1FL6B

The hapten complexed germline precursor to sulfide oxidase catalytic antibody 28b4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
219
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGSYAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY GERMLINE PRECURSOR TO 28B4
publication title A comparative analysis of the immunological evolution of antibody 28B4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 219
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl6B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fl6B01
2LAGB 4NFCA 1YECL 4K9EH 1D5XB 5D2LF 2FEEI 5DJ8B 2W92A 1M05A 4G8GB 2KQNA 4H1LG 1RJZA 5D7IB 1TZIA 1WAAF 4NUGL 3SGDH 5DQJA 5JORB 1HDMB 1TTGA 2ITCA 4AM0A 3MYZA 4PTUB 4JDTL 1WEJL 2FWOA 4P5TC 3EFFB 5D7JA 5IEKB 4MAYB 5JA9A 3MRMA 4GUPB 3DXAD 1JUFA 3CSYA 3NIDF 2FRGP 1RUQL 5EU7E 5HHNA 1JGVH 5CKGA 3DX7B 2EE6A 4HJGB 4XB7A 1F8TL 4NRZB 3MO1A 3Q5OA 4L4VE 4U7MA 3U7AA 2ICCA 1UWGH 2B4CC 3I2CH 4H26A 1DUZA 5C8JB 1MIML 4JY6A 5JXED 2P8PA 2P4AB 1HHGA 1WWBX 1U36A 4MA8L 4NO0B 5SV3A 3MRJB 2UVEA 5IW1B 4NKOA 3RWJB 1GJIA 2AI0L 4NZTL 3WHE0 5D8JL 1UM6H 4LPYA 4NT6B 3OGCA 4FMKA 4HWNA 3E3QC 3B9EA 2PNDA 5E1AB 3ARYA 1G6RA 5D70L 1N59B 1HXMA 3T2OA 1KG0B 2I60H 3BEWA 5KZCD 1DQQA 4N0FA 3GM0A 4NSKA 4TVPD 4LCWB 1AO7D 4ALAL 3WXVL 4YEFA 3KPQA 5CP7B 3W2DH 1X5HA 1INDH 4FQ1H 2FJHA 1FN4B 4Z78B 1YYML 1JHTB 2NY5C 1H8OA 3LS5H 2Q8BL 2AEQH 1TENA 3RDTD 4EN3D 3QT2A 3P9WB 4PJIF 5D9SA 1OW0C 4CU7A 4MD5B 1F3JB 4FABL 3EOBA 1BF2A 4OTXL 5H35B 2V7NA 1IAOA 3HUJB 4Z5RA 5F3HA 4C83B 3QIBC 1KB5H 3W81A 2BJMH 3LEXB 2H8PB 1QUNA 4X7DC 1UXSA 2CLRA 2DRUA 1YEGL 2PO6D 3RRQA 3J8F7 5TF1L 3IDUA 3RWEA 5DHYB 4L1DA 5JOPE 2RFXB 5EBWA 1I9RL 4LSQH 3TN0D 1S7XB 2ZZUT 1PDKA 3FZUD 5CJ5A 5KSBA 3MLXH 4JRXD 4FQJH 5T33H 4JKPH 3JUYA 4M48H 5CILL 4ZAKB 4MAUH 4D9RD 1MY5A 2XWJB 2A6IA 3BE1H 5F7LB 1Z9MA 4R2GB 2CLVA 2WUCH 2Y5TB 2IAND 4YDIH 1JPGB 4EBQH 2X4RB 3O41B 1EUUA 5GGTL 3DHMA 5INDB 2X7LA 4G43A 1T66C 2Z91A 1F4HA 4UBDD 4JZJB 1E27B 5FO7B 3ARGA 4U7KA 2EDBA 1NH6A 3O0RH 2WWKO 3QBTB 3NH7L 3I3DA 2IF7A 2VQ1B 4PR5B 1WBYB 4JFOA 3ZE0F 1RUMH 5HI3D 3TBYB 5JIPA 3LKPB 4DZBA 3WFHB 4JREB 3O6KL 3G6DL 4QTHB 1NBVL 4IM8A 1AD0A 3RGHA 5DFVC 2OL3H 3GI9L 1ZGLA 1AR1D 5I2IB 1HHIB 2XIDA 5K9OB 2R8SH 4AG4L 1IZJA 5K9JH 4C54A 25C8L 3SDAD 5E6ID 3VXRD 4XNMB 5ALBL 1Z9SA 1IT9L 5EC2B 4F9PC 2EH8H 3PP4L 2HH0H 1EHLH 4Z7UA 4GKNA 3QQ4A 3FONB 1P7KA 4PJ8D 1C5DA 2D7QA 1QQDA 1T7XA 4D0BA 1BIIB 2NZIA 4I0CC 2GSIB 1T04A 4F57L 2VC2H 4XRCB 5SV4A 3BGFC 2R0ZL 1XF4B 1AIFA 3GJEA 5HD8C 4LLUB 2K9UA 2ZPKL 4C56A 3LV3B 2OM5A 4KJPC 4ZYKB 3C60A 1DQML 1IBGH 2GKIA 3BZEA 5IEHA 3MODH 1NUGA 1MRCH 4XAKD 5FECA 5EZLB 4I18B 4RAUB 5E8DH 1OGAB 3DURA 4Y16A 2NPLX 3TPUB 1OY3B 4S1SH 1MLCA 2F54E 2V2XA 5FM5M 3LH2L 2BX5A 2VAAA 2YRPA 3EYFB 5GZOC 5EOQH 5CUSL 3HPLB 2CLZB 2XOTA 4LPVA 1LO4L 1R3IL 1QFWL 3K8KA 1XIWB 3JTSB 5C3TA 5KN5A 4U1LA 2E7HA 3O3AA 1L7IL 1ORSB 2X44D 3MLTA 4G8FB 3TIEA 1NEUA 3RAJL 2VKXA 3TM6A 4D9LH 1KEGL 2D31B 