1FL5B

The unliganded germline precursor to the sulfide oxidase catalytic antibody 28b4.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGSYAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY GERMLINE PRECURSOR TO ANTIBODY 28B4
publication title A comparative analysis of the immunological evolution of antibody 28B4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 219
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl5B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl5B01
1Z9SA 2FX8H 4YHYC 3C9NA 1TJGH 1VPOL 1AO7D 3K46A 4N1CA 4O2CB 4O58H 1JCKA 3TIEA 1A7OL 2DQHH 4BUHA 4U1MA 4J6RL 4C83B 3RWIA 1MPAL 4LDOB 5DJZB 3EFFB 2OP4L 5EOQH 12E8L 4HBCH 3SOBL 1H8SA 4F33A 32C2B 3WFZA 1WWAX 4GG8A 4BK4A 4JFFD 4UB0L 3VRLF 5JHLL 2R69H 2BSTB 1AP2A 3PWUA 2RCSH 2JLLA 3GB7B 4KDTA 3QUXD 5T5FH 2YXMA 3HI1A 5C0FA 1Q38A 4DVRL 5E56A 2FGZA 3OPZL 4LARL 5TE6L 4D9RD 3OL2A 3D5OF 4JY6B 3QI9A 2GTZA 3GUTB 5E99L 3MR9A 4YDJB 4NN7C 4Z76A 2N1KA 3VG0H 3WIIH 4WW2F 4UV4H 5DFVD 1BFOB 1BWMA 4WENB 4LU5L 1KBGH 1TVDA 1VB9A 4K7PX 3SKJL 1T6WA 4Z77A 5ILTL 4JFPB 3P77B 4LLWB 1UB6A 3S97C 4TSAH 2JE8A 1FZJB 4YDKL 2V9RA 5ITBH 1OWRM 1FO0H 2NR6D 1OPGH 1P5UA 3IDMA 3QHFH 4U1HB 1L7TH 3QIWC 1MLBB 3NFSH 3VXPA 3NN8A 1JZ8A 3MV8E 3STZB 4ODHH 3RPIA 2UVEA 4Z7VB 5FHBH 5MEND 1Q94B 4YIQB 3LQZB 4XCYB 2QQQA 5DA4A 4JKKA 2VXUH 3ARGC 3BEWB 4MA8H 3QG6B 2ARWA 1EAPA 4EOWL 1N0LA 3W9DB 5CEYB 3S6CA 4PJGE 4NM8L 3QG7H 2W60A 1IFHL 2ZNXA 5I8CA 3CFDB 1MWAA 4O02H 1K4CB 4Y4FB 4PD4K 3TNMB 3EZ8A 5ACLA 2R2BB 3A67L 2QQKH 2ZSVB 5HYSA 2EECA 1MRFH 5JPNB 4BZ2L 3HE7D 5GGQH 4OKDA 3GIVB 2WBJD 4I1NB 4HH9A 1BFTA 4HV8B 3QO0B 4QOKE 5C0CE 3F5WA 3LKNB 1PD6A 3UPRA 1V05A 1ACYL 4X4XA 4X5WB 1TTUA 3HE7A 3G5VB 1YDPB 5D1XA 5HHME 2WBJA 3BE1L 5E8DH 4DN4L 5E8OB 4O5LH 4P3WA 2PCPA 3SE3A 2R4RL 4M62H 4WU7A 5KZCB 5D7SH 1UWXH 4M6OH 1KB5B 1CK0H 5DMGD 5CGYC 3T2NL 1JE6A 4DFIA 1KPVB 5A2FA 5IMKA 4PRDA 5F9WC 1NFKA 1WUNT 4YEEA 5C0BD 2Z35B 4KJPD 1CLYH 1T20A 4JQVA 4FRWA 1J5OL 4WI8A 3L3HB 3A6CL 5CMAA 5C0IB 2F15A 1T80A 3ELAT 1HYRC 2G2RA 1DBBL 1T66C 1G9NH 5BOPA 5JDSA 1NPUA 5DURD 3P2TA 3D69B 2NTFB 2ICWJ 5GRXG 3GSWA 1HSAA 5T3XD 5HBBA 1JGUH 2H2PC 4Q2ZB 5E4EC 2GKIA 2IAMC 3HCVA 1RZGB 5KW9H 3VRJB 4HWZA 3AREB 4HG4J 4BM7A 4OCWL 2NX5E 3H9SD 1UACH 4NZRH 1LMKA 4NQDD 4QRRE 1CIDA 2DTML 1MH5A 1XF4B 4KJQC 3D39D 4MXVE 5E1AA 2H3NB 3H9SA 3OKNB 4HCRH 3QT2A 3BGMB 3FO0H 2DMBA 4U1GC 3VXME 1O0VA 5LGHH 3IXTB 3LEXA 4FQQB 2JIXD 5T1DL 1AGBA 1U95B 3QDGB 4RA3A 1P2CB 1J0IA 2I60H 2VC2L 2DLTA 3UDWC 3VXRB 4Q9CA 1HOCA 1OSPH 1WFUA 4P5MB 5ICXB 3GI9L 2UV3A 5GSRA 1LP9E 5GGTH 2J8UF 3SDXE 2NXYC 3LV3A 2ZSWB 4IRJD 4GRLC 1KNOA 1RIVL 2O5YH 3ARBD 3CFCL 4R90L 4IOFC 4N9GA 2I07B 2I9LB 2J5LC 3SDCC 3TA3C 3JTSB 4LQFH 2DM3A 1FRGL 4HF5H 4X6EB 2B4CL 4X5XA 4MB3A 4ZUTA 3S37L 3C9NB 4IRJA 3I2CL 3BDYL 3ARBA 4YBLB 2M2DA 4PPTA 3UJJH 4CN1A 4Y2DD 3TIEB 1LNUA 2DQCH 1ERNA 2NY4C 1P6FA 4OZHA 4U1MB 2ADFL 1CR9H 3RWIB 4JB9H 5E2VH 4R2GB 3MRMA 3MGAA 5AAWA 5FYKH 3RWGA 4U6YA 4Y2DA 1RZKC 2D03H 2VLKD 4F33B 1X7QA 3GBLA 1UCTA 3MC0A 4GG8B 4QNPE 4XP6L 3K4AA 4F9LA 2ESVA 1YC7A 1F5WA 5M94B 1AP2B 3PWUB 5LQBL 4NZTL 2KUTA 1T4KA 2VLKA 3HI1B 3QHZL 5C0FB 1CGXA 3QEGH 1VFMA 2X4RA 5EBWA 3HI6H 3B9AA 5JXEA 1KB5H 3QI9B 5EOTA 2P24A 2GTZB 4S1RL 3MR9B 5E6YA 4YH6A 4Z76B 1R24A 4LIQH 4WRLA 5FYJE 5JIHA 5I8OH 3PP4L 3JTTA 4WUUD 5DFVC 4Z77B 1UB6B 1KC5H 3SGEI 5DQ9A 1IQDA 1Y18A 3ARDD 1LEKA 1F2QA 3MNWA 3VGAC 4K71C 4L8BA 3IDMB 5TGBA 3EDFA 2VDNH 3DURA 2IBZY 5HDBF 4WUUA 2B5IB 1T04A 5HVWA 5I71C 3VXPB 3NN8B 4FQ2H 4XP4H 3RPIB 5HY9A 4M5YH 4MGXA 4LDEB 4PB0H 1UJTA 1FORL 3GI8L 3NIDF 3TBTA 3C5JA 3WLWC 1R3IH 2YRLA 1EAPB 5HVHC 2VLMD 2PUQT 4KKBD 3N1QC 4Z18A 3HTLX 1OW0C 4ODUA 5F1IA 3OAYK 2W60B 5E6ID 4WFHD 5IEKA 5I8CB 4J4PA 1I1AC 1MWAB 1RZJL 4HQQH 1Z5LA 4NN5B 3QNYA 1UKTA 2FYYA 4HKZA 5D5MA 1F00I 3VXUA 4C56A 5HYSB 3TBVA 4U1SA 5E6IA 4AY0A 4XTRD 3O41A 5F7HA 4HH9B 3BP7A 2CUIA 4KZDL 5GXBB 1G6RA 5H37H 5GGVH 1FH5L 3F5WB 3PQYE 3UPRB 1PG7H 4G6FD 3D85D 3CJJA 3HC0A 4X4XB 5T3ZD 3HE7B 4ODSH 5D1XB 4HC1H 5L7XL 2VDOH 4QTIH 1ZEAL 2WBJB 3RX7A 5JPMA 5HYFA 3I9GH 1DTUA 4NO0D 2PCPB 4TULH 4WU7B 5CD5C 3D85A 4KTEL 4AEIL 1QSEE 4FQ1L 2QV2A 5GQBA 2I25N 5D70H 5EZIH 4DTGL 2FWOA 5T5NG 1C7SA 5INCA 4YXLH 5IMKB 4PRDB 3T2PA 4U0RC 1T20B 5MHSD 1V7ML 2NY6D 4MJ6A 5I6XB 4Y1AE 2IF7A 5CMAB 4M03A 2ORBL 1JUFA 2G2RB 2X42A 4Y5YA 4HJJL 1BD2A 5JDSB 1OAYL 3O2VH 4ERSL 3OJDA 5MEQA 4P9ML 1ORQA 5EOCJ 4U33A 2NY1B 1G7QA 1HSAB 3GSWB 3SKOA 1OQXA 2IC2A 3HCVB 5DVMA 4OZFH 4OCXH 4HWZB 3PDDA 4YEFA 2ADIA 1IRAY 1D3CA 3LKOA 5DURB 3RX8A 3CD4A 4MMZC 1JIBA 3GNML 1AQKL 2YXFA 1H5BC 1I3UA 2APTA 2F58L 1BVLA 3A6OA 5C08E 1MH5B 5D7KE 2XXMB 5FAAA 4QY8A 5IK3A 5E1AB 3H9SB 2C3WA 3ARWA 4G6KH 5T1KD 1IAOA 3G6JE 3LEXB 2OR8A 4KTDH 1AGBB 5DXWA 3B83A 5E6ZA 2P5ED 4XMKL 4GXVH 1HOCB 5J11C 4URTB 1DVFD 5IB5A 1QO3A 1RJZA 4EXPX 5GSRB 5T1KA 3LV3B 5B3NA 1N0XH 3GMRA 2H26A 1N59A 1KNOB 3BMWA 3BZFA 4N9GB 4YWGH 1U3YA 1DVFA 2XQBH 5C07A 2ZG2A 1U91A 4X5XB 1LD9A 4ZUTB 4PRAA 5F1KC 4KKLD 2FD6H 4JM4L 4IRJB 3ARBB 4MJ5A 2JJUA 3S3PA 3IKCA 2VXSL 2W1NA 2BHYA 1T7XA 