1FL5B

The unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGSYAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4
publication title A comparative analysis of the immunological evolution of antibody 28B4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 219
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl5B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl5B01
2DICA 4ALAH 3HMXA 4ONHA 4A2MA 2F8XC 5DR5L 1ZA6B 1WFTA 4JHWL 4AH2B 2QR0B 1RK0A 4D0BB 5DQJB 5FO7B 4AK1A 4KRPB 5BOZG 5AUMA 3BE1H 4HFWA 4P23B 4ZNEE 3L5HA 5TE7H 2O61A 3QUMA 1Q94A 4M43L 4ELME 2IFFL 2R0WL 3TA3B 4Q9QL 2BY2A 3TFKC 1BLNB 3C8KA 3D39A 2EO1A 1HHGA 3SBWC 2X9YA 2DQEH 3O0RH 3K81A 1BF8A 5DHVB 3C2SA 4G9DA 4UAOC 4ZFZA 4M7LL 4WY7L 4DUWA 3RWHA 3T0EE 2FH6A 4U33A 4TVPD 1NCBL 2KL6A 5FYLE 2XPGB 3MLTB 3AMKA 2CLVB 3HC4L 3WIFB 3RI5K 4L3CA 4MD4B 3FT4A 5J12B 4IRJA 3FQUA 2YN5A 3GSUB 5C0BA 4NSKA 4UOJA 3GMNA 5GRVL 3FB6B 3MV7B 1IARB 4XI5D 2I9TA 3K4AA 2R2EB 4DCQB 3FO1A 1EFXA 4YHPA 2XWJA 5DFVC 3FQXA 2IQ9H 5DLML 3MRDB 4ZO7A 3GUTB 1EVTC 5SX5K 2CD0A 1QYGL 1LQSR 3SKUD 4NBZB 3UO1H 5CZVH 4CKVX 1BECA 4YFLF 1RUQH 1TZHB 3U79A 5E94B 1CFSB 3C60C 1KPVB 2OSLA 3BN9D 4IHOA 4P99A 5IGXH 1AD0A 3QJHB 3IDYC 1WFOA 1AGCB 4Z7OE 1KUMA 1W0VB 2UZXB 4DOHE 4RQQA 4KRMB 4HT1L 4E9LA 2V5MA 4L9LB 1A4JA 3NVQA 3P0VH 5I8EA 3RZWA 2E7HA 1JTOA 2F5BH 4J1UA 1CD1A 1LP9B 2NMSA 4K3JH 2WINA 5D1ZD 4OIIH 3N06B 1WCBA 4HK3J 2OTWB 4NFBA 1JGDA 1MFCH 3MV11 3MRFA 2ZWLT 4K7PH 1PBYA 2KQNA 1MLCB 3PWNB 1Q72H 1IGYA 4MQXD 3ILQC 1A14L 5EIIA 1Z9LA 2FJHB 2OTUA 4UINL 4J4PD 3ZHLA 4RNRA 4UILL 3T2QA 2O26U 1GGYA 3T0WA 3ZT5A 5ALCL 3H6JA 1R5WA 2OI9B 3WJJC 3JV5A 4QF1A 3T3ME 1HHJB 3BWAB 3GIVA 3QDGE 2GY7B 1G9NL 4KZDH 4PS4H 1MH5B 3HZYB 5I17B 5GS0D 4YO0B 1FGVL 5CGYC 1NCNA 4OKVA 5HDLA 4ZUUB 3L3OA 5IEHB 1Q9KB 1F8TH 3WIHL 3SKMB 1CDGA 5HHOB 3P9LA 2ADIB 4U0RB 2KPNA 1ZXQA 2OR9H 4YX2L 2NY4C 4DK6A 3KXFB 3VG9C 4LSTH 2MQCA 5HHMB 4MNQB 5I8KH 1VFUA 4K9EH 4NOBA 4HC1H 1M7DA 2JELH 1MIMH 3LQZA 2OCFD 1MVUB 4FQJH 4GBXB 4AG4L 5A2JH 3MV9B 3BYTA 1KJ2B 4QNPF 1JF1A 4UQ2B 3R1GH 4V1DA 3T2NL 4F37F 1T22B 1A5FH 2VITA 4WJ5A 3WMSA 4DUXA 4K23H 3B3IB 2IGFH 2Z9TA 1RURL 1F5WA 1KCSL 3T0XA 3SKJH 3IDGA 2XKNA 5BW7A 2WBJB 5DC9B 5D1QA 5HYEA 2DWDB 3GBLA 4Z7VB 4ETQA 3OKNA 4NZRH 3NA4A 4JKKA 1ZANL 3MQIA 2FR4A 5FGBA 5L2KE 3MLZL 4RAUA 4PJFA 1M6OA 4PJGA 5F72S 1KLFA 1FO0L 3RGVB 5I1EL 4ZXBD 3LRGA 4BELD 4L3EE 1MRDL 4QRRE 3ZE1E 3V4PL 4XT1C 2ZOKA 2XICA 1AY1H 1LK3H 1E28B 2C1OA 2DQDL 2YPKB 5ICXB 1F4YL 2ATPA 5JIHA 5IBLC 2BVOB 4A6YL 3TYFA 1E6JH 2NW2A 5INCA 3NCFB 2JB5H 3B2UC 5CJXA 1M71B 3QNYA 4QHNB 4QTIH 3W9EB 4O00A 2XXMB 1NFDB 3NOIA 3OKEA 1G7PB 4G7YH 4PJCB 1FRGL 4OD3L 2DD8L 3QQ4A 3E6FA 1NGPL 3LD8B 4BUGA 1U8OA 1P7KB 4G7VH 5C07D 1TVHB 5MEOA 4PRPE 5EG6C 1NGWB 1DQQA 3RU8H 3GFUA 4YPGA 1T6WA 2OTPA 2GSIA 2AJXL 4YR6A 4NKIL 4LLAA 1NDGB 4Z95L 3SGEI 2LU4A 1YEKL 4QHKI 2X10A 3V6OA 2CJUL 2B4CL 4K94C 1IGJB 3QNZA 5IR1A 1JFQL 3LZFH 4L5FL 3V0VB 1A7BA 2QQNH 5C71A 4XCCL 1I9RH 2EEBA 3L3IA 3T0DA 3PXHA 5L9DL 2Y6SC 4O9HH 3VFPA 1F11A 4ODTL 1F4WH 4KUZH 5T3ZH 1MRCL 4XP4H 1UG9A 4ELMF 3JWDH 4AEHH 1SVCP 5IOPA 4EBQL 3S9DB 1OAUL 4Z7WE 1D6EB 2EKJA 5TFSL 3ULSA 5LG1A 3ARBD 5J11C 3UDWA 1UM5H 4GSDH 1EXUB 4QXTA 5ALBL 3MODL 4MHHG 1C7SA 1ND0B 5DK3A 3A6OA 2ADJA 4HULB 3QIBA 5LGKA 3E2HB 4GG8B 4OLUL 4P4KA 4J3XA 4PJIE 2DMKA 1OF2B 3ARDA 2IG2L 4NNPH 3GKWH 3P4LA 3I3EA 5EUKB 1RAMA 2NY5L 3STZA 2AJZA 2PR4H 2X42A 4C57C 1U2CA 3IXAB 1TQBB 3LMJL 2R0ZH 1AHWA 3O6KL 2DI7A 1CFTB 1CGYA 4IOFD 5D1QC 3K4DA 4NO0B 2Y1VA 3QEHB 5I1AB 1TPXB 1ZVSA 2ORBH 2I27N 2OJZL 4I0PB 5ID0B 4MXVE 2H9GB 4H5SB 4K8RD 3ZDZF 1R0AH 1JHKL 3VFOA 1I7UA 3HE6B 4MX7B 1AE6H 3EHBC 4BZ2L 4HWZA 4Z7OF 1I8MB 3GMOA 3VFRB 3ZE2E 3SJVE 3V4VH 4OJFH 3MNWA 5DUML 5EUOA 3WO4B 2YD7A 5D7JD 2EKSA 3OJDB 4ETYA 1A6PA 5LXGL 2ZSVA 3RIAF 2PW2A 3DX7A 4NHCH 3U82B 3QNXA 5BVJB 1CLYH 5CJXC 4YDVA 3V4UL 2NXZB 2W65A 4RA0C 3VRIB 4JZOB 4ODWA 4OCWL 4WEMB 5D70L 3CVHH 1C5DA 4JVWA 4Z8FH 4N0UA 4TRPL 5C1MB 3CZFA 3JWNC 3QULA 4IDJH 5IQ9B 1SYSB 2R1YB 3TZVD 5MEQB 5TDNA 4X9HA 1I85A 2ZCHH 3MRKA 3TCXA 4M1DH 3OTTA 3TBVA 4OFKA 5HYJB 1CL7I 4UNTA 3OZ9L 2VIRA 1T3FA 5FM5O 3LKRA 2W07A 3P4NA 4MLIA 1CXKA 1HNFA 2UVEA 1WBZB 3FMGL 4XVUD 5EBWA 5HVGB 3ZTNH 4XCNB 1J8HB 1NAML 3OX8B 2DQTH 4PJDB 4QHLB 1Z0MA 5JXEA 2MFNA 3UYRH 1H3XA 1MLBA 1MIEL 2GTZA 1JNHA 3VXTA 3EO1B 3U7AA 4JRXA 5T5FL 2R39A 1U3JA 1EPFA 4X98B 4NJ9L 3IJSA 4DVBB 1WICA 5IHBA 5IMOB 4UB0H 2P4AB 3G5ZB 1LNUA 2NY3B 1U0QA 3WV0A 2DMCA 4LPWA 4FZEL 3UDWC 1KTDA 1BM3L 2DLGA 3TM6A 5BMFH 1J1OH 1J8KA 1IGCL 1I1AC 5I19L 1N7ML 2CDFA 2PYFA 4I9WE 4P4KC 1KCUL 3T0ED 4CN6A 2PYEB 1MCLA 3BO8A 1SJHB 3IJHB 3ARDC 4ZUVB 3OR6B 5IT2H 4JO1H 3MV7E 3GSXA 4IBLT 4MNGB 3UTSA 3HMWH 5EB9A 4ZS6C 5E9DA 3QPXH 1T1XB 4PR5B 5FYLD 1X4XA 1MHPH 1GAFH 3BT2L 2R0KL 1I1FA 1M4KA 4XVSH 4GH7B 4Y4KC 3IS1X 3FAWA 3IAQA 5C6TH 3ARGA 4RAVB 3VFTB 1AHWC 2W1NA 2C3GA 5JHDB 1CLOL 5JXAH 3FN9A 3RWEA 2BDNH 4P9MH 1YEJH 4FFWD 2A1WL 4HPOL 4ZFFB 5C0CA 4FG6C 3FTGA 1XGQA 4HUMB 4MA8L 3TT3H 1YNKH 3ZE1F 3TFKD 3PGDB 1MCOH 1AIFA 4LDEB 4JM2B 3T4AA 