3DIFB 3GSRB 3DMMC 2AEPL 1AHWB 1J12A 1X4XA 3B8YA 1YQVH 3WUWB 5FXCH 4UV7L 1ZA6A 2WIIA 3CXDH 3SDCC 2O5XL 3GSUA 1DBKL 4JJ5B 3U83A 1XGUB 1VEPA 1JPTH 1MPAH 3ARTA 2BSTB 2YC1B 4WHTA 3IXAB 5E5MA 2AXGA 1P9MC 5DUPL 4P4KB 5IJVA 2IQAA 5EUOF 3VFVA 1A7NL 3AB0B 1VFUA 1GGUA 4PJBF 2ZUYA 3D39A 4G8EA 1V7NH 4O51B 2FJGB 1T1XA 4ZFOB 2NTSP 3NACH 4OZHF 1RIHH 2NY7H 3A0OA 3OZ9H 1AP2B 3KYAA 4XCFL 5AEAA 4O2EB 4L4TD 4QHKI 2D2OA 4S1RL 1T4KA 2VLLA 3RY6A 2ZUXA 4TVPL 5E24E 4EI5A 1I1AA 3WJJC 4DQOH 5F6HJ 4P3CH 2JK5A 4JFHD 3GRWH 1IGTB 4JZOB 5IGXL 2A1WL 2DTML 2W0FA 1T7VA 3VFMA 3LHPL 1G7MA 5EDXA 1CD1B 2Z31D 5FKAB 3P9MB 4RMRA 3MNWA 3OG6B 3CFBA 4YWGL 3BD3A 3I85A 4XCYB 5IB1B 3O6FC 4XHQA 3VWKB 2HKHL 4XCNA 3TVMD 3WIIL 1S7RB 4KKAD 1BVZA 4CUCA 3FB6B 3MRHB 3HE6B 3X13A 4HF5H 1HSBB 1K8IB 3UROR 3VXNB 5H94B 4YFLI 3TFKC 2VUYA 1KJ2L 4NC0B 1ONQA 2Q20A 3WFDH 4JFQA 3BD5A 32C2B 1OARL 1T80A 3SY0B 1CK0L 1PLGH 1CCZA 1IC4H 5C08B 5GHWL 4OZIB 4ZXBD 1BVKA 3PP3K 3N9GL 4TSCL 4IRJA 3HPJA 1ZVSA 1OSPL 3DX8B 3GSNL 3MMEA 3TJEH 5J56B 3EHBD 1JF5A 4HS3B 1AGDB 2ESVB 1AKJB 3FN9A 2VL5A 3WDHA 4P2CG 4ZTPH 3UJIL 3B4NA 3MGTB 4D8PB 4K9EL 3T0EA 3QEGH 3M1BA 4TUKL 5F7DB 4I0PA 1RZKC 3QWOA 1RD6A 2FZ3B 5J12C 5DA0B 4GKZA 3B83A 3RPIB 1QSFE 1JZ6A 4JVPA 1CFQA 4JM2A 2DQFA 1FO0H 3KPMB 1KC5H 2MWCA 4MXVE 4ZO6A 4YDLC 1QHPA 1KIQA 4P2QA 1JGVL 1UWGL 3KLHD 4LVHB 3I2CL 4N8CH 3QQNA 5HYIA 4MSWB 1U3YA 2PW2A 2GCYA 1W0WA 3ZT5A 3PWPD 2BVQB 5TF0A 1YDPA 4MGXA 1MCSA 2JB5H 3IDGB 2ZOKB 2VXUH 4WIQA 4H5SB 4O5LL 1IGYA 3MRCA 3QUZA 3KWWB 1UM6L 3EIFA 4KQ3L 5GRVK 3T09A 3TO2B 1YPZB 4X4MA 3BPNB 1MJJB 3X3FL 2KUTA 1NUDA 2FX9H 4MQ7B 2J8OA 5IG7B 1VA9A 3QH3B 3IS0X 2GK0A 1OP5H 1RHHB 5KVGH 5TDOA 2I60L 3MV8A 4BKLB 3MUJA 1S7UB 4LKCA 1MFCH 3W2DL 4G9FE 1INDL 4FQ1L 5GZND 4TTDD 3AREA 3ARWA 3FQWA 4PB9L 3IJYB 4OI8A 1TCMA 3LS5L 4HJ0C 1IQDA 4RSVA 3NCMA 2XI9A 4XVUD 2VLRE 2IALA 5ACLA 1IMHC 1V5JA 3KYOA 5CGYD 1BQUA 3KXFA 4OGAC 2X70A 2AQ1A 3BKML 4AZ8A 4UIMB 3A6CL 4YHML 1MJ8H 4X9HA 1UGNA 2I5YH 4X5XA 2BJML 1TVHA 5BRZE 1CGWA 5HYSA 3LKSB 4U6XA 1FZOB 2VDNH 2NY3D 2IWGA 3SDXA 5F44A 4LEOB 5SWQB 3G6JB 2EDWA 3O8XD 4LSQL 1JPSH 4PJEB 4K2UH 1DEEB 4FQJL 4WV1A 4JKPL 5T33L 4M48L 5DMKA 4F7CB 4TUJA 2VO5A 5IVNA 4WHCA 4JANB 1FFPB 1IGJB 2VDLL 3BE1L 3CMOH 4UT7H 4TULH 2WUCL 1BWMA 4YDIL 4XWOC 4N9GB 4EBQL 3QEQA 3IFNH 1MCWW 4LLMB 5FGCB 2EECA 4NHUA 4R97B 5FA3A 2AKRB 5C0CE 5FHAH 4I2XE 3LRSA 4DUXA 1DQLH 3RTQB 4JFED 3X14B 3FQTB 2AK4A 3DSFH 5L8JB 4CVXB 2HFEA 1CDIA 3O0RL 4G8GE 1SEBA 5D7IE 5ISZB 2I07A 4RIRB 2AXFB 5EWIH 1TZHA 2ADIA 3UZQA 4WI8A 4DK3A 1RUML 3C5ZD 5GGVY 3MLUH 1XF2B 3LOWA 5GS1C 4XHJD 2NLJB 3G5ZA 3DRQB 5IHZB 3C8KA 3SCMB 2OL3L 4OI9A 2R8SL 5ICZB 5K9JL 5E08H 4Y5VB 3TBVB 3TJHD 2EH8L 4MCZB 2HH0L 3QUXB 5AYQA 3STLB 1EHLL 5GQBA 1U58A 5EH1A 1KUMA 5HYSG 3DUUA 3BN3B 2NY6D 5DVOA 4LF3A 3H9SD 1M7DA 2BRRH 4ZD3H 3CAFA 2VC2L 3SN6N 2VXQH 4R8WH 4NQEB 1FNAA 1U8KB 2EDNA 4XX1G 1ZVYA 3D6GA 5MEQB 2F8OA 4ZSOA 4CU6A 5HHPA 3LQAH 4J12A 2H2PC 4JFPA 4LARH 1IBGL 1PYWB 3QDJD 