1MWAH 2Q3AA 1LNUB 5CD3A 1WFNA 1EBAA 4OZHB 2WUBH 4IIQC 1UC6A 5CINH 2HWZL 2LE9A 3LRGA 4LSDA 5C0JA 3EOBA 1F3JA 3CX5J 4S2SA 1BAFL 3MRMB 3RWGB 4U6YB 4Y2DB 5EUOA 4LLQA 4M4PA 1X7QB 4AL8H 4Y8AA 4GMTH 2BRQA 2H45A 3DIFA 3P4MA 4PJFA 2YMXL 2ESVB 2E8ZA 1RUKH 3NA9L 4PJXE 4GRWB 4K7FA 1T4KB 2VLKB 4MAYD 3MBEA 4Y4HC 2GITA 1OP5H 3DVGA 3QXWA 2X4RB 3PDGA 5EBWB 5BRZD 2AEQH 1LK3L 5IBUB 5EOTB 2P24B 1RJCA 2VLJD 5A16A 1R24B 2XZCL 1D5IL 3JTTB 1J10A 3MRBA 1MHEA 2OL3H 5I74C 2Y9RT 1FYHB 3N1FC 1BJMA 5DQ9B 1IQDB 1Y18B 1FNLA 1LEKB 3LEVH 3OGOE 3MNWB 3SDYH 5JW3H 4L8BB 5TGBB 2Z93A 3ARDC 3C6LD 4LL9A 3DURB 2D0FA 1MFAH 4WUUB 2ERJC 1T04B 1OTUD 2UWEE 4PJHE 4V2CB 5HY9B 4KHTH 4KI5E 2WSKA 2DOCA 3B9KD 2O61A 1I3GL 4YHLH 4WFGD 1X5LA 3NABL 3TBTB 3C5JB 3VFOA 1WISA 4OLZL 1JF1A 1AXTH 4XVTL 2EIDA 5D2NA 1OP3H 4XGZA 1MCCA 4ODUB 5F1IB 5KVEH 1HILA 3STLA 3B9KA 5IEKB 4RMUA 4DOHB 1C12A 1Z5LB 3NVQA 1MCSA 3QNYB 2FYYB 4HKZB 2BVTA 2CKBA 5D5MB 2B4CC 4PLKD 5F7MC 4QXGH 3VXUB 4C56B 5K9JH 4Y7MA 3TBVB 4U1SB 5E6IB 2Y36L 3F7RA 5E5MA 3MLSL 3MRCA 3O41B 2N7AA 4KUCF 3BP7B 1NKRA 1G6RB 1X4ZA 1MVFA 4GG6F 1A1MA 3ZKXC 5GGSA 1JZ5A 1F97A 1MF2L 3HC0B 1TDQA 1M71A 5F8RC 1CE1H 1XGYH 4WY7L 3UZEA 2BVUA 1GGCL 1B6UA 1A6ZA 4XWOC 4JHZA 4UUJA 5JPMB 2AI0L 3V8OA 4M6ML 2RIKA 2FL5A 3F6IA 4FP8H 3D85B 4NC2B 3O8XD 3QDMA 5JW4N 5BVJA 4TOYH 3DWTA 4K94L 5EC2A 4FHBD 1U41A 3IT8D 1U8QA 2FWOB 1YNKH 3ABZA 5INCB 4LAJH 4M3KB 3WEXA 4JRXD 1P9MC 3V6OC 2C1OA 5D2LA 2DJSA 4JR9L 4MJ6B 1RUQH 2OR9H 2BERA 2NY6C 4U3HA 2BFVH 4JFHD 2FECI 5LGJA 1E4XI 1NCAH 3VRLE 1JUFB 5FYLH 4Y5YB 1BD2B 4F37K 1O7SA 1QUNA 1CU4L 4K07A 1J8KA 4Z0BL 3OJDB 5MEQB 1ORQB 1H15A 1G7QB 3SKOB 1A9EA 3M1BA 3UPAA 3L5WA 2ADIB 5KVGL 4L3EE 3ZLQC 3LKOB 3AB0C 4GRWH 5EU7C 1RUAL 2EH7H 2D7TH 1MIML 3D25A 1UGNA 3QRFM 1BVLB 4P23A 4U05A 3P11H 1F4WH 2EDLA 4PGZA 4X7SH 4DGYL 2HKFH 2ZUVA 4WJ5A 4UTAL 4QY8B 5IK3B 4FFWC 3P0YH 4LRIA 1S5HA 4YHPA 2VKXA 1U3HC 3MO1A 1ZTXL 1QSFE 4JO3H 4ZD3H 1IAOB 5IT2L 3GMNA 1RZJC 3B2VL 3MV7E 3LVEA 4PLJC 3U9PL 2V5RA 3U2SA 3MRHA 4M9OA 1I1RA 5F6HJ 3VXNA 5IB5B 1QO3B 1RJZB 4XNYL 5T1KB 3LD8B 3GMRB 1X5AA 2DLFL 1N59B 2H26B 2YD5A 1GGYA 3BZFB 4NOBA 1DVFB 5C07B 1BEYH 1WZMA 1KCSH 1U91B 3CLEL 5FYJU 4X7EC 5DT1L 1LD9B 4PRAB 4OM1L 1JJUA 2IH1A 2FEDD 5CJBA 4OZIA 4JFZL 3VMNA 1YPZF 4MJ5B 4Z95H 3IKCB 2OJZH 1RUML 5I8KH 4N5UA 4AZ8A 3H42H 2F5BL 5CD3B 1KACB 5L8JB 3V9FA 1ZT4A 2XKNA 1GL4B 5C0JB 3EOBB 1F3JB 3QH3A 4S2SB 1KPUA 2HVJA 3D9AL 5EUOB 4LLQB 3V0VA 2VDKL 4KU1A 1G6RH 4HS8H 4PJBA 3DIFB 4ZO8A 3LKQA 5I73C 1IGIH 3P4MB 4JRYD 4PJFB 1MFBL 4CRPA 3SJVD 2AV7A 4HZLA 4K7FB 1NMBL 4ONGL 1LDPH 5IFHH 3UTTE 3SO3C 3B8YA 4BQ6A 3MBEB 4KHXH 2GITB 2PETA 3DVGB 2GY7B 4MAYC 1IAII 1NUFA 4ZXBC 3IS0X 5LJYH 3GEWB 1L7IL 4XAKE 1HYSD 5A16B 3G6DH 1K3ZA 4TTGA 3MRBB 1MHEB 4WO4A 5GS0D 3R0MA 2VB5A 4L9LC 2CJUL 1V3JA 5HI3D 4HJGA 2EEDA 2Z93B 4TRPL 1DQDH 3EUUA 2E8YA 3C6LC 3H9ZA 3QZWA 3RAJL 5JUEH 1FGVH 1OTUC 4WV1A 3EYQD 3K0WA 2O61B 4KROB 1DLFH 3VFOB 1JF1B 3L9RA 5D2NB 4XGZB 4LLUA 1HZHH 2BHUA 2O5XL 4Z7NF 4WEBH 5INDA 1HILB 3R1GL 3B9KB 3STLB 5A2JH 1C12B 1J88A 3MLYL 2DI8A 4LGPB 3TO4A 5I0ZA 1MCNA 1CLOH 2CKBB 3K1KC 4KK6D 4PLKC 3GIZH 3PNWA 1FFRA 5EWIL 1QLFA 3V7AG 5E5MB 4EI5D 3MRCB 1QD0A 4KMTH 1SBSH 4OLYL 5EZOL 5FECA 3VH8G 1A1MB 2E9JA 3LHPL 5GGSB 5HDQL 1BM3H 5GRWA 1M71B 2AGJH 4XP1L 2R29H 1DBJL 3V4VH 4EI5A 3CLFL 1A6ZB 1KG0A 4UUJB 1Z9MA 5GGVY 3KR3H 2FL5B 2X1WL 2Z0BA 3QDMB 2YWYA 2JB6A 3MRGA 1QBAA 5BVJB 4UV7H 3O8XC 5B38G 2EDNA 3UBXI 3W2DL 4GKOA 5EC2B 4YHZH 1A7QL 4LSQH 1WAAA 4FABL 5ADPH 1U8QB 1OGTA 1UFUA 4LLDA 1S7QA 4JDZA 3MV8D 5D7JC 3TH2T 3WEXB 1JWSA 4XVJH 2C1OB 2APFA 5D2LB 5TJWK 3BD4A 1X5FA 5D71H 2ZKHH 1DDHA 5LG1A 5LGJB 2COQA 4ZFOL 5LXGH 1JNLL 3ZKMD 5DHVA 4PBVC 1IT9L 3V5KA 4PJ9D 2B0SH 1H15B 5J89A 1BZ7A 1KCVL 2AAVA 2P8PA 5IM7A 1CXKA 2PNDA 2V5YA 1MNUH 1A9EB 4PJDA 2DL9A 2UZYB 3M1BB 1DBMH 4LEOA 4PR5A 4PJGA 2H32A 3L5WB 1LWRA 5K9QG 5E5UB 2PXYC 2AXGA 4PD4J 2BXZA 1XIWD 3MLZH 3TJEL 3D25B 5KVDL 4F15C 5IB2A 1A2YA 4QOKD 5C0CD 3NCEB 4P23B 3VXSE 1FNHA 1II4E 1WCQA 4WJ5B 2H1PH 4IOIA 3GDBA 5HHMD 4QYOA 2BHZA 3FHAA 2WZPD 1S5HB 4YHPB 4HWEH 3GHEH 1YMME 4F9PC 3OKEA 1RJYA 5I1GH 3IU3A 5C0CA 3MO1B 2K7PA 3GMNB 3MA9H 5SV4A 2NY0B 3U2SB 3WO4B 1CTOA 2KZ1B 4UMGA 3MRHB 3BQUA 3NIDE 3JWOH 4F57L 1FNAA 5GRUL 1WBXA 3VXNB 2VXTL 1U93A 4RQQA 2Z91A 4R4FL 3ZO0A 5DJ8A 4RFOL 4D3CH 5E4IA 3QPQD 2HTKD 1PFCA 1OM3H 1GXEA 4MX7A 3DO3A 4Q9RH 4JHAH 3RI5F 2IH1B 4DEPB 4OZIB 3B4NA 3AROA 2Q1EA 3UMTA 3ZDXF 4JFQA 3RL1A 2YWZA 1T2QH 1Y6NR 4NQXA 4YHIA 1Q9LA 1ZT4B 4ONHA 4X4ME 2CKBH 2XKNB 4LCIL 1MRCH 1FJ1A 3WHE1 3QH3B 3RJDA 2NX5D 1KPUB 2HVJB 3GK8H 3WCYA 1QBMH 4QRRD 5B39G 3V0VB 5AD0A 1ED3A 3IVKA 1NGPL 1BQHA 2IFFH 4PJBB 5JHDD 5HGGS 3LKQB 4F7PA 3VD9A 4WTWA 1PBYA 4P2RA 4G43A 2AV7B 4YXHH 5DRWA 4HZLB 4QRRA 3VXMD 4QRPD 4XNZC 5IFAL 3PGCA 2IGFH 4R3SA 5JHDA 1EPFA 2IEPA 3GO1H 3PXJA 1FFOA 4YGAB 4Z7OF 4HUXA 4HT1H 3ULUE 3ZT7A 4QRPA 5J6HA 1OAZL 1HYSC 4RDQF 1A14H 4AENA 4WO4B 3VWJD 5CZKA 4KK5D 1P4BL 1GJIA 2Z31D 4IEFB 3DSFH 3I3BA 3N50A 2CDFA 1UYWL 3SDXA 4HJGB 1O5DT 5HI3C 4NWTL 3QZWB 4RNRA 2R1WA 3VWJA 2N56A 1NFDA 1FZKA 1K5NA 