1FL3B

Crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
214
Chain Sequence
AALTQSPVSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPNRFSSSGSGTDFTLRINTVEAEDVGVYYCAQNLELPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLUE FLUORESCENT ANTIBODY (19G2)-HEAVY CHAIN
publication title Blue-fluorescent antibodies.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2000-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl3B01
1HHJA 4UTBL 1V5JA 1UZ6F 4CU6A 2ZUQC 4OSUL 1MHEA 1KLGB 2ICCA 2A6JA 3A6BH 4TQEL 4PLKC 2OBGA 4YX2H 5C0EA 5DDHA 1BGXH 4LCWD 4BQ8A 4JFOB 2HMID 2CRMA 1LO2L 1X6NA 1R3LA 2C3XA 4HK3J 1OD9A 1PJ9A 4JFDE 4DGYL 4EDWH 4ESKA 4M3KB 3V5KB 4BZ2H 5FYKE 1GYAA 4KKNA 3CLEH 4MVBC 2O5ZL 1LP9F 4QLRA 5DS8A 1WFUA 4KQ3L 3MRKA 4J6RL 3HPJB 3EYFA 4XRCA 3OKKA 3RKDD 3GSVA 4EN3D 5E1HB 5I74C 4QWWD 4OLVL 4XC3L 2YZ1A 4LCUB 4DTGH 1EO8L 4PBXA 2D03H 1C5BH 5C09E 1DQML 3FOMB 4D8PB 1BMGA 4LIQL 5FXCH 4DK3A 3RTQB 4YDKH 1OAYL 2NW3A 4HV8A 3QDMD 1ZGLM 1UWGH 2APXA 3LHPL 5JW4R 3FO0H 2VZOA 5IB2A 4JZNA 2KH2B 5EO0B 1RULH 1XF4B 2PW1A 4I3SH 3RI5K 3WNKA 1GAFH 4Y5YB 5B38G 1EV2E 1KLGA 3T1WA 3DRTB 3Q2CA 5HYQB 3TO4D 5D7SH 3UPRB 3CVHH 1BWWA 1G6RL 5ITBH 1KTLB 1VFOA 1TDQA 2AGJH 4LF3B 4JFOA 2WP3T 4YIQB 4ZSOE 2DAVA 3H7BB 1QHPA 4KY1H 3GBLA 3WXVL 3V5KA 3RWGB 5DZLA 2UVFA 9CGTA 2DKUA 3FQRB 4OBSA 5D7LB 5I74B 4G8IB 1GOFA 2QSTA 2OTPA 3THMH 4FTVE 4IOSD 4R2GC 5F7DB 4F8QA 3VXUE 3HPJA 3T3MF 2DQHL 3X11B 3AROA 3U1SH 1MCIA 2FCBA 4KKCC 1VA9A 4JRXE 4LCUA 4AIXA 3F12B 3MLUL 3FOMA 4ENEC 1XGYH 4XP1L 4WFGE 4JFED 3MRRB 1HKFA 1UKSA 1D5XB 3RTQA 2GJ6D 4LPXA 4R97C 2WBWB 4M7JL 4X83A 4OQTA 3ARDB 2CPCA 4HWBA 4F15C 2GJJA 1UADC 4B5EA 2ICWB 3HE6B 5EO0A 3IB4A 1MI5E 1XF4A 1PG7H 4XP9L 2DYPD 3MGOB 1V7NH 3C08H 3L7FB 4Y5YA 2DIAA 4KZEH 3O9WB 3DRTA 4I77H 2AV7B 4ZAKB 5HYQA 2GEEA 1QHOA 1X4XA 3UPRA 3ARFC 1DLFL 3EBAA 3T0XA 1KTLA 1QFWH 4LF3A 3QJFB 4YIQA 1VFBB 4XMKH 3H7BA 5E8EB 4XPBH 4OKVB 2AQ3A 1ZT1B 1P5VA 3RWGA 5TGBB 3NFSL 3K2MC 3FQRA 1F58H 5D7LA 2EZ0C 4HIHB 4OM1L 1IM9B 1I9JL 4G8IA 4QWWC 3WNPA 4L4TB 4RQQB 4FQJH 4F7CB 1K3IA 5F7DA 4LLVB 4X4MA 2DQUH 4DGIL 1KT2B 2HT3C 4X4ZA 3I6LD 3EYSH 4WEMB 1F5WA 2X89D 2VZVA 3X11A 1ADQH 4HUKB 3ZSSA 1Q9WB 4R97B 4U4BA 4JHAH 5C6TH 3WFHB 5DT1H 4NQED 3T1FB 3EJJX 4PV8B 3F12A 2R29H 1CBVH 4XCYB 4JY5H 3MRRA 3PHQB 3F5WB 1D5XA 4UB0H 4DKEL 4L1DA 3PUCA 3CZFB 4HC1H 3ARDA 1E4XL 4KROC 5DD6B 4XVUC 2EEDA 2NY6D 3MLSH 4AZ8A 5BV7L 2NY0C 1RD6A 2ICWA 5FHAL 3HE6A 1NFKA 5E08H 1QUNA 2XZZA 4NO3B 2ZZUT 2L4OA 4TUOB 2X1QA 1JPTH 4LQFH 3MGOA 3S7GA 3L7FA 3CVIH 4OZHB 4F2MB 1RUAH 3O9WA 4RGOH 4U2ZA 5F97E 4U6VL 4ZAKA 4Z7WE 2Q8BH 2Q8AL 1O7VA 4EN3B 1F4XL 5FGCE 1MCHA 3QJFA 1RUQH 4QHMB 1VFBA 5KVEH 1NCWH 5E8EA 4OKVA 2AJXL 1ZT1A 3T65B 1J86A 4JN2B 3V6BR 3QUZD 4ONHB 5TGBA 4DEPC 2VTFA 1HWHB 3NH7H 5EUOB 4HIHA 1IM9A 1FO0B 35C8L 4L4TA 1IE5A 4RQQA 3B83A 4S0SD 7CGTA 4F7CA 4KPHH 4GAJH 4LLVA 4PJDE 1KB5H 4Y5XC 1KT2A 1G0XA 2F15A 1RZJC 3GJEB 1P9MC 3U83A 4F80A 1XCTB 3TT3H 1NCCL 1Q9WA 1HQ4B 4MQTB 2RBLA 3U7AA 3WFHA 1AJ7L 4KROB 1GGBH 3T1FA 4PV8A 3HMXL 2YUZA 3GIVB 1P4BL 4XCYA 3PHQA 1T03H 3F5WA 5CGTA 4O4YL 3CZFA 4UQ2B 4JDVB 3X17A 1QLEH 5DD6A 1HKLH 1CFTB 1NFDF 4KU1A 5LWYL 3J7HA 4XPGL 3ME0A 3HR5B 4MMZC 4NO3A 4TUOA 4B7IA 4NZTH 1J0JA 1EAPB 3TC9A 4ODVL 2X10A 2UV3A 4OZHA 4PREA 3MLTB 4G8GD 4F2MA 2BXZA 4PB9H 5DQDH 3KYMB 4NDMB 1NAMH 1EEQA 3L3OB 3N06B 4NYLB 4OGXL 4DEPB 4EN3A 1NSNL 3X12B 5BMFL 4HSQA 5CP3A 3DMMD 4LDEB 4N0UB 4QHMA 1UZ8B 2D7MA 4Y5XB 5JMRA 3T77B 3EHBD 4OCYH 3BKCL 2EDXA 3T65A 4JN2A 4ONHA 1BAFL 1BOGB 1YUHB 3DUUB 3VD9A 5EUOA 1FO0A 4ODXB 5DRNB 5EZLB 2QHRL 5KVGL 3KVQA 2ED7A 4XTRC 3GJEA 4FQQB 1T1WB 3RY6C 4XP6L 2XY1A 4POZC 4XC1L 2WAHA 1XCTA 2VR5A 2DYPB 1HQ4A 4Y4HD 5JIIA 4HBQA 1IGJB 4X9GA 3RRQA 1A7NH 4GAGH 4B41A 3GIVA 4OJFH 3LN5B 1EFQA 1MRCL 4P2QE 3FB8B 1P6FA 4JDVA 4PJ8C 4UQ2A 5CJ8A 4GRWF 3ZT5A 1CU4H 3FFCD 1CFTA 4I3GA 3NPZB 3HR5A 2L7UA 4GFTB 2CIIB 3ULVF 1EAPA 3LQZB 3QEUB 2ZJSL 4JPVH 3WYRA 5I8CB 3EFDH 3MLTA 5J3HD 2DWDB 5D6CB 5D70H 3W11C 3KYMA 4I0KA 4NDMA 3FB6B 4X6FB 3L3OA 4YHYB 3DETD 3FHAA 3C5JB 3DV6B 4WY7L 4NYLA 3X12A 3B9EA 1AI1H 1G0DA 4NQEB 4N0UA 1X4YA 4K3EL 1N3NB 5DHXB 4R90L 4Y5XA 4NUGL 4RA3A 3T77A 1P9MA 3S36H 4NC2B 3WIHH 5FO9B 2GJ6A 1BOGA 1YUHA 3DUUA 3QCUL 3ARUA 4HJ0C 3RIFF 4ODXA 3UPCA 3LRGA 5DRNA 5EZLA 2NY6B 3X3GL 5HVHC 1EPFA 1A1MB 5SX4H 2JB5H 2RIKA 5C6PB 4FQQA 1T1WA 4OLYH 1EK3A 5INCB 3ZT7A 1N0XH 2DLGA 2DYPA 5JHDE 3LEYH 4MJIB 1IGJA 1BD2E 1T7WA 4GT7A 5I1HL 2AVGA 4NN6C 2ZOKB 3LN5A 4OLUH 2PYEE 4FOMA 5F9JB 1FGVH 3D0VB 3MLPA 4XB8A 3FB8A 1WGOA 4M1GL 3LKRB 2KQMA 4P46D 1IKNA 5DVKA 1CL7I 3UYOD 4K7FB 5IVXB 1ZTXH 2CIIA 3ULUF 3QUZB 3LQZA 5DA0B 4NNPH 3QEUA 1E6JL 5I8CA 5HGHB 1P7HL 2OJZH 2P47B 2DWDA 5D6CA 5L0QC 4ZFFB 2YKLL 5E7FA 4F37F 3FB6A 4X6FA 4NZJA 1RU9H 5JO5B 3C5JA 3DV6A 1NMCC 1JGEB 5EBMB 4LFHG 1H8SA 1I8MB 2QQLH 3GO1H 4NQEA 1N3NA 1MFCH 3D6GA 3L3JB 2W38A 3WN5C 4U49A 2BNUB 1P5UA 3RY6A 5FO9A 4J8RB 2Y06L 3R1GH 5I1GL 4YWGH 1CF8H 4TULL 5MERB 1QBAA 5GJTH 3QNYB 5F9OL 3O6KL 3PL6D 1A1MA 3TFKD 5INCA 3C5ZD 3NGBB 3SDDC 1AFVH 4MJIA 3MQIA 