3K2UH 3MODL 3IJSA 2EDDA 4HJJL 1JTOA 1MRCL 4LCWE 1IRAY 4E41A 2IBZX 4HPOH 1RZKH 3TO4D 2WAHA 4X5WB 5E8DL 3O4OC 3BI9X 4R3SB 3QA3B 2WBJA 4S1SL 1RZ7H 4FXKB 3P30H 1FNGA 3VFOA 3QI9B 5EOQL 2H32H 3DRTA 3HUJE 5C0IB 1LD9A 1D5ZB 2V9TA 2X4SB 3OKOB 2CJUH 3GSWB 3BGMB 4D9LL 3WN5C 5DK2B 5IMOB 5IJKA 1C8PA 3HB3C 3VFTB 2J12B 1YQVL 4RNRA 3PWJA 5C0DB 2JE8A 1MOEA 5L6YH 3CXDL 4F7PA 3GSOA 3SO5A 3T8XA 4WFED 1QD0A 5IROC 4MB3A 2PXYD 5HHQB 4YHPB 4MXWH 1MPAL 1MCBA 5DMIH 3CC5B 4OCMC 1P2CB 5A43C 3T0DA 4Y1AA 5FK9B 2MMXA 5HDQH 3TNMA 3HNTH 4G42B 2NMSA 1V7NL 2Z35A 3SDYL 3NACL 1FCGA 3O2DL 1RIHL 2NY7L 1BLNB 3OZ9L 4ELMB 1H3TA 3QIUA 2VE6A 5J89A 2ADJA 3V2AR 2V7HA 5BMFH 4DQOL 2YPLA 4MWFB 5DJAB 1CFVH 2HWZH 1N8ZB 4N0CC 3GRWL 4PJAF 4HQQH 1VPOH 5CBEA 3HLAB 5CD3A 2IQ9H 4O2CB 3UPAA 3QJFB 5DYOB 1QSEA 3N1GC 3BDYH 2V2WA 1FL5B 4AQ1B 4UU9B 1C12A 3F5WA 3HZMB 5EZJB 4XZUB 4XMLH 4JN2B 3PL6B 3L5IA 3THMH 3ZE1E 3IXTA 3RVWC 3STZB 1NGXB 2RJMA 5DJXA 4NN7B 3UEZA 3GUTA 4HF5L 3MRDB 5DUML 4GG8B 3BRFA 4RQQB 4HW6A 3B3IA 1ZMYA 5EOTA 1GGCH 4AM0B 3QB7C 4G80B 4LQFH 3P0GB 2ZUWA 1E4WH 4PLNC 3WFDL 4HEME 4H88H 3OR7A 1Y18A 1HILB 1LMKA 1WZ1L 4XXDB 2VLJB 5FF6B 3RGVC 3CSYB 2WWMC 1HIMH 2PR4L 1W72B 3MO1B 4OSUH 5HI5D 2Y5EA 1MSPA 3P4NB 2IPTH 4Y2DD 4PD4K 1MHCB 3TNNA 1NKOA 3HI6H 1OGAE 2H1PL 4P57B 1ZT4B 4KGLA 4OQTH 5I0ZA 4GS7C 3TT3H 2DLFH 3RVXC 4ZTPL 4K8RD 1NC2D 3LB6D 5B38A 5KG9A 3QEGL 2PYEA 4QNPE 3WHE1 1CD0A 1WTLA 1XF3A 5MERA 1TXKA 5DMGC 1X4ZA 3ESUF 1GH7A 4MQTB 4IOSD 2DQUL 1P4LB 1H8SA 1P53A 2E8ZA 3BEWB 5FV2A 5MP6H 4PJ5B 1H3PH 4N0FB 4W6YB 2EO1A 1SMOA 3ULSA 1FO0L 4ZUSA 3MUGA 3BIKA 5B3JF 3KPQB 4U0QB 3X3GH 3QQ3B 2E9BA 1G7IB 2JCCF 5IFJB 1FNLA 2VR4A 4YGVB 5HHMB 6FABH 3T65A 4MDJB 1KXVC 4RISL 4N8CL 3QUKA 2DQHL 3VXOA 5BZWA 2G75B 2BNQB 1MF2H 4BSJA 1U3ZA 1INEH 1R3JA 1X6NA 2V7NB 2JB5L 5FA4A 2VXUL 3QSKB 4BUGA 4PBXA 5EN2B 4RAVA 1ZT7B 1F4WH 3VU2A 4M4PA 3O6MH 4P9MH 5F88A 4F8TA 1L7TH 5HYQB 1QVOB 2NR6D 2NY4D 2FX9L 1G7QB 3HE7C 4Z77A 1T22A 3KPNB 5DZOA 5KVGL 3WL9B 5DC0A 3UTOA 4OLWH 3KAAA 4GW4B 4KJQD 3GMRA 4JEGB 3SHSA 1KLFA 2YUXA 1MFCL 2W65A 1RJCA 4RDQF 1U8PA 3ARDB 3QUMH 1PEWA 3WO4C 4APQA 3FB5A 1XZ0A 1FZMA 5IVXB 1ZLVH 2HN7A 1J5OH 3BH8A 3U9UB 1S9KC 5JQHC 2GJ6A 1U8MB 4PYGA 5EPMA 4XPHH 3HRPA 3SBWC 5EC1A 4ZPVA 1I9JH 3HNSH 4Y4FC 5BV7C 5LJYH 2IAMB 1DBJH 2QR0A 1BOGA 4X9IA 4QRSB 4JG0L 2VDNL 1OP3K 3QO0A 3T08A 4GXVL 3IVKB 2B39A 3MROA 5FGSA 5C0BB 1PZ5B 4L1HA 4GOSA 1JPSL 1H15B 4H0GA 2NZ9C 3QCTH 4K2UL 3CFEA 5J8OA 2BVPA 3T3PE 1OAUH 3UTTA 4KJWD 5C08E 1OL0A 4OZIE 3S3PA 4ODXA 3CMOL 4UT7L 4TULL 3D25A 4CJ0A 1YEIH 5DO2C 3IFNL 1R3LB 5D2NB 3QRFM 1ZHKB 5DC4B 3QQ4B 1T5WB 2ESVE 3MUHL 4LPUA 3VDCA 1WIPA 5EU6D 4CVWA 4HULB 1DQLL 1JWSB 3WFEH 1AGBA 4P59H 1A8JH 1EDQA 2AJZB 3O4LA 4HIIA 3S36X 3FO0L 1E4KA 4OFYD 5EWIL 1NANI 2F54D 1E6JH 2OK0H 3DO7A 3VE0B 3ISWA 3IKCA 2COQA 4KUZH 5FECB 5CIPA 1NGQH 3M17A 1Q94A 4XTRD 4G6KH 3VXUA 1QLFA 2CKBB 4M4RA 1D5IH 2BXYA 4Y16B 5E08L 1EA9C 2OYPA 2GIYA 3TH3T 1IM9B 4RGOL 1TCRA 5EUKB 1V3KA 3UTSB 2HJLA 