2IAMA 4WV1B 2Z31A 4YHKH 1FPTH 4E0RA 3QQ9C 3EJJX 3W5MA 4OFIA 5EO1A 3PL6D 2CDEA 3QEQD 3L9RB 3KS0H 1INEH 2DB8A 4LLUB 5INDB 5I8EA 4ZNCD 3L5XL 3ILQD 3MSPA 2YD8A 5K59F 3TO4B 3QEQA 2BRRL 3OBAA 3X12A 5I1HL 4LVNB 1R5WA 1MFEH 4KK6C 3PNWB 4LSTH 1QLFB 2VLRD 1RI8A 4EN3A 2HN7A 2Q20A 5FECB 2XRAH 5C92A 2XWJA 4OGAC 3GZKA 1WT5C 4JFDE 1VFUA 5FYJD 1NGZA 2VLRA 4EI5B 5GISL 2DN7A 5D1ZD 4YUEL 3CSPA 2MOVA 1KG0B 4N0CD 3SDCA 4OGXL 1I3VA 3Q48A 3DO7A 4P9HC 3MRGB 2JB6B 3UAJC 1XGRA 3LRHA 3C09B 3TF7C 3WXWH 1B0WA 4I9WE 3TBYA 1OGTB 1FNGA 1S7QB 4LLDB 4JDZB 5J56B 3TYFA 4YK4C 1JWSB 3BPCA 2E27L 2HFGL 3D18A 1J8HE 2W91A 1I8LC 5FUOL 4DW2H 3LH2H 4R8WH 3T77A 1DDHB 2OMNA 5CUSH 1FSKC 5DHVB 4OGYL 3V5KB 4K55A 3F58L 5GS2H 1FYTE 4PJ9C 1BZ7B 2P8PB 2G9HA 1TVHA 5IM7B 4PJDB 1RU9H 1T0NA 1H0DA 5E94A 4LVHB 4LEOB 4PR5B 4PJGB 2H32B 1N3NA 1PVHA 4XPHH 2VXQL 4XMPL 4NQTA 1NAKL 2AXGB 3UC0H 1ZLVK 1CXEA 1AGCA 1XIWC 5IB2B 3KPPA 1A2YB 1ZANH 3KJ6H 2BY1A 1U8OA 3PQYD 5DQJA 1GGIH 1CICD 2YD6A 2QSQA 1QLEH 1NMAH 3HG1E 4IOIB 4GO6B 4QYOB 5FHAH 2B2XL 3OKEB 1RJYB 4XNXL 2Y25A 2V5MA 3IU3B 5C0CB 4TVPH 1PSKL 2J6EL 3S8WA 3QULA 1QSED 5D6DC 2APVA 1YN6A 4HUNB 4PJ7E 3JWNC 3FQTA 5CBEA 5GZND 3BQUB 2Q8AL 1MCWM 1E4JA 1WBXB 1D6VH 3QO1A 3RU8H 1U93B 4RQQB 1NCDH 4Z7VF 2BNRE 2Z91B 3GJFA 4G7YL 5DJ8B 5GS0H 3E6FA 5L0QC 1MCHA 4DKFH 4M5ZL 3MXVL 5JIIA 3WN5A 2AK1H 4GJTB 1NCBH 3QPQC 4Y1AD 5ERWA 1IE5A 2HTKC 4MX7B 2HH0H 2A9NL 5E2TH 1JRHL 3UYOD 4AEHL 1RK0A 3FB6A 1R3KA 4JHBA 4JFQB 4TYUA 3RL1B 2H9GA 3VFPA 1MEXL 1P4IL 1TNMA 4PGCA 4PJ8D 4NQXB 4UAOC 4YHIB 3OG4B 1Q9LB 4ZFGH 4ONHB 1KT2A 4NFBA 1B4JL 1FJ1B 3PHSA 3FRUA 3MJ8A 4O4YL 3ROOA 3TZVD 2VH5L 1EHAA 1MHHA 2EDTA 3WNNA 3LDBC 1MJ8L 2XTJE 5AD0B 3RIFF 1ED3B 3IVKB 5D7KD 1BQHB 4ZUWA 1E0OB 2XZAL 4F7PB 5HYQA 4WUKL 5I1KL 4P2RB 4G43B 3TZVA 5DRWB 4PV8A 3BAEL 4BFBD 4QRRB 1FIGL 1MIEH 3PGCB 3RY5A 3VFVA 3VD3A 4R3SB 5JHDB 5IVOA 1FFOB 3AMKA 5JNYA 4HUXB 3LOWA 3BESR 4QRPB 15C8L 1NBVH 3OKOA 5J6HB 2NY5L 1N5AA 3V6BR 1MY7A 1VCAA 3ES6A 4AENB 5IB3A 4YHOL 5C0GA 3NIFF 4EDWL 3C60D 2YN5A 3MYJA 4KK5C 3T2QA 2CRZA 2VSCA 1GC1L 2CDFB 4LPCA 3SDXB 1JMXA 4HMCA 3T0DA 5ITFA 3LPGA 1INQA 4RNRB 2R1WB 3VWJB 2EH8L 4NWUH 5DHVH 2DYPA 1NFDB 1FZKB 2HVKA 1K5NB 2IAMB 2Z31B 3C60A 5FK9A 2OYPA 4E0RB 3OKYA 1W0WA 5EO1B 3S34L 1S7WA 2CDEB 3PL6C 3KXFA 1XGQA 1ZHKA 5EN2A 1JYVA 2R4SH 1X5IA 1NBZA 2NZ9D 2SEBA 2VZ1A 4UILH 4RMQA 4BFEA 5I8EB 4I8DA 5KSBE 2LU7A 4KKNA 3MODL 4X99A 3CDGA 5AWNH 1A7NL 3QEQB 3HNTH 2P8LA 4AMKH 4PJAA 4NZUH 3X12B 4HMDA 1D5MA 3FOMA 5F96L 5HHOA 1R5WB 3BW9A 1YA5A 3QRGL 4OD3H 2XTLA 3PG2A 1K6QL 5CAYB 2MKWA 3B43A 4L8SA 2AS5M 4EN3B 2HN7B 2XWJB 1HEZA 3MNVA 3Q1SL 1NGZB 2VLRB 1U2CA 3HNVH 1G84A 4AIOA 4I2XA 2A6KA 5D1ZC 1KOAA 3SDCB 3EO9H 1YPZE 4ZS7H 3DO7B 5I75B 1XGRB 4WHYG 1BQLL 4FZEH 4N5ED 3TBYB 1LO4L 3DI2B 4EIZC 3O6LH 1FNGB 2ICWI 3TYFB 2NY4B 2ATPA 3BPCB 4KJWD 1UEYA 4OT1L 5DQDL 3EYFA 3TPKA 3D18B 1IL1A 1EGJH 1J0HA 3B6SA 5FUZH 1R0AL 3T77B 2X4SA 4XNMA 2YD2A 4D94A 3W39A 5I1CH 4HUVA 2E6PA 3OJ2C 3TT1H 5DJAA 1DQML 1H8NA 1BJ1H 2YHGA 4OLEA 1MCLA 2G9HB 1TVHB 3ULSA 4MJ2A 1ADQL 1T0NB 4QTHA 1H0DB 5E94B 5ETUA 4L3CA 5HVFB 1N3NB 4Y4HA 2Z8RA 1AGCB 3UZQA 1KCUL 3KPPB 5DD5H 2ARJA 1U8OB 4HXAH 5DQJB 2HRPL 3QCUL 4K23H 1M7XA 1CICC 4U1KA 2LABA 4F58H 1QFWL 1WV7T 3NACL 2UUDH 1L9NA 4HJ0D 4K9EH 3WXVL 3X3FL 4MZ2A 2X4QA 3HMXL 3U0WL 1OCWL 3VGAB 4HGWA 4JO1H 3SGJA 3ZTJG 3QULB 1DQLL 1FG9C 1YN6B 2X9WA 1IZJA 3FQTB 5I71B 5CBEB 3H2WA 3ZKND 5CJQL 3QO1B 2XZZA 1UA6H 2HT4C 3LS4L 3GJFB 4GQ9L 4JG1H 1G9ML 1ZMYA 4H8WC 5CGMA 3E6FB 4Z7NE 2R0KL 3WN5B 2IPUG 3CH1A 4ZPVA 5ERWB 4Z6AT 4NRYA 2DI7A 4Z7UF 1B0GA 1Q0XH 3ARQA 3CZFA 3T0AA 4CDHA 1JFQH 4ELKA 1IQWH 5D1QD 3BGFB 4GMSH 1RK0B 2WIIA 3FB6B 3UROR 1R3KB 3VFPB 2H9GB 5A40E 3O3DA 4PGCB 5C3LD 1KEGL 5A2LH 1JYWA 4PJ8C 4B7IA 1KT2B 2RGSA 1NL0L 3CIQA 4JQXC 3SE8L 3FRUB 3MJ8B 1AE6L 5DLMH 3V0WL 5EU6E 3ROOB 4M43H 3DYPA 1FBIL 5GGRA 1MHHB 3RQ3A 4EJ1C 4X4YA 3U1SL 1KJ3H 4ZFFA 2Q6WA 2A77L 5EO0A 4M7LH 4ZUWB 3CVIL 2GUOA 4A2LA 5HYQB 3QFDA 1FLRL 1XZ0A 2B1HL 4XC1H 4NBYB 3TZVB 3CMGA 4PV8B 2A0LC 5BV7C 1QSFD 1ZA6A 3VFVB 3MV7D 5KANG 4HWBL 2AJXL 5GGSY 4MHHI 4Y5VC 1ZAGA 2Y07H 5JNYB 1TQCB 2BP3A 1P9MA 3V6OA 5HJ3A 3OKOB 2UY7A 5B8CA 1N5AB 1ZHLA 1D5XA 3ES6B 5I19H 5IB3B 3UTZA 4OSUH 3UYRL 4G7VH 5C0GB 4JRWA 2BX5A 5GRVL 5FOBA 3MYJB 3FFCE 4XRCA 2D2OA 3MRQA 5I1IL 1EO8H 4LCWD 3P9WB 5ITFB 4QHNA 1INQB 3D0LA 1KTLA 1FE8H 2B20A 3KYKH 2DYPB 4OLXL 1F4AA 2HVKB 5ISZA 2EE2A 3C60B 5FK9B 5CJOL 3RNKA 3FQUA 1NCTA 1W0WB 4OQTA 1S7WB 4LCWA 4JKPL 3KXFB 3W11D 1CDBA 1XGQB 1ZHKB 5EN2B 1YNLL 3BUYA 1NBZB 1YYLL 2SEBB 1DP0A 3WFEH 5F7EH 3ULVH 3EFDH 1PAMA 4X99B 5GRJH 3CDGB 1Q1JL 4HIXL 2AJSL 5DYOA 5EB9A 2P8LB 3EJYD 4MYWB 4PJAB 2R39A 1S9KC 5F70A 1OSZA 4W4OC 1D5MB 3FOMB 5DGQA 4KZEH 1JPGA 5HHOB 4EUPG 3BW9B 2IANA 3PXHA 3BKYH 3UTTD 3P0VH 1IC7L 5AAMA 4L8SB 1LHZA 1FVEA 1DQTA 3ARZA 5TE7H 5BJTA 1CDYA 3LZFH 1HEZB 3MNVB 4XAKD 5FCSH 1W8NA 4KY1L 3UTTA 3BPNC 4NJ9L 4I2XB 2A6KB 4BK5A 2R0ZL 1MFDL 1EMTH 4DGVL 2YRZA 3GJFH 5I1JL 4K3JH 4X5LA 1WIPA 4P59L 3WKML 3UTPE 3E6HA 4OB5L 1ZLWK 2AABH 3ZDXE 4RAHA 3TVMD 4IBLT 5J1SC 3HZKA 