3HMWH 1CGTA 3QDHA 1RUKL 4QNPE 3BN9C 1OM3H 2ZOKA 3CXDH 3X3FH 5F9JA 5D7IB 4LEOB 3NIDE 3D0VA 3VH8G 3ZTJH 2HRPL 1MFEL 3W9EB 2R0LL 1HWGB 2FECI 3LKRA 3VJ6B 3DMMB 2EKSB 5L0QB 4U1GB 3WFCH 5F7EL 3SDXB 4RRPA 4X7SL 4K7FA 5IVXA 2ZUSA 4UT7L 4Y4FD 2BOBB 3DETC 4QGTA 5INDB 1CDUA 3QUZA 5F7YC 4XNYH 1TZGH 1TJHL 3QFJD 3OB8A 1KUMA 1A3RH 4OD3L 5HGHA 1EIBA 2FECL 3UXFA 1RPQA 3JWDC 3ZKSD 5FUZH 1CGUA 5C0RH 2ZKHH 4ZFFA 4WO4C 4MNHB 3WN5B 2VXQL 5KN5B 5JO5A 2W91A 1JGEA 5EBMA 5HGBB 1UT9A 4Y4HB 3T0WA 3O11B 1I8MA 3I84A 3L3JA 2JLLA 4FP8H 2BNUA 4JO4H 5DK3A 4LMQE 4J8RA 2QSQA 4V2CB 4MA3B 5MERA 3DGCR 4FS0A 4CVXB 3QNYA 2BRRL 3FFCB 1IKFH 1CGWA 4IHOB 2DJ4A 3T0BA 3STZB 2YC1B 3OGCB 1PY9A 1AH1A 1YYML 2I26N 2O26U 4Z7WF 1RZKC 2VSCA 1MPAL 1ZHNB 3V6OC 4WW2B 1AQKH 2MCPL 2VB5A 1GGYA 2A74B 5JA9A 1IARB 2PO6C 1QACA 1TJIL 4UBDD 1AD9B 5GXBB 1BJMA 4TRPL 5LGKA 5D7IA 4LEOA 4FQCL 1YPZE 4QF1B 3L5JA 3QB7C 3W9EA 2IAMC 5C7XH 3VJ6A 3DMMA 1JL8A 2EKSA 2WINB 3NABL 5IUSA 3SDXA 4O58L 4OF3A 5I1KH 2BOBA 1NMAH 2QSVA 5HYIA 5INDA 1BBJB 4DW2L 1ZLVK 1HE7A 4N8VB 4OIIL 5I9QB 4Z8FL 4MNHA 3RDTC 3W82A 3WN5A 3CFBB 5KN5A 4MD0B 4PS4H 5DEGB 5HGBA 1MOEA 3MJ9L 4KRLB 4Y4HA 3O11A 3O3BA 3DYPA 3S5LG 3V4VH 3V5HB 1BFSA 3SE3A 3KAAA 1YEKH 1ZT7B 4OGYL 4KKLD 4GXUM 4P9ML 3BJLA 4M6NL 4TVPH 4MA3A 5T3ZH 4S1DD 4ZOAA 5HDQH 1U8OB 3RAJH 4CVXA 1G9EA 4FFVD 3FFCA 4P46B 5KW9H 2X4NB 4IHOA 4GRMB 3STZA 4D2NA 2NXZD 2YC1A 3OGCA 1CGYA 4YLQT 3MODH 4HMDA 1FJ1B 1SY6H 3CMOL 1ZHNA 1T1YB 3BGFB 4WW2A 4P5MB 1KIQA 2IAMB 4PR5B 2A74A 4G6MH 5T3XE 2X42A 5JORB 3MROB 1AD9A 3MUHL 2IG2H 3OR6B 5GS1C 4HG4J 2ARWA 2EEAA 4UIKL 4QF1A 2IPUG 1OAQH 1LP9B 2QQNH 2WINA 5FHBL 3V7AG 4TSAL 4FQHB 4HUUB 5F1NB 1FLRH 2CJUH 2WP3O 4MB3A 1DBAL 3ZKXB 2F54E 1BBJA 1V05A 3K74B 4XNUH 5FGRA 4N8VA 1KPUB 4GLRI 4WDIB 4KTDL 2AV1B 3B2UD 1T2XA 3CFBA 3NCEB 1A02N 4MD0A 5I8EB 3NFPB 5DEGA 4D9QD 3N1QC 2IBZX 1YEGH 1CCZA 3R8BB 3V5HA 4FQ2L 3ZDZE 4OKDA 4YBQD 3REVB 1ZT7A 3DIFB 3TCXA 2R4RH 1CVSC 3V6OA 5TE6H 1A3QA 4QXUH 1FLTX 1EJ6A 1U8OA 4Z77B 5HXMA 4P46A 2C4FT 2X4NA 4GRMA 4F8TA 4JFXB 2R23B 1QTYT 5GS1B 4FQ1H 2DLFL 2Z8WC 4Y4FB 4L8BB 1FJ1A 4PLJC 1DBKH 1T1YA 2WQ8A 5C0NC 4GW5B 5DGQA 4P5MA 3QXVA 4Y19E 2IAMA 3QFJB 4PR5A 2K3TA 3SE9L 3WXWH 1J0ZA 5JORA 3MROA 3INUH 2VLRE 5DUML 3OR6A 3NTCH 3C2AH 3PV7A 4J3WA 4PG9B 4WHCA 1RUPL 4ZO6A 3KLHD 2DQGH 1LP9A 4JO1L 1C5DB 2ZWLT 5EZOL 2JJUA 3U7WH 4FQHA 4HUUA 5F1NA 4Z7UF 1T5XB 2YOCA 4RDQG 2PTUA 4XBEL 3WO4C 4XI5D 3QXWA 5E2UH 4OUUB 5IVNA 1NDMB 4LSPH 3B2VL 1KPUA 4WDIA 2AV1A 4UU9B 4X5XB 4RFOL 4QKXB 2P42B 5I8EA 1HQRB 3RJDA 3NFPA 5GSVB 4OCMC 4DKAA 1ORQB 4DZ8B 1A0QH 4K2UL 4ZD3H 5IROC 4KRPC 2NXZC 3GBMH 2COQA 5EU7E 1DN0B 3REVA 3DIFA 4HJJH 3WUZA 2ZPKL 2D9CA 3L5HA 3H3KA 4Z77A 1G7PB 3S4SB 4MLSA 5FYLD 3KWWB 4JFXA 2R23A 1QRKA 4JFDD 5GS1A 4H1LG 2OR7A 4Y4FA 2XKNB 4L8BA 3RNQB 5FYKD 3PWPE 4GW5A 3QFJA 5DD3L 4NM8H 3FMGH 4XPTL 4URTB 1M6OB 3ALPA 1NAKH 4PY7B 2IPUK 4PG9A 1QFUL 4JB9L 3WDHA 1B0WA 1B2WH 2MKLC 4FRWA 4OAWB 2Q7YB 3RUGE 5IOPB 1C5DA 4LCCC 3E2HC 4J3XA 3ET9F 5C09D 1GGCH 1G7LB 1WUNT 2VXUL 3GIZH 1T5XA 3WKML 1V7MH 2FSEB 1MLCB 3NACH 5I1AB 2CD0A 4OUUA 1NDMA 1YDPB 4RAVB 3V4PL 1NDGB 2FR4B 1QRND 1CLCA 4UU9A 1GIGL 2NXZB 4X5XA 3QUMB 5HYJE 1R0AH 1HQRA 1C5CH 5GSVA 1ORQA 4DZ8A 4G6FD 2FGWH 2A6KB 5IG7B 3MX0A 2Q20A 3D3VE 3O8XD 4MAUL 4YGAB 4NQUA 4NJAH 1DN0A 3ZE1F 3EIFA 4HFUH 1OQXA 4PP2B 1MRDH 4ELKB 1Y6NR 4IRJC 4GG6B 1G7PA 3S4SA 5KVFH 4FMKA 3KWWA 5T5FL 5SV3A 3VD5A 2OMNA 3T3PF 4Y5VC 2XKNA 3RNQA 1FO0L 1RQ5A 4PJ5E 1DTUA 3GNMH 5H35B 1M6OA 3U6RB 3GDBA 3OXSB 3I85A 4PY7A 3X13B 4X9FA 1DE4B 2R9HD 4OM0H 1A5FH 5FM5O 5J8OA 4Z95L 3GRWL 4OAWA 2Q7YA 2P5WB 4XZUB 5IOPA 4JJ5B 2VUOA 3MRCB 4JRXD 2YD8A 4HK0B 2BSSB 1G7LA 1EDQA 3AFLA 1A7BA 4MS8D 4CN1A 1FRGH 4WFGD 1E4KC 3ISWA 2VDQH 2FSEA 1MLCA 3BDYH 2Z31C 4JQIH 2Q6WB 5I1AA 4RAVA 5IROA 2FR4A 1NDGA 3VI4E 5FV2A 4J3OC 3QUMA 3Q1SH 2DQCL 3UTSE 3SKMB 2E7HA 1MI5D 2DM2A 1YPZF 4ONGH 5F6HJ 3LN9A 3QXAB 2A6KA 25C8H 3V8OA 5IG7A 3PIQB 5KTEL 1LO2H 2NY3C 1NFDB 3F7YB 4I0PC 5JA8B 2H1PL 4FABL 3HI5H 3GI8L 1EX0A 3TJHD 1H3TA 2H32B 4KUCF 5DC4B 2R0KL 3RWCB 3JV0A 4PP2A 4ELKA 1X4ZA 2X1PA 3QPXL 4NM4L 4GG6A 3SE8L 2B5IB 2Q76B 4ZXBD 1RZJL 3ULVC 4KVNL 2WK2A 3B8YA 4ZFOB 3IDIB 1U8IB 4RMVA 1CYGA 3C5SB 2J6EL 1MEXL 4OLVH 4XC3H 5H35A 4JEGB 3U6RA 4XCCH 3OXSA 3X13A 1HI6B 1K4DB 4QHKJ 1DE4A 4LIQH 2ZUYA 3HI6H 1MCFA 3ECBB 2P5WA 5GISL 4XZUA 4GQPH 2Z31B 1HILB 4JJ5A 3MRCA 3STLB 3KHOA 4HK0A 4P3CL 2C4XA 1NL0L 4YHOH 2BSSA 4HUNB 2E7CA 4AEHL 3U4BH 1UFUA 2G2RB 5BZWB 1QKZL 3EKCA 1WZLA 1MJUH 4K71C 1RJCA 2Q6WA 5GGRB 3DJ9A 4I0PB 5F7KC 4MDIB 3A6CL 4F57H 4JFDB 2I60L 5ALCL 5C0AE 1QR1B 3SKMA 4CVWA 4U1NB 3C60C 1CQYA 4FMFA 4V1DB 4EQ2A 4MA1B 1G6RH 3QXAA 4PJ9D 1MUJB 3PIQA 1NFDA 3F7YA 4KMTH 1JHKL 5IT2L 1YEFL 1BVKB 2J5LB 3JWOH 5GIRB 5E9DE 3ELAT 3GK8H 3QNXB 4XAKE 5B8CC 2R0WL 5CJOL 2WUBL 3WXVH 2CDFB 2H32A 1MWAB 3RWCA 3ZTNH 5IV2B 1HNGA 5GQBA 5E8PB 2NW2B 5C09B 2Q76A 4UT6H 2IPKB 1UWXH 3VFTB 3ULUC 5EH1A 4ZFOA 1DUZB 2DQHH 3BPOC 3IDIA 3QDGB 4WCYH 1U8IA 3C5SA 1KCRL 5FM8A 1JGDB 2IH3B 1FNLA 1RJZB 4F58H 1S78D 3H42H 3PJSB 1HI6A 5HBBA 1K4DA 4FFWD 