH 4PJDA 2GSIA 4I3SL 4OGAD 3ZKQD 2EDWA 1CFSB 2AJXH 1ADQL 3T2QA 2Q87A 4C4KT 3NACL 1X3DA 4NWTL 3NBNA 5HGGS 4NRYA 1TVHB 3G6AB 5SX4I 2E27L 1PEWA 3HNVL 4OLYL 4EVNA 1IILE 4EKXA 3OKEB 2RFXB 5IB3B 2DQFB 3AAZB 1KLGA 3HZVB 3KAAA 1OTSC 4OFPA 4QTHB 3B9VA 4RFNC 3P0YL 1X6LA 5INCA 4P2OD 3VJ6B 1UCBH 3ES6B 3HZKA 1SYSA 1OAUH 2QQNL 4OM0H 5EIVA 2W0FA 4JZOB 3MLXL 4F33A 4OQTH 1MFDL 1UQSB 4OD2A 2PYEA 5DQJB 4L3ED 5F3HB 4DKEL 4P2RB 5IFJB 4NQCE 1MRDL 5ISZE 3VG9B 3M1BB 1Q0YL 5FYKE 1T1XB 3OKDA 4PGCA 3RBGA 3U1SL 2GY5A 5EU6E 1IQDB 1RI8A 3L3GB 1TJGL 5TE4H 1YMMD 1YMHA 3NA4A 2VLKA 4NQDE 4HIEB 3ILQC 4YDJB 1MELA 4WI3A 5EPMB 4KDTC 1D5IL 2J6EA 5A43C 3F7YB 4ODXB 3D3VA 1UH3A 1OT1A 3D1MC 4M1GL 4PGBA 2NQCA 1U91B 2IALA 4PP1C 2HRLA 4Y5XA 1SVZA 3WHE1 1LK2A 5DO2D 3UYRL 3G04A 1F90L 4JY6B 3QBTB 1YYMH 1G6VK 1G7MB 2UVEA 4NKIL 3VFWA 4I13B 2Q6WA 1VFAB 4P5TD 3VFTB 3MRCA 2MCPL 2J8UF 3VXMD 1CD8A 3R8BB 4BK4A 4GKNA 4K94C 2DB8A 1KIPA 1INQA 3TA3C 4M5ZL 1YEHH 1HHGB 3OZ9H 4UTBL 4X7FC 1MRCH 2BFVL 5D1XB 1OF2A 1YEJH 1WEJH 1A7NH 5T33L 2ZCHH 1FVCA 1AKJB 3RZCB 4X9IA 1I85A 1W0VA 4HMDA 2EDOA 1ZXQA 3CMOL 1ZE3C 4HMEA 1EAJA 3MNWB 4ONHB 1BQLL 5DJ0A 4NNYB 4J1UB 4LSUH 2Q7YB 3MGTA 25C8L 4ACPA 2IADB 1WT5A 3QI9C 3QQ9D 3Q5TA 1RJZB 4PIRF 5T3XE 4WUUD 2DQIL 3O45A 3SN6N 2EDJA 4NGHL 3GRWH 1MJJB 4NJ9L 1I9EA 5DD5L 3HC4H 4D0BB 1KLUB 2FIKB 4YH6A 3O4OB 2JB5H 3ARDC 4QT5A 1UB5A 1EZVY 1XAUA 5CIPH 1A5FH 1OSZB 3N50A 2YK1L 5I0ZA 4MS8D 2AVGA 1DE4B 5FXCH 5E7BA 3OAUH 5IMMB 3EYUH 3DO7A 1U42A 1ZVYA 2VB5A 1OAZH 4RFOH 3QIUB 5CJQH 2YUZA 5EN2A 2GAZB 4XX1E 4BSJA 4P5KB 5E1AB 4PUBH 4MXVE 1EFXD 5JIKA 3UO1L 3Q5OA 5F9OL 3K2UL 1MCWW 4OJFL 1ZLVH 4ZOCA 5KVFH 4HF5L 3RY6C 1KG0B 3O6FC 4DUXA 2BOBB 3AREB 1OGAB 1SEBA 4CNIB 4GUPB 3C2AL 3UPRA 4YUEL 2PO6C 2NY1D 5ENWA 2PTTB 2QR0B 5IK3B 