2DQTH 3EKCA 4PJEA 2CLZA 3MLXH 4HZAA 3IDYB 3RY6C 3DRQA 2ATPB 2FZ3A 1DBAH 3TVMA 4XPGL 5J1AA 2ZUSA 4KI5C 3EYFB 1IL1B 3TNNA 5C0AE 1VPOH 3B6SB 1KN4L 1RQ5A 2NY7L 3SBWA 2B7DT 3CK0L 5SV3A 2X4SB 4XNMB 1N6VA 2VR9A 1TMCB 2NY5C 5JZ7D 3S88L 1AXSA 3W39B 1A7OH 1PYWA 5I0DA 4HUVB 3O4OC 1YJDC 4P5TD 5DJAB 1X9QA 3EO1A 4ZMAT 5D6CA 3V52L 1CE6A 1J11A 1MPAH 3G04A 5D7LE 1CT8A 3ULSB 2OP4H 1GC1C 12E8H 4QTHB 1S5IL 5ETUB 4L3CB 4GRWF 3SOBH 3QIBD 2RHEA 4Y4HB 4Z7OE 1S9XA 4HHAA 2WK2A 4UB0H 2ZP0T 1VGEL 3MOBH 1WWBX 2EDRA 2YUVA 5JHLH 2Z9TA 2FJGA 2ARJB 2X40A 3BPLC 1J87A 1OGAD 4U1KB 4UNUA 4DVRH 3BZDA 1LILA 3OPZH 5J8OA 2E6QA 4LARH 5TE6H 3TC9A 1YEKL 4UIKL 4ZS6C 2X4QB 2AJVL 4NKQB 1OGAA 4HGWB 5DFTA 3O9WD 2EYTA 5DRXA 4YDLB 4GS7B 1EUUA 4FMFA 3HR6A 4M1GL 4LU5H 2OR7A 4YXKL 3SKJH 4XHQA 1HQRA 3Q5OA 5ILTH 4MLSA 3V8CA 3O6FD 4YDKH 2P49B 3PF2A 1U8KA 3CH1B 1S7VA 4ZPVB 3R4DA 3QUYD 4JO4L 1F8TL 3LS5L 4NRYB 1GAFL 4XAWH 1B0GB 3CZFB 3RVXD 4ELKB 2WIIB 5D1QC 2HLFC 1I1CA 3NGBB 3VFNA 4JY4A 3MRDA 3O3DB 3OMZA 4EOWH 1TCRA 4NM8H 5E7BA 1IFHH 2ZNWA 3QWOA 3PWLA 2MQ3A 4OGZA 4FMKA 3CSYA 5GGRB 1BVKA 1KTDA 4I48A 4WW2C 3WKNA 3A67H 4X4YB 3VXSD 4HXBL 4ZFFB 2Q6WB 5EO0B 4C59B 5C71A 4OV6F 2VDPH 5CS7A 4B50A 1REIA 3CMOL 2DQDL 2M8XA 3ZYIA 4BZ2H 4XXCC 2GUOB 3ZYOA 3FB5A 3QFDB 1XZ0B 1YMMD 1F4YL 3RWHA 2DMCA 2DQGL 4G6ML 2W59A 2A9MH 1ZA6B 3OAUL 1ACYH 1CCZA 1FN4A 4J3UA 1UWXK 3K8LA 3SE4C 5CBAA 4GH7B 4F2MA 5ECJE 1YMMA 2PTUA 3NPSC 3SDDA 2MPAL 2R4RH 5E08L 5HJ3B 1G7JA 2ZCKL 3OB0H 5B8CB 4YAQA 1ZHLB 1D5XB 3UTZB 4XPFL 1KJ2L 2A74A 1NLDL 3T2NH 5FOBB 2BMKA 4QRUA 4XRCB 3MRQB 2CLVA 2EEBA 3VDBA 2VMFA 4MJID 4QHNB 3DX8A 2NNAA 3D0LB 1KTLB 1B88A 2OZ4L 1J5OH 3JVGC 1YY8A 4DJMA 5ISZB 1N64L 2VITA 3RL2A 3RNKB 3FQUB 3MRLA 1L9MA 1QSVA 2OMBA 4FQCL 4LCWB 1B90A 4MJIA 1SY6A 3S7GA 1WZ1L 1A22B 2YUXA 3BUYB 4QCIA 2QSTA 5K9KA 1C16A 3AY4A 4YFDB 2C1PA 1L4IA 2X4UA 5DYOB 3JWDL 4OCWH 3NCCB 1OSZB 3MUJA 2K9UA 1JYNA 1JPGB 3G5ZA 4JJHA 3BHBA 5DR5L 1HXYA 2IANB 1HH6A 2DTMH 4ZOAA 5L88L 3U7WL 2Q8BL 1FVEB 2HT2D 2P45B 2CPCA 5BJTB 3ULUD 3UTTB 3AM8A 4JPWL 5T1DH 3OZ9L 1MUJA 2ZUQC 2VC2H 2UVFA 3E0GA 3WIHL 4GFTB 3E6HB 2ZJSL 3LQAC 4JGMA 2JTDA 4PJIA 3GI9H 2QSCL 4S0TD 2Y6SD 4WI7A 1HWHB 3HZKB 1OAXL 2YPVL 4PJEB 4CU8A 2CLZB 1RIVH 3CFCH 4R90H 3NFNA 1V3KA 2EDHA 5FYKE 3BYYA 5ESVA 3DRQB 1FRGH 2FZ3B 3WE6A 3TVMB 2B4CH 5J1AB 3S37H 1BZQK 3TNNB 1VEPA 5IWLA 3I2CH 3BDYH 3E3QC 4PBXA 4U49A 1EH9A 1RJLA 3RDTA 3KDMA 5FGBA 4P4KA 3MTRA 2AP2A 1AXSB 2DLEA 4NC0B 1PYWB 5EUOF 5JZ7C 4OUUA 3H7LA 4GW1A 2EEAA 3VFWA 3WNOA 4QF1A 5I73B 2ADFH 4RX4A 3EO1B 3AFLA 4P5TC 4M7KL 5D6CB 3QFJA 1CE6B 3G04B 1CT8B 5L2KA 3MV11 1L0XA 2HKHL 4NHUA 4NC1E 1JNHA 3QSKB 4Q97A 3ORJA 3QIBC 4LIQE 1S9XB 4HHAB 1EEUA 1EZVY 4XP6H 1T5XA 3TT3H 4DCQA 1JPST 2B1AL 2FJGB 4Q0XL 5LQBH 4TN9A 5FM4A 4NZTH 1ES0A 2DKSA 1VEOA 5F6HI 5KS9F 3QHZH 4H26A 2JELL 4JFDD 4OLVH 5HYJA 1UM4H 2WQRA 4XBEL 1A1OA 3FCTA 3FT4A 4K3DL 5SX4I 5DJXA 4S1RH 3LKPA 1OGAB 3WFCL 2EYTB 5DRXB 3HR5A 3O9WC 5ACZA 3PP4H 2E7MA 3EYUH 1EUTA 4HEPG 1F6FB 1HQRB 3D2UD 3RRQA 1LEGA 1A6WL 1D7FA 3O6FC 2NPLX 4MWFA 3IDGA 5IVXA 1J8HD 1U8KB 2E9IA 3EDJA 1S7VB 1SM3L 4P2OD 5B38A 3QUYC 3R8QA 3EDEA 3F7VA 1KIQA 2CO6B 1ND0A 3GI8H 3MLVL 1I7TA 3RGVD 2WLZA 4TUJA 3VFNB 1FYTD 4JY4B 4BZYA 3MRDB 1F58L 1U42A 1TCRB 4IRZH 5IBTL 2WUCL 5AZ2H 3VXTA 3VXRE 2OSLA 2VE6A 4XMLL 3QWOB 1XT5A 3PWLB 5BCAA 5FOJA 1MHCA 3BH9A 3FQWA 3ZDZE 1FYTA 3QJHA 3CSYB 1BVKB 1KTDB 4I48B 2CIIA 5CZXD 3HG1D 4C4KO 5CSZA 1XEDA 2M26A 2Y4SA 3FB5B 2F54E 4CMHB 2PW1A 5JOFA 5LAXA 4KZDH 3RWHB 4GUPA 3ET9F 1SHMA 1FH5H 1OARL 3VGFA 4APQC 1FN4B 4HW6A 1NC4A 5CBAB 5L7XH 1RVFH 4F2MB 1ZEAH 1QACA 1PDKA 1YMMB 2LTQC 3SDDB 1AKJD 3BJ91 1N4XL 4WGVB 4ODBD 1GVIA 1QYGL 1G7JB 4KTEH 5BZDA 5JQHC 2BNRD 4AEIH 2FIKA 1BHGA 4YAQB 5CZVL 4FQ1H 3KWWA 2A74B 5L8KB 4DTGH 2NY2D 3REWA 4XCFL 1AKJA 2BMKB 4QRUB 2FH8A 4MS8D 1G7HA 2CLVB 4KK8D 1F90L 3DX8B 3ARSA 2NNAB 2L4OA 2XKUA 2M1KA 1V7MH 3ARFA 5GPRA 1NBQA 3MJGX 5D72L 1YY8B 4ZTOH 1IGFL 2WWMC 3RBSA 2VITB 3RL2B 2P7TA 2VR5A 4Y4KA 2ORBH 3MRLB 4HJJH 4XPBH 4MJIB 3IFNL 4WIQA 5C9JA 3HRZA 4ERSH 2F5AL 4QCIB 4P9MH 3ALXA 1AGDA 3BDBA 5DMJB 1C16B 5K9KB 4PB9L 4D9RE 2XTJD 4G5ZL 1UQSA 4OI9A 1VDGA 4J23A 4LEXL 3MBXL 2C1PB 2DQIL 2X4UB 1ZLUH 3NAAL 1AQKH 3G5ZB 3QQ4A 3O6KL 3BHBB 1HXYB 1HH6B 3OR7A 3VG9C 5IROA 1UM6L 4TTDD 1W0VA 2EDBA 1KUMA 5FKAA 5D7IA 1Q0YL 2R8SL 5KTEL 2ENSA 4KC3B 5DS8A 4LGSB 1MJ7L 4P2QA 1AHWC 2CSPA 3CXHK 3ULUC 5E8NA 3QCVL 3HE6D 1JWMA 1MUJB 5CSBA 3U7YH 1YQVL 2ED7A 3HA0A 4HFUH 4ZAKD 3ZHDA 5F1NA 5LGKA 3BEVA 1F3DH 3KHOA 1Z9LA 1SMAA 4PJIB 4HGKC 5SWZA 2BSRA 2Y6SC 4OKVA 4OZIF 4HIHA 3RHWF 4ZAKA 2VQ1A 3NFNB 4YBQD 3VGGA 5ESVB 1T03L 2YD3A 4PREA 3WE6B 4LQ1A 3VFRA 1C08A 4JREC 4JM4H 1LGVA 1PLGL 1TQBB 2R23A 2X1XR 1RJLB 1BFSA 1JPTL 3RDTB 2VXSH 3KDMB 4P4KB 4F7CA 1CYGA 4G80A 1NMCB 2AERT 2JCCA 5E00A 1I3RA 4GW1B 4OUUB 3VFWB 4JJ5A 4QF1B 2HWZH 4PJBF 1PW3A 1TPXB 3B8SA 3QFJB 1GH7A 2FECL 2ADGA 1E4XL 5E24E 1RZFL 1BAFH 4JPVH 5L2KB 3S35H 4K7PL 4NHUB 3L3DA 1JNHB 1BGXL 4TPRH 5C9KA 5KSBA 3FO9A 4LPXA 3BJLA 4J2XA 4AM0A 4L5FL 1OP5K 4CJ0A 1A6UH 1WF5A 2YMXH 1T5XB 3BXNA 2VNCA 