4KQ4H 3ZDZF 3FRPA 4YXKH 3WO3B 2GI7A 3ECBA 3RVVD 4G6FB 4M7JH 1HILA 1OLZA 4DN3H 3STLA 3O8XB 4YHML 5L88H 2XXCB 2ZCHH 1UKTA 2NTFB 2G2RA 2CMRL 3IFOB 5BZWA 2C4FU 4LMQI 4J12A 2X1WL 3L5IA 5TFSL 4G5ZL 1I3GL 3KPPB 5GGRA 4I0PA 1TQCB 4MDIA 4ZSOB 4JFDA 2OJEB 3RL1B 1QR1A 1I75A 3HNVL 4U1NA 3OKEB 1DLFH 1FDLH 3SPVB 4HS6B 4F7EB 1MUJA 3EO1B 3WLWC 4FTVB 5GIRA 1BVKA 3H2WA 4M3JA 4JG1H 2R4SH 3VXUB 3QNXA 1OSZB 1KFAH 3D48R 3KDMB 1F4WL 2CDFA 1MWAA 5IV2A 4EI5C 4NRXB 1I9JH 5GGSY 5E8PA 2NW2A 5DR5H 5C09A 2IPKA 4ONFL 3VFTA 2VDOL 2P43B 1DUZA 5GRWA 4Z7VE 4L3AA 1UJTA 1JGDA 2IH3A 1U92B 4M48H 1E4WH 1RJZA 5EULV 4XVJL 5IJKC 1JHLL 1HOCB 1DLHB 4A6YB 4HXBL 3PJSA 4TSCH 4KMQA 1MI5B 5GS3A 4DKEH 1MY7A 1SMAA 4Z7OF 1X5KA 2AJYH 3DXAE 3BYYA 3DSFL 3O8XA 5I30L 1T66C 5BV7H 3BAEL 4KK5C 1N7ML 2NTFA 3I6GB 2BVQB 3IFOA 1KTDB 2IF7A 4P2QD 4RMUA 3TV3L 4G6AD 1IC7H 1ZEAL 3KPPA 3MV8E 3P30L 4ZSOA 1CLYL 3BKYL 4OCXH 3KS0H 2OJEA 3RL1A 1TQBB 3P2TA 3OKEA 5JXED 2C3HA 3SPVA 1F4XH 3QXUA 2BY1A 4HS6A 4EI5B 4F7EA 1UH4A 3EO1A 1CFBA 4FTVA 3OJDB 3VXUA 1OSZA 3KDMA 1MY5A 3P9LB 1I1FB 3MOBH 3IDYC 4XH2B 4NRXA 4RMRA 3WNLA 5EOCH 5D6DC 1OAUL 3A67L 4AQOA 4NO2B 2YD3A 1A6UL 4UNUA 1CICD 3IU4L 2RAMA 3E8UL 4CN6A 1U92A 1UCBH 3S98A 1YYLL 3KR3H 3H8NA 4ZS7H 1HOCA 1DLHA 3FZUD 3HMXH 1S8DB 4A6YA 1AE6H 4ZUTB 1MI5A 2GTWB 5JHDD 4LSQH 1BD2D 4NO5B 4PJ9B 4YK4B 1MCNA 4U7KA 5EIQA 2DM3A 3O2DL 1BBDL 3MZGB 4Z7WB 5BVPH 3I6GA 2BVQA 1NUGA 3CLFH 4Z7NE 1KTDA 4GW4B 1YEIL 4NNYB 1IJ9A 5FGCB 2QV2A 4ODVH 3MLYH 3UP1A 3JWDL 4TTGA 4MD5B 2XIDA 3HAEB 5JW3H 1H8OA 1KELL 1FFNB 4ZOBA 4OZGE 3SO3B 2FJFB 4N5EC 2V17H 4P5TD 4EI5A 1NSNH 5FKAB 2W0PA 4LKCB 5J89A 3OJDA 4BQCA 1VADB 4PJDB 2ATPB 5GSRB 3TPKA 1X5LA 4PRPD 2MJWA 5T1DH 3P9LA 1I1FA 4X7EC 1BAFH 4XH2A 1MCPH 4KK6D 5ISZE 2NMSA 3NVQA 3OHXB 5KVGH 1CIUA 2P1YA 4XCFH 3VI4F 3F58L 4NO2A 1RZKL 5I71C 3VXSB 4ETQB 1SJXA 4XC1H 4FZEL 5AZ2L 3MACL 1RZFH 1S9YA 4P4KC 3T0AA 1HIML 4UMGA 1F13A 4GMSH 3ARBD 1KJ3H 4ODWB 1BQLL 1NANI 3CU1A 3UJIL 5JR1H 1S8DA 3MNVB 2VLJE 4ZUTA 4MQSB 3CDFA 4NRZB 1MCOL 1MRCH 4KI5E 2GTWA 4GAYB 4NWUH 2ATKB 1M1SA 4NZRH 4OFYD 3WNOA 4PJ9A 4NO5A 3CFKB 1BPVA 5E95B 2VDKL 1F4HA 1BQHB 4P48A 4Z7WA 5I1IL 4GW4A 4NNYA 4PGZA 5F8QC 2YD1A 4Y2DD 3IKCB 2CLVB 1H15B 5GS0D 3DV4B 4MD5A 1U42A 3HAEA 1VENA 5TF0A 4BZ1L 1FFNA 2J88H 2MPAL 4PG2A 2W0FB 2FJFA 4WY7H 1JNNH 2VZUA 4K94H 5FKAA 4LKCA 5D6DA 5I0DA 4K3EH 1MCWW 1VADA 4PJDA 3BRDA 4R90H 1MHPH 2ATPA 5GSRA 1JGUL 4NUGH 4W68A 2O5XL 3NAAH 5BO1H 4LLYB 1ZLVH 4N0RA 2O93L 4QRRE 1EUUA 2UYLB 4JVUA 2VKXA 2VXVH 1TPXC 3LOWA 5CZXC 3QRFM 3VXSA 4ETQA 1I7ZB 3N9GL 1HNFA 4GOSA 4P2QB 1OAXL 12E8H 4R8WH 1UEMA 5AD0B 4ODWA 3BH8B 3MNVA 5DURD 4PGDB 3PDGA 4NRZA 2YD4A 4GAYA 2ATKA 5GRJH 3QI9D 4RWHA 4LVHC 3CFKA 4M1GH 1NC2D 1E27B 4KKAD 1KOAA 1WAAE 5HI3D 1A3LH 1BQHA 4F9PA 1G7JB 1VGKB 2VDNL 2GITB 2FBJL 3WFEL 5F71A 2VDML 1AGCB 3MUY1 3IKCA 2CLVA 1H15A 2LAGB 3RX5A 1TIUA 1H9VA 5IKCB 3DV4A 2B0SL 1SEQH 3BX7C 3HUJE 4DFIA 4UTAH 1EBAA 3ZE0F 2YKLH 2W0FA 3RA7H 1Q1JH 3LVEA 5E8DL 3LB6D 5CZVH 1CICB 4PB0H 2YD9A 3TJEH 2RFXB 4ZO9A 3ZSTA 1MJ8H 4JDTL 1EZVX 2Y06H 3HZYB 5JHDB 1ZVHA 4LLYA 4DVBB 2HT2C 4Q74A 5KZCB 1BD2B 4WFFE 3KYNB 3ARBC 1XF3B 2WLZA 3B9KC 2B4CC 1LO5B 2UYLA 4JPIB 5F9OH 3O6KH 3RU8L 3VXRE 5JIPA 2PYEB 3AVEA 4WTZG 4ELME 2I9TB 1I7ZA 3FTGB 4P2QA 1GCFA 3REWB 1DFBL 1FORH 1Z0MA 1FFQA 4LVHB 4OT1L 5DVOA 5AD0A 3MBXH 5ELIA 4U1JB 1RUKH 3KYKL 3BH8A 5ID0B 5E6ID 2XXMB 4C54A 1D9KC 1Z2KA 3MRQB 4PGDA 5EWIH 4WI3A 5JXEA 3L9RB 1MFEH 4HX1B 4P5TB 1ZV5A 2GFBB 5T3XD 1E27A 4O9HH 3MO1B 2HN7B 4LHUG 1OAZH 1I7UB 5F7EH 1G7JA 1VGKA 4E5XB 2GITA 5TDNB 3MV11 1IFHL 1AGCA 3F8UB 4OF7A 3WMSA 5IKCA 4KXZI 3WSQL 1LHZA 5LAXB 5FYLH 4DN4L 2ZP0T 2VXQH 3BGMB 1IGCH 1Z0NA 2F54D 3FHQA 1CICA 3WJLC 1J8HE 2P48B 3MRBB 2RFXA 2VMFA 3R0NA 3ARBB 4HMEA 3QUML 3P11H 4YXHL 1MCKA 3S4SG 1MCJA 4D9LH 1FFRA 3RVUC 3ZYJA 4P4RB 1J1PL 4CMHC 4PYGA 3HZYA 3V6FB 5JHDA 4F7PB 1OWRM 1QD0A 4DVBA 1BD2A 2AEPH 1XF3A 2BRRH 4JPIA 2PR4H 5AYQA 1LO5A 3ZKND 2I5YH 3PQYE 3HB3C 3TBTB 1RHHB 2PYEA 3GMMB 4P23C 5D7KE 2VXSH 4RGNE 2XZAH 2I9TA 1CK0L 3FTGA 1MPAH 1M4KA 3REWA 1MAMH 5IHUL 1PBYA 3OPZL 4KKAC 1RZIB 2EDYA 3BN3B 2VUYA 4U1JA 5ID0A 4NQCE 3MRQA 1JK8B 3FN0L 4FNLL 2JCCE 5DEFB 5D96B 3L9RA 1W0WB 1OP5K 4HX1A 4P5TA 4XP4L 1CGSH 2GFBA 1QBLH 3GBNL 1DSFL 3MO1A 2HN7A 2VLRD 1I7UA 4K8RC 5M95B 3CCHB 4E5XA 3HS0B 5C0DB 5BZDB 5TDNA 5C07D 5IQ7L 4KZDL 2DI7A 1DQDL 4KK8D 1FFOB 4DW2H 3TA3D 4LVEA 4UAOB 3K0WA 5LAXA 1OHQA 1UG9A 2X05A 4HCRH 3QP3A 5ACLA 4O02L 3ZHLA 3BGMA 1MFAH 4UINH 4CDHA 3MRBA 3ARBA 4Q9QH 4Z6AT 2HLFC 3QUXC 4KV5E 5DURB 3MJ7B 4P23B 4P4RA 1V8HA 2FEDC 1IGML 3SBWC 4Z7NF 5D1XD 3TESA 2FIKB 2EIZB 3MCKB 3V6FA 4F7PA 4PJXE 4JFHE 4OFYA 3QI9B 1NC2B 3AMLA 4NZUL 1OCWH 5TQ2L 1JFQL 3TBTA 4OZFB 1RHHA 3HC3L 3GMMA 4CKVX 5K9JL 3IS1X 3QULB 4KHTL 1Z9MA 5FYJL 1YPZB 2HP4A 1LO3L 4M1DL 1FYTE 4L3EE 4LOUD 4P99A 3PNWB 4HH9B 4WHYG 1RZIA 3S34L 4LAQH 1IVLA 4ALAL 3MV01 1N8ZB 3T2OA 4ZFOL 3SCMD 4LP4A 1JK8A 1EGJL 1KTRL 5DEFA 3PWPD 1W0WA 4ORZC 4HPYL 2OTUB 2WM0A 5GRVL 4ODHL 1JUFB 1G1CA 4TSAH 3CCHA 5IMKB 3HS0A 2YXFA 2Y4SA 5C0DA 3LIZL 5TDPB 1U8JB 