5CEXA 3Q2CA 2Z35B 5DXWA 4G6MH 5C92A 1MCOL 3QNYA 1UKQA 4YIQA 5JOPD 3U36B 1XGQB 3IGAA 3LVEA 4EDXB 4UUJB 3SDXF 3T65A 4RWYL 4NHUB 5SX5K 1OAKH 4AH2A 2GUOB 2FEEL 1YJDH 3H2WA 3HMXA 3H3PL 1OSPH 1D6VH 4PLNC 3RA7H 3D25A 4RMTA 4MJIE 5CGMA 5CP7A 3BWUC 1RUAL 4QHLA 5CIPB 3ULVL 2DLFL 2V7NA 1LK3L 3R1GH 3SBWC 4HK3N 2XNAA 5KN5B 1YPZF 4WNQA 5C07A 5L2KE 4YHZH 1NL0H 4EUPH 3MRPA 1NAKH 3FTGB 3MBEA 3CLFL 3IFNL 3TJHD 1PW3A 3M45A 3WE6A 1U8MB 5CMAB 3U6RB 4LCWA 5C9KA 4TRPH 4FFYH 1S9YB 2R2EB 3DXAE 2I27N 1MWAL 3ZDXE 2LE9A 3ZZ1A 3PP3H 4PJIB 3RVXD 2XWTA 1F58L 1J5OH 1RJLA 2AEIT 1H3PL 1Q9KB 2IAMD 5L0QB 2FYYA 5LXGH 2NY3D 3K8LA 3ZE2E 5I1AB 1WZMA 4DKFL 3W11C 2WAHA 2OTWB 3CFJA 1X5LA 3DWTA 3IDYB 3GMLA 5FCSH 4HUWA 1NAMH 1Q9OA 1EDQA 1MCCA 1R24A 4HCRL 1J0YA 1P4BL 1XCQB 1XGPB 1A64A 5FFLA 1FE8L 1FLRH 2R0LH 3MYJB 2P45B 2XTJE 2Z91A 4QXUL 4JM4L 3JTSA 3EBAA 3K2MC 5JOFA 4Y19D 4Z95H 3WS3A 2BVTA 5FCUL 4GLRI 3RX7A 3B8SA 3HE6A 3P4NA 4MAYB 1Q72H 4FQHB 2OBGA 3TJEH 4EUPB 1XGRA 4QRUB 2NY4C 3HC0A 3QZWA 2B1AL 5GGRY 3GMQA 3I3BA 5I6XC 2F54E 3TNMA 5MENB 4ETQA 4EN3B 1DBMH 1U8OA 1UJ3A 1CGWA 3O6MH 3QSKB 4PJBA 5C70A 2NW2B 1S78D 4PRNB 2A6KB 2QQKH 3TN0C 4MAUL 3RDTB 3T09A 5DJ8B 1CICB 5BVPL 1KB5A 3TPKA 3UPCA 3VRJB 4I18B 3WKNA 2DQHH 2HRPL 3VXTB 1BFVL 3GMOB 1CLYL 1SM3L 3B2VL 1TTGA 3DTXA 4MA8H 4HZLB 3MJ8B 4Q6IC 1QO3B 1NAMB 5LGHH 4LSSL 1PDKA 2X70A 3PL6A 1QBML 3QEUB 1A6ZA 3L3HB 4JE4B 1DVFA 3WL9B 3PDDA 5EU7C 4JRXA 2D7TL 2PKDA 3CDFA 3BH9B 1DL7H 1U3HB 4M4RA 1QLRA 4MD5A 3CIQA 3TIDB 2FD6L 2PYED 4XNUH 1T3FB 5J3HC 5FYKH 4ZUSB 4QGTA 1NBYB 2JJWA 4GG6A 1KCSL 1XF5B 4LVHB 4LNRA 2HFGL 3FT2A 2YEZB 2A9NH 4H1LH 4J12A 3V7MA 5F1IA 3GSRA 4R0LA 1TCRA 3MCLH 3VFVB 1KIQB 5E94A 3U0PB 2ZUQB 1FL3A 3BDYL 3WXWH 2VLKD 2WWMD 4U6HA 1V3JA 5DVKA 5C2BL 5I8OL 1LNUA 1YEFH 