4DCQB 3MCG1 3NA9H 1ES0B 1WTGT 5F7UA 4FTVA 1WWCA 4H26B 4LSUL 1NKOA 5HYJB 3PP3H 3NCBB 3C5ZA 1RZ7L 1Z2KA 3FN9A 5D8JL 1R6VA 1A1OB 1LK3H 3FCTB 3FT4B 5DJXB 4CVXA 2UZIL 3LKPB 1WWWX 2FX7L 3WFHA 4X7TA 3HR5B 2XZCH 5ACZB 3WUWG 1D5IH 1SYSA 4WGWB 4N0FA 3RVWD 5AZEL 1HH9A 3QUZD 2H6PA 1LEGB 3QUMA 3OHXA 1GYAA 1CDUA 2YD1A 4MWFB 3IDGB 2P5WA 3QB7C 3QP3A 5IVXB 5BVPL 2E7LA 5B38B 4NM4L 3ARVA 1OP3K 2BVOA 4P2OC 3F7VB 3KJ4C 3T0EA 1KIQB 1RIHL 2HJKA 2DMKA 3UJTL 1ND0B 4QO1A 1I3GH 1I7TB 3NABH 3CUPA 4TUJB 3RGVC 3MFGB 3INUL 4OLZH 4XVTH 5CJ8A 3L3KA 4GKZA 2CGRL 3MGOA 3MJ6A 3T1WA 2KZWA 1G6VK 1NAML 5EBGA 3VXTB 2YR3A 2OSLB 2VE6B 2OM5A 1SVZA 1MHCB 3BH9B 3ESUF 3FQWB 5F9OL 2WIMA 5GZOC 1FYTB 3QJHB 3VW3H 2CIIB 4TQEL 5CJXC 5I18H 2A38A 5CZXC 4ZSOA 2Y36H 3L95A 5CSZB 4F8QA 4OCNC 2PW1B 5JOFB 5LAXB 3AUVA 4GUPB 1CGWA 4G6AD 4GBXC 4HPYH 2LFGA 2G60L 1CD1A 1NC4B 3IFPA 1CTNA 3OX8A 1CFVL 4WY7H 1AQDA 3JZ7A 1GGCH 4HKXA 1XF3A 3M45A 1X4XA 4OZHE 5DD3L 3UZVB 2AI0H 4M6MH 1H3UA 1N26A 5KG9A 3QXAA 4NUGL 5FYLE 7FABL 1MJUL 5BZDB 1IAIL 2FIKB 3WDIA 5HGDA 1IC4L 1IEAA 4Y16D 2W0LA 3HC4L 4K8RL 4P5KA 4K94H 5DA0B 5F21B 4IRSA 3KWWB 3REWB 1AKJB 1S3KL 2IG2L 4N8VG 2NY2C 4B53A 3OKDA 3WJJC 2ESVE 1G7HB 1IM9D 2G5RA 3REVA 1QBBA 4MS8C 4KK8C 4Y16A 35C8L 4GRWE 4O2FA 2VLKE 3ARFB 5EIQA 4JR9H 1L6ZA 4CU7A 2P7TB 1BJ8A 4Y4KB 1J0JA 3RVTD 4N1HB 3C08L 4PJGF 4RFEA 1TIUA 4UT9L 1KIPA 1CU4H 5C9JB 4Z0BH 3MRFA 3HRZB 4U3CA 4CUCA 1AR1D 5EU6D 2OI9B 1X6LA 1AGDB 5LBSL 1UQSB 2XTJC 5KVGH 5J3HC 4MA1C 3QQ4B 2VN7A 4PTTA 4WUUE 2VDLH 4DGYH 1TJHL 4X8JA 3OR7B 4UTAH 1DL7L 3WYRA 1U6AL 1W0VB 2R15A 2D9CA 2PN5A 3FN0L 4TTDC 5FKAB 5D7IB 3QIUA 5E8PA 3HLAA 4KV5E 5DS8B 3CNKA 3X3GL 1ZTXH 4P2QB 3FT3A 2DTSA 5IT2H 5ACMA 2R0WL 5E8NB 3B2VH 1WSST 3WHXA 1JWMB 4LBEA 4WHCA 3U9PH 3HE6C 4YHML 3RBGA 1BF8A 2R2CA 1EHNA 5F1NB 2DAVA 3BEVB 1P69B 3FFCD 3ISWA 4IMLA 4XNYH 5SWZB 1CVSC 3QWRD 5C6TL 2BSRB 5D5ME 3PABA 4OKVB 3VXUE 4JEGB 4C56E 2FIRT 2DLFH 3BT2L 3ARUA 4HIHB 5IQ7L 5HHNA 3GJEA 3ARTA 4ZAKB 2FEEI 3VG0L 2VQ1B 3RVUD 1EV2E 4WFHE 2RR3A 4PREB 4YBQC 1IGYA 3CLEH 3FFCA 4PJ5A 4M02A 3QWRA 5DT1H 1ULVA 4OM1H 3VFRB 1C08B 5EORH 4U1LA 1OOAA 2O26U 1FZMA 1ZV5A 4JFZH 2BOBA 2R23B 3BKML 5ITBL 1A3LL 1RUMH 4F7CB 4G80B 3TN0A 2F5BH 5E00B 2JCCB 1I3RB 4KWUA 4JJ5B 4ZFOB 2ADGB 3RKPA 2YA0A 3C2SA 2VXUL 5HHPA 4NKDA 3L3DB 5CLTA 2VDKH 5KSBB 3FO9B 3MLUL 3KPRE 1LEIA 5GGRY 5M95B 1EVUA 4AM0B 4XWGL 3BXNB 3KVQA 1MFBH 2GTWA 5CEZL 3QNZA 1AGFA 4ONGH 1NMBH 2DLGA 4FTVB 4M1DL 1BWWA 4ZPTA 3GMMA 4HAGA 3C5ZB 5DC4B 1HINL 3K8KA 3SO5A 3LAFA 1BD2E 1DCLA 4NHCL 3UTPD 4CVXB 1L7IH 4XHJD 3WFHB 4NNXA 4X7TB 2KKQA 3WS6C 1M7DA 2DRUA 3SDXF 3TGXA 4D9LL 1SYSB 4N0FB 1YECL 1J7VR 2N4IA 1NH6A 3AC0A 2J6EA 2XT1B 3WFBH 1DQJA 1HH9B 1NFDF 2H6PB 4JN1L 1ZXQA 1ZA3A 3QUMB 3QUZC 3OHXB 2GT9A 2CJUH 2YN3A 3LY6A 4TRPH 1QFHA 2P5WB 2AEIT 5C0AD 4LPWA 2OXHA 8CGTA 2BVOB 2DQFA 3BN9D 5DVNA 3IU4H 3T0EB 5F93C 2HJKB 2I27N 4KQ4L 5ICYA 4YQXL 2BC4A 2Q7NA 4KKCD 5B3JF 2EDWA 3CUPB 4DKAA 5D7LD 2F8VA 3L3KB 4GKZB 5FCUL 1A7PL 3MGOB 4LPVA 3GM8A 4TUKL 1CL7I 4UNTA 1A21A 1D9KC 2O5XH 1AJ7L 5E2WL 1AY1H 3R1GH 4M6AA 3QPXL 2E7HA 4G3YL 4HK3J 4WEMB 4FQLL 1X5GA 2PO6D 4ZSOB 3L95B 5C07E 5ADOL 1IEBA 5EWIH 5KW9L 5KN5A 3IGAA 3SQBA 2W07A 4KUZL 4J8RA 4OLYH 1RD6A 5EZOH 5J9PA 1CD1B 3IFPB 3OX8B 4XP1H 1AQDB 2NYYD 1DBJH 4HKXB 3CLFH 1XF3B 4I18C 5KG9B 4KRPD 3QXAB 1NBYA 3MA7A 5HGDB 1IEAB 4P5KB 4DUXA 1JGVL 3P0GB 3W2DH 5EUOE 4IRSB 3X11A 3O3EA 4FABH 2DM2A 2X5PA 2DWEA 4ZODA 3OKDB 4FQHA 4PJFE 2DM4A 4BELD 4X0KA 4BSVA 1CXFA 3REVB 5SX5H 1CLCA 1GOHA 4Y16B 4RDQG 1F4XH 3O2DL 4O2FB 2APXA 1BBJA 4R7DA 1F45A 3CVHL 5M7QA 3I6KA 1Z3GL 3NCMA 3VWKC 2CRMA 1JNLH 4RFEB 1KIPB 1IT9H 1DSFL 3MRFB 1BMGA 3EYSL 1NDGA 3ULVF 1KCVH 3B5HA 5J0BA 4ZOBA 1WBYA 1A3RH 2W9LA 2P1YA 2L0DA 4FXKA 2HFFA 1C5BL 1XF5A 3S9DB 2ZOLA 4IJ3C 3TJEH 5KVDH 1F6AA 2O93L 1W0YT 4ETQA 5C0ND 4PTTB 25C8L 4WFFE 4X8JB 1AC0A 1TTFA 3N1GC 2DI9A 5T1MA 2D03L 1T7YA 4W68A 3QIUB 5ENWA 5E8PB 3HLAB 4HPOL 1X6NA 3FT3B 5D2NE 2F19L 1Q8MA 3WHXB 2JJVA 4LBEB 4H88L 4JLRA 3QUMH 1FVCA 3PWVA 4X6CA 1LO2L 1VERA 5GRUH 4F57H 1A7BA 2EE3A 2VXTH 4IMLB 3PABB 4R4FH 5AEAA 4N90E 4RFOH 4M7ZC 4O9HL 4JY5L 3GJEB 5HHNB 4X9FA 2F8XC 2IJ0C 1I9RL 1IGYB 3FFCB 4PJ5B 2ICCA 4P46C 2ZCLL 4KXZH 3NTCL 4U1LB 3S3SA 1FZMB 1KC5L 2BOBB 2K3TA 5EU4A 3IETA 1E4KA 4A2MA 1KYOK 1KB9K 1BP3B 3T0VA 3CU7A 3TN0B 1CFQA 2WW8A 5CGTA 4FQ2L 1U3JA 4XP4L 4LCIH 5DZLA 1NEZA 3QDME 2XN9D 4Z7QF 4HCRA 5HHPB 4NKDB 2LAAA 1LEIB 1NGPH 3OF6D 2B8OT 1GCFA 2VRAA 2XPGA 2XN9A 4JHWL 3HMWL 1JTPA 2GTWB 2VZTA 5D2LE 3QNZB 1AGFB 2MKLC 2MWCA 4ZPTB 5GGTA 3G6JF 5IFAH 3DXAD 3GMMB 3NFPA 2GK0A 1F2XK 3DMMA 4G8GE 2DKUA 4KPHL 2V2WA 4Y4FD 4NNXB 4XHJC 2PF6A 5L6YL 3THML 1M7DB 1OAZH 4JFHE 3DXAA 3DX6A 3HMXA 4LCCA 5D93B 4RAUA 4BQCA 5FYKD 1P4BH 1DQJB 5DVOA 5DD6A 3P9LA 1ZA3B 4JZJA 4PG2A 4ZUSA 2GT9B 4NCC2 4JVPA 1UYWH 2ZCHL 3I02A 5KSAD 2NXZB 4Q6IC 1J86A 4NWTH 1I8KA 1KCRL 4RZCA 5H2BA 4QXWA 1UEMA 2DQFB 5J12B 1A6VH 5LWYL 1FAIL 5ICYB 3BN9C 2BC4B 3HI5L 4WTZG 5KSAA 3TBSA 4KVNL 1ZHBA 2XZQL 1EEZA 3QDHA 2QL1A 3A6BL 2C4FT 4PJAF 4AQOA 4NP4L 5DJYA 4EXKA 5JTWA 1I85C 3L5XH 