1UM5L 4JAMB 4TOYL 3U9PL 5BZDA 3Q0HA 1DBAH 1GHFL 1FFOA 4I4WB 2W65B 4MCYB 5HHNB 1WWWX 2IQ9L 4NWTL 2D7TL 4YDLB 1IC5L 1B4JL 1OAKL 1J1XH 4JGUA 4Z7QE 4KI5F 1QEWB 1CDJA 3K2UH 3BDXA 4R26H 3FQXB 1CDBA 4FQ2H 5LVEA 5K9QI 5E6IB 3LS4L 4GLRH 3MJ7A 4P23A 3SDYL 3VDCA 1TFHA 5FYKL 4LSTL 1H3XA 2FIKA 2EIZA 3MCKA 4P2RB 2GSIB 5CLTA 1ZLUK 3QI9A 2EDQA 3WS6A 2DTMH 1NC2A 3LH2L 1MQ8A 3D3VD 5FCUL 3E3QE 5CCKH 3ULVL 4OZFA 2WWMD 3QULA 3VFVB 4R96B 1YPZA 4LHUD 4P49A 4X5WB 1QNZH 5J57B 5SWQB 3PNWA 4OD1L 4HH9A 1H3VA 4ODTL 1N8ZA 2JJWA 1FC1A 2X09A 4XMPH 4CADB 1U58B 2GHWB 4U0RB 1RUPH 2F54B 5LQBL 2AXFB 1X5YA 4PJ5D 4MXQC 2OTUA 2CGRL 1OOAA 3IDGB 1JUFA 2Z91B 1GGIL 2FHFA 3IJHB 5CJ5A 1LDPL 4LASH 5EZOH 5IMKA 2QR0B 3O6LL 4ZO7A 5TDPA 1U8JA 4JAMA 4QYOB 5JXAL 2ITCB 5A40E 3TBSB 1S3KH 5DHVB 1BFVL 4I4WA 2W65A 4MCYA 5HHNA 4XWOC 5IWLC 2DQDL 3IGAB 3I75B 4FFZH 1WBZB 2E27L 4D0CB 3HAEH 5I0ZA 5B39B 1W72B 3G6JE 4U1KB 1QEWA 3V7MA 3MFFB 2ADFH 4K2UH 3QQ4B 1CZ8H 2EXYD 3FQXA 4N8PA 4BFIB 4BQ9A 4P59L 5E6IA 2EDDA 3UTSD 5I75C 3AM8A 2RJMA 3S3PA 1EXUB 5F72S 1OB1B 3U9UB 4P2RA 2GSIA 3MUJA 4Y19B 4Q6IB 3TNNB 1S9KC 1L9NA 3SKUD 3HUJF 2VLRB 1J7VR 3ULUL 3S37X 5ADOL 5FUCC 4G6KL 3VFVA 4R96A 1BX2B 4X5WA 2A9MH 4NHUB 5FYJU 5SWQA 4ZYKB 3OB0H 2W0LA 3QEHB 3BEVB 1KJ2L 3TA3B 1G7HB 4M5ZH 4WI9A 1QA9B 2KUTA 1LE9B 3LZFL 2V9RA 4FQIL 2A0LD 4CADA 3UZVB 4Q0XL 1QFUH 2LTQC 1U58A 2F54A 4JB9H 5I15L 2AXFA 1NGQH 2JTDA 3IDGA 4L8SB 2Z35B 4YFLI 2Z91A 3FT2B 3IJHA 4LDLB 2RCSH 1C12B 1O5DT 4H26B 2QR0A 2F8OA 1ZLSL 3AREC 2FHBA 3CH1B 4QYOA 1NUDA 3F7QA 2V5MA 2ITCA 3AS2A 5D1XB 3TBSA 4PP1C 2DLHA 2VABB 4PUBL 2M2DA 3G5ZB 1YNKL 3IGAA 3I75A 5E0QA 1GIGH 1WBZA 5MEQB 1TCRB 3MOQA 3PP4L 4D0CA 4OGZA 4H88L 1OP3H 5B39A 3EYOB 1W72A 4U1KA 4J3TA 3MFFA 4OFVA 2QKIB 4YHZL 3QQ4A 4HKJB 3LEXB 4BFIA 1A6AB 5C0AD 3ESVF 3EYQC 1EXUA 2UY6A 3CX5J 1OB1A 5FYKU 3PWPB 2FNBA 1MCCA 3AB0C 3U9UA 1CE6B 2VIRB 4Y19A 1D5MB 4Q6IA 3TNNA 1ZOXA 5GRVK 4CU8A 2VLRA 1NPUA 5E9DD 4XAKD 4TTDD 4IRSC 1BX2A 1YJDH 5TE4H 4NHUA 4OB5L 3RUGB 5D2NC 1BQSA 4ZYKA 3QEHA 3BEVA 4LEXH 1CN4A 1UACL 3TA3A 3QRGH 4UNVA 1G7HA 4JHWL 1QA9A 5K93A 5DSCB 1LE9A 5SWZD 1JPSH 5K9OB 4EDXB 2HFGH 3AREB 5EA0L 3VDBA 3GRWH 4NC1C 2YPVH 2AJVH 2XTJC 3OKLB 4L8SA 1B90A 2Z35A 3H3BC 3FT2A 5IWLA 4LCYB 5E2VL 1CDGA 1C12A 5HYJB 2NX5D 3O81A 4H26A 4MZ2A 3IF1B 3CH1A 4JZOB 5D1XA 1GC1H 4GQ9H 2VE6B 2VABA 1UC6A 1X5AA 3D3VB 3G5ZA 4HK3N 5MEQA 4XXCC 1TCRA 3OKYA 3EYOA 2DB8A 3MLVH 2JCCF 2QKIA 4HKJA 3LEXA 5EO1B 3ZLQC 3BT2H 3LPFA 1D5BB 3GM8A 2UZIL 1FE8L 3TYGH 1A6AA 4EOWL 4EQ3A 4FABH 5J12B 3GI8H 4APQD 4U6YB 1DQLH 2C7UB 3PWPA 3T2PA 1CE6A 2VIRA 4PJ5B 3WHE1 1AC0A 1D5MA 4J4PD 1KSRA 1RIVH 3Q3GB 3SGKA 3D2UD 4ZMAT 4OFIA 4BSVB 1RZJH 2A0LC 3QIUD 5H2BB 3RGHA 1QLRB 4KVNH 4N68A 1QLFB 3OR7B 3RIFK 3ZL4L 4GRLD 2KQNA 1SVCP 1UYWH 2YRPA 3RUGA 4HT1H 2E6QA 5IESL 2XTJB 2J6EH 3VMOA 1NCUA 1IGTB 4ODSL 1U8PB 5DSCA 2ZSVB 5K9OA 4AEEA 4EDXA 3OBAA 3GJFK 3NCJL 2BERA 2AERT 5IVZB 5E94B 5IK3B 1JNLH 1FH5L 3OKLA 2NLJB 4PJXF 5D2LE 3AY4A 2FH8A 3S35L 4IRZH 4LCYA 1MF2L 3UTSB 5HYJA 2APBA 1ETZB 4M5YH 3IF1A 4JZOA 1PEZA 2X6MA 1G9NH 4M62H 3VW3H 1DANT 2VE6A 3DXAD 3D3VA 4XVTL 2ZCLL 1J88A 3NA9H 4HIJB 4XVSH 2I60H 4M7KH 1OTUC 2Y36L 4HF5L 2W92A 4AENB 1S9WB 1P4IH 4YUEL 3UYPA 4DUWA 1WVZA 4P57B 5EO1A 3MA9H 4JO2H 3MV8D 4F37K 1CFQB 4WVRA 5MI0C 1JHKH 5E6YA 1D5BA 4MHHG 2GW5A 5KVDL 1FL5B 4N0YL 2R0WH 1F6LL 4U6YA 32C2B 4QOKD 2C7UA 3E6HB 5GGVH 2J1KA 5GPRA 4PJ5A 5IM7B 4OV5B 3LEVH 3Q3GA 5T1LD 1EJOL 1I3VA 3GHBH 4N1EA 1S7RB 1VESA 4BSVA 2E7LA 4LHQB 5H2BA 1QLRA 2XRAH 3O6FC 1QLFA 3OR7A 5T33L 1AR1D 1XAUA 4Z7QF 5HSFA 1IGTA 3MXVH 5CD5D 1U8PA 2MWCA 2ZSVA 3BZFB 5D8JL 2VAJA 4MQXC 3VRLE 3SN6N 5IVZA 1OPGL 5E94A 1MFBL 1J8KA 5IK3A 1MELA 2NLJA 3ZT6A 4LRIC 1HCVA 4RA0C 3VA6A 2XG5A 1AD0B 4G43B 4PRBB 3NCBB 2XA8H 4DQOL 4LCWE 2DMCA 4XXCA 5C0AB 1ETZA 3UTSA 5L6YH 3FQNB 4YXLH 1YEJL 1ZSDB 1TTGA 4ZODA 1LK3H 2V6HA 2NXYC 1T2QH 3QAZC 3MFGB 3ARSA 5TFSH 4BKLB 1KEGH 1FVDB 5I8KH 3AGVA 4M93C 1I1AC 4S10A 1A7PL 4ERSL 1N2RB 3IFLL 4Y7MA 1A9EB 3WE6B 2FLBT 4HIJA 5E9DB 1WK0A 1WITA 3EOTH 5T1MB 4AENA 3BE1L 4GH7B 1S9WA 5JOFB 2WIMA 4DUVA 1IGIL 3SGDI 4K7PY 4P57A 2E7MA 1CFQA 3OZ9H 2B2XL 2F5BL 4HXAH 3S8WA 3U0PB 3BJ91 2WANA 1FL5A 2HTLC 2ED8A 5I1EH 32C2A 3E6HA 5DD0H 5ESQB 5IM7A 4OV5A 1VB9A 1F4AA 4DWHA 3SO5A 3RPIB 3G08B 1JMZA 1S7RA 4ONFH 4YFEA 5DJ8B 5KJRL 5C6WH 4L8DB 4CAGA 1BEYL 1OARH 1FNSL 1A6VL 4DAGL 1XIWC 5ISZD 4HQQL 4Y89A 4JRYD 3BZFA 3TN0D 1MSPA 3O3UN 3JUZA 2OK0L 3QAZB 3C6LC 1ZHLB 3K7UA 4J7RA 5D7JD 1QYGH 2IGFH 2QADC 4M93B 1I1AB 1S5IH 3VG0L 4PRBA 1AD0A 3DSFH 4G43A 3ESUF 4QHUB 5I30H 1JN6B 5TH2B 5IB1B 2VLJD 3DGGB 5C0AA 1N7MH 4APQB 3FQNA 2FJHB 1ZSDA 4DGVL 3UAJC 4A2MA 4JKWA 4KI5D 4EUPB 3IFNH 4I5BB 5HHVH 3B9DA 3K3QA 4BKLA 5DHYB 1FVDA 1RURL 1M7XA 3VXME 4NNXB 3WUWG 5LGJB 4GO6B 1N2RA 3D2UB 1R5IB 4OTXL 1CLYH 1A9EA 3WE6A 5E9DA 3QIUB 5CEZE 5T1MA 3S96B 4N1HB 4GRLB 5JOFA 3WFDL 1YC8A 1KLFA 4PJCE 2E5EA 2IBBA 3E6FB 4K3GA 3U0PA 3P4MB 3U46B 5IFHL 4LVNC 5J0BA 3WLBB 3RWHB 4Z7VB 1AR1C 1X5XA 5F3HB 1N5YL 2QSCH 5E2WL 5ESQA 1ZKAA 5L9DL 2NY4C 4R0LC 2B4CL 1XIWB 2MMXA 4JFEE 