2VZUA 3OJVC 3OWEA 4R2GD 4OCNC 3HI1A 3I2CL 3RX8A 1FBIH 4MA3A 1P53A 1QOKA 2FJHA 1QSFA 3D3VD 2IPUK 3V4UL 1DQMH 2OTPA 3O41B 4XNQA 2OL3L 5HHMD 3S5LB 2JJVA 1QFHA 3SCMB 5DI8A 2A6JA 2Z0BA 2VABA 3ECBB 3OPZL 4Q0XL 4M62H 3P4OB 4JFQA 4NPYB 1MNUH 3LKQB 4NO3B 1C08B 1AXTH 5HGHB 4EDWL 3OXRB 1EGJA 4M7ZC 1JI1A 1ORQA 3H0TA 3O2VL 3PGDA 5HGAA 4M6MH 4FQ2H 4WI4A 4BUHA 4BH7B 5F7NC 3VXSE 4FABL 3QEHB 4NQCB 4ZAKC 5ISZB 3B43A 2DQGL 4L5FL 2GHWB 4JPVH 4RQQB 4LRNL 1T04A 3CH1B 5EU6B 3RKDD 4KROC 4BELD 4H1LB 2Z93B 3T1FA 2DMCA 3AB0C 5D93C 4LCUA 4KDTA 4NQDB 3L9RB 4Z7NE 3DUSA 2FEDC 1C5DB 2PCPB 5T3XH 3OHXB 5C0IB 3SE4C 2BY3A 1FV1A 1U8KB 5GZNC 5D8JL 4FS0A 2YRPA 1UWEL 3IETB 1OQXA 4OLWL 4Z7WA 4LNVA 4ZS7H 5KSAB 4JDTL 3TIEA 3GBML 2YUXA 3MUHL 4EI6A 3JWDL 4MNHB 1CGVA 2CLZB 1CQYA 1NGWB 1AIFA 1X4YA 3REVA 1VADB 2PNDA 5TDPB 2Q8AH 5IB5A 1I4FA 4XBGA 4UTAH 4GMSL 4M6AA 3T0AA 3TA3A 4HKJA 4YDKL 3U7YL 1WAAA 3KPLB 3LD8C 3PWPB 1OAYL 1G9MC 5ALBL 1HHIB 1NCTA 4GW5B 3MLSH 1SJHB 1F3DJ 1NDGB 3BEVA 1P7QA 2OS7A 3QCTL 3VWKB 3QCVH 2UV3A 4P3CH 1A14H 4BKLA 4TTDC 5T1DL 2ADGB 5CCKL 1ED3A 1XCTA 4PJ5E 3RWGA 1VKXA 3C5SA 2OJEB 4L8BA 2XQYK 3MRQB 1X7QB 1PLGH 3GIZH 1FC2D 5F7UA 3QI9A 4U0QB 1NCUA 2HA1A 3OGCA 4N5UA 5T1MA 3MLTB 2R2HB 3M8OH 4LGSB 5HGDB 4HHAA 3D9AH 4LASH 1YA5A 5AG8A 2PTVA 2DQDH 3MNVA 5IR1B 4HUVB 4GQPH 1RU9H 1R3LB 4BSVA 3GSVA 1GGCL 1ZA6A 3NGBB 3QUKA 2CGRH 2DQUL 1RUKL 1PEZA 4QRSA 4JDVA 5DA0B 2VDLH 1LO0H 1NBZB 1FH5H 5DZOA 2IFFH 3L5IA 5C07D 3VXOB 2CKBH 1FIGL 1FNEA 1SY6A 4E41E 1PAMA 1S9VB 4GLRH 3MBED 1A0QL 4JM2C 4M8QB 7FABH 4Y5YC 5IIEB 1Q94B 1WCBA 2BVYA 4LCWD 4EUPG 5IW1A 3L6FA 3RY6A 4UAOB 3QWOB 3O6FA 3ISWA 3CCHA 4PJIF 1I7RB 3U9UA 4ZUUB 1BIHA 2B0SH 4OCMC 1CF8L 3P3YA 4DW2H 2PO6A 1AQDA 1JNLH 5KVDL 3AU1B 2EC9T 4DUWA 3EYSL 2VQ1A 4MXQC 4G6FB 