2DD8L 3RX5A 2E7CA 1OAKL 2BRRH 5JR1L 4D0DA 4R4NC 4NKMA 5EDXA 5TH2A 5I1HH 3L3IA 1R5IA 2QHRL 1G7IA 2PO6C 1IEBB 3GBNL 5KN5B 3IGAB 2YKLL 4C4KT 4J8RB 4MA3A 3SCMC 4OZIE 4AIXA 5J9PB 3MUZ1 3TIDA 3VXOA 5I15H 3ETBF 5GISH 3VI3E 5GS1C 3ARED 1JPFA 3I3DA 4OGXH 3JSSA 3PGFL 2GEEA 1NBYB 4KRPC 3RHWK 3MA7B 4XVUD 1NGQL 4I4WA 4KAQL 3DHMA 3X11B 3O3EB 4LPUA 2UWEF 4PJBE 2DWEB 2C4FU 2X70A 4FQHB 3OKLA 4Q74A 5F9DC 4BSVB 4X0KB 4PJHF 3VCLA 1F02I 2E27H 5D4QA 2HFGH 4JG0L 5A43C 1BBJB 1XGPA 4R7DB 4JFED 5FUOH 4G9FD 3I6KB 2VDML 4M48H 4RFNC 2C5DC 3F58H 1NDGB 2J8UA 2EKSA 3O2WL 4JFEA 4G9FA 1DZBA 1UWEL 4TVPE 1KFAH 1WBYB 4FXKB 1A6PA 4HC1A 2HFFB 1CG9A 4XMPH 1NAKH 1BFVL 1XF5B 5D96B 43CAA 2ZOLB 2F54D 1F6AB 4UDUA 4ETQB 1OTSD 4RBPK 1N5YH 2EDKA 5T1MB 4OCRL 1W72L 3CAFA 2F54A 4GMTL 2B2XH 5ENWB 1T21A 4XNXH 3W0WD 2FSEA 5C2UB 1PSKH 3EDKA 1GHFL 1RHHA 4R2GD 5I9QB 4NQEE 2J6EH 1R3HA 4N1EA 5H37G 1KLUA 4LSRL 4JLRB 3L5JA 1FVCB 2FLBT 4Y88A 4ZTPL 5JXAH 2Q8AH 3PWVB 4X6CB 3W0WA 4NCC1 4WHYH 4F37F 3EJZD 3VGHA 1N7ML 4G7YH 4M5ZH 3MXVH 1TETL 4XB7A 1WITA 2H2SC 2IBZX 1IKFL 3GBML 4LCUA 4OZFA 1BECA 3QI9D 2A9NH 1FIEA 1JRHH 3NCYP 4AEHH 5EU4B 3QDJA 1EEYA 3SDYL 3IETB 3VU2A 4I77L 1MEXH 3CDCA 1P4IH 2BJML 5DC0A 1CFQB 3WMSA 4ZO6A 1B4JH 4R9HA 3DROA 1NEZB 4OTXL 1QHOA 1UT9A 5F8QC 4O4YH 4S1SL 1CF8L 4APQA 2HMID 2VH5H 4XZUA 1MJ8H 2C9AA 3MJ9L 1WAAE 4X98A 3LMJL 4LHUD 4KKAC 1I8MA 2XZAH 1UH3A 2XPGB 2XN9B 3GHBL 5I1KH 3FJTA 5FUCC 5T3XL 1IEHA 1HXMA 3BAEH 1FIGH 4RISL 3NFPB 4QXGL 4GKSA 1MCRA 4LHUA 2GK0B 4RGMB 3H9YA 1JYXA 2E6JA 3S36X 3DMMB 3C8KA 2V2WB 3CXHJ 3MUHL 3ZTJH 1CIUA 2YOCA 15C8H 4Y4FC 4PJDE 3DXAB 3U83A 4XNUL 3DX6B 5F1OB 3FRPA 4LCCB 4WI4A 43C9A 3FT2A 2X89D 4RAUB 4YHOH 1X4YA 5DD6B 4EDWH 3P9LB 1OY3B 3FQNA 4JZJB 4ZUSB 4NQCA 3T0XA 3VMPA 1JZ7A 1GC1H 3K81A 3I02B 1D5ZA 3RKDD 3QAZB 4NQVA 4FP8L 5SWQA 1ZS8A 4KVCL 1I8KB 4RZCB 2ICEA 2X89A 3DOSA 5H2BB 2EH8H 5D1XD 3A0OA 4MNGE 4YO0A 3S34H 3QQNA 1M05A 5KSAB 3TBSB 2FO1A 1IC5L 5HVGB 5ID0A 2ZUWA 1ZHBB 1EEZB 1UJ3A 1GPOL 5DJYB 5BS0E 1HQ4A 3CH8A 2NY3B 3WJLA 4C57C 2H8PA 5HGHA 3BYTA 3ARRA 4NC1C 3MODH 3SQOL 2HTLD 4D0DB 4DQOL 5TH2B 4NKMB 3L3IB 4XC3L 1R5IB 3G6AA 5HYSG 2ENYA 3QRGH 1G7IB 2GJZA 1K6QH 4Z0XA 1FFNA 2W92A 2OL3A 4MA3B 1S7XA 3Q5TA 1FGNL 3TIDB 3VXOB 1TTGA 2PTTA 1HWGB 2NY1D 5GRZA 2JJSC 3BI9X 3NIGF 2G75A 4PJEF 2EC9U 5FM5O 1JPFB 1WVZA 1RUPH 1P7KA 3AREC 1WC7A 3P0YL 3LB6D 1BQLH 4IDLA 3FKUS 2DQUH 4JO3L 3U46A 5CKAA 4I4WB 5F71A 1KV3A 3PHQA 3UTSE 1LO4H 1TZIA 3HFML 4H20L 4M61A 2X70B 3OKLB 4EKXA 1KJ2A 4P2RE 3VCLB 4OT1H 5DQDH 3Q6GH 1XGPB 1KTKE 4ACPA 4N8CH 2VUYA 1R0AH 2I9TA 5JHDE 4FA8A 1WFTA 4BSWA 3N85L 2P48B 2BVPA 4LSVL 2OZ4A 1H3XA 1OTTD 4M00A 1DQMH 3WO3B 2J8UB 3IJSA 2EKSB 4JFEB 4QRPE 3T3MF 4G9FB 4BJLA 4FS0A 2BSSA 4H0HB 3T1FA 4NJAL 3SGDH 5MEPA 3DV4A 1CG9B 43CAB 2UUDK 1RZIA 1KCUH 4UDUB 1DN0A 1MCOH 3FTGA 4EUPH 5DDHA 5T33L 2HRPH 3QCUH 1OTSC 4YBLC 1NFDE 3DHJA 3NACH 2F54B 3R0NA 2V2XA 1T21B 1F4HA 1WQVT 3QEHA 2WANA 2FSEB 3OB8A 3WXVH 3X3FH 1W8OA 5FYLD 3HMXH 1U58A 3U0WH 1OCWH 1RHHB 5L9DH 1R3HB 4R2GC 1DQLH 1KLUB 2V5SA 5B3JE 5IJVA 3W0WB 5CJQH 3QEQE 2ESVD 5T3ZL 3LS4H 4E41D 1UZ6F 1ZVYA 3MV9A 3WIHA 4GLRI 4GQ9H 2X10A 4CVWA 1G9MH 1G7LA 4KDTC 2R0KH 3G6DL 3WV0A 5J06A 4MSWA 3JV6A 3T08A 4LCUB 4OZFB 5JXED 4E41A 3QI9C 5H35A 1T89A 3QUXC 5EOCL 3QDJB 1EEYB 5FKPA 1RY7B 2VLRE 4YNYA 5DGRA 5TFSL 2NMSA 2IH3A 1M1SA 2OQJA 1NL0H 4NKIH 3DROB 3E8UL 4OFYA 3SE8H 5L8LB 1X5ZA 1AE6H 1QNZL 4WWID 4APQB 1FBIH 4GBXA 3KLAA 4XZUB 1PX3A 2HMIC 3U1SH 1C5DA 3IDJA 2A77H 4X98B 2B5IC 4ZNEA 2YPLA 3CVIH 4TNVK 1VESA 3DLQR 1NCCH 3IRZA 4XX1E 1I8MB 2LTQB 5GS3A 1FLRH 3MCKA 2B1HH 4N0YL 4LCYA 2LV4A 2NR6C 1HXMB 4L4VE 4WWKA 4MD0A 3T4AA 4GKSB 1OHQA 4HWBH 4LHUB 1A4JA 2AJXH 3X13A 4FNLL 4MQXD 5IJKA 3ZTNL 5IBUG 4J4PD 3C8KB 3DETD 3EOAA 1MHPL 5IBLD 1OVZA 3VXUD 4AJ0A 4C56D 43C9B 3FT2B 4K2UH 4MHHG 1FV1A 3UYRH 2KDGA 2R29L 2W9EH 5HSFA 3FQNB 1KN2L 4NQCB 3ULVE 3TP4A 4GG6A 5I1IH 1D5ZB 3KR3L 4NQVB 5SWQB 4LRNL 1ZS8B 4YHNA 3RKDC 2ICEB 5C6PB 3Q6FA 4MXQD 4OLXH 3HE7C 3HZVA 5CJOH 2CO7B 4YO0B 2WBJC 5GJSL 1M05B 4JCMA 4FQIH 4JKPH 4WCYL 4NZJA 5ID0B 4DUVA 1UJ3B 3SE3C 4X83A 4AIZA 4PRPA 2YZ8A 1YNLH 4DK6A 1YYLH 3D0VA 1HQ4B 2H8PB 3O6ML 5HGHB 1AGEA 2FO4A 3KPRD 3IFLL 1Q1JH 2VUOA 2AJSH 4HIXH 4JFXA 2HTLC 5TDPA 3G6AB 4JQVC 2GJZB 5DMGC 2VERN 3KPRA 4Z0XB 5I6XC 1IC7H 1FFNB 3L3OA 3T4YA 4OIIL 4DN3L 3WD5L 2OL3B 1EFQA 1BD2D 1S7XB 3GJFK 1F11A 5DF0A 4KJPC 3CSGA 4OZGA 4PJIF 4CVZA 3ULUF 5FO8A 2PTTB 4KY1H 3WFDL 4ORZC 4NJ9H 2NY1C 2G75B 2H1PL 4X9BA 1MFDH 1XAUA 4DGVH 1CBVL 5I1JH 1P7KB 3WKMH 4P59H 1WC7B 2CRIA 1E6OL 2EDFA 1F6LL 1SJXA 2C3VA 3H0TA 3LB6C 4Y5XA 3U46B 4L9DA 3PHQB 1TZIB 2N7BA 4M61B 5EUKA 3WUWA 1OD9A 3KLSA 1I9EA 1KJ2B 4EEEA 4XPGH 4Z7QE 1IKNA 1A8JH 5EU5A 3AU1A 1KN4H 2NY7H 3CK0H 2I9TB 1IGML 4BSWB 3S88H 2BVPB 3PWJA 1SJVA 2DBJA 2Y5EA 4IMKC 3IJSB 4Q9RL 2KH2B 3V52H 3P73A 3DX9A 2BSSB 4CVUA 3T1FB 1S5IH 5ELIA 4ODVL 4DWHA 5MEPB 5C07D 2R2HA 3DV4B 1VGEH 4OLUL 4OF6A 1RZIB 2VO5A 2JF1A 4I0PA 1DN0B 3FTGB 3PDOA 5DDHB 3P4LA 4IRJC 2FHCA 3ARBC 1IAMA 1QRNA 1JN6A 1KF9B 1JF5A 4OCSL 2V2XB 1YEKH 4UIKH 3QEHB 5F6IB 