4J6RH 1F11B 2BRRL 3FAWA 4ZD3L 5KN5B 3EDJA 3O3AB 4IDJH 2XQYK 4Q6IC 2VXQL 4R8WL 1YPZE 1C16A 3TN0C 5GRXG 4YBQD 4LGRB 5IHBA 4YDJA 3LQAL 3MV7B 3LMJH 5DT1H 1ZXQA 4ZAKC 1FVCA 3MRNA 1OAKL 3K2UL 1BZ7A 2OI9C 1RZKL 1FG2A 1NEZA 4HKBA 1J0ZA 4R2GC 2CIIB 4G8IA 1FH5H 5EBMB 2AV7B 1MCJA 5DSCB 4K3GA 5FUCE 4WHTB 1S7TA 2D0FA 2EDEA 4K8RL 3CPLB 1SYSB 2BMKB 1RZ7L 5FHBH 3P30L 3PV6A 2R29H 4JZJC 2AJSH 4G8EB 5GRVL 3S8WA 4GRLA 5DK3A 1KELH 3NCYS 3HC4H 1J8HB 1X5LA 4KTEH 3C6LB 3QIWA 2YKLH 2CJUL 2ZUTA 1UXWA 3TA3D 1MHHA 5D93C 1R24A 4QY8B 1J0JA 3OKNB 2QADB 2A38A 4YQXH 4PY7A 1AR1C 3JVGC 1DVFD 2BSSB 3G6JE 2UWEE 5EG6C 5L6YL 2NXZD 4PJEE 3OKMA 4QRRA 3MBXH 4KU1A 4HS6B 4L3EA 4MXWL 2ICWB 5DMIL 1LEGB 1OQOA 5FFLA 1V8HA 1Q0XL 5KS9A 5HDQL 3HNTL 5FGCE 4FQ2H 4N90E 3RWGA 4ZFZB 2YRLA 1YEDB 3Q3GA 1WQVT 3BQUD 4XBEH 2Q6WA 2DYPD 3BJLA 4ZFFB 5E00A 1EXUB 5GGTA 5BXFB 1NEZG 5BMFL 5ISZE 1A6PA 2GJZA 2ARWA 3VFUA 2CRIA 3BAEH 1CFVL 2HWZL 1YMMB 5JMRA 4NNPH 5C86A 4HMDA 2XPGA 4HQQL 4M7LT 4HMCA 1I8LA 3ZDZE 2R1YA 1BVKB 1CGUA 3D85A 3CFDB 4DTGH 5BV7H 2NNAB 3BDYL 4A2LA 4P9HC 3SGEI 3QPQD 1K4DA 1UB6A 2XA8H 1N6QH 4FQXD 1Q9KA 5L0QB 4P23B 3K4ZA 5EU4A 4QHUB 3VXTA 5HYFA 3THML 5ITBH 5D2LA 3MNZA 3MZTA 4M1GH 3OHXB 3RKPA 4JFFD 1QZ1A 4YHNB 4JCLA 1MQKH 1WAAA 3D2UB 9CGTA 4WI5A 4OCNC 1GGCL 2CR6A 2VIRB 4NDMA 2AVGA 4LQFL 1RJLA 2NXYC 1ZANH 4POZC 1CFQB 3LPFA 5DEGA 3T4YA 2X2YA 1E4WL 1JGEB 4NQEE 4RZCA 5CBAB 4H88L 5L7XH 3MRLA 4N8VA 1RMFH 1HIML 5HJ3B 4PJ9A 4OSUL 3N1QC 2JF1A 4ODUA 1PD6A 4PY8I 3RZCC 2IPTL 4IMKA 3W11D 4U1NA 3HI6L 4KDTA 1K4CA 3AB0C 4OQTL 2PYFA 1JGDB 3RWDB 3TT3L 2DLFL 3ARFD 5T1KB 1IGYB 3P4OB 4Y4HD 4KRMB 5F1IB 4G9FD 3MV9A 4OD2B 2VABB 4NKMB 2R2BA 1XF5B 3BP4B 4P5MB 1FVEA 5EU5A 3HKFA 5F9WC 3S4SB 3BP7B 4EIGB 1Q8MA 4RMWA 2VLRD 1U95A 3V0VA 3ARBA 4QRTA 3ES6B 4XNQB 1H3PL 4CW1B 1HKLH 1UWXK 4J4PA 4LKCB 35C8H 1FNSH 5HTSA 2D7TH 3AU1A 5DQDH 3I75A 3X3GL 1Q1JL 3VXPA 2A6JB 3LPWA 4PP2B 4PY8J 1IQDB 5BRZD 1ZHBA 4OBSA 1RIVL 6FABL 1FZJB 5BS0E 2FO1A 2GTZB 4PJIA 4Y5XC 3UPRA 1MF2L 3TVMC 3KYOB 3MJ7B 4MJ6B 5J06A 1T0MA 1TZGH 3IDXH 1INEL 1R3HB 1XGQB 2OTPA 3CK0H 3T4AB 4LKXA 1A1MB 5JXEA 1JN6B 1F4WL 5H2BB 5B3NA 3O6ML 4P9ML 4N8VG 3RNKB 4DVBB 4ELME 1L7TL 5F93C 2APVA 4TYUA 5JQ6H 1HXYA 1MCQA 1INQA 4UINH 4B7IA 2IPUK 4TSAH 5C0CD 1S9VB 4ZMAT 4U2YA 1U8OB 4DW2H 1TQBC 3QUML 2EEDA 2JJTA 5ILTH 4RFOH 4G6MH 5TQ2H 1AO7A 1K8DA 1J5OL 1FL6B 5AD0B 5E9DB 5KTEH 5J1SC 3QXWA 4HUVB 1W0VB 1Y0LA 1RK0A 2BOCB 4XPHL 2AK4B 3RDTA 1ZGLM 4MAYD 3HTLX 3I6GB 3GEWB 1I9JL 2CDEB 2EKSB 2HFEB 3HNSL 1SVCP 4HWEL 4IIQB 4KMLB 4FTVB 5F1NA 1M6OB 5IBUG 5C09B 2WSKA 4NO0D 4OF8A 1QFPA 5GS0C 1NCAH 2NY1B 2PO6A 2VLJE 1I85A 3KDMA 1OAUL 5DJDA 4OD1H 3KYNA 2YS4A 3H0TA 4KROD 3ALPA 4KK8C 1HYSD 1YEIL 3QG6A 2ZOLA 4XP5H 1U58B 4V1DA 4PREB 3JV6A 1N2RA 4K94C 5D7IF 3DV4A 2IANA 4HIEA 3WFEL 4P59L 1ZLUH 5TDNA 5C0FB 1G9EA 1UCBH 1FLRH 1IC7H 2FIKA 4D3CH 3GSNA 3VI4E 2X1PA 3RKDC 2HLFD 1J0YA 4QWWD 1OT2A 1ZVHA 2OK0L 2DLTA 2ENYA 4LHUB 4UTBH 1ZEAH 4KUZL 3WMSA 4PJ5E 1N6VA 