2QHRH 2RR3A 4HXBH 4BK5A 3FO1A 4L3AA 4X7CC 3E8UL 3IVKA 3S88H 4ESKA 1ZT7A 3DYPA 2HFEA 5DD3H 2ATKA 2CXGA 2GKIA 3ZTJG 2AJ3A 3RWJA 2VXTL 5JORB 1KELH 3BSZH 5BMFL 4RGNC 5HPMB 1D9KC 5HI3D 3O8XB 5JQ6H 4MJIB 5GIRB 1HILA 5EOCJ 5JZ7D 5DR5L 4UNTA 1QYGL 4WENB 1W0WA 5E03A 3SBWA 4QHNB 4JEGB 1FZJA 5F9WB 4MNGA 1KLFA 3OX8B 2DM7A 5DJ2A 4DOHE 4O5LH 1RUQH 3P30L 1MF2L 4O02L 4YXHH 1GIGH 5IMKA 4YPJA 2X09A 3EFFA 5L2KB 3MJ7B 1LO5A 4K9EH 4QRQA 1K3IA 1BBDH 2CKBB 3BP5A 1R3JA 1YQVH 3HE6D 3TBSB 3DXAB 5CJXC 4TSBH 1J1OH 2PYFB 3DX8A 3RHWF 5IGXH 2W1NA 1QHPA 4UT6L 1LE9B 3BGMA 4JFYB 3MXWH 4JN1H 3GI8H 5GHWH 1FFNB 5EOCL 4ZUWB 1FPTH 3LPGA 1AXSB 5IVXB 3JWDC 3BJ91 1JHKH 4LLYA 5B3JE 1XGYL 3ZE0E 1EVTC 1LDSA 4J3WA 3O6LL 3ZKNC 3H42L 4KJYA 2NY0D 3R8QA 4FXKA 4OLVH 1FO0H 4HQQH 4KMQA 2I24N 1AGDB 1CE6B 1CK0L 4HIJB 5K33A 5AAMA 3S5LG 3GO1H 2HT2C 2D0GA 4LCCB 1K85A 4PJEA 1AY1H 1D6EA 3PL6D 5E4EC 1DVFD 5FYJE 5FUCC 2C3WA 1JNJA 4L4TB 4JRXD 2VR9A 5KOMC 2XTJB 4QYOA 1BJ8A 5SWQA 3A6BL 1YZZA 3PE9A 4XT1C 2X4UB 2HT4C 3BGFC 3GUTA 1AGCB 2D31A 4X9HA 3I84A 4N5EC 3BKCL 4Z78B 3UTZB 3VMPA 2BC4B 3MXVL 4FQLH 4TPRL 3WNOA 5DMKB 5HI5C 1JP5A 2J4WL 3EJJX 5F70A 5ERWB 4ZO6A 2F54B 3QHFH 4R26H 3FN3A 4HIXH 4CVXA 3TN0A 3MLUH 2V17H 2RGSA 1OM3H 4H1LG 4U3HA 5CGTA 1WQVT 1A22B 3LSOA 2V5YA 2DIJA 2DQJL 3EDKA 5FA4A 3QIBC 4R4FH 4HX1A 1A02N 4N8VB 5CJOL 3GJEB 1W72H 3MCKA 3NFNA 4Q6IA 3D18A 1QSFD 2Y5EA 1FNGB 1U3YA 2CO7B 2ZCKL 1WK0A 3DLQR 3FKUS 3I6GA 3MRJA 3VG0H 4GW4A 2I5YH 1U58A 4G8GE 4YEFA 1KNOA 2YOCA 4P99A 1FO0B 4PJ7A 3T0BA 2X5PA 1OTSD 4R97C 4PP2B 3WFDL 3BXNA 2B4CL 2G5BB 4RRPG 5FYLL 2EC9U 2BNUB 3IXAB 4YNYA 1IGYA 4PRDA 3MV8E 4XPAL 4ODWA 4YGAB 4XCCL 2VLMD 2WQ8A 4X9BA 4KKLC 4XPBH 1KB9J 5JDJA 4FZ8L 5HVFB 1KN4H 3DX9B 4A6YA 1U2CA 3FAWA 2JK5A 2VAAB 2XN9E 4JY5H 5FV2A 1VFMA 