1NMAH 1KGCD 5FKPB 5F9AC 5F7YC 4LQFL 3QG7H 4MA7H 4U1GB 2GITB 2YD4A 3HG1A 3GB7B 3RWJA 4AM0A 1Z5LA 4AMKH 3KDMB 4UIKL 2AK1L 5FF6A 3MYJB 3BKYH 5DJ8B 1P84K 3BW9A 4LIQE 1NBZA 3PGFL 5L0QC 1YNTA 1IAKB 3DHJA 2EDQA 3OKOB 3WKMH 4JFEE 4DGIL 3M17B 4XVJL 5DJ2B 4I18A 1OCWL 4X5XB 5HYFA 3C6LA 3SKNA 2Q3ZA 1J86A 2EO9A 1I85C 1UJ3B 4LARH 4TSCH 1CU4H 3UTTB 2WAHA 2ERJB 5IHZB 2CXKA 2CKBL 3CMOH 3QEGL 4YDLB 4QY8B 5KS9B 4Z77A 1OSPH 2C5DC 1A7OH 5TDPA 1E4WH 5HHOE 3PABB 3O45A 5F9WB 4HDIA 5A1AA 1AXTH 2IQAA 3ROOA 3U0WL 3QDGD 2FATH 5DJZB 5JXEC 4JFHE 3AS0A 4G80A 4XPTL 3MMEA 3K2UH 4UDUA 3QQ9D 3VGBA 4Z7WF 4GLRH 2D7TH 1JF5A 4X4XB 3L6FB 1DQMH 4JANB 4XPGH 3MNVB 3UYOD 1AGFA 1M7XA 3H9YA 1YUHB 2QLVB 4YHOH 4PJIF 4BSVB 1SY6L 5EOTA 5HYSB 2WQRA 5EZLA 4IIQB 1YJDC 3F7VA 1W0WB 4MDJA 1WUNT 3HZKB 4RX4A 1RZFH 2DKUA 1ITCA 2WLYA 5HPMB 5JO5B 1MJ8L 3G08A 1IC5H 3GMLA 1JTPA 1Q0XH 1H3WM 4OD2A 1HQ4A 4DN4H 2WK2A 1QP1A 2J7LA 3UJTL 5C0JA 1WIUA 1NC4D 4HH8A 4V2BA 4G6AD 2PO6B 1XGYH 1INDL 3SO3C 4MXVF 1J0KA 4ISVA 5BQ7A 1DVFA 2OL3A 3BP4B 4ODUA 5JNYA 1HILB 5DT1H 3GDBA 1K5NB 3D2UB 4F15B 1HSBA 1S7WB 4N68A 3NTCH 3P77B 4GRLD 5L2KD 1BZ9A 3ZE2F 4DTGL 4QRPA 2WANA 3FZUD 5GSVA 5I0ZA 2EDXA 5EZJB 4KMLB 5IMLA 4L3ED 1D6VH 4QRRD 1ULVA 1A9BB 2EDDA 4ALAL 4RGMC 2BNQB 4LSRL 4NHUB 4PLKD 4LKCB 5D7LE 4BFGA 3FONA 4APQC 2AV7A 4C83B 4LPTA 2NXYB 4KK6D 3I84A 4UBDC 4M62H 5TE7L 1U58A 3KR3L 5BXFB 2HH0H 4LP4A 1HH9A 1PY4A 4U1KA 2A0LD 4CUCA 4WHTB 3UCRA 2DQEL 3C6LC 3O0RL 3DTXA 4RMTA 3KPLB 4PRPD 5EA0H 2IH3A 1V3JA 4DKDC 5DSCB 4XP1L 1IC4L 2Y5TB 2ILLA 4HS8L 1QLRB 4OLWH 3DX9A 5CP3H 3VWJB 3VE0B 5DJDA 3H9SA 1EBAA 3VXNA 5GGQL 2IBZY 4Z7UB 1BVLA 4L4VE 5KVGH 3H8NA 4H1LH 1S9YA 1U3ZA 1YY8A 3SDAB 1KYOK 1A6TB 3DXAA 2OXGA 1WFUA 4ZTPH 4DKFH 1A1MA 1B4JH 2VL5B 2WWKO 2I07A 5IBLD 3H9ZA 1F3JA 3MRIB 1EX0A 5IW1A 2D03L 1ETZB 4OLXH 1T5WA 4YHLL 3DV6B 2VABB 4A6YA 3KS0J 3KPSE 5CMAB 1F4AA 5KSVA 1JN6A 1V3LA 4GW1B 1NEZA 2FEEL 1FNFA 1MCNA 1HI6B 2VDKL 1AR1D 1RUQL 3I85A 3HE7B 3WDJA 4OV5A 5T1LD 5AEAA 4NP4H 5F3HA 2CLZA 4WI9A 3ZTJH 1UZ8A 3S37H 5SWZA 1U3HD 1KF9B 2H8PA 4XC1H 1I4FA 3IGAB 3TNMB 5GZOC 1QFHA 5CBEA 4YWGH 5C92A 3WFHA 4FZ8L 1I7ZA 2H26A 4LBEA 1CIUA 3IDNA 4IOSD 3BPOC 2GUOA 1FAKT 4XGZA 4DFIA 1A1NB 1G6RB 1SBSH 2B1AH 1W72B 4Y5XB 1ZGLM 2AKRA 2H6PA 3QQ3A 1YC8A 3K3QA 2J3SA 1IGMH 4EIGB 4FQQB 1FBIL 3CXHJ 4GG6B 2JJTA 2VLJD 1IAII 3MACH 1G9NC 1DVFC 2XXCB 1Q9WA 5K33A 4K7PL 4UAOB 4XC3H 1Q72L 4JY4B 1NC2B 1KN2L 3CXDH 4JHZA 1MUJA 2EDBA 5FGRA 4L8CB 2C3VB 2E3VA 4P5TA 4QT5A 3QZWA 1CQYA 3QCTH 5EU4A 4WUUE 4QGYA 3AVEA 3U0PB 4ZUWB 1L7IH 1MJ7L 4PS4L 1P1ZA 1ZHKB 1F02I 5C08B 3SDCD 5I1JH 3NCMA 4LVEA 4JZJA 5J06A 2Q7YA 5LWYH 2VSDA 2VH5H 3C5JA 1U8JB 2OR9L 5DK2B 5JOFB 5KSBB 4KKAD 5C0AB 1IE5A 3QSKB 2AABH 5MENB 4HBCH 3O81A 5BOPA 2P5EB 1OM3H 5I8KL 3QP3A 3C60B 1XIWA 4NNYB 4PJDE 2YUXA 1TVBA 3PDOB 4HC1L 5CJOL 2HJKB 3IDMB 4P46C 3QFJB 1MI5A 4KRPD 2F53E 2OM5A 5DRNB 3WYRA 3P9MA 2IBBA 5A16B 5FUZH 5B3NA 3RWFB 3QIWD 1A5FL 1X4YA 5E6IB 5DZOA 3WNKA 3TA3D 2IGFL 1TITA 5JDJA 4HH9A 3SKJL 1I7RA 2ZSWB 5E08L 5D2LA 3NIDE 4NZRL 5SWSB 2D0FA 2B8OT 2XQBH 3IU3A 4F3FB 2HMIC 1IBGL 2PYEE 5I1LB 3I3DA 1JV5B 5KZCD 1WEJH 5M7QA 4PG2A 1YPZB 1U8QA 4PGCA 4JR9H 2PF6A 3BVNB 4NQEE 4YBQD 3PIQA 1GGCL 1T04B 2MJWA 5IV2A 5J56B 1BOGB 4J8RB 4WFGE 5D9SB 3MUGA 4LCWE 5CWSB 4WI7A 3W9DA 1EV2E 1DUYB 1IL1A 1AY1L 1SEBB 4I9WD 3T8XB 1TJIH 3RPIA 1OAQH 5DMGD 1VFAA 3S88H 5HD8C 4QHMA 4N5UA 3MV7D 1E6JL 3WN5C 1UVQA 1RK0B 2JB5L 3PF2A 5FCUH 4PV8A 3GSOA 1JNNL 2C4FU 2W9DL 2EYSA 4GXUN 4IMLA 3RY4A 1RJZA 2XA8L 2X09A 5AUMB 1YQVH 4L1DA 5TQ0L 2G9HA 2EDTA 3FB5A 4HFWB 2P7TA 4P9HL 2XQYK 2B4CC 4WWKA 2O61B 4G7YL 3QUMB 4UTAH 1L9MA 1NEZG 2NY4B 4QO1A 3KPTA 3VG9B 3DLQR 4X9FA 2JJTC 5KVFH 1ACYL 3C8KB 3D39B 1HHGB 2R8SH 4ZTOL 2HJFA 5FFLA 4G9DB 5DEGA 4ZFZB 2FO1A 3MGTA 5JR1H 1EO7A 3RWHB 1VPOH 5K9KA 3FFCA 1F58H 2Y23A 4NUJA 4PJCF 2YEZA 4PRHA 2QQNL 4WEBH 1I9RL 1QUNA 1M05A 1E4XI 4L3CB 4XX1E 4Q6YA 3EDKA 3FT4B 4IRJB 3WNOA 4MAYA 3DYMA 1WT5A 5C0BB 1F4WL 3GMNB 5T3ZL 1G7JB 2I9TB 2IALA 5T1MB 2NTFB 3FO1B 3LB6C 4YHPB 5KOVC 2XWJB 3FQXB 2R0LH 1U9KA 4JFED 1FORH 3L9RA 5C09E 1AJ7H 1UM5L 4GSDL 2EZ0C 4M4PA 2OR8A 4JY6A 4OAWA 1OLZA 2KBGA 3OJMB 4G6KH 1QACA 2P42B 1G7HA 3FAXA 1D5IH 1XIWC 4MQTB 5IVXB 3QZWG 2OSLB 4IHOB 4JQVA 1BD2A 1AD0B 1FC2D 4NDMA 4XRCA 3GHEH 3VXUE 4XNMA 4NNPL 1FNSH 1QHOA 4RQQB 4PJ7E 2R69L 3VRLE 1RVFL 4F2MA 5EU6E 5HHOD 4HIJB 2D7PA 2HKFH 4ENED 1BFSA 3ESVF 4BSWA 2PR4L 5I8EB 2VXUH 1EAJA 2JCCA 3KXFD 4HIIA 3SE4A 4JFHD 25C8L 5JMOC 2XFXA 4FQXA 4MNQD 4OZHA 2WINB 2RIKA 3IU4H 3UJJH 4P2OC 2DKSA 3HAEH 1IVLA 5ERWA 3SEPA 5E8NA 3BH8A 4NO2B 5KW9H 3MRFB 1R0AL 5C0IA 3MV9D 1IGYB 3KYAA 1CQKA 4PG2C 2K3TA 4LCCB 5EIIB 2WZPD 5E1HB 4RNRB 3RBSA 2IAMA 3VA6A 2X4TA 1R5WB 1HWGB 2VZOA 4QF1B 4F58H 3HUJB 3DI3B 3WHE0 2WBJD 3GIVB 1BBDL 2OYPA 4HXAH 4LGPB 4NC2B 1CLYL 4NUGH 4OKVB 3WIIL 1ITBB 3L3OB 5EWIH 5KSAA 2YA1A 3BKML 5IM7A 3P9LB 1YEIH 4MJ4A 4Z8FL 2FJGB 4KV5E 1IEHA 4WWKC 3QDMA 4IDJL 3HAEA 1AO7A 4CN4A 5J11B 2VMFA 4EDWH 3GEWB 2ZCHL 1LDPH 1S78C 3QUZD 1M7DB 1A3QA 2P24B 4G42A 2DQIL 4O58L 2J5LB 3LQZB 