3KXFE 4M7JL 5FIEA 3HZMA 2AJVH 1U58B 1T3FA 3MRKA 5IFJA 5IVXF 4M1GH 2YSSA 4Y2DC 3SY0A 3KYNA 4YXKH 5IJVB 4RGNB 3KJ4B 3CX2A 3SE9L 2OLDA 2ITDA 1H3PL 3MCLL 1CFSA 3GO1L 4PJAE 2X2YA 3MV9B 4F9LC 1Q9WA 1G7LB 4MA7L 1RPQA 5HHOE 3MOAH 1N6QL 3RFZC 4P0DA 4MSWB 3MBED 3JV6B 4JO4H 3LS5H 4PV9A 1GAFH 4DZ8A 4E41B 4V1DE 5JXEC 4AG4L 4N8VA 4OJFL 2QJDA 5H35B 5DK0A 5KAQF 3MFFA 5FKPB 3DUHA 1UG9A 3F7PC 3KLDA 5I76A 4YNYB 1EDQA 4I2XE 5HHVH 1NC2A 2XACC 2IH3B 2QADD 2OQJB 4YHKL 3MLRL 3P40A 5IHUL 3KLHD 1ZLSL 4GBXB 3KLAB 4HKBA 3S96A 1C5DB 4WFFD 3IDJB 4HXBH 5C7XL 4M93B 2YPLB 3CMOH 5DD1L 3RY4A 2DQDH 4HDIA 4RMTA 4U7SA 4YC2B 2C3HA 3GKZA 3MCKB 1C7TA 3UEZA 1INDL 1C1EL 4LCYB 1F4YH 4EBQL 4TNWK 4KROD 2HFEA 2DQGH 4G6MH 2EO9A 4WWKB 4B5EA 3OAUH 4MD0B 3OB0K 4G8EA 4HIIA 4R97B 1UH2A 3T4AB 1A4JB 3X13B 5E2JA 4PJ7F 2MPAH 4J4PC 3EOAB 5E08H 5FO7A 2ZCKH 1NGYA 4Z8FL 4N90D 1PG7X 4HWNA 4KKBC 5I16A 3S4SA 1FV1B 3VWKA 1KJ2H 2X4TA 1WK0A 5E6IC 1NLDH 1HKFA 4X7FC 3I3EA 4Z5RA 2BVYA 4YE4L 4GG6B 4OF5A 2EYSA 4YHNB 2H41A 2OZ4H 3Q6FB 3RTQA 4XPAL 3SGEH 1N64H 2D0HA 4AEFA 3HZVB 1N2RA 2HJLA 4E9LA 4XTRC 2R2EA 4FQCH 1HK6A 5HDOA 4FOMA 4FFYH 3BDXA 3MRNA 1NANI 3VFSA 2WNGA 1NUDA 1X3DA 3QDMD 1WZ1H 4AIZB 4PRPB 1KB9J 1S78D 3CFBA 5KOMC 3D0VB 3M17A 4U3XA 4UT6L 1R3LA 4HIEA 1AGEB 2FO4B 3LH2L 1AR2A 2GJ6A 3FL7A 1JHTA 4WI5A 2QTEA 4JFXB 3JWDH 1UB5A 5D7IF 5TDPB 1A4KA 4UTBL 4ELMA 5DR5H 2XG5A 1RHFA 4HKJA 3KPRB 4NIKB 5L88H 3L3OB 3T4YB 3U7WH 3KPQA 2Q8BH 1SVCP 4XPHL 5HHXL 3PIQA 2VR4A 3BD5A 4G8GD 4KK9D 1F11B 1YEGL 3V5HA 3WNLA 4OZGB 4CVZB 3UPCA 5FO8B 3SPVA 1T1ZA 4JPWH 4V2BA 5DJDA 5JW4Q 3OZ9H 3V2AR 1NMAL 2I26N 3B2UD 1DR9A 2Z4QA 3BUTA 3WIHH 1SMOA 1TNNA 4G8GA 2EDQA 5FHAL 2ZJSH 3WNPA 2QSCH 3KPOA 2XQYG 3QA3A 2C3VB 3H0TB 4Y5XB 1OAXH 4P23D 5GJTH 2F53E 6FABL 4ZUVA 3GSUA 4ALAL 5EUKB 3WUWB 1J1PL 1CDHA 1PQZA 2JCCF 5EU5B 2ADJA 1NCDL 3KS0J 3AU1B 3FFDA 3U30B 5GS0L 2NY0D 4NSKA 2AK1L 3SDAD 3PWJB 3FQXA 1DBKL 5KSBF 3U0PA 1P53A 4E5XA 2P4AB 1NUNB 4UZGA 3V6OE 4M7KH 5FO9A 1CGSL 3P73B 5AYQA 2I5YL 3DX9B 3VE0A 4DKEH 3LD8C 3OJMB 5DO2D 3CGTA 3TO2A 1ZKAA 3SDAA 1YEHL 2HKHH 4JFYA 5DHXB 1G0XA 2R2HB 1J1XL 1DVFC 2C3XA 4CADA 1FC1A 1MI5E 3OSKA 3H3PL 4JM2A 4I0PB 3TYGL 2B1AH 4Q0XH 3PDOB 2DICA 1JZ6A 3T3PF 1ACZA 2BVEA 1I7RA 1QRNB 5ISZE 1C5CL 2JELH 1T0MA 3H3KA 1JN6B 5HDLA 3ZE2E 3L1OL 1TZGL 4XBEH 5EZJA 3BKCL 4LCWE 5EU7E 4CNIA 4K3DH 4BFGA 4KKLC 2LVCA 3HZMB 2L7JA 1T3FB 3AXLA 3ARXA 4LVOB 3MRKB 5EIVA 1FL5A 2X4NA 5IFJB 5GS2D 4ESKA 2YSSB 3SY0B 1P7HL 3KYNB 1FL3A 2VWEE 4X80L 3LIZL 2ITDB 1CFSB 1A6WH 4F80A 1Q9WB 3RIAK 5CFHA 2IANE 4XPTH 3DI3B 4WFEE 1SM3H 2LVEA 4FQXD 4P9HL 3MBEC 3HNSL 4PV9B 1U8HA 2HJFA 1SJEA 2FCBA 2ZZUT 4DZ8B 2CK0L 3NBNA 3U7AA 4N8VB 1V5JA 3MLVH 1VGKA 5DK0B 3MFFB 1I1FA 4LLMA 3UBXA 3C5SA 4PYHA 5I76B 1L0YA 4FQXA 4QRTA 4TVPD 1F58H 2ZUUA 1NC2B 4WO4D 2WUCH 5KSVA 3VFGL 4XMLH 2BDNL 1RSFA 2XFXA 3SCMA 2WV3A 2PYED 1TVBA 3NIGE 2ZUXA 4HKBB 3S96B 3SGKA 3JWOC 4PJEE 1RIUL 1CLZL 3BZEA 3O4LE 2QADB 4PY8I 4S1DD 4HDIB 3TWCH 4JDTH 4KQ3L 5ALCL 2DM7A 2PYEA 2HFEB 4XCNA 5AWNL 4KROC 1OARH 3ALWA 2D9QB 3B9DA 4NQED 5D2NC 4G8EB 4HIIB 2JJTA 4OLWL 4UBDD 2VZUA 4NKOA 3QBTB 4UINL 3RZCD 2YK1L 3B9KC 1N4XH 3TO4D 3AS2A 5FO7B 2AXJA 4X8XA 1QYGH 1NGYB 4NQEA 2Y5TA 2CUHA 5CZVH 5I16B 3S4SB 4U0QB 3RZCA 4YDVA 3VWKB 2X4TB 4B7LA 1A5FH 4XCFH 3ZKSD 2IQ9L 3WHE0 4Z5RB 3T3ME 5IMOA 4LOUD 1F90H 1E6JL 3W9EA 4GAGH 2EYSB 1B3JA 4D0BA 5D72H 3RTQB 3UCRA 1IGFH 4LASL 3NOIA 4JO2L 1IJ9A 1N2RB 2HJLB 4R0LC 4N0UA 2R2EB 4LMQE 3IFNH 3MRNB 3VFSB 1QOKA 1OGAE 1EHLL 3PWNA 3K2UL 2F5AH 3CFBB 4HS3A 2HG5A 1ZLUK 1S78C 3M17B 1KENL 4RIRA 3BPOB 2FB4L 4PB9H 4G5ZH 1R3LB 4HIEB 1KLGA 2GJ6B 4YDIH 4LEXH 5FB8A 1JHTB 3MBXH 4K3EL 2DQIH 5DC9B 3F7QA 1UB5B 3NAAH 4PGEA 1A4KB 4ELMB 3O6KH 4WVRA 2EDOA 4JPKL 2OXGA 4HKJB 3OTTA 3S98A 1MAML 3KPQB 1UZ6E 1FAKT 5JQ6L 3PIQB 4MB4A 3C2AL 1DANU 4M4RA 5HI4D 5KTEH 2R8SH 2MCPL 3CFJA 3V5HB 4U6VL 5IMMA 4KK9C 1MJ7H 3I84A 4GAYA 1T1ZB 3SPVB 5DD5L 3VD7A 5DJDB 3QCVH 4NO5A 4P3DA 5TE4L 1H3VA 4KGLA 1HHIA 1YQVH 4QT5A 2Z4QB 3U0TA 1C8PA 4X9IA 1K8IA 4G8GB 5IEHA 2XY1A 1EX0A 3KPOB 3QA3B 1SQ2N 1PEWA 3BO8A 3IJYA 4P23C 4PY7A 4ZUVB 4DVBA 1PZUB 4JO1L 2J1KA 3GSUB 1YC8A 4QHMA 5FV1L 1MCWW 1T03H 1PQZB 4RRPA 3IDXL 3KYOA 4XCCL 5E7FA 3IAGC 2ADJB 1PLGH 3FFDB 1JPTH 5E9DA 4NSKB 4HLZH 5BS0D 3O2DA 2NY0C 2X05A 4MNGA 3BQUD 2IMNA 3CVHA 3FQXB 3P30L 3U0PB 4PRID 4E5XB 4MQTB 5FO9B 1G7MA 3VE0B 1E4XH 1RZFH 4JFOA 3TO2B 4L4TA 5BS0A 4PBWD 5DO2C 3SDAB 4K7PH 3FZUD 2CK2A 2WINA 3QIWA 4JFYB 4UU9A 3CU1A 4YPJA 1BGXH 1OAUL 1WIOA 2DLIA 4PRIA 1PKOA 4ZYKA 3U4BL 4CADB 3PP3K 4L5FH 1E28A 3AS1A 4JM2B 1KXQE 2X4OA 3ARGA 1RZ8A 5DLML 4DEPC 4PFEA 1I7RB 2AVGA 4LSUH 1T0MB 2FDBP 1RZ7H 5EZJB 2ITCA 5ANMA 4XP5L 5D8JH 4CNIB 5KBNC 4MJIE 4J3SA 2FEDC 2FX9L 2FX7H 3AXLB 4MD4A 1FL5B 1LO3L 2WP3O 2X4NB 5FDWA 3UTSD 3ZT5A 1EGJA 3QXVA 2AJUL 1FL3B 4JVUA 1CFBA 3D3VE 1JF6A 4WW1A 4HUWA 4HMEA 5FYJL 5F7KC 4P2RD 1T22A 3UTSA 4HULB 5BVPH 1QFUH 3JUYA 3E2HB 2D7OA 4UT7L 3L7EA 4JKMA 4NM4H 3KNBA 3KPSA 4UQ3A 5CGYD 1U8HB 2HJFB 1SJEB 1CXIA 5I30H 1MAKA 1TXKA 5C09A 5F7NC 3UJTH 5C2BL 2FEEL 5I66A 1LO0L 1BJ1J 1VGKB 3BMVA 