1EO8H 2X4TA 3SDCB 4WFHE 5IMLB 1F11A 1FSKC 3GKWH 2NTSP 2R4SL 1UXSA 3P0VL 4K7FB 1GH7A 3X11B 3ILQD 3V4PL 3LV3B 2FB4H 1F4HA 1TIUA 4OGYL 1Z9OA 3BZDA 4DZBB 1VEMA 4KQ3H 1CFBA 2QEJA 4WI5A 4PP1D 3RPIB 1DFBH 3VD3A 1QR4A 2VLJA 5E24E 1W72B 2Q7NA 2IFGA 1DSFH 2CIIA 5K9KA 1LO3L 1IEAB 4PJXA 4O4YH 5FM5M 3V5HB 5HDOA 4OZFA 3QXDA 1NDMB 1MWAA 3WJLC 5E9DE 3SKJL 3UAJC 4JB9L 1EEYA 2EIBA 4YXLL 5DUPH 5I16A 4ELKB 3GB7B 5ADPL 3TA3D 4ETYA 2Z8WC 1EMTL 5EG6C 1GJIA 1YEKH 4NKQB 3OAYK 1FZKA 5JW4N 2ED9A 4E42A 5FOJA 1U6AL 2MPAL 3WEXB 2CIKB 3CC5A 3SKNA 4O2EA 4ZAKA 1Q0XL 5A2JH 3I02B 5J6HA 1P7QD 1WFUA 2YKLH 3TO2B 3ARWA 3VXSB 3ARSA 3S97C 2MQ3A 2KPNA 5DMGC 3V0VB 5IQ9B 4KUCD 3QUYC 1MLCB 2FECL 2Y06H 1CTOA 1UVQA 1IKFH 5TE7L 4ZYKA 1MCJA 5AZ2H 3QI9D 3SE4A 4E5XB 2V2WB 4CN6A 2WWKT 1HH9B 4WEUD 3WFEH 3LQAH 4JJ5A 3E3QC 4FNLH 3IFLL 1GGTA 4TUJA 1G6RH 3A6CL 1G7JA 4RGOH 4L8CA 3ARDD 4UV7L 5FAAA 3FT4B 5JW4R 5JHDA 1RIUH 2NR6C 2ENSA 4ONGH 3C9NA 3SKUD 4G43A 2VITB 1I1FA 3C08L 5GRWA 2C4XA 4W4NA 5DVNA 4CN4A 4Y1AE 5C0JB 2O61A 1I1AB 1HQRB 5IROC 5EZLB 5I17B 1EXUA 5I1LA 4KAQL 3BP4A 3MODH 2XRAL 5FM5O 3LZFL 1P7HL 4KZDH 3OMZA 3K4DA 2XWJB 4UQ2A 1EERB 4G6KH 5FDWB 1EAPA 2HN7A 1LO4L 4YZFE 3ROOB 5IFAL 1T21B 3O6FD 3DUUB 4X6BA 2PXYC 3K1KC 2B5IC 2PO6D 3HR5B 2R0WL 4L3CA 1MLBA 1U8JA 1E28B 3MROB 3I6KB 2VIRB 3SQOH 5ESAA 1VFBA 4NP4H 4U1IA 1K9TA 2A1WL 2WMPA 1MFNA 5ESQA 1IZJA 3GHEH 3RWFB 4LSQH 1OARH 4XPFL 4LSVH 1G7QA 3PHSA 1KJ2H 1G6RB 5A16A 4HKBB 1AO7E 1NSNL 3QPXH 4ZNEA 2NY5H 1JNNH 5JR1H 1BX2A 4OLZH 3UDWC 4S1SH 2BVOB 3I3DA 4XZUB 4YPGB 2VZ3A 4OB5H 1MPAH 1ZOXA 2HWZL 1GGBH 2VC2L 1UGNA 1BEYL 1F6FB 2JF1A 2ZSVA 3DSFH 4JM2A 3H9SE 4KHXL 4Y5YA 3MJ9H 4HUNB 4OLXH 4E41B 1YUHB 1QA9B 4YR6B 4DN3H 4I48A 5EUOE 3ZDXF 5EZIL 1IGFL 4IS6B 4DN4H 3LCYA 4YBHA 1A6AA 2A74A 