3GIZL 4M5ZH 4H20H 4UIMB 1TFHA 3UC0L 3PDGA 1QKZL 4PY7A 3LKOA 4RIRA 2DBLH 1OAYL 1JF1B 3AXLA 4V1DB 5DRWB 3S37X 1B3JA 3P0YH 2MKWA 4R4NC 4WJ5B 1V7NH 2BVQA 3G5XB 3W39B 3LKQB 4M7KH 1B6UA 1ZTXH 3IDGB 1WT5C 2XKNB 4ETQB 2VN4A 3OKNB 2FGWH 3D9AH 4PV9A 5D7LD 5L7XH 4M61A 1C1EH 2VXTH 1KB5L 4PY8I 3RZCA 4QGTA 7CGTA 4XCFL 3BP6B 3ELAT 4JQXA 2FR4B 3L5IA 1T2JA 4PJDF 2YXMA 4RAUB 4PJFB 5EO9A 1M6OB 3DSNA 2GTWA 4PJGB 1LVEA 2BVTA 2FIKA 3TO4D 1KEGH 4X80L 1J1OL 1VGKA 1XGTA 1X5FA 1VESA 3SE3C 1OTUC 3B83A 2ZOKB 3TV3H 1JPTH 5DO2C 4JQVC 2CPCA 2MNUA 3SCMA 3FRUA 1SYVA 2ATPB 3DVGA 5I8OL 3TYFB 4NRXB 2NW2B 3HMWL 5INCB 5D1XA 4R0LA 4J2XA 3QPXL 4L4VD 5LBSL 3X14B 4J7RA 1A8JH 3QNYB 3RX8A 4XVSL 5CD3A 4MA1C 5IFJA 3VG0L 5C6TL 1F2XK 2X4PA 2XNAB 3OKEB 1R3IH 2AXFA 4J12A 4KWUA 3SE4C 4P2QA 4CVUA 4FQXC 5JXAL 3QQ4B 3E6FB 4OZFH 3X3FH 1MOEA 1U8OB 2VWEE 3VXSA 4APQD 2YC1A 4P9ML 4YXKL 3O6LH 2DLHA 1UB6A 1DQQB 4LFHD 3D3VE 4NQCA 4X4ZA 4YPGB 3KPSD 3GI9H 3BUYA 2MKLC 1DQLH 2DQUH 2GSIB 3CUPA 1YNKL 4YR6B 2XTJB 3SGEH 4U7KA 5T5NG 1AP2A 4PG9A 4Y4FC 1CXEA 3QNZB 1FLRH 2IAMC 5IR1B 4U1NA 3KNBA 4CVXA 3L3IB 4JRWA 4AMKL 1J1PH 3U36A 4HLZG 3BKYL 3PWJA 1R5IA 3VFPB 2PCPA 1F11B 1NDMB 2COQA 4JM2F 5KSAC 4X6CE 2DQHH 4D94A 4KHTH 2A77L 3WKML 1U8IA 2X4QA 5IOPB 4HBQA 5C0ND 1R3LA 3ULSB 1ADQL 4GXVH 1Z9MA 1S7SA 2YD2A 2VZUA 4QXTB 1ZLWK 1VACA 2YR3A 4LARL 1FH5H 3QIBB 3Q6FA 4PTTA 3C8DA 4OUUA 3NACL 5FYKU 3ARDB 4DGYH 1ED3A 2NXZD 1A64A 1E4WL 2CUIA 3UJIL 4MAUH 4PD4J 3WXVL 3X12A 4JZNA 2UY7A 1T2XA 5DI8B 3ZKXC 3IDIA 2AJZB 5GRWA 4OZIA 2HRLA 5BRZE 3DMMD 1N3NA 5JIPA 2UVFA 2XACC 4Z0BH 5DD0H 3CDFA 3HAEG 3K2UL 3ILPA 1I9JL 5I71B 3UROR 1KJMB 3IVKA 1ZVSB 5CJQH 4WFEE 3RZCC 3UTPE 3W0WA 3MPCA 1FG2A 5GGUA 2N1KA 2R15A 1LO4L 2OQJB 1T80A 3VFVA 5JW4N 1RMFL 1RJCA 1YECL 4HIXH 3VFOB 2ESVB 3C2AL 4XZUA 5E7FA 1ZKAA 3W11C 3G6DH 4HWZB 4XPFH 5FA3A 3GMOB 5EUOB 3ALPA 4PJ7F 2EKSB 3VRLF 2HTKC 3QUYC 2J8UE 3AREC 2ZSVB 1CFBA 4FQPA 3CIQA 2PW2B 3SCMC 4YFDB 2EDRA 1HCVA 3DX7B 2DLIA 4D0CA 3QNXB 1T4KB 1IC5L 4R0LC 4YDVB 5L0QB 2AJ3A 1Q1JH 2DTSA 2NY3D 3KPPB 1MVFA 4ODWB 3BQUA 5LCVL 4DN4L 1CICB 2VN7A 1C5DB 2AEQL 4N0UB 1GH7A 1EO8H 3CZFB 1XGYL 1P4IH 4MA3A 1A3LL 3QULB 3EDDA 1A3RH 2DQFA 3F6IA 5DT1L 3MRKB 4EN3D 4K3DL 2PYED 5HHQA 3U6RA 2VZSA 3TBVB 1CL7H 3QAZC 4ZPTA 3NTCL 4WCYH 1FQ9C 4Y4HB 4H0IA 3VGGA 2VIRB 1T3FB 4NQED 5JOEA 4I3SH 3LKRB 3P4NB 1A22B 4DK3A 5K9OB 4MSWA 2VLKE 4WFGD 4LCWD 4PB0H 5EBWB 3RNKB 4EUPH 4URTB 3REVA 4P46D 2NY0B 1QSEA 5MI0C 1ZWIA 1G0DA 3OG6B 1MLBB 5IHUH 1VGEH 1JNHB 3VXTB 1DEDA 3FB8A 2AV1B 3ZYOA 1FVDA 1ZT4A 4JRXB 4KV5F 5D6CA 3ECBA 3OXSA 3BP7B 3IJSB 5T33L 4DAGH 1PEZA 2YRPA 1LNUB 2HH0L 3B9EA 4ODHH 1NMCB 4JM2D 4OFYD 2QADB 3FCTA 1HXYA 4OM1H 4WU5A 1RFDL 2R1XA 4KQ3H 4CAGA 4E41E 5LGHL 3PNWA 4LCIL 4JDZA 3HI6L 1T03H 2JB6A 4X5LA 3THML 1L9NA 2XKSA 2CDFB 2PYFB 4N5ED 2Z8WC 3U48A 4EUPA 2AK4E 3GJFH 4S1RH 3UTSB 4HIEA 5E2TL 4FMFA 3PXJA 3N9GL 5E9DB 1YYMH 1I1FB 5CHNA 3BPLC 1CXHA 4CL7A 1B6DA 4IMKA 4DKFL 3PQYE 1B4JL 3DO7A 1MCPL 4OCYH 2KH2B 3ARGB 4CDGC 5IVXE 3QUXC 3B4NA 4OSUH 3RWEB 1UM6L 4M1CC 3ZKQD 5JUEH 3GBNH 3OGCA 4LLYB 5C0CB 3FTGB 3WSQH 5ITFA 1XGQB 5ACZA 2VXQL 1YEHL 5F3BA 5E4EC 5GJTL 5C09D 1OGTA 1HEZA 2FWOB 2BSRA 4WDIB 1AIFB 5F6IC 3S7GA 3A0OA 3T4AB 3IETA 4TYUA 4PRIE 4I4WA 2WIMA 3WFBL 4X6EA 4WO4A 3PHQA 3HG1B 1GZQA 4OUOA 4XC1L 4AL8H 5I1GL 5KTEL 4RGMB 3VXUD 4GKNA 4R2GB 2A83A 3S96A 4MD0A 4AM0B 1Z5LB 3OF6A 1SBBA 3O11A 5D2NC 3RHWK 5FF6B 4JPWH 4WEUD 2KZ1B 4G9FE 3ESUF 5EU6D 3BW9B 4HAGA 5ECJE 1NBZB 3GK8H 4I0KA 5FKAA 3QXWA 1YNTB 1SBSL 3WXWL 1DBKH 2R2HB 3T09A 2EH8L 4HMDA 3BRDA 5FOBA 5JPNB 4I18B 4F9PC 3L3KB 4UT7H 4Y1AA 2RQ8A 3C6LB 1PAMA 4QRTA 3TNNA 4XP5H 1JGUH 3PL6C 4L4TA 3HUJE 3RVWD 2YS4A 4XC3L 1JRHI 4F7MA 2MQ0A 1GRWA 5GS1C 5B38A 3CXDL 4ONFL 5GJSH 2BSED 4Z77B 1TZGH 5TDPB 3QCTL 4GMTL 1KN4H 4HDIB 5DQDL 4ZDHB 4JFXA 3A6CH 1L7IL 2MHAA 2PO6D 3ROOB 2VLRA 1MSPA 5D2NE 5I1JL 1H5BC 4G80B 4X6CF 5DHYA 3RAJL 5I73C 2H2PC 1N64L 3MMEB 4LOUC 5DJXA 3D2UD 2YPLA 4M3KB 5DA4A 4E0RA 1TIUA 1S7RA 4KHXL 2VH5L 1ORSA 4S0SD 3MRHA 1X5HA 2AABL 5HGAA 1AGFB 4RFNB 3DUUA 4JRYE 1NFKA 1IFHH 5GGSA 3NABH 5I8CA 5EZLB 1KXQE 3F7VB 1J87A 1RIVL 2BNQD 4MDJB 2AI0L 3NFNA 4JB9L 2ID5A 3KYKL 3G08B 3GMLB 3N1GC 3OL2A 1ZLSL 1OPGL 2KDGA 1HQ4B 4XNYH 5BZWA 5C0JB 4M6NL 5EOCJ 2P5WE 5FHBL 1ZS8A 3DYOA 3TLRA 4ISVB 4BQ6A 5BQ7B 1A1OA 1FL3A 4UI2A 4M93C 1RZJL 2OL3B 5JOPE 5HYQA 4ODUB 3VWJD 4PREA 4PJHA 5T3XH 4G5ZL 4U4BA 4B50A 4JR9L 4FTVA 6CGTA 5FUOL 3QB7C 2Y07H 4QRPB 4P9HC 1IAOA 4EUPG 3RUGE 5GSVB 3SDAD 3GSRA 5IMLB 5DFWH 5EPMA 4WO4C 2VDRH 2IPKA 4PJ5A 1TJIL 4D0DA 1OAQL 2GW5A 4YHZH 1JVKA 4LHUB 4EKXA 1QPPA 2B1HH 3MA9H 4R4FH 3MRMB 4PLJD 5F70A 5DD3H 1YPZF 3ZLQC 2CGRH 5CGTA 2Z93A 3FONB 1W8OA 3TJHC 4EI5D 1K6QL 5GS3A 3W5MA 1KXTB 1X9QA 5FO9B 3OG4B 1PKQA 3JTSA 2NZIA 4UTAL 3CLEH 2P48B 3RRQA 2V7NA 1HH9B 5EFIA 4U1KB 3ZL4L 5KVFL 2R8SL 1EERB 1F3RB 2OMBA 2ZUUA 3DTXB 1OB1A 3SE9L 1UWXK 1QFPA 2IH3B 3D3VD 1I9EA 2Z92A 1Q0YL 2F8OA 2BSTA 5JR1L 2FBJH 3CFBA 1CBVH 3DX9B 1JI2A 3G9AB 2MOVA 1KB5A 5DJDB 3H9SB 2BVYA 3L3HB 3VXNB 5E24E 2ADGA 1TMCB 2B2XH 5GZNC 2P47B 