3RPIA 3G08A 4OUOA 5CSBA 5DJ8A 5BXFB 4L8DA 3FO2B 1QPXA 4NC0B 3BISA 4XNXL 3T08A 2EXWC 3KJ6L 1YNLH 3DXAB 3E8UH 1YQ2A 4QRRD 3UTZB 4LARL 4PJFE 1G6VK 3H0TB 3S35X 4IJ3C 5AZEL 1MFDH 2EH8H 3DI2B 5HVFB 1NCBH 1NJ9B 2X44D 1INQB 2D0FA 1ZHLA 4NO0D 3MV8B 1I1AA 4QHUA 1JN6A 5TH2A 3QZWB 5IB1A 2V2TB 4OFPA 3DGGA 4APQA 4Y4KC 2FJHA 3WFBL 1J18A 3W9DB 5EC1B 3IXTB 1Q72L 4EUPA 4I5BA 5AEAA 4M00A 5DHYA 4J4PA 3W39B 3JWDH 4NNXA 5LGJA 5T1LB 3GMPB 4YBLC 3D2UA 1R5IA 1NH6A 3JTSB 2P5EE 4R4FH 3QIUA 3MCLH 4J23A 2F8VA 1IEHA 4JRWA 4M6OH 3S96A 3CSYB 3I9GL 2P44B 4GRLA 2YPLD 2Y23A 3QT2A 4R0LB 1BZ7B 5ICYB 2V5TA 2NY1C 2A77L 3E6FA 3R4DA 3P4MA 3BP6B 4R4NC 3U46A 3MUZ1 3C8HA 5AYUL 4XBPB 3WLBA 3RWHA 2XQBL 4Z7VA 2X4RB 5F3HA 5GZND 2J8UE 4G7VL 2IQAB 1WEJL 1XIWA 1RVFL 3G9AB 4HAFA 4ZUSB 5DMIL 3F58H 1T7VA 4KDVA 5CUSL 5BXFA 8CGTA 3FO2A 3DO3A 5GRUL 5I16B 2E9IA 3IDMB 1NLDL 3PP3K 3DXAA 4WFFD 3UTZA 3NIGE 3H0TA 4HBCL 3TM6A 1WLHA 3VXRD 2D7NA 2XI9A 3HE7C 2NZ9D 5I1LB 3FOLB 4X4XB 3RX7A 1WZMA 4PJIE 1NJ9A 4PYHA 1INQA 3RWJB 3QA3B 3MV8A 5EN2B 4LU5H 3F6IA 4K8RL 3QZWA 2V2TA 2OXGA 2AI0L 4OZGB 5I1IH 3W9DA 5EC1A 3IXTA 4QCIB 2HKHL 5HD8C 4PJHE 3W39A 5T1LA 3GMPA 4F33B 3IDUA 3U4AA 3JTSA 2J8OA 2X4PB 1OQOA 4GS7C 1RUMH 3CSYA 4ODUB 4DCQB 1T3FB 3GMQB 4R0LA 1BZ7A 5ICYA 5ISZB 2X4SB 4J1UB 5D2LF 3S9DB 1JGUH 3BP6A 2Q1EA 2IADB 4XBPA 3TN0B 2DQJL 1PD6A 2X4RA 3D87B 4JR9L 2IQAA 5D7JB 3T2NH 2WUCH 2CKBL 4DOHE 4UOW1 4ZUSA 1DANU 4PBWD 2VLJB 4MMXC 5DO2C 2VWEE 2VITB 4GBXD 5IB4B 4XHQA 3N9GH 5D4QA 5EDXA 5I16A 4TUKH 3IDMA 5T3XL 2B20A 3QCTL 1OW0C 3PQYD 1I1CA 1GGUA 4N9GB 4RGND 4G8GE 4YC2B 5I1LA 4XP5L 3FOLA 1YECL 4X4XA 4LIQE 1C1EL 1CLZL 3OKDB 2CO6B 2VR4A 5JIKA 3QA3A 3QSKB 3RWJA 2WBKA 5EN2A 1U3HC 3SGJC 5JTWA 4NQCD 4OLZL 1A4KB 4OZGA 3ZDYE 2JJSC 2DQIL 3Q5TA 4CMMB 5FEBA 2YD2A 4QCIA 3GHEL 2Q3AA 1FC2D 2GSGB 3QIBD 4F33A 5C3LD 1FIGL 2BFVL 2X4PA 5ACZB 2OL3B 4ODUA 5F70A 2BJMH 4DCQA 1T3FA 2F19L 3GMQA 1S7QB 5JZ7D 1OTTC 1JZ5A 4QRRB 5ISZA 2X4SA 4J1UA 3QIWC 4J3UA 4L9LC 2IADA 1CFSB 4JDTH 3MRMB 3TN0A 2YRLA 1INDL 1ERNA 1IQWH 3V52L 2BDNH 5H8DA 4OGAC 5D7JA 4QRPE 5BW7A 1AGBB 2AABL 4NP4H 1YN6B 3F6LA 1JF5A 2VLJA 3RU8H 2VZ1A 2VITA 5IB4A 1U93B 3FJTA 4CN4A 3GFUA 1A7OH 3RNKB 1DFBH 3G6DL 2V5YA 4OF6A 4JFHD 4B53A 4OT1H 1S5HB 5CILL 1U3HB 3KYKH 1KBGL 1T80A 1AY1L 4N9GA 1I85C 4M1CC 1FSKC 1FYTD 4PJ7F 3OKDA 4L3ED 1WZ1L 2AK1L 3HUJB 5EPMB 3GEWB 4POUB 1II4E 5SX5K 5A3IC 4EI6B 1BM3H 1A4KA 1IEAB 2DIBA 1HINL 2NYYC 5EUOF 4CMMA 3FQUB 4E0RB 5B39G 3BO8B 3SDCD 1KCUL 3CVHB 4F9LC 1U36A 1MVFA 2GSGA 3WSQH 1K6QH 1WQVT 4DN4H 5ACZA 5E8OB 3VD4A 3FL7A 3P77B 2OL3A 4I48B 2BCKB 1WWAX 2BSRB 3UX9B 3VFUB 1ZLWH 3EGSB 1S7QA 3MZTA 4M7LT 5I1CL 5F44A 4QRRA 4J3VA 4ZS6C 4KXZH 4M02A 1BFTA 5EU6E 4C4KT 1ZMYA 2A73B 4HS8L 1B0GA 1LO4L 4ELMB 1CFSA 2RGSA 3MRMA 3OXRB 2O61B 4TSBL 1EUTA 2P46B 2DKMA 2H2PC 1AGBA 5LGHH 3UBXI 4M03A 3K80A 1YN6A 2CSPA 4YDJB 1U93A 1F4YL 2DQTH 2VZSA 1FSKB 1I9EA 3RNKA 3C9NB 1KN2L 1JZ2A 3BZDA 1H3PH 2V9QA 2UWEE 3OPZH 4YHLH 1S5HA 1DL7L 1P7KB 1VGEL 1U3HA 1WAAA 3SGJA 2LAAA 4PJCF 2JJTC 3BW9B 2XQYG 3MV7E 4KTEH 3FONB 3S37H 3W81A 4NRYB 2JJSA 3VWKD 3OTTA 3HRZB 4NJ9H 3FN0H 4FNLH 3ARRA 4MCZB 1UQSB 3JWNC 3BOVA 3GMRB 3O2WL 3HUJA 3GBNH 1DSFH 2B8OT 5BQ7B 5EPMA 1AHWB 2FD6H 3C87A 4NUJB 4EI6A 5LCVL 3LRHA 1IEAA 2G5BB 3FN3A 3MRPB 6FABL 2MQ3A 4K55A 3FQUA 4WHYH 4E0RA 3BO8A 1J8HB 1EA9C 1HSAB 3CVHA 1R24B 3DNKA 4LSRH 3SKJL 5F7HA 3EYUL 2VDRH 4PJFF 1JGLH 1LO0H 4PJGE 5E8OA 4GBXB 4IDLA 3EJYD 3P77A 4O02H 4I2XE 4I48A 2BCKA 2BSRA 3VMNA 3VFUA 3GKWL 3EGSA 5CJBA 1U95B 1MQKH 1RMFL 2MCG1 4WEBL 2WV3A 4X98B 3PQYB 3K8LA 3LS5L 2H9GB 2BVUA 2A73A 5KAQF 4NN7C 4RGNB 3I2CH 4ELMA 3OXRA 1U8QB 2VC2L 2O61A 1IGMH 5ALBH 3UBXG 1EVTC 5EUKB 5JPNB 5I1JH 4XMLH 2OR9H 3OAZK 3MRLB 4AQ1B 4YDJA 4XHJC 1OWWA 1YY9C 3F7PC 4KHTH 5AAMA 5FYJH 2JCCB 2YRZA 4HLZG 4EIZC 3C9NA 4UV7L 1C7TA 2ORBL 5DJCB 1TETL 1P7KA 3S34H 4WI6A 3QIBB 3BW9A 4K23L 4TN9A 2VQ1B 3FONA 3UO1L 1IILE 4NRYA 1EGJH 3HRZA 4NGHH 5DMJB 4MCZA 1UQSA 3T09A 1J11A 5D9SB 4N90E 2J8UF 3GMRA 4HPYH 4WW1B 1T7YA 1AQDB 5BQ7A 1AHWA 4CVUA 5LKNA 3KLAB 1IZJA 3GSNL 3LKOB 4NUJA 4L29B 1N64H 2DWEB 2G5BA 3MRJB 3MRPA 4TOYH 2UY7A 3CXHJ 1MRFH 5MP6L 2AW2A 2DM7A 1QFOA 1GHFH 1I3RB 1J8HA 1HSAA 3BKML 1R24A 2XZQL 4FQPA 3NIGF 4JY4A 5DFVC 4GBXA 1K4CB 3WIIH 1Q0YL 2KL6A 1WTLA 4OCRL 4YZFF 4PJXB 1U95A 5H37G 2OP4H 4IBLT 4KK9D 4FQXC 4X98A 1U6AH 3PQYA 2R56L 1IT9L 2H9GA 4YE4H 5DQ9B 1U8QA 1NBVL 4GRWH 1FYTB 4LSTH 5EUKA 5JPNA 1ADQA 4L3EB 3U36B 2FGZA 2VXTH 3RZWA 4PJHF 5IFJB 3MRLA 5FCUH 2Z92B 4D94A 3M8OH 4JDZB 1L7IH 1GJIA 2JCCA 2R8SL 3SDCB 1XF2B 4W4OC 2XQYK 5DJCA 1ROWA 4HC1A 5B4MC 3QIBA 5LG1A 3W2DL 4M7LL 5IGXL 1CR9H 2ILLA 2VQ1A 5MHSE 5EU5B 1LEGB 3KPMB 5LQBH 5D9SA 4JREB 3UJJL 4WW1A 1AQDA 4RWYL 5ADPH 3KLAA 3LKOA 2BMKB 3M1BB 4L29A 3SQOH 2DWEA 3MRJA 3EJYC 3O6LH 1VPOH 2R69H 1KEMH 1P1ZB 3DECA 1I3RA 2HJFB 2YD7A 4HH8A 1BFVH 5GZOD 4FQXB 1JYXA 4UILH 1QBBA 3RVXD 1WFOA 5ID1B 4S1QL 1K4CA 5J6HB 3P73B 2AJSL 4PJXA 3O4OB 4MXWL 4LRNL 3TF7C 4P59H 4G7YL 5DQ9A 4KVCL 1Z3GL 3ZO0A 3ZDYF 1FYTA 4L3EA 5GGQL 3U36A 4K7PL 1JV5B 3SDXF 1UJ3B 4D3CL 