3T4AB 1FAIL 1CL7L 1H15B 1BMGA 1EBAA 1NCDH 3BESR 4IMLA 2WZPD 3QDJA 4A2LA 4RCAA 4QRPE 1DQDH 3ZE2F 5IVXF 3W11D 4HPOH 4S1QL 1I8LC 4IRZH 1MCIA 1EPFA 1QFPA 1OAQL 4PRAB 3BIKB 3BN9C 4N8VG 3MACH 3BFOA 3MPCA 5HYEA 1AHWB 3MLYH 4DQOH 4YGVB 2EZ0C 5HSFA 4UDTB 1A7QL 3CVHB 4HWZA 3V6ZB 1D9KA 1MJ7H 2N4IA 3PHQA 1R3IL 5FYJH 3GJFK 2E7HA 1KJ2B 3EIFA 3KR3L 3UZEA 2FSEB 4H26A 1QSEA 5A1AA 4FA8A 4X0KA 5CBEA 3W39A 3N9GL 2GITA 1HINL 5LCVH 2JJSC 4YHMH 2C1OA 5LVEA 4Y4HC 2P7TA 1IC5L 2KBGA 3K4AA 5CJXA 2GSGA 3SJVA 3VH8G 3P9MB 4MWFA 2NY4D 3UTSA 1GXEA 3QUML 3U30C 3HAEH 5D1ZB 2R0ZL 4ZFFB 1X5HA 4LEOA 3HR6A 2MQ0A 2HTKC 4POZC 2Z31C 1XGTA 3Q1SH 4P3DA 3KPOB 1K8DB 3HPJA 1OL0A 3TN0D 5F6IC 4LPXA 2X4PA 5BOPA 3QRGL 1IM3B 3PJSB 1DQQA 2D4DA 3MRGA 2YPVL 1S8DA 2OP4L 2UZXB 3RTQB 4OCWH 5D2NA 3RUGE 4UOW0 4OLEA 1DUZA 3GHBH 1CXIA 4RX4A 3LKNB 1RVFH 5IT2H 5C8JB 4LSTL 3IDMA 2X4SB 3UBXI 3VA2C 2P44B 5DJCA 5C7XL 2BDNH 4W81A 1FNHA 3L3KB 5DQDL 5DJZB 4YHYC 3WHXA 1KEGL 1TVBB 4WWKC 3WIHH 1MFCH 4I3RL 4LLDA 5CSBA 4Y5VB 3OKMA 4LCYA 1UM5H 4ZXBB 3ZL4H 1TETL 3CFKA 4IIQC 5J3HD 4OBSA 3TYFB 12E8L 2X1QA 3ARGC 2NTFA 5JW4M 5IVZB 4JFFE 1TCMA 1S9WA 5J9PB 3CPLA 3HAEB 3FFCE 3FAXA 4PY8I 2QQQA 4LDEB 1A6TB 3FRPG 3K81A 3QIBA 3MLVL 3FO2A 4CRPA 2ZCLL 2DI7A 4D9RE 5A2LH 2AQ2A 2BHUA 4V1DB 4Z5RA 5C71A 1JGLL 1YNLL 3MNZA 2J3SA 2YBRA 4Z76B 4QHUB 2W92A 4UINL 2VLJD 5HYQA 1GGIL 1PZUB 5I71B 2AJVL 1M05B 3TBVA 3J7HA 4N9OB 5T1LB 4G5ZH 5FA3B 1REIA 2ESVA 1E4XH 5DEFA 5EBMB 2R1XB 4KKCC 5I1EL 3VFUA 3MRRA 3MV8B 4X7SH 1EHLH 4OCXL 4J3OC 2MSPA 4QCIB 1BZQK 3Q6FB 4U7SA 4M61A 4WO4B 4XP9H 5IFHL 1YC8A 2ZUWA 4M43H 4ZAKD 3BZEB 4HS8L 3QDGE 1JK8A 4U31A 1M6OA 3BUYB 4MJ5A 5B8CB 2XN9B 2R0KH 4UIKH 3IDJB 4WCYH 5ICYA 4P2QE 4BQ9A 2HKFH 4KROD 5SV3A 4AM0A 2YD2A 1UFUA 2H1PH 4IM8A 3KLDA 5DD1H 