5E6YA 5I74C 1S9YB 3BDYL 1YY8B 3Q5OA 2EXWD 3DXAB 4R7DA 2JIXA 1A1MB 3GRWH 3MBXH 4WI4A 3B9AA 2I07B 3MBEA 4NM8L 2VZVA 1F3JB 1RULH 1HH6A 2VQTA 4QOKE 5IW1B 5I1DA 1S7UB 2N7AA 5FM8A 1T5WB 2X9XA 1CK0H 1GC1H 3WLWD 5FYKH 1JN6B 1FORL 1MY7A 3Q1SH 1NEZB 3EDEA 3LQAL 5B38G 1AJ7L 4DZBA 1WAAA 2GT9A 4DJMA 4G6KL 5D7SH 4OV5B 4JFZH 5F7UA 3QDJA 2YZ8A 5F3HB 4NRYA 2CLZB 2AJVH 1BQSA 1UZ8B 1D5BA 4LGSB 1TVDA 5SWZB 5T3ZE 2H8PB 1I4FB 1TNNA 1A6VH 5CBEB 1U8NA 3U9UB 3WFHB 3ZYZA 1S9VA 1I7ZB 2H26B 2QJDA 4LBEB 3IDNB 4J3WA 3I6KA 4Y4FD 2HKFL 1NKRA 3RP1A 5D7IA 5E1AA 1FVCA 4P48A 1OARH 1G9ML 2GUOB 4XGZB 2ATKA 2V6HA 2VXUL 1B0WA 4YLQT 5IVXF 5C0AD 4PJXA 3JV4A 2AKRB 5BRZD 1FYTB 4JFDE 2ESVE 2P5ED 2CMRH 3E3QC 5DYOA 2SEBA 1TETH 3ARZA 4Q9RL 3ARFC 3HZMA 1ZLUH 1BFTA 2UWEA 2GJ6B 2EDLA 3IU4L 1QBMH 3UJJL 5IP4A 2M2DA 5DZNA 1Q9WB 4PJ8A 1IAIM 4LVHC 4WFED 3UTPD 2B20A 2WNGA 3O41A 4XWGL 4TOYL 4JG0H 1KCVH 4MMZC 4TTDC 4GKSB 2RCSL 5FYJU 1MUJB 3RY5A 3ULUD 3O6FA 1EZVY 4P5TB 4QT5B 1RUML 1OWRM 1JZ3A 3QZWB 5EU4B 2NYYD 3O3DB 4F58L 4CGTA 1F4XH 1P1ZB 3RY6A 4C4KT 2XZCH 1GGIH 3O3EA 1JPGA 3AMLA 2XY2A 1EO5A 4M48L 1XEDA 4JZJB 4XBEL 1P5UA 4PBVC 4I3GA 2Q7YB 4JFYB 3HB3D 4LU5H 5HGGS 3C5JB 2DI9A 3ZKMC 3E3QE 2RGSA 3HUJF 2HT2D 2OJEA 2R4RL 1MCIA 4U1IA 4EDWL 4J6RH 2X6MA 5IB4B 3RVTD 2Q8AL 3DIFB 4X99B 5BO1L 1H3PL 1TVBB 4AEIL 2Q7NA 4G8GA 4TVPL 4H20L 4HSQA 1MWAH 1YNLH 5GGRA 5GQBA 1BEYH 3QJFA 1MI5B 3B8YA 1HKLH 4K7FA 2GIYA 2FLRT 4K55A 4N0FA 4RGNE 3OBAA 1JYNA 5FXCH 4KVCH 3T4YA 2DBLL 3WFEL 1AQKL 3QWOB 2VLKD 1YY9D 4KKLC 2ZOLA 5JDSA 3TH3T 3CDGA 4Y5VA 4JO4H 2QTEA 5HY9A 3ARED 5F6HJ 4OGYH 4M7KL 4HH9B 2VOTA 3D39D 1I7RB 3I6LE 3MBEC 4XMLL 5D2LB 4NO3A 2FGWL 3SGJA 1C1EL 4G8IA 5FK9A 3KPNA 1L6ZA 1BGXL 3IU3B 5AZ2L 3RL2A 3T0VA 4F37K 1A7PL 5HI4C 4GAJH 4MJIE 5B39A 4U1SA 5FUCC 5ESVA 4TVSa 4KTEH 5D71H 1U8QB 3Q6GL 4PGCB 2IC2A 1T1YA 1WZMA 4IRSB 5IFHH 1KEGL 2DQGH 4E41D 3PIQB 5IV2B 3EFDL 4C56A 1HE7A 3HS0A 3MUGB 5DD1L 3SQOL 5TE4H 3W9DB 4IRJD 1GGBH 4LK4A 4YUEH 3RPIB 2VDOH 1VFAB 3LY6A 4M6MH 5H2BA 4DN3H 2DRUA 4QHMB 4HKJA 3L1OH 1A4KB 1UVQB 2AK4D 3OB0H 2XN9E 4PV8B 1B88A 2QBWA 1OP5H 4IMLB 1FNHA 2EYSB 3H3PL 3WE6A 5C0DB 5JQHC 4BQBA 2G9HB 3V5HA 1IMHC 3FB5B 1IEBB 2P7TB 1R3IL 1QR1A 3PQYD 4WWKB 2AP2A 3SDDD 4QYOA 1JYWA 3JBG7 4R90H 5F7EL 4I0CC 4LAQL 2P49B 3HN3A 3O6LL 4Y16D 4YK4B 4PJ8C 1QLEH 4X0KA 4HCRL 5DJYA 1BMGA 4X6DE 2QSVA 3RUGF 5GRUH 1NLBL 1HYRC 2HWZL 3FFCB 5IVOA 1KLGA 1S5IL 4NUJB 1JGVH 3VGDA 1DL7L 2YEZB 4PRHB 4PRID 3ETBF 1IC7L 2P43B 1DBAL 1G0XA 1CT8B 1E4XH 1M05B 4WRLA 2VO5A 1J10A 1MRFH 3RY6C 5MERA 4MAYB 4OIAA 2WLZA 2XQYG 3S8WA 1X5JA 4FNLL 4R7NA 4BKLA 4BH7A 2DQHL 2IALB 4KHTL 2NY2D 3SDYH 2A6KA 1UH4A 3VWKA 2MCG1 1KBGL 4F7EA 3L9RB 4Y2DB 1UCTA 4UTBH 4JY6B 3QG6B 4OAWB 1C08A 1QRNE 1FH5L 3VDBA 2HFTA 4Z7NE 2DTMH 4OM0H 1OD7A 4NN6C 4XRCB 1BD2B 2P44B 4NDMB 4XHQA 4AY0A 4Y5YA 3UXFA 4XNMB 4RBPK 5INDA 4LP5A 1RZ8A 3KLHC 1YEDA 1CR9H 4QEGA 4MAUL 3O9WA 4F2MB 1QG3A 5F88A 4OF8A 4MA1B 1T7VA 1HZHH 4KC3B 3VJ6A 5IB3B 4HIIB 4DQOL 3DUSA 2Y72A 5DD0L 2XFXB 4FQXB 1QSFE 1R3HA 4OZHB 4HJ0C 2A6JB 3DRTA 5FO8A 3HR6A 3SGJC 2AJYH 1CFQA 4KJWC 5CJQL 5ERWB 4GQPH 1UENA 5E8NB 1FGNL 3O8XA 5B4MD 4QHUA 1ORQA 5C0IB 4U1HA 5TQ2H 1Y0LA 2EDEA 3VXQA 4M9OA 4PP1C 4JGMA 3IKKA 4XWOD 5F1SA 3TPKA 3PL6D 4KMQA 5D72H 4JRYD 2IAMB 1YMMA 2X4TB 4OZGE 3QO1A 1TNMA 4K3HA 1EGJH 2D31A 2ZCLL 3LKNB 4M4RA 32C2A 3ME0A 1PEWA 2FSEA 2MCPH 5BVPL 5IM7B 2OS7A 1UKSA 3QIUA 2Z35B 4YDIH 2P5WD 5E2UH 5B39G 3QDMB 3DX8A 3RIAK 1QO3A 1A3RL 3HAEB 3BJ91 4KAQH 3RKDC 5DUBA 3RDTA 5F9OL 5IB5A 4DUVA 1ZMYA 1AKJA 3T3PE 1CVRA 3NAAH 4P3CH 2WUCL 4WCYL 3NA9L 4G42B 5DVMA 3MNZA 4LLVA 4PY7B 1I8LC 2YD6A 1JWUA 3LKOB 4RIRB 3T04D 2APFA 2CRIA 3AXLB 1EGJA 1ZGLP 4HGWB 1IGIL 3DUHA 3MRQA 2FCBA 3KAAA 2VDMH 5I0DA 2ZUXA 2J6EH 2DN7A 5DJ0A 5IHUL 2OZ4H 3PV6A 5GGVH 5C0GA 2VZ3A 4JQIH 4R6UA 2E7CA 4MD5A 4PV9B 5EZOH 3BIAX 3V79C 2ENSA 4XPBL 4M61B 4BFIA 4EEEA 3HI1A 4YBHA 3RZCB 4EI6A 5IF0A 4MHHI 4DAGL 3FO2A 3B9KA 4S1DC 3VWKC 5J8OA 2YRZA 4OM1L 4P57A 3UAJD 2GTWB 5FV2A 1ROWA 2FIKB 1VGKB 3W2DL 1X6NA 2F74A 3ZDYE 2QHRL 4FQLH 2D9QB 2HP4A 1XMWA 4YDJA 3ZDXE 1MHEA 3SCMB 4Y5YC 3FRUB 1SYVB 3DVGB 2XI9A 4K71B 1Q9OA 2NNAA 5D1XB 1WWCA 1FFOA 3O9WC 1YA5A 3BPNC 2J6EA 3BIKA 5CD3B 2B39A 5IFJB 3KVQA 3GI8L 2Q6WA 1AFVH 1RPQA 4OCYL 1N6QL 2AXFB 3KPQA 1Z2KA 4P2QB 2H2SC 3TT1L 4QOKD 2R1WA 4OSUL 4KDTA 3VXSB 2YC1B 1CF8H 3QIBD 5JUEL 2I5YH 2J4WH 1UB6B 4EOWH 4P2RA 3WSQL 2ZUQB 3BUYB 3QAZB 5TPWH 1DSFL 2YPVH 3CUPB 3AFLA 3VCLA 4L8BA 4KJQD 3OKMA 3LIZH 1AP2B 3CCHA 4PG9B 5HGHA 3CSPA 1FYTE 4U1NB 4BM7A 1DR9A 3NGBB 5T3ZD 3KNBB 1N8ZA 3KJ6H 5B22A 2GJ6E 4JPWL 3S4SA 1BF2A 3PWJB 2VTFA 1R5IB 2A38A 2PCPB 5CINL 1FCCA 1DBKL 4M6OL 1NH6A 3KS0H 3SDXA 5CSGA 2X4QB 2NZ9C 4PJBE 4PJEA 4ACPA 1G1YA 5J1SC 4JFDD 3QIUC 2ESVD 5FYJH 1R3LB 5J3HC 5EU7E 3RTQA 1P2CA 1S7SB 4X6DF 1VACB 3RDTC 1JGUL 3EOAB 3MXVH 2EIZA 1IGFH 4Q0XL 1WZ1H 2NX5E 1OL0A 3Q6FB 4PTTB 4OUUB 3EUUA 5GJSL 2JE8A 3MOQA 1ES0A 3FQNA 3EBAA 4O5LL 4YHKL 4TQEH 2HAZA 5DJCB 1WZLA 3O3AA 4MS8C 4EXKA 3BP5A 1CICD 1KN4L 1U92A 2D4DA 3NCBB 3X12B 3VGHA 4LSVH 3A6CL 3PWPA 2Y9RT 