2N4IA 5IFJA 1FP5A 2Z92A 3G6AB 1ACZA 5ADOH 4CRPA 4U05A 4JDZA 4G6KH 5HGAB 3VA2C 4IDJH 5BJTB 5D93B 2D3VA 3QISA 3SDCA 1XF2A 1NGYB 2P8PB 4U33A 4NHCL 1Z9LA 4JANB 4QHNB 2EIDA 3BQUC 4YBHA 3LZFH 1XF5B 4YGVB 1SBSL 1RIUL 4B7LA 4JHZA 1F8TH 4RFNC 5EU5A 1A7RH 1LEGA 3KPMA 3H9YA 1URLA 2A1WH 3QQ9D 4K3JL 1R3IL 3VFWB 4D9QE 1KCSL 2VDPH 2BMKA 1PG7W 2FB4L 3G6JB 5TE7H 1SJEB 1P1ZA 4XAWL 5EIVA 4ZFGH 1UXSB 2HJFA 4BSJA 3CMGA 3TT1H 4PUBH 4FQXA 4PY8I 1D7FA 4X5LA 5AWNH 5ID1A 4Z0XB 4H88H 5HYSG 1E6OH 2IC2A 5J6HA 4HLJA 4JO3L 2FL5B 3P73A 4M43H 1MHHB 4PJBE 3GSUB 5JHLL 1UA6L 1RJYB 2O5YL 4DK6A 4U1MB 4YHZH 5DF0A 2AJUL 1U8MB 1HN1A 2EDBA 1KCKA 1H0DB 1D6VL 4KUZL 3SE4A 4ZTPH 5E00B 5C0JB 2A9NH 3QG7L 3QDAA 2CR6A 3B5TA 1JV5A 1UJ3A 5CGMA 1UVQB 3BQUB 3G6AA 2OZ4L 3SQBA 2IPTL 3QHZH 3S88L 5EBGA 1F2QA 4WHDA 5HGAA 5BJTA 3WJJA 4RFNB 3NCYS 2QEJA 3TBWB 1NGYA 1CXLA 2P8PA 5D71L 4JANA 4W6XB 4QHNA 3VCLB 1JNHB 4AJ0A 2Y25A 4HGWB 4YGVA 1XF5A 3VFSB 4KAQH 5FIEA 3MXWL 3U0WH 1J0IA 2X41A 1DDHA 4N0CD 1NBYB 3O2VH 1CTNA 5TPWL 4XNQB 1GPOL 3RTQC 5IW3A 3VFWA 5IBLC 4L4VB 3CC5B 3FT4A 3G6JA 1FGNH 1SJEA 4RBPK 1UXSA 1JWMB 2BNQD 4QTIL 1ZGLP 1IAOB 2UWEF 3I3DA 3U7YL 5IR1B 3QEGL 4FFYH 4Z76B 4MB5A 1SHMA 4Z0XA 4XCNB 4Y5YC 5FYLE 1UM4L 2FL5A 3GI9L 1MHHA 3GSUA 3WIHA 1RJYA 2OL3H 4U1MA 4NQVB 4GXVL 4HWZB 1U8MA 1FIEA 2OLDA 1H0DA 4EOWH 2HVJB 1MHCB 1TVBB 1XT5A 4H20L 2C3VB 5E00A 5C0JA 5ESVB 5I8OL 2IALB 4OLXL 1NEZB 3WFZA 1EVUA 3UYRL 5FA4B 1UVQA 3BQUA 1CDIA 2FEEL 4PJGF 5CLWA 2FX8H 4CBPA 3TBWA 3D18B 2D2OA 2Y6SD 4S0TD 2UUDK 3VCLA 1JNHA 4HGWA 3VFSA 1YY8B 5IFAH 2N7AA 1QRNE 1I9RH 1KENL 3L5WB 2B1AL 3UZQA 2HTKD 1NBYA 1FH5H 3DVFA 3L3HB 1NCAL 4XNQA 4CUCA 3OF6A 3S35H 4L4VA 3ARDC 3CC5A 3CZJA 5IEHB 1L0XA 1JWMA 4GKSB 4MA8H 3B6SB 3HE6C 1IAOA 4XVTH 3RY5A 2ZCLH 3LQMA 5IR1A 3L5XH 1P7QD 2FX9H 1HYSC 4Z76A 2NNAB 3TYFB 4XCNA 5IJVB 3VGHA 3O9WC 3MTRA 1HEZB 1MCLA 3RVWD 5F96L 4YUEH 4ZAKC 1YEHL 4NQVA 3QUYD 3RWFB 3VXMD 4HWZA 1J1OL 3BRGC 2HVJA 1MHCA 4KHXL 2AXJA 2EDKA 1TVBA 2X4OB 5KVDH 2C3VA 5CEZD 3TO2B 5ESVA 5HYEA 3K4ZA 2DMBA 2IALA 1NEZA 3DYOA 5FA4A 5DD5L 1EJOH 5GGTL 3UTOA 5IMMB 3QQNA 3BD5A 2PF6A 3D18A 3OL2A 1A22B 5EB9A 4AIZB 3HC4H 5D2LB 4QHLB 2YN5A 4L8CB 4ZQKB 1TITA 1F3JB 3SDAD 1YY8A 3ORJA 1JZ6A 3NZHH 1JGVL 3VI3E 2FH6A 3L5WA 1MFBH 4L3CB 3L3HA 2Q87A 3BIBX 2E6JA 5FUOL 4DQOH 2HMIC 2VDLH 4KKBD 2E8ZA 5IEHA 3NOIA 3Q6GL 4GKSA 4XT1C 5DI8B 4AEIH 3B6SA 1IBGL 1A7PH 3ILQD 1PKOA 2NNAA 2VSDA 3TYFA 5IJVA 1CLOH 1HEZA 3A6BL 4U31A 1CXKA 4U2YA 4N8CL 1IGIH 5F88B 4YX2L 3VGEA 4O00A 3RWFA 1QSZA 3RKDC 3EJZD 1OGTB 4EN3C 2F5BH 2P5ED 3BKJH 4WGWB 2X4OA 3WDIA 4EDWL 3TO2A 3IS0X 1J5OH 3VFGH 1Y6KR 1H5BC 3SGDH 3TBVA 1E4XI 1WBXB 5IMMA 2AP2A 1F6FB 1T4KB 3EOBB 1KCVL 1BEYH 2YD6A 2WWKT 4AIZA 2F58H 1H3WM 3IJYB 1FNSH 1A6VH 5D2LA 4QHLA 4L8CA 4HQQH 4ZQKA 1F3JA 1Y18B 1KC5H 4D9RE 2D03L 1C5BL 4LCWB 5EOTB 2C26A 1UCTA 4P2OD 5CINH 4H5SB 3BMWA 3TGXA 3TO4C 4YDKL 4L3CA 5A2LH 5L8KB 3VG0H 1UWGL 3FO0L 5FO8B 3NCYP 1N0LA 2Y72A 1T89A 3MLWH 4PREB 1TNMA 1CDYA 4GG6F 4LVOB 5DI8A 1AXIB 4C4KO 4DVRL 4AIOA 1NGXB 5F1IB 5JOPE 2D0GA 3WEXB 5EFIB 3RVTD 4NOBA 5D7SL 4PJ7B 3DBXB 5F88A 2AGJL 4BFBD 1H5BB 3O0RH 5F93C 1VFAB 1OGTA 2IWGA 2DTSA 3NMEA 4POYA 3TZVD 3QDMB 2UZXB 1CIDA 4KY1L 5TF1H 3CFCH 3V9FA 1SY6A 4R7NB 1A6ZB 5L9DH 2B4CH 1MAJA 5C2UB 3THML 1WBXA 5I17B 4WI5A 1T4KA 3EOBA 1MCEA 5CJXC 1TCMA 5AUMB 3IJYA 4PJBF 3KJ6H 3TO4B 3U1SL 1ES0B 2FHCA 1T83C 1Y18A 4N9OB 4LCWA 5EOTA 1K5NB 4PJEE 1PSKH 4H5SA 4XX1G 5EU4B 4WUUE 3VFMB 3FO1B 5D72H 3QUYB 3VXMB 1MNUH 2VN7A 2MHAB 3HZMB 5FO8A 5HPMB 4L1HA 1IKNC 1GOGA 3TIEB 1PG7L 3D85D 2QLVB 4Z0BH 2H2SD 1NGXA 5I18H 5F1IA 3PWLB 4PJCB 3C08L 3WEXA 1AO7E 5EFIA 2ZUVA 1MREH 1KB9K 4I77L 2HVKB 4PJ7A 4BQBA 2QQKH 3I9GH 4XPFH 4HJGB 3DBXA 1QFWL 1YEEH 4K9EH 1GL4B 4JFEB 1H5BA 4YHYC 1VFAA 2GJ6B 2A77H 3IDJB 1E28B 4Y8DC 1NCDL 3QDMA 4XPBL 3G5YB 4R7NA 1A6ZA 5IBUG 2J4WL 3MLZL 1F58L 4JY6B 1WICA 1RVFH 4PJFB 3O4LE 4KJPD 5CGYD 4FQJL 5I17A 3AS3A 3N85H 5HI4D 3ILPB 5J1TC 2NY6C 3EYSL 1FAIH 5GRUH 1ADQL 1NLDH 5AUMA 3TO4A 1ES0A 4QRPD 5C6TL 3BWAB 4HBCH 3H9SE 2AK4E 1U8NB 3EO0B 4LLUB 1DQJB 1CBVL 2B1HH 1EEUA 4JY5L 1K5NA 3BZ4B 5EU4A 4UB0L 1A47A 3VFMA 1BECA 4HC1L 3FO1A 1CTOA 3QUYA 3VXMA 2HT4D 3MLSL 4K8RH 2MHAA 2ID5A 3HZMA 1RY7B 5HPMA 4WHTB 2DDQL 5E08L 3PXHA 3TIEA 5A2JH 2HKHH 2GQHA 1TJGL 1JPTL 4LQFL 3PWLA 4PJCA 3LQAH 3CVIL 3QUZC 1RHFA 3KS0J 3RZCD 1RZGB 2HVKA 2OS7A 1JP5A 4IIQB 1R5VB 2Q8BL 4O5LH 2J8UB 3HFMH 4HJGA 5C71A 4JKLA 4JFEA 5DMGD 3ZMRA 3QHFH 5ERWB 1F00I 2YMXL 1RUQL 3IDJA 1E28A 1F97A 3L3IB 1NCWL 1SMOA 3G5YA 2DQJH 4P2OB 5CJXA 3V8CA 1NMBH 3DHJA 5EOCJ 4JY6A 4PJFA 1T83A 4KTYA 2CKBH 1JWSB 3I6KB 4JPWH 5EU6D 4GAJL 1KB5L 2RR3A 3HLAB 3ILPA 3BYTA 2CLZB 1KXVC 3V4UH 2QBWA 3TT3L 4PJIB 1OSPH 3HNTL 4P5KB 3BWAA 4WWKD 1X7QB 3NGBC 5BS0E 4D0DB 3IRPX 1U8NA 3EO0A 4LLUA 1DQJA 1IGFL 1P84K 3BZ4A 1T03L 2H2SC 4PJHB 3BRFA 4RISH 1HKLL 3MV7D 1W0YT 4OLZH 3TZVB 3DMMC 4WHTA 3UMTA 4U1GC 4NZTL 3ALWA 1DN2A 4PRPE 3EHBC 2X89A 3S3SA 4PB9L 5DQDL 1RZGA 1QFHA 4X7DC 2GY5A 2YZ8A 3CU7A 1NAML 1R5VA 4IIQA 1YC7A 4OQ1A 2J8UA 2XV6B 5MEND 2F19H 5B38B 5E70A 3P4LA 