4X6DA 3VXQA 1I1FB 3BRDA 4LLMB 3UBXB 1UKSA 3C5SB 5J13C 3DNKA 2CGRH 4FQXB 4QRTB 2DWDA 5EBMA 2DIBA 3PWPA 3U79A 3QXUA 5KSVB 3KYKL 4WO4C 2V17L 3V4UH 4RSVA 4PJIE 5F9OH 2XFXB 1KELL 4IDJL 3SCMB 1TVBB 4TQEH 2V7NA 3BZEB 4RMVA 2J7LA 3VFUA 1Q9KA 2H2PD 1BQHG 2IAMD 2XI9A 5F7EL 5GS0C 4WV1C 2FGWL 3B5GA 2PYEB 4D0CA 4XCNB 3SKMA 1URLA 4YX2L 4ONOA 4HD9A 4OZ4A 2AK4A 1CFVH 1HKLL 3M8OL 5F9JA 4NKOB 3EYQC 4UBDC 4OF7A 4KJQD 2VL5A 4NUGH 3QFJE 3IAQA 4NZDA 7FABH 3TO4C 5IMLA 1MJUH 4DAGL 4NQEB 5MI0B 5L2KE 1IC4H 2Y5TB 3HC4H 4K8RH 4LVNC 3RZCB 4YDVB 1DN2A 1I9JL 3FO1A 1S3KH 2IG2H 4RFNB 1EMTL 4EN3D 5IMOB 3AMLA 4LOUC 3EZJB 3W9EB 2AABL 3GSVA 1WTLA 2CIKA 1HCVA 5F9AC 4D0BB 2NXYD 2Y06L 3KGRA 2ZUTA 5CCKL 5HYJE 2DQTL 1WJ3A 4N0UB 3UDWA 4IOFD 4EI5C 4H8WL 3SDCD 4OI7A 4UT9H 1AD9A 3PWNB 1MREL 4GRLA 4HS3B 2HG5B 3C09C 4RIRB 5LBSH 2MCG1 1KLGB 3TA3A 4QRQA 1NSNL 5FB8B 4G6JH 5HD8D 1JHLL 3V6ZA 1JHKL 2NY4D 5J1TC 3RUGE 1CL7L 4YHYB 2RB8A 3ILPA 4PGEB 1FHGA 5IVXE 2E9WA 1AO7A 4L4VD 1CD0A 2DDQL 5JW4M 1TJHH 4A6YL 3I50L 1DL7H 1U6AH 1MRDL 4KDVA 4PJCE 3FN0H 5LKNA 4DFHA 4X6CF 4QHKJ 3MOBL 3CFJB 3X3GH 5IMMB 5HI4C 1T7VA 4MAUL 4L4VA 4GAYB 2R0WH 4NO5B 4GXUN 4P3DB 2PR4L 1HHIB 4QT5B 4LVHC 4YHMH 5LCVL 5DEZA 3U0TB 5BV7L 1K8IB 3ZKMC 4JFFA 5IEHB 3AS0A 4HEME 3ULVD 3H7BA 5C6TH 4MCZA 3BO8B 3QUXA 2FH6A 3C87A 1PKQA 3IJYB 3BT2H 4PY7B 4DVBB 5IQ7H 3CDFA 4GSDL 4QHMB 3G9AB 2ARJQ 3F62A 2YS4A 3EHBD 3Q3GA 4XX1G 2OK0H 3KYOB 4NN7B 3O0RL 4P2CG 4UOW0 2GSIA 3BKMH 1A3LH 1ONQA 5E9DB 5TQ2L 5K93A 4MNGB 3IXAA 1Y6MR 3CVHB 1WICA 3BQUC 1TENA 5DUPL 1MQKL 4RBPH 4XAWL 5E1HB 5C70A 3BN3B 1G7MB 4MQSB 5K33A 4JFOB 4TSCL 4L4TB 1BX2A 3WLWD 5BS0B 5FA3A 2DS4A 3QIWB 2WINB 2XA3A 4UU9B 3FZUC 1OT1A 2GIYA 1BVZA 3MLUH 4PRIB 3KPMA 5T1LD 4Z7UA 4ZYKB 2C3GA 4XWGH 1E28B 1G1YA 5MENA 2X4OB 1I1AD 4P2YA 4MZ3A 3ARGB 1RZ8B 3EGSA 5CEZH 3MROA 4WHTA 1AFVL 4CU6A 4M1DH 2VQTA 1M7IA 1OW0A 2UZXB 5T1LA 4CJ1A 3MGTA 1YY9D 2VDPL 1HINH 2ITCB 4TVSa 5ANMB 1XF1A 1I1AA 4D8PB 4NHCH 1W72A 4MD4B 1I8IA 5FDWB 4GAJH 4D9LH 2A9ML 1MLCA 1YECH 1CN4A 2RAMA 2CMRL 4YPGA 4JN1H 4WW1B 3GRWL 4HUWB 1T22B 4J12A 5CD5D 3UTSB 2QKIA 1MCPL 1UM5L 5IQ9A 1K8DA 3L7EB 1RFDL 3KNBB 2A1WL 3KPSB 4UQ3B 3QISA 3UO1L 4HS6A 1YN7A 4KQ4H 5D7IE 4YQXH 5C09B 5I66B 4M6NL 3VXQB 4X6DB 4P2QE 1FQ9C 4Y19D 5FCUH 1A7PH 4TUKH 2DWDB 5EBMB 4K9EC 5TQ0H 3PWPB 3JV5A 1QQDA 2ICWA 1AJ7H 2Z92A 5E2WH 3BX7C 2ILLA 5CWSA 5DMIL 2EDXA 2PW2A 3QPXH 5JDJA 5F9WB 2XYCA 5SWZE 2BSED 4G3YH 4Y19A 1DEDA 1P4LA 5C0BA 4LHJB 4FQLH 1FG2A 3KHQA 1YJDL 2V7NB 2GK2A 1P1ZA 2D7PA 3VFUB 1Q9KB 2DYPD 3VWJC 4G42A 5ADOH 2Z31C 3MJ9A 3X17A 4D0CB 4KUZH 2JKXA 2DLHA 3SKMB 3KXFD 1NJ9A 1RULL 3S3JA 2W0KA 4W6XB 5KJRL 1J1OL 4OZ4B 4PRHD 2AK4B 5E4EB 1OLZA 5F9JB 4QGTA 1AD0A 2JCCE 1GOFA 4QRSA 4Z7WA 1TFHA 4LKXA 3GM0A 4N68A 2VL5B 5EG6C 1I75A 2WAHA 4PGDA 5IMLB 1H5BA 5SX5K 4QXTA 4PRHA 1MFNA 5HHOD 4NQDA 1S7UA 1JGVH 1IMHC 1OAQL 1QTYT 3FO1B 4MXWL 3ILQC 3D39A 4V1DD 4EN3C 1BREA 4IMKA 4U1GB 4U31A 1IGJA 3GSVB 2CIKB 3O2DH 4CDGC 4FTVE 4UOW1 3FMGL 3CVHH 4MDIA 3PV7A 2JIXA 4OIAA 3RA7L 1X5XA 1Z3GH 1XFPA 2IPTH 1P84K 2XA8L 2IALA 2QQLH 1T1WA 3L3JA 4V1DA 1I9IH 1AD9B 1DSFH 3ZDZF 3EYSH 4OD1L 1R5VA 4ZQKA 3T3PE 2NXYB 3GMLA 5C8JA 4GRLB 5I75C 1J0YA 3WBDA 3TJHD 2RBLA 2J5LB 3TA3B 4QRQB 4N0CC 4XNQA 3V6ZB 4Y2OA 1ODAA 1C5BH 3MACL 5HD8C 3ILPB 2P5WE 1AO7B 3BSZL 25C8H 4P49A 1T5WA 1T2XA 3T0EE 3KPTA 4IIQA 3TCLA 4HPOH 1FDLL 2YBRA 4L4VB 3TT3L 5AYUL 4LPYA 2F19H 1MSPA 1GGBL 1Z6JT 3KG5A 2VAAA 4H88H 1CQKA 4Y4HD 2XICA 4OLVL 5CILL 1EJOL 1A64A 1UM4L 2MJWA 4ZO7A 1LO2H 4JFFB 3S5LG 2AJZA 4I3SL 3H7BB 3ULVC 2VXVL 4MCZB 4L29A 3QUXB 4ORGA 1PKQB 3BD3A 4O9HH 4JY5H 4ZSOE 1QP1A 2VDQL 3EYUL 4YJZL 1YEIH 1VADA 3Q3GB 1I9RH 3BKJL 3EHBC 3WSQH 2CH8A 1K2DA 3ZE1E 2ZCLH 1HI6A 2CR6A 3NTCH 3GKWL 2OCFD 1YUHA 3JV4A 2WLYA 2GSIB 1ONQB 5BMFL 3DVNA 3F65A 2MSPA 1A0QL 3F6LA 4OQTL 4EDXA 4N8PA 4TUOA 3IXAB 4CW1A 5IVZA 1ZVSA 3NH7L 3WLBA 3HRPA 1BIIA 4K71B 1S7TA 3ARDA 1BX2B 5FA3B 3FN3A 1V3MA 1SEQL 3WN5C 5GZNC 4IRZL 3KPMB 4GOSA 4Z7UB 2MMXA 3H3BC 5AZ2L 5MENB 1KIRA 4JHWH 3HMWH 3EGSB 4OFPA 1JZ4A 3MROB 3BGFC 4WHTB 5HVHB 4K7PY 1M7IB 5T1LB 4KRLB 3MGTB 1YY9C 1I1AB 2AJYL 2AKRA 3VFTA 3G9VA 4KPHH 3K80A 5DD0L 1W72B 3K1DA 3X14A 1NEUA 4I5BA 2QEJA 1I8IB 5L6YH 3THMH 3LPWA 3MV01 4U1IA 4MDJA 2F53D 1MLCB 5DZNA 5TDOA 2IBBA 4UDTA 2X9XA 1RVFL 4YPGB 1ZWIA 4XWOD 1MJJA 3NPZB 3TM6A 2ZCHH 1A7RL 2R0LL 3TZVC 4OM0L 4EQ2A 2F53A 2QKIB 1XGTA 1KCRH 3LQAL 5IQ9B 4ZOEA 3GFUA 1K8DB 5LWYH 1FAIH 1YN7B 4HS6B 8FABA 3HI5H 4NO0A 4KVNH 1TQCC 2XZQH 2HYMA 3A6BH 3QCTL 3LPFA 4NP4H 1QKZL 2CQVA 1QQDB 2ICWB 4ZTOL 2Z92B 5CWSB 1JNNL 2EE6A 2P47B 2PW2B 5I2IA 2DD8H 4U0RB 1MI5D 1OAKH 4XPBL 5JR1H 4Y19B 1K85A 1H8OA 1P4LB 4NFCA 5C0BB 5IGXL 1FG2B 5IG7A 2QHRH 1P1ZB 5E0QA 5ISZD 4G42B 3GBNH 5DK3A 3C60C 4PJ5E 4NT6A 1MI5A 1TITA 2YKLH 4XBPA 1NQBA 1NJ9B 1RZKH 3EOTH 1J9CT 4BFIA 4OCMC 1AD0B 5H94A 4FFWD 4QRSB 4Z7WB 4LKXB 4DK3A 3PGFH 3AAZA 4PGDB 1H5BB 5FV2A 1B2WL 3RGHA 1U3HD 3DGCR 3G5YA 4QXTB 4PRHB 4Z9KB 4NQDB 3ZL4L 1S7UB 2NZ9C 2IAND 4HSQA 1NGQH 4PLJD 4KAQH 5C0DA 4WFED 3U7YL 3D39B 4HFUL 4KJYA 4L8SC 1U3HA 3SKNA 1IGJB 1OQOA