3IDIB 4OZIB 1N3NB 1U6AL 4JO3L 3DETC 1B0RA 4ZMAT 4Z5RA 3ILPB 4XP6L 3QHZL 5D7KE 3IVKB 4MNHB 1EMTH 4Y4HD 3W0WB 1FG2B 5GGUB 3OJVC 3VFVB 3B9KC 1C5BL 3MCLL 3RNQB 5E4EB 4Z7NF 5F6IB 4Y19E 2DYPA 2WWMC 2VDLL 4HKXA 4J3SA 4FFZH 5FA3B 1IFHL 2DBJA 1KENH 4ZG1A 1WC7A 2LAGB 2HVJA 4TTDD 2HFGH 1RZJC 1JHLH 4JRXD 1CFVH 4RGND 4QXUL 4D0CB 3ARUA 1HOCA 4ZSOA 2O5XL 4HMCA 4MWFA 2PTVA 2AJ3B 3CX2A 4PGDA 2QADD 1GZPA 1OTTC 2LVCA 3BQUB 1JYXA 5D8JH 4UT9H 3IDXH 2F9BT 3ULVH 2X7LA 3I6LD 3CH8A 3EIFA 4MA3B 4LNRB 2DQFB 1EFQA 2DF3A 3IAPA 1HYSD 2VKXA 3U6RB 4MJID 2YBRB 5T3XL 5GHWL 1AI1H 1XAUA 3UTSD 5AYUH 1FZOA 1C5CH 2NY6D 1G9EA 2GQHA 4MSWB 4V2CB 5I1HL 4FHBD 4ERSH 1EHLH 2VDRL 4IRZH 4HS3A 3REVB 4YHZL 3NCJL 3ARGD 3SE8H 1F6AA 1QSEB 1ZWIB 5F6HI 2YUVA 5DD3L 5I73B 4F9LA 5D5MB 5L8JB 1EAPA 2XN9D 4OGZA 1FVDB 1ZT4B 4WUKH 3CU1A 5C0CD 4NCDA 2AJUH 5F96L 2JJWA 5HJ3A 1TQCB 3CFIC 5LAXA 3NH7H 5I76A 4OLZH 3T1FA 3BUTA 2YZ1A 2FX7L 3FCTB 3UPRA 1HXYB 1EK3A 2VAAA 5EOQL 3CAFA 4JG1H 3T3PF 5CBAB 2FJFA 3UTQA 4WU5B 3GSNA 3RTQC 1VEPA 3PNWB 4JDZB 2HLFD 4R2GD 2JB6B 4KTDL 2VR4A 2FBJL 2A9MH 2F54E 2YK1L 5EU3B 1F45A 4GQ9H 5GISH 4PP2B 4YBLB 2J8HA 4XP9H 1I75A 1WWWX 2B2XL 3I2CH 3WNNA 3P73A 3S4SG 4EUPB 1TJGL 4WVRA 3WUWA 2WUBL 1P4BL 3LQAC 4HIEB 4LLQA 4N0CC 1A2YA 3WNPA 4C54A 2CDEA 1RZIA 1DCLA 1NCWL 3E1F1 4XH2A 5CHNB 5HI5D 5DK0A 4POYA 3LS5L 5SWQA 3DO7B 3OAYH 1U3YA 1RULL 5I9QB 2BOCA 1ONQA 1B4RA 3IDUA 3S34H 3FT3A 1RUKH 3OGCB 3S36L 5ITFB 3Q1SL 1WQVT 5ACZB 5F3BB 1CGVA 1FIEA 1G9MC 1H8NA 2LU7A 3I3BA 5D1ZA 1OGTB 1HEZB 1YC7A 2BSRB 5CZKA 4JFZL 1QTYT 1UH2A 1QRND 3ZDXF 4I4WB 4X6EB 4WO4B 5I6XB 3PHQB 1VA9A 1GZQB 3TJEL 3H2WA 4NPYA 4JREB 1KT2A 2A83B 3S96B 1UYWL 4MD0B 5T1KD 2RR3A 1J1XH 3O11B 1URLA 4HCRA 4J4PA 5TDOA 3RX5A 4YE4H 2P8MA 2D7QA 1OARL 4LASH 4CU8A 2IFGA 3BISA 1J11A 4TPRH 4JJHA 1BIIA 4X8JA 1KIPA 2CMRL 1MQ8A 5FOBB 1HK6A 1TETL 1UZ6E 1QSFD 3DURB 1IAIL 1O7VA 2B0SH 4MZ3A 1EHNA 1JNLH 4Y1AB 4QRTB 3TNNB 3NPZB 4L4TB 1JRHH 3NCCB 3IKCA 5LQBL 4JG0L 1KCVL 5B38B 2W9EH 3LEVH 4PYHA 3T65A 3A6BL 5CSBA 1PVHA 5KAQF 3HHRB 4UQ3B 5I74B 1XGPA 4FQHB 2X89D 3MLSH 2MHAB 3TC9A 2CK0L 3BKCL 3VGAB 1KCKA 1NCUA 3BHBA 4OCXH 2HFEA 2VLRB 3TYGL 3LKSA 4R8WH 2XZCL 3CX5K 2NW3A 5DHYB 1KEML 2IANE 2FLBT 4F9LC 3IAGC 5DJXB 4PJBF 2YPLB 4P3WA 5F7NC 4E0RB 1S7RB 2V2WA 3RVUD 4LU5L 1ORSB 4OT1L 3HNVH 4QRPD 3MRHB 2P1YA 5F89A 2VDQL 5HDQH 5GGRY 3DUUB 2FRGP 2ZPKL 4XI5C 4LCUA 4LHUD 3F12A 4X5WA 2AXHA 5CKGA 5GGSB 1MWAL 1OVZA 4GRWB 3NFNB 4LRNH 15C8H 4G8EA 3VGEA 4DKEL 1CLZL 4W4OA 3JUYA 5IEKA 4JO4L 5DUPH 3HPJA 4R97B 3BN9C 4H8WH 1NCCH 4X4YA 5BZWB 2QSQA 4JO2H 5KVDL 1QBLH 1ZS8B 2HG5A 5BV7L 4ZO6A 5ACMA 1FL3B 3MOAH 4M7JH 1U41A 1DQTA 1NFIA 3L3GA 1RZKL 5HYQB 3MUHL 4LVHB 1IM9B 1BJ1J 4M7ZB 5TH2B 1O0VA 3H9SD 5KOMC 3U83A 4X9GA 4PREB 5D71L 4PJHB 1DQJA 1WBYA 1JMXA 1WZKA 4FTVB 3ALXA 5IFHL 2DQGL 1DEEA 5IIEA 1N0XL 4HX1A 5D1ZC 5C07A 1IAOB 4OLYH 3ARQA 5H35A 1N59A 5D2LF 3WUWG 3DSFH 4OLVH 1FAIL 3VXRE 1B2WL 1GHFL 1GGBL 5EPMB 1ACZA 4YUEL 2IPKB 5KN5A 4D0DB 2VDOL 2Q86A 5KJRH 1CGSH 2F19L 1JPST 4MQXC 4DN3L 2ZUWA 2PW1B 4XXDB 3L1OL 1MFDH 1HWHB 4J4PC 3VW3L 1XR9A 1MCQA 3BGAA 1DLHA 1FE8L 1OGAE 3MV8E 4XPAL 3DI2B 3O6ML 1YN7A 1PKQB 3JTSB 4WI5A 3SKOA 1UM4L 2V7NB 5GS0C 3KJ4C 5EFIB 2C4FT 1CD8A 3O4OB 4WHYH 5SWZD 1OB1B 4X7DC 4PJAE 2Z92B 2B5IB 2Q1EA 4LSPL 2BSTB 4Q9CA 3RGHA 1KIUA 2NY7L 3CFBB 4RGOL 2BRRH 3ARBA 4OFDA 2CO7B 2IEPA 3TN0B 2ADGB 2ZZUT 5C7XH 2QV2A 5IB1A 3HNTL 4O2CA 4XPHH 1FYTD 2R29H 1E4XL 2GEEA 1KCLA 4FQIH 4R7DB 2JIXB 1MRFL 5IBUG 4HWEL 1MREH 2GJ6D 5JZ7D 1ZEAH 1HH6B 4NZJA 4HAFA 1KACB 4R96A 5I1DB 4P3DA 3BOVA 4HS6A 3WHE1 5JA9A 2ED8A 3MLYL 2AGJH 3VD7A 1E27B 1WWAX 4ZUSB 2APTA 1NCAL 4Q2ZA 1T1WA 3EKCA 4RWYH 2NY1B 4DZBB 4P5TD 3VDAA 2NCMA 3CLFH 4OFPA 4CMHB 5J1TC 2X4NA 4QXGH 3QDJB 5E8OA 4HJGB 2DTML 5JHLH 2G60L 2OK0H 4JPVH 4Z76A 2Z31D 1GGUA 1N6UA 5A2FA 4LSSH 1GOGA 3MJ9H 1NSNH 1BX2A 4KI5C 5TJWK 4JKPH 1DN0A 4ZAKD 1CR9L 1S9VB 3L3DB 4RZCA 4LPYA 3I6KB 3E8UL 1XZ0A 3G6JB 4W4OC 4ZXBC 3P11L 5D7IB 5E1AB 1FVCB 2ADFH 3QFDA 5D7JA 2ATKB 4K2UH 2BX5A 2ZP0T 3A67H 4PJXB 4BJLA 3JV4B 3QEQE 3AB0C 3L5WA 3HNSL 4TTGA 5DYOB 2SEBB 2AJYL 3HZMB 4AIZA 5D7KD 4OGXH 3P30L 4LGRB 2D2OA 1CZ8L 1DQDL 1MI5D 4PJ8B 3O41B 4HHAA 1PSKH 3WDIA 5DQ9A 3F7RA 3CSYA 4Y19D 1OHQA 4HG4K 3TZVA 5FCSH 3O6FB 3Q3GA 5D72L 1K8IA 1A6WL 1UA6H 2GJZA 5I75C 3FHQA 3L3JA 1HHHA 2CDGA 4H26A 4IS6A 4KI5E 1JE6A 1WTLA 3JWOL 4AIOA 4PRBA 1M1SA 2HRPL 1R3KA 3O3EB 2YD8A 4GAGL 2MCPL 4ORGA 1IKNA 5J9PA 3MRCA 1UZ6F 5DEFA 1M7IA 4IRSD 4YDIL 5E2UL 1NMBH 3QXDA 4KAQL 1ERNA 2OJEB 4WIQA 4U1IB 1Z3GL 4GW5A 3IF1A 3MFFB 4Y8DC 3S5LA 4G8GB 4P3CL 5AAMA 4ZNEA 4Y89A 3C5ZD 4DVRL 4NN6B 5TF1H 3OGOE 1LE5A 4N1HB 3QJFB 5D5ME 5IROA 4ELMA 1RU9H 4K7FB 1EJOH 3ARBC 1CD9B 4FXKA 4N0FB 1H8SA 3QR2A 3QH3A 2O93L 1JNJA 3FB7A 5JDSB 5DZLA 3S97C 4Y5VB 3STBA 4WV1A 5HVWA 4KK8D 3T0EA 3RWCA 2F58H 5IESL 4F57L 5CEXA 1OQXA 1BFOA 4NO3B 4AZ8A 4M1GH 5MHSE 1GJIA 3TO2B 5FK9B 5DJAA 3KPNB 5D93C 3RL2B 1MAML 1MQKH 3R0MA 4M6AA 5B39B 4U1SB 3MLRH 3V5KA 5ESVB 3D0LA 3FO0L 2ICWA 1T1YB 4IOFC 3VRJA 4C56B 2OBGA 5DDHA 1FPTH 2EEDA 4TN9A 2E5EA 