1NGQL 5FUCC 4M7JH 5E4EC 4G6KL 4EIZC 5E2WH 2V6HA 1D5IL 1JWUA 4PLJD 3S97C 2P45B 1JTPA 4M7LH 4ZDHB 3UTZA 5CGYC 2BNRB 2JJSC 2Y7QA 4JG1H 3VW3H 5IM7B 1QLRB 4PGDB 5GS2D 3D48R 4LAJH 2BNQE 4MJIA 5EO9A 4H8WC 3SDAA 2LABA 2KDGA 3VXRA 4JPKH 3CVIH 1PG7H 4XH2A 1J11A 4J6RL 1I7ZB 5C92A 3CU7A 1Z5LA 2NY2B 4IDJL 4PJ8A 5IMLB 4Z7OE 1T03H 1J7VR 3WV0A 1UWXH 1MRFH 4RMQA 1NJ9A 4HHAB 1UB5B 1F6LL 3LMJL 3QXAA 3V4UH 5DT1L 3IYLW 5MEOA 4YLQT 3G5YB 2AS5M 1EZVY 3NIFE 1MCEA 1CL7H 2Q86B 1DFBH 2VDMH 1SY6H 1TQCC 4Y4KA 3GSXA 4R97C 1MI5B 5EUOA 3HUJF 5FHBL 4PJBA 4WFHD 2R29L 2AJSL 2DLHA 4OZHA 1KELL 4U1JB 3KR3L 2X41A 3MXWH 4JDVA 1WT5A 5JO5A 1CU4H 3TBWB 4KTEL 2OJZH 4AEEA 4X0KA 3ZKSD 2X42A 3OAZK 4KJYB 1I9EA 4JO1H 5E8EA 1S9WA 4KKLC 3DV6A 4QCIA 4YQXL 2FBJH 3PIQA 5CD3B 4OAWA 5C0BE 2V9QA 3KPLB 1KB5A 5J11B 2R4SL 5T3ZE 5CSZB 4HG4J 5ID0A 3MBXL 5JLZA 4Y5VC 3HMXH 3TBTB 4Q9QH 4WHYH 2P7TA 2DWDA 2AJ3B 5D2NE 5D1XB 3QDGA 4FQ2L 4UQ2A 3PGCB 3D3VB 3D1MC 5K93A 4ZG1A 2IFFL 4XBEL 1PX3A 4P2OC 5DLML 43C9B 4Z7QE 3BESR 4UQ3A 3T0VA 2E7LC 3FFCB 4LSRH 3NBNA 1A21A 4O2FB 5DD0H 4HUXB 3BT2H 3BAEL 2DLGA 4HT1H 3TO4C 4IOIB 3TZVA 5F8QC 1CN4A 3I3EA 5JR1H 4IRSB 3LN4B 4LCCB 5E95B 4DTGL 3MRRA 4KTDL 3QCVH 1IEBA 1XIWD 1N6QL 3PE9A 1L9NA 4HKXB 5ITBL 1V3MA 2OL3A 4M1GL 5B38B 1MQKL 2J7LA 2A74A 3UTSE 4XNZB 3W9EB 4GKSB 3SKMA 4R90H 3BHBB 1FFOB 1IGCH 2P5WA 3MJ8A 4KGJA 3FO9B 2QEJA 1YNTA 3FFDB 1ZANL 2VISB 5ANMB 3W9DB 4P4KD 1KACB 5L7XL 1NFIA 2VAJA 4LEXL 3MV7E 4UAOC 1KSRA 3IAQA 3BWAB 4NYLA 3VXOB 1Y6MR 3IDJB 1YUHA 2YOCA 4PJFB 3V9FA 4ZXBA 4QNPF 4PTTA 5I15H 3ILQC 4TTGA 4UNUA 3V5KA 4YR6B 3C8DA 5DJZA 4N1HB 1FZKB 4GW1B 1VGEH 3MFFB 1EJOH 4LNRB 5CLTA 4AT6A 1AC6A 4P5TA 5TPWH 2NW3A 4HX1A 1P69B 4L9LC 3QHTC 3OJVC 1A9BA 1YEKH 4LBEA 1HKLL 2XTJD 4MYWB 3WFZA 5F70A 3UBXA 3HS0B 3V4VH 3VWKD 1FNSL 2C1OA 2D7TL 1XCQA 5DQDL 3V52H 1QFOA 5J6GA 2XZQH 2JIXA 1XZ0B 3HE6D 3KLAB 5HPOA 4MJ5B 3R06A 3STBA 3OGOE 5FYJE 2FLRT 1KCLA 4IMLA 3IDXL 3MGOA 4PUBL 4D0DB 2YPKB 2B0SL 4ONHA 5C08D 2QR0B 1HQRA 3O3EA 5KVEH 2HMID 1JNHA 5E8PB 5CGMA 5HPMA 5CMAB 4B41A 5EO0A 1FNFA 2O93L 2A73B 4NQVB 2ESVD 3P9LA 3QEUB 2BERA 5HGGS 3NGBB 5D1ZC 5EBGA 2A6KA 1YMME 1D5MB 4KRLB 4Y2DC 4NQDA 4DW2L 5E8NA 1Q9LA 5ILTL 5HBBA 3UZEA 4G6ML 1E4JA 5TQ2L 4HUWA 1OW0A 1KIUA 1CG9B 1FJ1B 1BFVH 3SJVB 3WS3B 3AAZB 2YD5A 5TE6H 2AV1A 3X11A 1NAMB 3SOBH 1AGBB 3QIBA 3NTCH 3DROB 1N4XL 4UDTA 1UQSA 4LSVL 3NPZB 1ODAA 5F7WC 3L3GB 1CICB 2CDFA 3EZJB 2FR4B 3UBXG 1UKQA 3HG1B 3VJ6A 4ZUWA 2BCKA 3CDCA 1V3LA 5DI8A 4PGEA 3U6RA 3DO7B 1XGYH 1MUJB 3P0VH 2XN9B 2R23B 4LK4A 4OZIF 1PSKH 2HTKD 4LLYA 3FT4A 1NCAL 3UO1H 2ICWJ 1PQZB 3WNKA 2DQTH 1OTSD 4OD1L 5I76A 3VGAB 3BPCA 1E4XH 1RZGA 3S5LB 5F96H 4BSVA 1KJVA 4XP5L 5F9JB 3TP4A 1T5XB 1FFNB 1G7PB 1DE4B 4GMSH 1RU9H 4HKJB 2NY4C 1UCBL 3H42H 1FLRL 1IC7L 1IAIM 1QBBA 4CNIB 4D3CL 2YA1A 3O3BB 4GT7A 1Z9LA 4YDJB 2IH3A 2X9XA 3ROLA 3JTTA 4K7PH 5ICYA 1MCPH 3IFLL 1YN6A 3I6KA 3VFPB 5ACZB 4UTBL 3OAYH 1LP9B 2FHFA 4M93B 5F97E 3LKRA 4M7JL 3VFRA 4ETQA 4HKBB 5E2WL 