2FEDD 3V0WL 3G5VB 2HP4A 3U83A 2CXKA 1HK6A 3G5XB 2EYSA 4GXUN 4Q9QH 2PTUA 3D0VA 4NJAH 3C6LB 5IB2A 5GZND 1JE6A 2DS4A 5DURD 2WLYA 2D7PA 3IFOA 3LRHA 5F44A 4DGIL 5F7EH 5C0DA 3JVGA 4TQEH 5E5RB 1UENA 3SOBH 2ZZUT 3ARVA 3KPNB 2D9QB 5JHDD 3WJLA 4X6CA 4MD4B 5LAXB 4NQVA 4DCQB 4G8EA 5E9DB 2FL5B 3QUZC 3VRIB 1T1ZA 2NPLX 2NY2C 4Z7VA 3NPZB 1C7TA 3L3DA 2BSTA 3WIFA 1BFSA 4NYLB 2HJLB 3F6LA 1NUFA 1VPOL 5E5MB 4KKAC 3DO3A 4TTDD 3ARUA 5FHBH 4LHUB 3QUYA 2FX9H 5D5ME 1UKSA 4PS4H 4HK0B 4POUB 4M6OL 1C5CL 5DRWA 1T1WA 4YEEA 1IAKB 2YA2A 3QNXB 3X12A 4NZRH 4DGYH 4QXGH 4ZO8A 5JW4Q 4Z8FH 4K8RH 4LLQB 2DIAA 3ILPB 4U1LA 1LEIB 1U0QA 2FGWL 4YO0B 4X5LA 1OGTB 5B39B 3I6LE 5I18H 3F5WA 4HEPG 3ULVE 2VYRE 3LKRB 2DKUA 5IROA 4PTUB 4MA7H 3F62A 3OKNA 3HE7C 4ZSOA 5BS0A 1MJUL 1TNMA 5D7LA 1PKOA 3O3DB 5E2VH 3FT3A 4WFGD 5EC2B 5KVMC 4JM2D 5IHUH 2AP2A 1MAKA 1TFHA 4P23B 5TJWK 3CLEL 5GJSH 4JFDA 4ZFOL 2DD8H 3GMNA 3G08A 1T80A 2PXYA 1K4DB 2KUTA 2G60H 1LGVA 1IZKA 3KDMB 5MHSE 4JFXA 1I3RA 3QDJD 2PW2A 5DEGA 2X05A 1NJ9A 2AXGA 3X3GH 4XPTL 1Z2KA 4MXQD 2ICWI 2BSSA 5CBAB 4YHLL 1PX4A 2Y7QB 1I1RA 1YNTB 3NPSC 1KTLB 3QO0A 4UOW1 4DEPC 4LEXH 1LD9A 4FQXC 3IJSA 2AABH 1J86A 4RGND 3T2OA 4OD1H 1D9KD 5DYOA 2VDQH 5DUBA 3VD9A 1CU4H 3UDWA 1XF3A 3IF1A 1B0RA 1AO7B 5E8DL 1INDH 3FO9A 5BO1H 1ORSB 5K9OA 4L29A 1ZWIA 1MVUB 1KC5L 1QSED 3B6SB 2C3GA 5IW3A 1N5AA 4DVBA 2C9AA 3HFMH 4G7VL 1T5WA 4N9GB 1FYTA 1SBSL 4XP5H 3RAJH 3O3AA 2W9DL 1T7VA 3H9SB 3X3FH 1CT8B 3BQUB 1PYWA 5E99L 5DVOA 1P1ZB 4UT7H 3SJVD 3UTSD 3T04D 1ZLSL 5MP6L 4UDUB 1GHFH 3E6HB 2FHCA 3HAEG 3MV7A 1ADQH 1KCLA 1CDCA 1RZJL 5L9DL 3B8YA 1I8LA 4XCFL 4HT1H 2E7LC 2ZP0T 4RA3A 4ODHL 1CLZH 3PWVA 2WUBH 3WFBL 4X4MA 4JPKL 3L5HA 5B3JF 3ZE0F 3K8KA 3ZKND 1I7UA 4E0RA 4OLYH 2R69L 3IB4A 3DV6A 1IC4H 3EOTH 5GGUB 1U8QB 4G8IB 4RX4D 