1T20A 2F54D 4K8RC 5CZXD 4XNXH 4MAYD 1P84J 1CCZA 5H2BB 4B53A 1T7YA 5I2IA 4HKJB 1P6AB 5DVOA 3P40A 4OCSL 2ZUSA 1KG0B 5A2LH 2Y36H 5D7JC 3RX7A 3GMRA 4MZ2A 3V5HB 4Y2DD 5HVHB 1D9KC 1QR1B 3DX6A 3JVGC 3O4LE 1HDMB 2VLME 4QYOB 5F9JA 4ZFGL 4DZ8A 4EOWL 1HSAA 2A73A 1BD2D 1KJ2L 5EO1A 2VC2L 4X0KB 2X70B 5DJYB 5BS0E 3Q5TA 3OKKA 3LRSA 4ONGL 3LHPL 3LIZL 3TZVC 3O2VH 2BNRE 4PRAB 1CDYA 2R56H 3MC0A 5DEZA 4FOMA 1TDQA 3KJ6L 1JGEA 4NO5A 4KY1H 4G43A 1IZJA 1KTLA 2RB8A 3I9GL 3QPQD 4CJ0A 1SM3H 2FO4A 5IJVA 4YC2C 4N0CD 1ZLVH 4R7NB 1S9KC 4BKLB 4XVUC 1IKNC 4BH7B 5I18L 2CRYA 2A6KB 3QDGA 4QTHA 5FYJL 3VWKB 4F7EB 3BZEB 3DGCR 2CKNA 3VXME 3NCYS 4PJAF 1FSKC 3HMXH 1C08B 1ZVHA 3MXVL 1RIUH 1IGFL 3LN4B 1WZ1L 4MLSA 2DIBA 1T0PB 1JZ7A 4Y5YB 5DMKA 5INDB 1S7QA 4JDTH 4TULH 5IMKA 1YEDB 5TF0A 4WGWB 3MR9A 1FFQA 4Z78A 5F88B 2HJLA 2AEPH 4WV1C 3QUKA 2Z8SA 3VJ6B 3ZT6A 5JLZA 3T0EC 3DUSB 4RDQF 4ZFOA 1R3HB 2IAND 3RL1B 1H0DA 3DRTB 5FO8B 1CFQB 1A7QL 4UDTA 4L29B 1TTUA 1NBQA 1CXLA 3O8XB 1ZVYA 3S5LG 1I8IA 2IH1A 2DQCH 4QHUB 1ORQB 1WLHA 2XWBB 3MOBH 4JPIA 4PB9L 3TIDA 4U1HB 1OLLA 5DRXA 3U46A 3VXQB 1CWVA 2CUMA 4FFZL 5SX4I 2AVGA 4FFWC 1YMMB 1KENL 2VXSH 3NN8A 3UPAA 5ADPH 4IEFB 2HFGL 3QO1B 5L2KA 2D31B 1TZIA 1HINL 1INEH 4JKWA 5MP6H 1LE9B 1S8DA 4XMKH 4NT6A 1H3VA 3WFDL 4HJJL 3AROA 1BIHA 1PQZA 4L3EA 4QRRA 1ODAA 1KIRA 2WV3A 1V7ML 1DDHA 3VFUA 2FD6L 1WBXB 4F33A 3CFCL 5F1IA 1LILA 1BJ8A 3DX8B 3MO1A 1UEYA 1CXFA 1OSZA 1PDKA 4U3XA 1W8NA 4NFCA 5DUBB 1QFWI 3HR5A 1AKJB 1J5OH 4JAMA 2Q8BL 1C8PA 4CVWA 1KFAH 3AS2A 5AYUL 4Q9BA 3MNZB 5D1XD 4LLVB 5HGBA 1VCAA 4NQDB 4YXHH 5AWNL 1KYOJ 1JWUB 4WWID 4PRPA 4KI5F 1EHLL 2IPUK 3VXRD 4IRZL 4G3YL 5JPMA 3MRQB 4P2QD 5ANME 5I30H 3U7YH 2FB4H 5EOCH 4YDKH 1G6VK 1SEQL 3VXSD 3ZDZE 4CDHA 3PV6B 3TWCH 5C0GB 3PV7A 1KGCE 5T3XE 1FVEA 4MD5B 4W70A 4BFIB 1OGAD 3MV8D 3HI1B 4J3UA 5IF0B 4BZ1H 4EI6B 1OAZH 4K94H 3NH7L 3FO2B 3WBDA 2R2BA 4OLZL 4JG1L 5EORL 4P57B 3MLUL 2YWZA 4PBWD 3N1PC 4JN1H 3QQ9C 4XNUH 4FP8H 2F74B 5D5MF 3TP4A 2A9ML 2MPAH 4MXWH 5AZEH 3T77A 1KSRA 4Z7WA 4YDJB 4NWTL 1MHEB 3CVIH 3VFMA 2AXGA 4GRMA 3EJYD 2Y7QB 4KFZC 3TGXA 3LDBC 5T1LA 1Q9OB 1U95A 2X5PA 5JW3L 1FFOB 5ISZE 5EO0A 3BIKB 2AERT 1EIBA 4ZPVA 1U3HA 1S3KL 2P8PA 3N1FC 3VFWA 4PJIA 2Q6WB 1MFBH 5EZIH 1Z9OA 2I60L 4IJ3B 1F3DJ 3REWB 4H0HB 3KPQB 1HKFA 4HFUH 2K7PA 2L7UA 4YXLL 2C1PA 2R1WB 2GY5A 3S34L 5CEZH 1QNZL 1RUKL 3VFGL 3J8F7 3GGWA 5L2JA 5DF0A 3BPCA 4ODVH 1RY7B 4G6AC 3DBXA 3G6JE 3BKJH 3VCLB 5EH1A 1DFBL 4L8BB 5E2WH 2VLJA 3CCHB 5HGHB 2YMXL 2WIIA 4S1SL 1I9IH 1A7NL 5BJTA 1NJ9A 4OF3A 3RWDA 4ZYKA 1N8ZB 4GRLC 1WGOA 1MCWM 3S4SB 1WWBX 3C08H 3FZUC 4FQCH 3MX0A 2IMMA 4JY5H 3SJVA 3GMPA 2EIDA 3O2DA 4JPKH 4W6YB 1JBJA 4TPRL 3OR7A 4S1QL 5IQ7H 4L4JA 3QEQD 4PJEB 4HWUA 1JNLL 1KIQB 1P2CB 4PLKC 1H15A 3ZSTA 4EJ1C 1JRHL 3GMMA 1JL8A 2PTTA 2GI7A 4KK6C 2EIZB 1ZV5A 3QA3A 4R26H 4HIHB 1RI8A 3LS4L 4ZUTA 3MREA 4I2XE 4D8PB 1NUGA 1ES0B 3FQNB 1UJTA 2HTLD 3DROA 2A0LC 3MRJA 5JMRA 3O3AB 4OTXL 3QYCA 3BP5B 1E6OH 5C0RH 1ZHBA 2BFVH 3MGOA 4KTYA 1DBMH 3PWPB 1A6AA 2QR0A 1JGLH 3OAZH 1FZKA 1S7VA 1Q9LA 4KI5D 1A6ZA 4L1HA 1NL0H 1BAFL 1B0RB 2AJSH 4YHMH 3GHBL 3D1MC 1A7RH 1GIGL 5KSUA 3QIWA 5FGCE 1HHKA 3RA7L 1RUPH 3TA3A 2FNBA 1IQWH 4PUBH 5FV1L 3H42H 1J0JA 1KTKE 1CE1H 1J9CT 1RIHL 3LEXA 4KVNH 3WS3A 4I77L 4HKXB 4O02L 3TVMD 1MF2H 5IJKC 5BV7C 2ZKHH 4LEXH 4KMTL 1FZJA 1RZKC 4LRNL 3MJ6A 3S3PA 3V95A 1F90H 1AR1C 1U91A 4MD4A 1HOCB 3MLXH 2YN3A 4MWFB 1NCCL 2G2RA 2OXHA 2MWCA 1U3HC 1GZPB 4PGDB 4OQTH 1QZ1A 4KROB 3BFOA 1QBLL 4M5YL 3MV7A 2X7LB 3TCLA 3KPRE 3S35L 5MHSD 3MRDA 5E99H 1KV3A 1A6UH 4FQ2L 1T5XB 4LIQH 1WISA 4YFEA 1X44A 4M03A 1PG7H 4DFHA 4B7IA 3RJDA 1MNUH 5J7CC 1KPVA 4KI1A 3QT2A 4OLVL 3TBWA 3CK0H 2ED9A 4HS3B 1D5ZB 4G6ML 2LFGA 4TNVF 1F6AB 1JHTA 2A6IA 5GSRA 3MA7A 5FAAA 2QQQA 3NZHH 4P59L 4P5MA 3TBTA 1EAPB 1NQBA 4OQTA 2JJUA 1I1AA 1W0YT 3SGKA 5HJ3B 4D9QD 5I1CH 4NN5B 5I76B 3SDCC 4C59B 3O4LD 2R9HD 2VLMD 3UPRB 4AENA 2VAAB 3RVXD 5DD5L 4NIKB 2FJFB 3UTQB 3GSNB 3BGFC 2DDQH 3AUVA 1OW0A 1WFNA 4G6JL 4GKZA 1RUAH 4OFIA 4Y4KA 4GFTB 1N5AA 3OAUH 4OI8A 4U6VL 5BS0D 4JFEA 2WM0A 4KKAC 2VKWA 3VXOB 3NBNA 4N0YH 43CAA 2IBZX 3W5NA 2VLJE 5C7XL 3WUWB 1A2YB 2CR6A 2BNRD 2R29L 3BWAA 2CDEB 7FABL 4FQIL 4XH2B 5DK0B 2X9WA 4OGAD 5SWQB 1MREL 5ICZA 5CUSL 4KRPC 2XTLA 3ISWA 1ZEAL 3P3YA 4L4TD 4MGXA 1ONQB 3J7HA 5HHOA 2QSCL 4P23C 3V0WL 1NANI 2AGJL 3IXTB 3QIWC 3QO0A 4BH8A 3FT3B 1D9KD 3TA3C 3QEUB 4POUB 3M8OH 2CXGA 2J88L 3VXMD 2GYSA 1OP3K 5GGTH 3V7AE 4H88H 1NGXA 3GNMH 2OK0L 1MVUA 4JPVL 4NZUH 2VXVL 2VLRD 1JWSA 3MJ9L 5FECA 3I6GA 4NPYB 4RMSA 5TDOB 4YBQC 3HLAA 1RD6A 1E0OB 1GGTA 3EYVA 5I1IH 1JWMA 4F7PA 3WDHA 1WAAF 1S7TA 2JLLA 2CH8A 3A67L 1XGRA 4TSBH 1T6VN 2WBJA 4LLMB 4OCRH 4X8JB 5CIPA 5DMGC 5IBUB 1K2DA 3BRFA 1YJDH 3D25B 1N5YL 4Z9KB 4RA3A 3P4OA 4OGXL 12E8H 3JWOC 3G6JF 1IKFL 3DHMA 3IKCB 5DHXB 5GGTA 3EO9H 2DLFH 1E4JA 5C6WH 4L8DA 2YHGA 3GSVB 2E8ZA 2FDBP 4CNIB 4U6HA 2ITCA 4EIZC 3UJTH 4HKBA 3QUZA 2VDNL 1UA6L 4HUVA 2BVOA 3C87A 2GSGA 4JHWH 1VADA 4HMEA 1NBYB 2EEAA 4LLWB 1WCQA 3BHBB 2HFEB 2NW3B 3UX9B 1IM9D 1PYWA 1KCRH 3SGKC 2V2WB 2X2YA 4M43H 4NQDE 2IFFH 