1T21A 4M7LL 1S7QB 4PJGB 4F9PA 4PV9A 3MJ6A 3QRGH 2C26A 5JPMB 2P42B 4RA3A 3VW3L 1OAZH 1FO0A 1A64A 4NNYB 4KRPC 5LWYH 5LKNA 3KXFE 5DJ2B 2E7CA 1B4JH 4JPKL 3CVIL 1PG7L 4NQCA 1YPZF 2XKNB 5JTWA 1DQJA 1G7HA 2DBLH 4WWKB 1WCBA 1EFXD 1SJVA 1MHHB 4LRIC 1MRFL 4N0UA 4XC3H 3V6FB 4P46B 4E5XA 1A7RH 3U7YH 1K3IA 3WNMA 4ZFOL 2ED8A 3V4UL 4N90D 3V6ZA 3HCVB 3WS6C 1HCFX 1NBZA 4RCAA 1CL7L 4JDZA 1SY6L 5FDWA 3QDMA 1GGTA 5L2KB 4J7RA 3K8MA 5E9DE 3VFNA 4UV4H 3P77A 3RWGB 4AIZB 1NGYB 2KZWA 3LRHA 3MXWL 2F8XC 3MOAH 3WEXA 2AK4E 2IG2H 1CU4L 2HTLD 1P4IH 2PTTB 2OJZL 3U46B 3CLEH 3PXHA 3U30C 1F6FB 3G6JF 2GJZB 2WK2A 4JO1L 1FP5A 2KH2B 4FQQB 3WLBB 4PJEF 3QUXD 4PJAA 3QNYB 2XPGB 3SDCA 2FBJL 2QBWA 5C09E 2UZIH 4HCRH 3VRLF 4UT9H 4ZFGH 4XPFL 1P6AB 1TETL 5IW3A 1ETZA 4FFYH 2DQGL 5JUEH 4HZLA 1KCKA 4KXZH 5EZOH 3E2HC 3WKNA 3PJSA 3HMXL 4WFGE 2XG4A 4OZGA 4NQED 5DJYB 4Q9QL 5C6WH 4YBLC 2PXYA 3O3UN 3VG9B 1W72H 4M7KH 3KPSA 5EO1A 5IK3B 1YMHB 1MHEA 1RAMA 3MREA 3DUSB 1KB9J 3S35X 4CU8A 1LEKB 2XKSA 1UJ3C 4AYFA 3KPPB 5F7UA 1RJLB 5F3BB 5HGAA 2R0LH 4RZCB 5DD0L 3BT2L 1JK8A 2ZUSA 1QR1B 4HT1L 4Z76B 3AMLA 3DI3B 3L3KA 3GB7A 3QI9D 3WSQH 1C08B 4LDLB 5JR1L 2VNCA 1GC1C 4E41E 1LK2A 3SE4C 3QCVL 3VWJC 2YXFA 5F89A 5IWLC 4R9HA 1K4CB 3OKKB 3O6FA 2PYFB 5SWSB 1ZS8A 5EBLA 1UZ8B 2J6EL 3RX5A 1B6DA 5HVHB 4TNVK 3BKCH 2VN4A 4NM4H 2DS4A 3R8QA 4LMQE 5EU5B 2YR3A 3B5GA 1A22B 3WYRA 4R90L 3D0VA 3S88H 1IGCL 5BS0D 4XVJH 5CEZE 5EORH 5JW5B 3BP6B 1TPXB 3V0VB 3ARBB 1DVFC 4QRTB 3D69B 4L4VA 3OX8B 3PDOB 5F6IB 2NXZC 5FOJA 1P4BH 3VD4A 1U3JA 5F72S 1R5WB 3U2SA 2BY3A 2JCCA 1P84J 1BQHG 3S9DB 2ZNWA 1ZHBB 2DM3A 3MR9A 1F4XL 2CO7B 3T1FA 4HBQA 5IHLB 3ZHKA 4LMQI 5J7CC 4Z95H 5I15L 4OLEA 3QNXA 1MI5E 4ERSH 4OZ4A 4OLXH 5FM5O 1S3KL 4HV8A 1KGCE 4Q2ZB 1KCVH 3PXJA 1YA5A 3B9KB 4QXTB 4MQSB 2M1KA 4AMKL 3HAEB 3ALWA 2H32A 1YEKL 2M2DA 3EGSB 3NMEA 3PL6D 4EOWH 5BW7C 3V4VL 5IV2B 1PFCA 1X9QA 3V52L 5GGUB 1DANU 1XR9B 3ILPA 3BX7C 4J1UB 5AAWA 4FQXC 1D9KC 3ALXA 3CUPB 2CXKA 1U8HA 1QSEE 5L0QC 1OGTB 4LASH 1RUPH 3AMKA 4KTYA 4MB4A 4GAYA 3S37H 1PX4A 5T3ZH 2V5RA 3L95A 3NIGE 5DRZA 4PIRF 4ELMF 1CLCA 3QUYA 2VLJD 1QYGH 1RZIB 2BSRA 3RWFB 5M95B 3D3VE 5KVEL 5DUBA 4P5KB 4R4BA 4Q9RH 1MFDH 4KK6D 5F1NB 4PRDA 3EJYC 3QXUA 1N5AA 4ODWA 2ZUQB 4U7SA 3WFCH 1MVFA 4JN1H 3IDIB 3KDMB 5F9AC 3ULVD 2RBLA 5MEPA 3JWDH 5FDYA 3B2UC 5I1KH 1AQKH 2ZOLB 4V1DB 1BFVL 5B8CC 5TE6L 1UC6A 1I1FA 4PJ5D 5FYJU 3SOBL 2APWA 2B8OT 2CKBH 3NTCL 3AC0A 1A0QH 4WTZA 1KNOB 4DGIL 1A7OL 3NFPA 2VMFA 2UZXB 4RDQG 4K23H 2CPCA 4WRLA 1EV2E 2Z8RA 1XGYL 2BNQD 2W60A 3P0VL 5EB9A 2P5EB 1EIBA 1PSKL 2CK2A 5ANME 5DRXA 2DIBA 3FTGA 4M7ZC 3MX0A 4NO5A 4X6FA 5D1QA 3UO1L 3FRPA 4UDUA 3L3HA 5CGTA 1JWUB 5C0NC 2H6PB 4HK3N 2NX5B 2Z92B 3O9WC 2Y25A 4KHXH 3NN8B 4NCDA 1NCTA 3HRZA 1E4XL 1UVQA 5F96L 3MLWH 1MH5B 4PJFE 3TGXA 1NBQA 2VITB 3MJ9L 5CSGA 3VI4F 3HZYB 3SE3C 4GMSL 4X7TB 1RU9L 1EO8H 3KLDA 3BKYH 4QF1A 3H42L 3HFMH 2X10A 4OQTA 5HXMA 1C5BH 2VDRH 5HY9B 2G5BB 4PV8A 5GS1A 1FSKC 4MCYA 4K7PL 1MCPL 1L0YA 1SQ2N 3BRDA 3RIFF 