5ERWA 4DOHB 3L3IA 4Y4HC 3JWOC 5HPOA 4NBZB 4P2OA 5K9KB 4OCYL 3SE3C 1EHLL 1PAMA 4JM4L 4CNIB 1OGAE 1QSEE 3SY0B 2XN9E 1JWSA 5CAYB 3I6KA 2EH7L 3HLAA 3P0VL 3UC0H 4FN0A 4G8GB 1ZANL 2CLZA 2PXYD 1N5AB 2NY2D 4PJIA 3D85B 4YPJA 4X80H 4WNQB 3D9AL 4P5KA 2NPLX 4WW2C 1X7QA 4GAGL 4D0DA 2JKXA 3BPNC 3MA7B 1AY1H 4KJWD 2XZCH 5J3HC 1ZA3B 2RB8A 1GXEA 1CXEA 2JF1A 4PJHA 3H7LA 3IETB 1ODAA 3EDDA 1FYHB 1CU4L 5KVMC 3D69B 5JW5B 3TZVA 3LKNB 4NQDD 5HDBE 5L8LB 2VRAA 1MIMH 5JQHC 1KNOB 3BD4A 4S1SH 1ZHBB 4N90D 4JE4B 1A64A 1G6RB 4JPVL 4ZUVB 3EFDL 3BDBA 1HH6B 7FABH 1JYNA 2B7DT 3WCYA 1DBBH 3CFEB 3ETBF 3O3BB 5E56A 4DFHA 4FG6D 5I9QC 5IVXE 1RZ7L 1T7XA 3V0VB 5B38A 1AI1L 4QRPB 5KOMC 5DRZB 1XGPB 1JPFB 2MNUA 3SKNB 1PKQE 3S36L 2X40A 4TSBH 5BRZE 5K9KA 1Z9SA 2CK0L 2PNDA 3B3IB 4CNIA 2NY7H 3SY0A 3BPLB 5IB3B 1QBMH 1KIQB 1WFTA 2JB5L 3BPNB 1RJLB 3GMLB 4G8GA 4KC3B 4P46C 4OLYL 1DZBA 4LSVH 1N5AA 3D85A 3ZDXE 4WNQA 3BGFC 1BQUA 4IM8A 3RQ3A 1FL3B 3RZCB 3MA7A 4OLUL 1FGVL 2E9BA 1ZA3A 4GSDH 4PRIE 4PJDF 2E9WA 3K8MA 2LU4A 4JZJC 3IETA 3QEQE 4MNGE 1A8JH 4NZDA 3BP7B 5LBSL 3D69A 4HLZH 2NR6D 3SHSA 5JW5A 5MHSD 3LKNA 1ZTXL 6FABH 1UWEH 1KNOA 2AEWA 1J87A 5CSGA 1ZHBA 4NNPL 3MNZB 1YMME 1G6RA 4ZUVA 2H26B 3ZKXC 2OJZL 1TVDA 1HH6A 5FGBC 3MJ8B 3TWCH 1KJVB 3CFEA 4ZTOH 1LGVA 3PL6C 2H41A 3TFKC 2XACC 3P4OB 1AGEB 3V0WH 1EHNA 3V0VA 2WBJD 5D1ZD 4QRPA 1RMFH 2QQLL 3C5ZC 4HEME 1A6WL 3GO1L 4WWKB 5DRZA 4WEBH 1XGPA 4Y16D 5CJQH 3LS5H 1JPFA 1WT5A 1MFCL 3DVNB 2BSTB 3IDXH 3SKNA 1UXWB 1J0HA 3FB7B 3NA4A 4QRSB 3R1GL 4WFEE 3B3IA 4YWGL 1CF8L 2UWEB 5GJSH 1KN4H 2DIJA 1VHPA 5C0BE 1EO7A 3UDWA 5IB3A 3MV7B 5M7QA 1CT8B 2QHLA 2VH5H 5B3JE 1RJLA 4Q97A 3GMLA 4W70A 4LPCA 3LDBC 5H37H 2X9XA 5C9KA 2OCFD 4GW1B 4Y4FC 1AFVL 4JZJB 1TETH 1YNTB 3HMWL 3RL2B 1FL3A 3RZCA 1LEKB 4K23H 1OM3L 5JNYB 3CXDL 5T5NF 5BV7B 2FATL 3X3FL 5IIEB 3RPKA 4LNRB 4LFHD 3P0GB 3TVMD 3FQTB 5JQ6H 4FA8A 5HYFA 4OQTL 3BP7A 2MQ0A 3QNZB 4HWBL 4PJGB 3GSNH 1A1NB 5EBWB 4I2XB 3PL6B 4XNYL 1TZGL 4HHAB 3MNZA 5GRZA 3LCYA 2XZQH 3G5VB 1A3RL 2H26A 3BSZH 3C5ZB 5F8RC 5FUZL 3MJ8A 1KJVA 1ZVSB 5C0GB 3P4OA 1AGEA 2Z4QB 3T04D 2J12B 3MGAA 1HSBB 3HNSH 1F02I 4WWKA 4KJQD 3ARPA 4A2LA 1TTFA 3DVNA 2BSTA 4FP8L 1UXWA 4HKZB 1T5WB 1JE6A 3KPTA 1JTOA 3FB7A 1D5IH 4JO4L 4UBDC 4GMTL 3LDBB 5D1QD 4RBPH 4QRSA 3NIFE 3U2SB 2UWEA 4EIGB 1FBIH 1BF8A 2FBOJ 5HY9B 3GSXB 1IZKA 1WWBX 3EO9H 1IKFL 3MV7A 1CT8A 3ARTA 3PGFL 5B21A 3OG4B 3W5NA 2EDEA 5GRYA 4M4RA 4K3DH 3V6OE 1AQKL 2HJKB 4GW1A 4JZJA 1OTSD 4I3RH 5C07E 1YNTA 3MPCA 3RL2A 1AR2A 4M7LH 5IGXH 1LEKA 2NR6C 5JNYA 5IIEA 2ICWI 2BZDA 4LNRA 2MSPA 4E9LA 3UJTH 1K85A 3FQTA 3UJJH 5C7XL 3CK0H 4PJGA 3QNZA 5FGBA 4RMSA 4G9DB 1A1NA 5I1KL 5EBWA 4I2XA 3PL6A 1NMAL 1N4XH 5CEZH 4CDGC 4HHAA 4KKLC 3PGCB 3G5VA 3C5ZA 4LPYA 4S1RH 3BXNB 3KLSA 4S1DC 4YHPB 5F7WC 3MLRH 4P2YA 4S1QH 3VGAC 1ZVSA 4FFVC 4PS4L 5C0GA 2Z4QA 2AJSH 3DOSA 2IMNA 1HSBA 1UGNA 4LP5A 2D7OA 4K94C 4UZGA 3V4VL 4G7YH 1YEKL 1T5WA 4HKZA 1KV3A 2EDOA 2XFXB 3QPQD 4TVPL 5IHZB 4HZLB 2QQQA 3U2SA 5T3ZL 2GYSA 3RAJL 3DROB 5HY9A 3GSXA 4LPUA 1F90H 1LK2B 3HMXA 1P53A 3MODL 2EE6A 2OTWB 2W9EH 5CBAB 4G6JH 3MV9E 3O6MH 1Q9OB 1G1YA 2HJKA 4NCDA 5KSAD 3AMKA 4G6ML 4OLWL 1JI2A 1M7DB 5CIPH 4J3SA 1A7QH 1SBSH 3GB7B 4HIXH 1RIUH 4YHKH 3B2UC 4QXGH 5BOZG 5C3TA 2VL5B 3MBED 3OQ3B 3V5DB 4TNWF 4ZDHB 5D1ZB 1L7TH 1R3IH 3UTTE 4Y16B 3LAFA 4G9DA 3VGAB 3M45A 2CJUL 4OCLC 2X4TB 2DI8A 2CDEB 4AG4H 4QNPF 4YBQC 3ARVA 4NQSB 3SKOB 2IEPA 3PGCA 1CGXA 3FAWA 4Q9RH 3CJJA 3NIDF 3BXNA 1JZ4A 3LKQB 1WWCA 4YHPA 3I02B 4MB4A 1MVUB 3T3ME 3OKNB 5JHLH 5CMAB 5DJ0B 2BSED 1IM3B 1GOHA 1YEGL 2C1OB 2VLLB 4WJ5B 2G60L 4UQ3B 5DYOB 5E99H 4XPAH 3K46A 4O2EB 4LCIH 3LPGA 3IFPB 3B9VA 5HDBF 5C08E 2XFXA 1SVZA 2PKDA 5IHZA 4HZLA 4QXUL 3MLXH 3TVMB 3VFOB 3DROA 2VLKE 4HIEB 4UV4H 3KLHC 3TH3T 1LK2A 5T1KD 3S88H 4FQ1L 5KANG 1G84A 2B5IC 2OTWA 1DBKL 5CBAA 1PLGH 4G3YH 1Q9OA 3I3BA 1RIHH 3WXWL 1NFIB 2CUIA 2BY0A 2DQFB 4L5FH 5DFWH 5KSVB 1M7DA 4XI5C 3INUL 4MAYD 4XGZB 4C58B 3GB7A 4YDIH 3C2AL 5BOPA 2AJ3B 1WV7T 2VL5A 1UM6L 4M7ZB 3V5DA 2DQGL 4ZDHA 5D1ZA 5I6XC 2F74B 1BP3B 5TPWH 4Y16A 5EZIH 1LDSA 5F6IB 4UTBH 3U7WL 3VH8B 4KDTA 1CXFA 4OSUH 5D1QB 2X4TA 2CDEA 5E8NB 4PJBB 3OWEA 4QTIH 4NQSA 5LXGL 3SKOA 4UNTA 2APTA 2BX5A 5E2UL 4TQEH 4LSPL 5C0IB 3U7YH 3LKQA 1FL6B 2DQEL 3I02A 2X7LB 4I0CC 4YO0B 1MVUA 2KDGA 3OKNA 1KIPB 2C3WA 4CVZB 1UM4H 4X7TB 1KIUA 2B39A 5CMAA 5DJ0A 1A0QL 1IM3A 2IBZY 4DGYH 2C1OA 2VLLA 4WJ5A 3CX2A 4UQ3A 3T0VA 3EYVB 5DYOA 4MA1C 3GBML 5J11B 4H20H 4O2EA 2O5ZH 3KPSE 3WD5L 3IFPA 2J5LC 4KQ3H 3UTPD 4MJ6B 5CD3B 4PLKD 3WNNA 4OLXH 4J6RH 3TVMA 3UYRH 2ICES 3VFOA 4K3HA 1HCFX 1U91B 1ZK9A 2LE9A 1U0QA 4HIEA 2Q7NA 3RGVD 3PV6B 1VDGA 4YQXL 1ZHKB 4N1CA 1EO8H 4E41E 1FNFA 1DQMH 3KYAA 2BC4B 2Y7QB 5I6XB 1NFIA 3FMGL 4WU7B 2FWOB 1F42A 2DQFA 5KSVA 5FF6B 4MVBD 1NAKL 1OAYH 4XGZA 5F7FA 4AEFA 2R2CA 2ITDB 3LHPH 2AJ3A 5I1DB 2B1AH 1X5FA 5DVLA 3HC0B 2F74A 4QRTB 1LWRA 2YSSB 1TLKA 4D9RD 1GGCL 5GGRY 1NLBL 3VH8A 1C08B 3HG1E 4QY8B 1N6VA 4X9HA 5DUBB 3O8XC 5D1QA 3GIZL 1WC7B 4HMCA 1MCWM 5E8NA 1V7ML 4PJBA 4JFPB 3NACL 1BZQK 1GRWA 1JYWA 5C0IA 1K8IB 1FL6A 3B9AA 4YO0A 2X7LA 