2R0WH 4Q9QH 4KK5D 4K3EH 1NGWA 5F89B 3TPUA 1ZHNA 4HWBL 5D7LA 1X7QA 4M7LH 1KELL 1OW0C 1I1YA 4WY7H 4LCUB 4RFEB 3F12B 4X5WB 5TF1L 3HZVA 4NM4L 1G6RL 1J12A 3MJ8A 1W72L 1NCBH 1EJOL 4PRNA 1GVIA 3TO4A 4G8EB 1C16A 3HC4H 3C09C 2E27H 5IEKB 3HPJB 5T1DL 4KRLB 4MCYA 2E6JA 3HRZB 2F58L 2AEWA 3DJ9A 2HG5B 5DURB 5T3XD 1L0QA 4M1GL 4L4VA 4XCEA 3EZJB 3H7LA 1QEWB 4ENEC 4U0RC 4X6BB 3L3GB 1LP9E 5C2BL 5K9JL 3TN0D 2YXFA 5F21B 1WBYB 1P7QB 1ND0A 1DEEB 5IIEB 4HX1B 5AG9A 3SOBL 5C07B 4APQA 1W2KT 1AD9A 2DAVA 4GG8A 5EBLA 3VI4E 4U6XA 5H35B 1N59B 5E6ZA 2JIXD 1OF2A 3KPSA 2VE6A 4XNXL 3VU2A 1A21A 5KN5B 1AGBA 2Q86B 5E03A 4HT1H 3K46A 1DBJL 2MMXA 3RBGA 1FHGA 1XR9B 5ISZD 2Y36L 3DVFA 1DLHB 4X7EC 5I15H 3IS0X 2PNDA 43C9A 2NY1D 1CFTA 1MJUL 4FABH 5I1KL 2WBJC 3V8OA 3STLB 3SKOB 1U2HA 4AT6A 4MMXC 2GKIA 4XBPA 8FABA 1NAKL 1T83A 4I48A 2JJSC 3U9PL 1DZBA 4WTWA 4DW2H 2KZWA 3KXFE 3ULUL 5HHME 1UQSA 4MNQE 3ARBB 1YEEL 4RISL 2EECA 5HI3D 1FNEA 3D5OF 1Y6NR 4O2CB 3CFEA 3QUZC 1G9NH 2OL3H 3MV9E 4X7CC 1UCBL 2YD1A 1FGVH 4JGUA 4F7CA 5BVJA 4S0TD 1LO0L 5J6HB 3UP1A 2W0LA 5FYKD 4Z7QE 1SM3L 1G7QA 5CILL 4HKZA 3WIHH 1BBJB 3MZGB 4P3DB 2H3NA 4HS6B 4WUUA 3IJYA 3V5DB 1S9WA 5D93B 3RPKA 5GRJL 1WTGT 4YX2H 4XNQA 4QLRA 3QI9D 3DMMA 4Z7VE 1KB9J 3VFSA 2IJ0C 4Q2ZB 1T1WB 3SQBA 8CGTA 2VUYA 3O6FD 2M8XA 4YAQA 3U2SA 2H45A 2X4NB 4LVOB 3WHXA 5E8OB 3EAKA 1NCDL 4K3GA 4MJ6A 2HFFA 4Z76B 1UEMA 1PG7X 3BDBA 4AG4H 2X1XR 1BX2B 1DN0B 4JDTL 1U36A 3QUML 1EA9C 4DEPC 5FYJE 4RZCB 3TO4C 3QISA 3T2NH 1XZ0B 4PJDA 4BK5A 2ZJSL 5D7JB 5E2VH 4PJ9D 1RURH 1H9VA 1KCSH 3WIHA 4BSJA 1KPRA 5ETUA 3L5WB 2F53A 4XVTL 3L5JA 3FOLB 5IMOA 4G8GD 3UZQA 1CDHA 3MCG1 4AIZB 1NFDE 4FQ1L 3INUH 4PJCE 2APVA 4U05A 1UB5A 4N8VB 3NPSC 1FO0H 1FNLA 5DQ9B 3TZVB 3PDDA 1MRDH 1UXSA 3V4PH 2AXJA 2O5YH 3BE1L 3E2HC 3Q3GB 4KPHH 4EN3A 2AQ3A 3OJ2C 2PYEA 4M8QA 1K8IB 3G6AA 1JPFA 2GJZB 3L3JB 4WW2F 4A6YH 1HHHB 4H26B 4IS6B 4NQEA 5MP6L 3LAFA 4PRBB 4XMKL 1R3KB 3V6ZA 5DMJB 4XXCA 3C5SA 4JFFB 4LCWA 5HHVH 4ORGB 5L6YH 2XZQH 2CR3A 1AQDA 5J9PB 1EHXA 4L3AA 2X4SB 1JZ6A 4P46A 3MRCB 3N1MC 3C8HA 4GAFB 1FRGH 1NUDA 5DEFB 4OV6F 5HYIA 1MEXH 3AGVA 4C56D 4XNZB 3QXDB 2APWA 3KPRD 1TPXC 4GW5B 4U2YA 5H8DA 1T83C 1FO0A 4UNVA 4LFHG 3S5LB 5D6DC 4CADA 2AJXH 4LAJH 3PGDA 3HE6C 3IFPA 4JM2A 5C0NC 1LE5B 4ELMB 3U30B 2B4CH 2PKDA 3BX7C 4FXKB 1JFQH 4L5FH 4WHDA 4XCCH 4LHQB 5J6GA 3MZTA 2IQ9L 3FB7B 1FFNA 5I30L 2FB4L 4KDWA 3RWCB 3T0EB 4YDKL 4NQUA 3UO1L 4KZEH 3EGSA 5CZVL 4ODTH 1HIMH 5CEXB 3VMNA 3TWCL 4B41A 4HWNA 2NXZC 1BFOB 1MRCH 2EE3A 1NGYA 5BCAA 5FM4A 5IKCA 4NJAH 4EBQH 4RWHA 5DJAB 5IGXL 1OAUH 4WENB 5SV4A 4HW6A 1IM3A 4AEEA 3DMMC 3V5KB 5ITBH 3WN5A 5ALBH 4OLEA 2AQ2A 3MODH 2IBGA 2ICWB 2DIAA 2EC9U 4WI2A 3C6SA 4FP8L 3VRJB 3BD5A 1PD6A 3P0VL 2KQMA 4ZQKA 4AJ0A 1L4IA 1CGTA 5IHZA 2DS4A 2MPAL 4MXWL 2F5BL 1T20B 2PXYD 1T7XA 3CFJB 2P8LB 4LPCA 5E95B 4K3JL 3CVIL 5EBMA 5C09A 4OIIL 5I2IB 3M45A 3OV6A 1A0QH 3ZKND 2LVEA 1TJHH 4EDXA 4UZGA 1MFCL 5SX5H 3WEXA 2DWEA 3LMJH 5EZIL 3VXUA 4XHJC 4ZODA 3DX6B 4TUJA 4DOHB 2AAVA 4KQ4H 5ICYA 5F9JB 4PJ7A 1LP9F 3D0VA 4ODBD 5E5MA 5EU6A 5GXBB 4F8QA 4X4XA 4UOW0 4DZ8B 2A73B 1JHKH 2NY3C 3V6FB 5EO1B 1INQA 3MNVA 1I3RA 4KZDL 3ZT7A 1CTNA 3VI4F 3LPGA 3OKKB 3BYYA 3LRSB 4R3SA 3BKJL 4O51A 4QCIA 4BZ2H 1F8TL 1K9TA 5DUMH 5HYJE 4EN3C 4NC0B 4UV7H 2HT4C 3MUY1 3BD3A 2DJUA 1XF2B 1JGEB 4NO5B 1XH3A 4KJPD 5JO5A 4PGEA 1VFMA 2ZG1A 4LSTL 1CTOA 2CLRA 1KTLB 4Y2OA 3V4UH 1J8HE 2FO4B 4FQCL 4RMRA 5IJVB 4ZOBA 5HHPA 1NUNB 4XXCC 4K9EL 3O8XD 5D70H 2JELL 1MIML 4TRPH 3IDYB 2PO6A 3I02A 4FQJL 4LLDA 3QDGB 3KHQA 4QTHB 5DFTA 4HEPG 3T0BA 2GFBA 3WKNA 3R1GL 4NQXA 2XRAH 4P23D 2FX8H 4JKMA 4K23L 4R26L 1R24A 3VA2C 4D9LH 3WUZA 3ES6A 1P4LA 3RVVD 4JM2C 1AXSA 5DMKB 1KPUA 3VDCA 4KK9D 3FMGH 1S7QB 4O2EA 2F8VA 5IMKB 3NIGE 4U1GC 2EDKA 4P2OA 3MR9B 4ZO8A 5C0RL 4Z78B 5IVNA 2PN5A 2W0FA 4Z7QF 3VMOA 1OWWA 1HCFX 2HJLB 3PG2A 2FZ3B 1VEOA 4X8XA 5CD5D 3BGMA 2QQLH 4MNGE 5JLZB 4N5EC 4NHUA 2NR6D 1NL0L 2LV4A 1V3KA 4ZFOB 4NJ9H 1H0DB 1K8DB 4Z7VF 2H41A 4OI9A 1T89C 4HV8A 3R06A 4NFDA 4LRIC 4UDTB 1LK3L 1RUPL 2EYRA 1G1CA 1I8IB 2IH1B 4NQDD 4ONHB 5JHDE 4PUBL 4FZEH 3TIDB 3K2MC 4NYLA 1UFUA 1CE1L 5DRXB 3U46B 5SX4H 4QTIL 2FYYA 5TE6H 1H3UA 2G5BA 3OXRA 2ERJC 2XT1B 3CGTA 3QRGH 5GIRA 4KGLA 5HPOA 2FHBA 1Q94B 4TUKH 4FFVD 1NAMA 1TZIB 4P2YA 3BD4A 4G7VL 2Y25A 5F9WC 1S8DB 3RKPA 1CFNA 3SDAA 1LEIA 3BT2H 3RU8L 3MLXL 1FFPA 1LWRA 4L3EB 2AW2A 4QRRB 2BHZA 1OOAA 1DBBH 5GS2H 4XX1G 4F33B 3JSSA 1NFDF 5F1IB 1DE4A 1CLOH 4J3OC 1OSZB 1F4HA 1QFWH 3LZFL 4HPOH 4DKAA 1T2QH 3HR5B 4EI5A 1QFWM 2X05A 4JAMB 1FDLH 1FJ1A 3FQUB 3FN3A 4O9HL 5EIQA 1U8HA 5M95B 5HGBB 4NSKB 4TNWF 1SJEA 4KUZL 4LQFH 5C0FA 4HLZH 3DVIA 4XP4L 5A2KH 3E0GA 3UTTE 3CK0L 4PRPB 3VI3E 3JWDL 4AEHL 1XCTA 3D3VA 3RVWC 1EFXB 1BZ7A 5KS9E 4AIXA 2IADA 5JPMB 4UIKH 5A2IH 3UTZA 3EJJX 2NY5C 3ZYIA 4HUUA 1FNGA 3PGFH 4FXLA 3WL9A 1G6RA 3SE3A 2DI8A 1FVEB 4I5BA 5FDWA 1BJ1H 3OB8A 4XVJH 2PO6C 2R2BB 3IFOA 1OCWH 3GKWL 2VERN 1LMKA 4F15C 1A4JB 1BQUA 4OKDA 4X6CA 1HHIA 1PJ9A 3QEGH 2R0ZL 5H37G 2IPUG 4YNYA 4Z7WB 4J1UB 3R4DA 1CD1B 5HHMD 5F1KC 3VFMB 3NFPA 4GRMB 5D4QA 5T1LB 2ORBL 4X6FA 