1NCWH 4OFYA 3VXMA 2F54A 3MLPA 1KCSH 1A6ZA 2XYCA 3ARGD 5INCA 5IIEB 5JA8B 5L9DL 5DRNA 4WTZG 1NC4A 3QRGL 1BBJB 3O11A 1OAZL 3SKNB 4NCC2 2YPVH 1I3UA 1OF2B 1FDLH 3BXNB 1B4JL 2DM4A 4JDVB 5A2LH 4Z7OF 2ARJA 3VGEA 2V5MA 1ZSDB 4IIQC 5FYJH 4WHDA 5E8EB 1JPFB 2APTA 3AY4C 3W5MA 4QCIB 1CT8B 1CFTB 3U7YL 2GITA 1JYXA 4JFXA 1H5BB 3Q6FA 3OJMB 1PY4A 5C0JA 3FCTA 2X40A 1A3RH 1I8KA 4M9PA 1FV1A 1KT2A 5IVXF 1BFOA 5FB8A 4KROC 5ID0B 3HN3A 1LNUA 4JFDB 4ONFH 5IVZB 2ZSWB 4L3CB 3NFNA 1ERNA 1NMCB 3GMLA 5T1LA 2WANA 1OAQH 3KJ6H 4UV4L 3SJVE 2AP2A 3QUMA 3VH8A 4L8DB 1XT5A 4HPYH 1CBVH 1P4IL 3PGFH 1EAPA 3CLEL 1NBYA 3WN5A 4Y16D 3HG1E 4PJCB 4MMZC 3UYPA 2BVEA 4WJ5A 3UAJC 5DDHB 3L6FA 1IM9D 3D18A 2EDHA 1T1ZA 4MX7B 4OLYH 2XN9E 1RULH 2UZIL 4HCRL 2R1WA 3G9VA 4YO0A 3UTSD 3ZKXB 5EU3A 4UT9L 3TA3A 2LAAA 4FFYL 2CXGA 5EZOL 1BX2A 1QPXA 1DBMH 2DJ4A 3EOAA 2Y36H 5T1MB 5SX4H 1BD2B 1BREA 2F58H 2Q1EA 4Z7QF 5L88H 3EYQD 2BDNH 1W72L 2W1NA 3MV7D 4M7KL 1KPRA 4F7TB 2A74B 3TBSB 5DQ9A 4HKZA 2Q87A 3TIDB 4DN3H 5C71A 5LG1A 1MVUA 3DTXB 3L3IA 1OP9A 2R0LL 3OWEA 5T1DH 3I02B 4ZUVA 1LWRA 1U3HC 3WSQL 1KIPA 3LQZA 1LP9E 2AXHA 2DTSA 4BFIB 1YUHB 1DLHB 3C6LD 4NIKB 4NQXB 3UJJL 3NZ8B 4EI5D 1JVKA 1I1AD 2ITDB 5I1JH 3L7FA 1QFWM 2R9HD 2QADD 1HCVA 3BYYA 4AJ0A 3G08A 1EEYA 3BKCL 5DJZB 1QSFA 4NM4L 3TCXA 3SE9H 3QR2A 3AM8A 1U8LA 2DI7A 3H7BB 4GH7B 5E2UH 3ZHLA 1BECA 3S88L 3G04A 1KPUB 5EORL 3EJZD 5ADOH 1AC0A 1P4BL 1X5GA 1MCIA 2RIKA 4W4OC 1EHNA 5J11C 2KZ1B 1NAKH 2K1MA 1J05B 2XRAL 2IBGA 4PRPA 2OSLA 1JHLH 2UY6A 4QRRE 3ARSA 4X98A 1MREH 3L3JA 4W4NA 1FYTA 1KN2H 3UXFA 4P4RB 1N7MH 5L2KE 4ERSL 1BGXH 4I48B 2HVKA 4OLXL 4FQIH 1QEWA 3TV3H 1P1ZB 3S34H 1HQRB 1JNHB 4NBXB 3ARFA 1KCVL 4X4YA 2MHAA 4Y4HA 4XVTL 3MFGB 4G9FA 4KZDH 1CWVA 2DJUA 1CLYH 3DBXA 4PJHB 1FNEA 2BK8A 1WFNA 4EOWL 4DKAA 2C1PA 5L2JA 3MRFA 4IRSC 4LCCC 4NQDB 4O4YH 4CBPA 1BJMA 1J88A 1AGEA 4KFZC 4J3XA 3D2UD 4YAQA 4LASL 2AJXH 4LLQA 2AV1B 5CFHA 3S37L 5BRZA 4JM2D 5T3ZL 4RGNC 4CRPA 1EBAA 15C8H 2GT9B 1UQSB 2IJ0C 5D2LE 3KPRB 4ELKA 1QYGL 1X5AA 1SMAA 4MZ2A 1DN0B 5JHLH 2DM7A 2X05A 4X6BA 2J5LC 4NJAH 2BCKB 4WI7A 1WBXB 3HE7A 4Q9RL 3GSVB 1ZWIA 5A2IH 3FRUA 5E2TH 4GBXC 7FABH 5KSUA 3WFCL 4J8RA 5FO8B 1HKFA 5ELIA 2G2RA 4JN1L 3ROOB 5GRJH 4MXQD 1FQ9C 4QXUH 4N5UA 2DL2A 1NDGA 3C8HA 5C0CA 5I76B 2PW1A 4FFVD 4I2XA 3JWDL 1CDYA 4D0CA 1CXHA 1D5XA 3M07A 5DJ8A 4G8GA 3SBWA 5SWSE 5D7IA 4WUKL 2QSVA 4FFWC 4PRBB 2CKBL 4Y4FA 1MHPH 5JORA 1A0QL 1HDMA 1RJYB 4U3XA 4PTUA 3EFFA 3ELAT 2A83B 3HR5B 4K23L 5HDBF 5IEKA 2XTJC 4MAYA 4GUPA 2A6DA 2ERJC 1YYLH 5ICYB 4MA1C 3E8UH 4YDKH 1DLFL 3KXFD 1U2HA 3DX7A 4HJGA 4RGMC 1I7TB 4NRZA 4ZOBA 2X4UB 4R0LC 1CGSH 5CEZH 1D5BB 5C8JA 3FO2B 1T21B 1U8IB 2XXMB 4U6YB 1BAFH 3MRJA 5IW1A 4KHXL 1VESA 3RWJA 3TT1H 3MLWL 4NT6A 1YN7B 4PP1D 5TDPB 1ZHNB 2N4IA 5TGBB 1WC7B 4NQCB 4K3HA 2X9YA 3BZFB 2PN5A 1EO8L 3BGFB 4TNWK 2P47B 5E1AA 5I1LB 3BKYL 3F7RA 1KG0A 4P3DB 1FNHA 1C5BL 4LCWA 2A2QT 3V4PH 2VDRL 1QFWI 3QEQD 5CP7A 4BQBA 1YNLL 1LO5A 1GGIH 5E9DD 3NGBC 2W9LA 4Z78A 3ZTJH 