3P0YH 2HT2D 1S5IL 4U4BA 1IM9B 8FABA 4RMQA 1BECA 1JRHL 1HIMH 1HXMA 1NCAL 5FYKU 3MLXH 5HYJA 3TBYA 3UBXB 3AROA 1U8IB 2BNQA 2G5RA 4JO4H 4NWUH 5FO9A 4NUJA 1I7TA 1G7HA 4XI5D 2JJSA 4U0RB 3RWEA 2C1PA 4Y4HA 4PJCE 2HT4D 4K2UH 4PLJC 2IQAA 3V52H 4IDJH 4N5ED 3BW9A 3R0MA 3S3SA 3MLWH 1JN6B 1EEUA 2Q8BL 3B9EA 3GMMA 3U1SH 3W82A 3WFHA 4KI5E 5EU5B 1P84K 1JHTA 2Z31A 4PV9A 1J8HE 5HI5D 2J88L 4ODVL 5CHNA 4ZDHB 3LN5A 4N0FB 5ETUB 2NY7L 5DVLA 3QAZC 5FGCE 5E4IA 1A3RH 2OSLB 1D5IH 5IG7B 5IMOB 1DLHA 4FQJL 4MDIA 3QIBD 1JYWA 1M7DA 1H0DA 2AI0L 3UYRH 2Z92B 2IG2L 4Q7DA 4GAYA 1KXVC 2YD1A 1X5ZA 1JWSB 2X9XA 4EBQL 2YD5A 35C8H 1A6WL 3RUGB 4F9PC 4GXUM 4P2YA 2XFXA 4HWUA 2DL9A 3ULUE 3ARTA 3FQXB 2M26A 3O4LE 3GFUA 4KTDL 4X9GA 1P4IL 3KJ4B 2Y07L 3WNKA 3S96A 4L1DA 3STLA 1MIMH 1B4RA 2ESVD 3DVNA 4WWKA 1RMFL 4CBPA 4I0PB 3P73A 2CLVB 4APQB 1OB1A 4KKLD 2OK0L 1U8LB 4OI7A 5GRVL 3JWOL 4I0KA 4D9LH 4KZEH 4IIQA 1IAIL 4M6NH 43CAB 3HNSL 3ARGA 1INEH 2FO4A 4PFEA 5B4MC 4WTWA 3MQIA 2HFFA 4KUZH 3CMOH 5SWSE 4GS7C 3L7EB 5I8KH 3LKOA 4JFFB 5FO8A 3HMWH 4Y8DC 5KSVB 2DYPA 3GSOB 1ZGLM 5DMIH 1QVOB 1MCFA 3FFCB 4WY7H 4NRZA 3IJHB 5C0BA 4PRIA 3T0DA 4XBPA 2DQIH 4J4PC 4NGHH 5DD5H 1UCBL 4U6VL 1OAUL 4OM0L 4GG8B 5DTFA 3FCTB 1BQHA 4OQTL 1X6NA 3E1F1 4QRRE 4HUXA 2AXHA 4WDIA 5CUSH 4FHBD 5ACMA 5B39G 5HHNB 3U7AA 5C0EB 3UAJD 3OXSB 4NCC2 3LY6A 1MHCA 1R3HB 1H3TA 4MCZA 2YWYA 3PWJA 4HKZB 3CUPB 3U9PL 4PY7A 5L6YH 2H8PB 1T0NA 3DRTB 5GSVA 3W9DB 2GFBA 4ZFZB 4OJFH 1CD0A 3X13A 3ZYIA 3FB6A 1VGKA 4MNQE 3QA3A 3MRIB 5DMGD 3GGWA 3WV0A 3GSUA 3QDGB 1R5WA 3QUYD 5JPNB 3T77B 1YY8A 1AGFA 4N8PA 3STZB 1TQBC 1W8NA 4P2QB 1YYML 3FQRA 1FG2B 4H5SB 1GGUA 3HI5H 1GGYA 1BAFH 4U2ZA 1DBBL 5IESH 3KLSA 3V6FA 5BJTA 2I9TA 1ZTXL 5I2IA 3MGOB 2DLHA 1U93B 1A7PL 3H3PH 1R3KA 2IMNA 4XTRC 4CU6A 3CFBA