1WCBB 4M8VA 1JGDB 5EO0B 3U0WH 4GBXD 4ZPVB 4WFFE 1U3HB 3VFWB 2P8PB 4PJIB 2OTUB 1AE6L 2ZG3A 4ZNCD 2C1PB 4Y4FA 2NXYC 3V4VL 1CI5A 4OJFL 5I66A 5F71A 5JOFA 3LOWA 1G7IA 3FN0H 4EZMA 5L2JB 5BRZA 3BPCB 1BJMA 4NHCL 4ESKA 3DBXB 3LEYH 1SY6H 2CKBA 1T66D 4H88L 2HJKA 2WIIB 3GNML 4DWHA 3CVHL 3VWJC 5BJTB 2E9JA 2WWKT 3RWDB 3FQTA 4ZYKB 3RGVD 3N0PB 3N50A 1MJ8H 1U8PA 5F8RC 5FYJD 4MDIA 5I1IL 3SY0A 1AGDA 3SDAC 4EVNA 4M1DL 2I24N 3SJVB 1WJ3A 3GMPB 2HT3D 2XKUA 3OR7B 2ZSWA 4OCRL 2J8UA 3V52H 2BNQE 1RV6X 1INDH 5CSZA 2AS5M 4JCLA 4Y8AA 1NUFA 4PLJC 4WGVB 2ARWA 4XTRC 3BSZH 1H15B 3ZTNL 4NQVA 4YZFE 2DQTL 2PTTB 2VITB 1YDPA 1ZT7A 2H32A 3BZ4A 3QA3B 4EI5C 1SY6A 3BVNA 3UYRL 4ZUTB 3MREB 4WI3A 1VERA 4JFFE 4MQSB 5D1QB 3DROB 3MRJB 2VWEC 4X4ME 1P5VA 2X1WL 4UB0L 4C58B 3EOTH 1ZHBB 4KROD 3MGOB 1A6AB 1FZKB 1S7VB 4I13B 1Q9LB 4Z7UE 1Y6MR 4FFYH 4E5XA 1A6ZB 1X6LA 5E56A 4LSRH 5I16A 4ODXA 5BMFL 5GRZA 3IB4A 2VLKA 1NGQH 4Y5XC 1KCRL 5KSUB 3KR3H 5DC0A 3QIWB 3HFMH 2EXWC 3QUYA 2D0GA 1HHKB 4RRPA 5MEPA 3AREA 2C1OB 5IT2L 2X44D 4JO1L 2ICEA 3PWLA 3U0TA 2C26A 5FHAH 1NGZA 4K3EL 1XF3A 4N1CA 2GK0A 3LEXB 3WS3B 1MHPL 4XP1H 1GAFL 1IC4H 1LDSA 4HS8H 3WLWC 1T0NA 5KZCB 3NIGF 5GGQH 1C7TA 1FZJB 3ALWA 3MRPA 1OP9A 1U91B 4E41A 2BDNL 3ULVD 5MEOB 1YEJL 2E27L 2EDYA 3BZFA 4F7TA 4JFQA 1HXMA 2G2RB 2EH7H 3NCEB 3TT3L 4QXWA 1S5HA 2EYTA 2UY6A 1MCOL 3K0WA 2D03H 1G7JA 1NMAL 2AK4A 3TCLB 4OF0A 4YHLH 2NTFA 5T1MA 3QG7L 1D7FA 4MA7L 3ARVA 2OP4H 2R4SH 4PFEA 3UBXA 2VLLA 5IHLB 3KYMA 3PQYA 4GG6E 2VDKH 4YH6A 4NO0D 4MJ5A 3SDDA 5CKAA 3QWRA 5IVXA 1BREA 5KVMC 4I0PD 5CJBA 4Y16A 3TBWB 5A43C 4LMQE 3HE6D 4FZ8H 3V9FA 1JHTB 2A6IB 4HIJA 5GSRB 3MA7B 3U1SH 1G7MA 4P5MB 1J18A 4NNXA 3TBTB 3ULUC 2VZTA 4PRIA 3QQNA 4TSCL 1MFAH 5E6IC 1P6FA 1CU4L 2ADJB 2NYYC 2Y06H 3P2TA 5C08E 5I15L 1I1AB 4P4KB 4FABL 1SJXA 4GW4A 3CMOL 2BK8A 3LH2H 1FBIH 5CFHA 1OSPL 5B8CA 2JK5A 4U1LA 1A7OL 4AENB 5A3ID 4G9FA 1QHPA 4NO2A 3CJJA 1AXTL 4GKZB 4Y4KB 5KSBE 1VENA 3G9VA 1N5AB 3CH1A 3STZB 1JZ8A 3HB3C 1KN2H 4DW2L 2FATL 5C0AE 5C2UB 5MENE 4LCCA 2N7BA 1H3TA 4JFEB 2P5EE 3VI3F 1AHWB 1UACH 1F2QA 2DLEA 43CAB 3QUXA 2HT2C 3NZ8A 5IWLA 5KS9F 1MHHA 3MUZ1 4POZD 3GBMH 3RVTC 1O7SA 2D7TL 3GZKA 5HYJD 3C09B 3HUJA 3QFJE 3TESA 3MRRA 4Y0GA 1MJ7H 2OL3L 3LN9A 1DQML 4XPGL 1JMZA 4KRNA 4N9OB 3X13A 5ICZB 4YHOL 1I7UB 1PX4A 1J8HD 1KB9K 3ULUE 1QVOA 2VL4A 2ICWJ 2FJGA 1NANH 1YY9C 3MNWB 3QO0B 4BH8B 4PGJA 4XHJD 4FS0A 5D2NA 5SWSE 5TGBA 1RZFL 4Z6AT 3NIFE 2P24A 2W65B 2VNCA 4UIMA 1Q0XL 1NGXB 4NKDA 5CJOH 1RZGA 4YHIA 4O4YH 1YPZE 5L8LB 2XG4A 3MGAA 1JWSB 1JPSH 5FECB 3I6GB 3D87B 4F9PA 1FC1A 5DRWA 2WW8A 3HLAB 5L88H 1JJUA 5TDNB 3PL6A 3EYVB 1JWMB 3G5XA 4JRYA 2I26N 1DANT 4MVBD 3W39A 4F7PB 3LKQA 2C7UA 1S7TB 5EC1A 1AGEA 5E2VL 4IRJC 2HT4D 5GS1A 3S98A 2X41A 1XGRB 4RRPG 5CIPB 5E08H 1K2DB 4MXQD 3I50H 2BOBA 3CMGA 3DYPA 1D6VL 3P4OB 1IBGH 3BP6A 3INUL 3G5YA 4CMMA 1YQ2A 4S10A 5JHDD 2P5WA 1H5BA 4HC1A 3D39E 4NC1C 3SDDC 2GTZB 1GGCH 1Q8MA 2N4IA 5C70A 1EZVX 1LD9A 4ELKA 4L8DB 3WO3B 1VHPA 3KG5A 2O5YL 4U6HB 2ITCB 3MJGX 4KPHL 4Y16C 1X5XA 4HKBB 4M62L 3L95A 3QUZB 2W0PA 4HUVB 2GSGB 1VADB 4NRXA 5DURD 5ENWA 3X14A 4LQ1A 1KTDB 1JNNH 2W9DH 5EA0L 2LAAA 3RUGA 2XA8H 2DJSA 5TQ0H 5HHVL 5L6YL 2XZQL 1PYWB 4G8FA 2XNAA 4P9HH 2HKHH 4OLWL 3UBXG 4QWWD 1MAJA 3IFNH 3ARYA 3D85A 2G75A 5C0BE 3EDFA 1P7QD 1MEXL 5C9JA 3BO8B 1WF5A 2ARJA 4YZFF 1ACYH 3OKLA 5B8CC 3GSXB 4ZTOH 4PTUA 4JFOA 3TPUB 5KVGL 1ZHNB 5D7LB 5JA8B 1EDQA 1X7QB 1I1YB 2NY2C 4ZTPL 4LCCC 3HZVB 3SGDI 4N90E 3MJ8B 4NC1E 3H9HA 3SO3B 1UKTA 4PRNB 4OLXL 4DEPB 5DS8A 3TO4B 5IWLC 1C16B 1I3GH 3UTTD 1LEKA 1N4XH 1VFOA 4Z7UF 2Q20A 4MCYB 2X4UA 4UU9A 3TEUA 4KZEL 1HIML 1NDMA 1QSZA 5DJ6A 4NP4L 3Q5YA 4L4VB 4XCEB 4NJAL 3O2WH 4ZOCA 3S37L 1FIGH 2IPTH 3RWJB 4YWGL 5ITBL 1EBPA 3NPSB 1JK8A 4YGVA 1U8KA 1SVZA 4GS7C 1L6XA 2V9QA 3MFGB 4QOKA 4APQB 1AD9B 5EBLB 5HBBA 2B1AL 4U6XB 2J5LC 4ORZC 2QQKH 3KPSB 5B4MC 2VE6B 1AGBB 1CDUA 1IGML 4FA8A 2R69H 1RVFH 2V5TA 1A0QL 1CE6A 3MACL 1TJHL 3SKNB 5DI8A 4XWOC 1BQHA 4WFFD 3ZMRA 43C9B 25C8H 3F5WA 4Q97A 1IT9H 5BW7C 4KQ4L 4HQQH 1S9XA 1KJMA 3CC5A 4AT6B 4XBPB 1XF1A 3EFFA 4GRWH 1FL5A 8FABB 4GG6F 3O45B 4I48B 2OQJA 4BQCA 4OI7A 2IQAB 5FGBC 2DQJH 4M9PA 4QRUA 5HHNA 4JGJA 4JFDA 2ESVA 4K9EC 5GPRA 4YFLI 5IMMA 1UQSB 4LSUH 1CDBA 4UDUB 4E42A 1KJ3H 2BNUA 1FNEB 5LWYL 3CFEB 4RAHA 3S6CA 4UV7L 1WK0A 1BBDH 5CEYA 3QCVH 1JIBA 5CEZE 3JZ7A 4HBCL 1T4KA 4F7CB 1F3DH 1QBAA 5E4IA 3WIIH 4V1DE 1OM3L 1G7QB 2EDHA 5K9QG 3KPPA 4HKZB 1CICA 5EOTB 2H3NB 3BKMH 4WUUB 3IJYB 2D7MA 1MPAH 1S9WB 1OAXH 4HK3N 4XNQB 3DMMB 3VFSB 4XAKE 5KSBF 1FYHB 4YAQB 2XRAL 3BPOB 2NXYD 5FUZL 3U2SB 2FX8L 2VZ1A 3VMPA 3WHXB 3GO1H 4O58H 2DQIH 4Y4HA 3GIZH 4OD2B 1QFOA 3V6BR 5IB2A 4D9LL 4MJ6B 4PJFE 2HFFB 3UC0H 4PJGE 2XTJC 1QKZH 1J05A 3T3MF 5K9OA 3DGGA 3V6OC 2N56A 4JFFD 3ARFA 3UAJC 1OAYH 3RNKA 1PY9A 3ARTA 1DVFB 2XQBL 5JNYB 1I7TA 3HCVA 4BK4A 1WEJL 4U7MA 2QQLL 1HSBB 3C9NA 3ULUF 4KUCF 1BZ9B 2AV1A 3CVHA 3SN6N 1KPRB 5ETUB 1V8HA 2F53B 3IFLH 3B9DA 2WBKA 3GMQA 5KANG 3BP7A 1KB5H 4XCFH 2WMPA 3S88L 1UB5B 3NIFF 2X4OA 3EYQD 4X80H 5FCUL 3AAZA 4K7PX 4OCNC 4XTRD 1IJ9A 1CGWA 1UXSB