4R7DB 1R0AL 1TQCC 1KIPA 4CVZA 1C5CL 4X7TA 5IW1B 1PW3A 2W07A 1R6VA 5KSAB 2FGWL 2GIYA 5E03A 5JOPD 1J1OH 3EYVA 4PRHE 3QFDB 1MLBB 5F3BB 5C0FB 1JI1A 4BUGA 4MJ6A 5SWZE 5CD3A 3MBEB 4HFUL 3S5LB 1DR9A 2R9HC 1MRDL 1U91A 3CUPB 5DD5H 2D7QA 5KVFL 5GGTH 3PV6A 1E4JA 2ADGB 5KAQG 2E3VA 1ZHKA 3ZE2E 5FDWB 1QRNB 2YBRB 5E4EB 5FECB 1NKRA 2A38A 3SJVE 3MLUH 2CUMA 4X6CE 3K4AA 1IC1A 1U9KA 2BC4A 2NX5E 4MS8C 5FYJE 2Y7QA 3RFZC 1A1OB 4XP1H 4WU7A 2FWOA 3GNML 5L7XL 5FF6A 3PF2A 4R2GD 3AU1B 2VZ3A 3Q5YA 2F53E 5SV4A 2ITDA 4OM0L 5I1DA 3HC0A 4QRTA 4KKCD 5EOQL 4XP9H 2YSSA 5FUOH 2P49B 4FZ8L 4PV9B 5CFHA 4K07A 1XH3B 1C08A 4QY8A 5DUBA 4ENED 1FRGL 2MTPA 1WC7A 4FXGB 4JG0L 4WUUD 3BDYL 4JFPA 3TJHC 3ROLB 2M26A 1IBGH 4JQIL 5KBNC 1K8IA 5E6ZA 4R7DA 5T1KB 3Q1SL 2WLYA 1S7WB 1HHIB 1KPVB 4ZXBC 1MCQA 5IW1A 3NCMA 4KH2A 3TPUB 4N8CH 4B0MM 4ONGL 4U3CA 5KSAA 1TQBC 25C8L 1AO7D 3QFDA 1MLBA 3NFSH 1IAIM 3RGVC 5F3BA 5C0FA 1J0YA 3HI5L 4KDWA 4MAYB 4OM1H 3KPOB 4JRXB 3HCVB 4C83B 4DGIH 3ARFD 3MBEA 4V1DE 5J13C 3S5LA 1DJSA 4GRWE 3BIKB 3CUPA 1VACB 5L8JB 4MNQE 2ADGA 2ERJB 1X5ZA 5C0CE 5FDWA 1QRNA 2YBRA 5FECA 1KCVH 2AEQL 3ULVE 1A1OA 3EAKA 2EZ0D 4IOFD 3O4LD 4RRPG 3RHWF 2GK2A 4X6DE 4XCCL 3AU1A 2HT3D 1BHGA 1E4XH 1XGQB 3ALXA 3PG2A 3HI6L 3QDGE 4WV1C 5FHAH 5JDJA 3LY6A 2BY3A 4UI2A 2ZUQB 4YHOL 4PV9A 4PJ9C 3H9SD 1Q9LB 1I8LC 2AK4D 1XH3A 4YK4C 3U4BL 4FXGA 3FB5B 4HCRA 1U2CA 4ZXBB 4LK4A 4U6VH 4DVRH 3ROLA 2Q8AH 5HHOE 1MJUL 2CLRB 3MJ9A 4QOKE 4KROD 4XVUD 3SEPA 3RGVB 5IMOB 2NY0D 4F57L 5T1KA 3RUGF 2E7BA 1ZXQA 4HWNA 1S7WA 1HHIA 1KPVA 5ANME 5DD1L 3TPUA 1LMKA 5J13B 2AJXH 4PG2C 3SO3C 1EFXD 3K1DA 4KMTL 3JWOL 2NZIA 4MAYA 1FFPB 35C8H 3KPOA 4G8EB 5HGGS 4JRXA 3GK8L 3HCVA 4HFWB 4JCLA 1S78C 4C83A 3ZTNL 4FFWC 3BIKA 3K81A 3BZEB 1VACA 1S9YB 3FAXA 1NCCH 3RVVC 4UT6L 4LLAA 4WI7A 1AJ7H 4WFHE 3ULUE 1BJ8A 3V79C 2DLTA 3MRIB 4WCYL 3OJ2C 1P4BH 4WV1B 1KULA 2YD5A 4H0GA 2BVEA 4F58L 1R3JB 4O4YH 4P9HC 3MC0A 3OKMB 3H42L 4H1LB 1UB6B 3GM0A 1XGQA 2GK0B 2VYRE 4KQ4L 2KKQA 4O2FB 4HWEL 1KYOJ 4D8PA 1HK6A 4QRUB 4HW6A 4YXKL 1XZ0B 5LWYH 3VFNB 4XPGH 5KS9E 3B5HA 4ZNCD 3ZYIA 4DN3L 5BS0D 4LSSL 5L88L 1BFOB 1Q9LA 1WIPA 2ZCHL 1VFUA 2N1KA 3NFNB 3FB5A 2R1WB 5TDOB 1DQTA 4EJ1C 3FRUB 1ZGLB 4ZXBA 4F9PC 5K59E 3Q48A 4U7SA 2CLRA 4ZFZB 5FB8B 4KFZC 4OGXH 5IMOA 3RGVA 5BMFH 2IFFL 3N1FC 3DUSB 3KLDA 1FDLL 3KPRE 3TLRA 2KPNA 3BKCH 4OBRA 2EDJA 3EDKA 1SEBB 4JG1L 3OAYK 2R4SL 1FFPA 3BWUC 2ENSA 4G8EA 4R2GB 1NCDH 4HFWA 4NBXB 1KFAL 2QHRH 4JRYE 2WSKA 5F9AC 5DWUL 1T6VN 4H25B 2J4WH 3MLZH 4XP6H 4IOFC 3BZEA 1EMTL 1JTTA 1T7ZA 3H6JA 5DR5L 1JYVA 2E9JA 2R1XB 4DKDC 3MRIA 4PJEB 4WUUB 1YJDC 4WV1A 4TUJB 4C56E 4PFEA 2IH1B 4M48L 4F15B 1E4WL 1OGAD 1QSED 2XN9D 1R3JA 2AXHA 1NUFA 3OKMA 4H1LA 1UB6A 4G6AC 1I8LA 1CG9B 2GK0A 3CDGB 2ZG2A 4XTRD 1AKJD 4O2FA 4TSCL 3AXLB 4QRUA 4POZD 4OIBA 4N8VG 1H3UA 1XZ0A 3KXFE 3VFNA 1PEWA 4JGMA 2AJYL 3P40A 5DJYB 5JXEC 1AO7B 5FO7B 3BH9B 1GVIA 1BFOA 2K7PA 2ZJSH 3DUHA 3CSGA 3NFNA 5TDOA 2R1WA 2DDQH 1JJUA 3FRUA 3ARFB 1ZGLA 5DJZB 1TJGH 1GC1C 4PJ8D 3KNBB 4MJID 5EZJB 1IC7L 4PPTA 4ZFZA 5FB8A 3A6OA 5AG8A 4OCXL 2AV7A 2GUOB 5HHXL 3MRDB 3DUSA 4QXWA 1PZ5B 3CPLB 5DRXB 1B4RA 4WI8A 3O4LB 1SEBA 3RBGA 1CICC 2YMXH 3QCUH 2DLIA 2ADIB 3W11D 3X3GH 2XWBB 4BELD 3FZUC 3MOBL 4H25A 4M6ML 4PBVC 5A1AA 5GHWL 4H0HB 5EOCL 3MRFB 4U1HB 3H9SB 2AK4B 2WW8A 5I1HH 4LLDB 2R1XA 5BRZD 4C55A 4PJEA 5KSUB 4WUUA 4TUJA 2L7JA 5IHBA 3HNTH 2K1MA 4HJ0D 2IH1A 1UCBL 1VCAA 3KR3L 4ZS7L 2X2YA 5ENWB 3NN8B 2NY0B 2VLME 1AE6L 3L6FB 4YDVB 1CG9A 1F3DH 1IGFH 3CDGA 3AXLA 3VXSE 4XB7A 1I3UA 1MCRA 4LSQL 1EFXB 4OI7A 5DJYA 1AO7A 5FO7A 4QT5B 5DFTA 1I1RA 3BH9A 4P5TC 2YPLE 2YA2A 1AGFB 4UT9L 1E6JH 5BVPL 3CLFL 3QH3B 3ARFA 3ZE2F 4PRID 3WNMA 4YH6A 5DJZA 1G9NC 3N1GC 2FZ3B 4X6CF 2HFFB 3KNBA 3N1MC 3MLYL 2J7LA 2WMPA 3I3EA 3QEQD 5EZJA 1X6LA 4YHNB 4NKOB 5JW3L 2ZUTA 1ZS8B 4KK6C 2GUOA 1UWXK 1I9IL 1VSCA 3MRDA 4OF5A 4RGMC 2V17L 1WIUA 1PZ5A 1J0KA 3CPLA 5DRXA 2AKRB 1YMMD 4DKFL 3O4LA 5I1GH 2BHYA 4TULH 2YWZA 2ADIA 1IGYB 3GSWB 2XWBA 5T1DL 3PDOB 4JGJA 1EHLH 4JM4H 4M8VA 3WDJA 1MCPL 3MRFA 1F45A 5BS0B 4U1HA 4XCFL 2EH7H 3H9SA 4HGKC 2AK4A 2OMBA 3P0VH 4LLDA 1W8OA 1ZANH 4BFEA 4TVSa 5KSUA 3IXAB 4WFED 1RZFL 1K9TA 4S2SB 3GRWA 4GMSL 3D9AH 1G9MC 5C0BD 1KJ3L 3HN3A 4Y2DC 2HRPH 5JR1L 5ENWA 2R0LH 3NN8A 2DOCA 4IEFB 3KGRA 3L6FA 4YDVA 2GTZB 3TH4T 5GS0C 1C7SA 4NWUL 4NZRL 1QOKA 4PRPB 4X7SH 3SDDD 4G80B 4UT7H 1EFXA 1R3HB 5D96C 4QT5A 4Z7VF 1TJHH 2Z93B 1AGFA 3BN9D 3PABB 4C59B 4OD3H 4CL7A 3D0LB 3RWIB 3QH3A 4RGMB 2BY2A 5FK9B 4LLMB 4U6HB 3X14B 2FZ3A 2HFFA 4YHNA 4NKOA 2YUVA 1ZS8A 5IEKB 1FCCA 4X6DF 2J88L 4UAOC 2ZG3A 1RZ7H 1QO3B 5GGVY 2AKRA 3KYOB 1JNNL 4K94L 1WIOA 1HH9B 1OGAB 1QSEB 2XN9B 1MHPL 1UZ8A 4BQ6A 3L3KB 4WO4D 1IGYA 1P4LB 3GSWA 2VO5A 1AKJB 3VD7A 3PDOA 3NAAL 5BO1L 2CK0H 4MLIA 1YYMH 1HZHL 1NC4D 2OM5A 2J6EA 4Y2DB 5BS0A 2VXVL 3QI9C 2MCPH 3WS6C 4Z7UE 5HI3C 1TJIH 3IXAA 12E8L 4TRPH 4R8WL 2AAVA 4S2SA 4PJ8B 4FQCH 1BWMA 2GTZA 4L4JA 3CGTA 3NABH 2QTEA 5GRJL 3R8QA 4O58H 4HD9A 4PRPA 4HPOL 4G80A 5JW4Q 3S6CA 4ZO8A 1R3HA 3LB6C 2PO6D 1A3LL 2Z93A 3EDJA 5LBSH 3PABA 4OIIH 3D0LA 3RWIA 1FV1B 5FK9A 4Z8FH