1JHTA 2R69H 2Z93B 4GW5B 4S0SD 3LCYA 1K5NA 1VHPA 3FHQA 4KKCD 1BF8A 1KCSL 2AK4D 3S96B 3MCLH 1MCCA 4NJ9H 1NBZB 1GAFL 1UG9A 2FO4B 4MD5A 1F3JA 5E03A 1Z9OA 5H35A 3DX9B 3HUJA 3BRGC 2FL5B 3VFNB 2YPVL 1F6AA 3LEXA 4LFHG 1FDLL 2H8PA 5JW4R 2ZCKH 3KHOA 1S5HB 1EVTC 5FYJL 1C7TA 1KTLB 5DHYA 4WFGD 2RFXA 3DMMB 2Y6SD 1S7XA 3V6OE 4RRPA 2ZCLH 1LE9B 1CDJA 4KHTL 1TDQA 5ALCH 4Z8FH 4ZAKA 3SDCB 2JJWA 2XWJA 4J3WA 1A3RL 2Y5TA 3MRIB 2EE9A 1JPGA 4LRNH 1DCLA 1CDGA 2X4RA 3O41A 4JQVC 5INDA 2ZKHH 2NYYD 4QOKB 4OZGB 4ONFL 2VLKA 3D5OF 1EH9A 4JZJA 2AJVH 1E27A 5C0EB 5FO7A 3VCLB 1LHZA 3KJ6L 4V1DE 3KPSB 4LHUD 4PJ7B 1U8JA 2VQ1A 2ZUUA 4PR5A 4HPYL 4E41D 1WBYA 3MGAA 4L8BB 4LLAA 2DQJH 1H3XA 1NUFA 3TBYA 1CBVL 3PGFL 3ZKMC 3ZDXE 4C4KO 2GFBB 3WFHA 3WJLA 5C9JB 2WBJD 4QTHA 1W8NA 4KI5E 5J0BA 5I2IA 1HHIA 3FJTA 4OLYL 5K9OA 1OT1A 2P5EE 1RULL 4K71C 3RNQB 4YX2L 4WNQB 1NLDL 3FB7B 5TE4H 1TITA 1DEDA 4QRQB 2EXWD 1UFUA 4U6HB 5CEZD 3FONA 2NY2D 3L3OB 3QFDB 1DBML 2NX5E 4F15C 3WXWH 2XFXB 3MZGB 1DDHB 4NBYB 2F58L 2GSIA 4XRCA 2BDNL 4RRPG 5DA4A 3T2NH 1XF4A 4WWKC 4LLUA 3LV3A 4ZYKA 4DN3L 3MBEC 1LE5B 3SGDI 4F58H 4Y1AD 5EZLA 3L9RB 1MI5D 5BVJA 5T1DL 4I18A 2ATPB 4RAUA 1OGAA 1URLA 2E7MA 4EVNB 3LZFH 1MCHA 3TPUA 2W0LA 1KGCD 4KPHL 4CMHC 4CVZB 3MR9B 5B21A 3BJ91 2EE3A 3T1FB 3EYFA 4FNLH 3HPLA 2CLZA 4ODVL 4PJBE 3JTSA 2ED9A 3T2PA 3PABB 5J12B 1ORSA 4G8FA 3SE9L 4LDOB 4HH9B 2QKIB 2D31A 3DIFA 5E2UL 3GSRA 1QSED 3K80A 1AHWA 3SDDC 3RY4A 3IF1B 2YEZA 3AS0A 3FL7A 4JQIH 5ADOL 1QFHA 4X7SH 4YDLB 4JJ5A 3NA9H 1XGUA 1NAKL 5D1XD 1LEIB 5IBLC 2BSTA 2YC1A 3IXAA 5D6DA 4P4KA 1K9TA 5JOEA 2AJUH 3CGTA 1MREL 4NWUH 3REWB 1CFSB 2FJGA 4O51A 4O02H 4ZFOA 1HQ4B 1KN2L 1PKOA 1AP2A 1N7ML 4ENED 1BGXL 2WV3A 3QDGE 4FQIL 1HHKB 2J88H 3S34L 3RL2B 1VFAB 4MDIA 1HOCB 4JKLA 4WO4C 2V2TA 2OTWB 4KZDL 1IGTA 4JZOA 1KLGB 2RGSA 5A16B 1NAMH 1CLYL 1OD9A 4PJCE 4AEHH 3VGFA 4JHAH 4EDXB 1CD1A 4O4YL 5FKAA 4GO6B 2E9IA 3P9MA 4Z18A 2QHLA 1UH4A 4P48A 3HR6A 4XCYA 5IB1A 2PTUA 3VWKA 2QTEA 3CH1B 1S7RA 5DD6B 2AJXL 4DEPC 3FB6A 3MRHA 3HE6A 1I1FB 3ARUA 3WUWG 2X4PB 3MRGB 1BD2E 1HSBA 1YC8A 15C8L 2Q8AH 3VXNA 1KFAH 4Y0GA 3K74B 2QSTA 1ZOXA 3HMXA 5JHLL 1UKTA 3OMZA 32C2A 3EOTH 3OKEB 3O6LL 4NJAL 1LQSR 3SY0A 3DPBA 5E2TL 2W60B 5C08A 1A1OB 4OZIA 1I4FB 4G6FD 4LSTH 7FABL 4JRYB 5KSVB 5JZ7D 2N7AA 2IGFH 3I3BA 5GRJL 3DX8A 1I1CA 4QXUL 5J9PB 1DQTA 4HS3A 1AGDA 1NQBA 1AKJA 2ESVA 3OG4B 2HT2D 1OSZB 3CX2A 2YUWA 4X6CB 3MGTA 4D8PA 5JHDB 1CF8H 5FO9A 5F7DA 5GGQH 2FZ3A 1YEJH 1MHPL 2EKJA 3MA7B 3RPIA 5F9OH 3B9KC 3BUYB 4RX4A 4FHBD 5EA0H 1R3KB 4APQD 4U1IB 5CP3H 2IPUG 4PV8B 5DF0A 4LLVA 3E8UL 2YBRB 3VFWB 3RY5A 4YDKL 2GJ6D 3OSKA 4PB0H 3VXMB 4OI7A 4XP6H 5EIVA 3WD5H 1VFBB 5CEZL 12E8H 1A5FH 1IJ9A 1JCKA 4PJFF 2BVQA 1BAFL 4GG6B 3IDGA 3TT1L 2ZOKA 5D7JC 5JW4M 2X4TB 3FN3A 4DWHA 3KWWA 1FIGH 4WHYG 3TO2A 1YPZA 3RP1A 1IKNA 4H20H 5C07B 1KV3A 5GPRA 4MQ7A 5IG7A 4HUNB 3QH3A 3E3QE 3VI3F 1C5CH 1RHHA 2IC2A 1VERA 3N1FC 4E42B 2EDQA 1B90A 1OTTC 3UBXI 4BKLA 2FB4H 2HFTA 3V4PL 4BZ2H 1S7UA 3U0PB 1CGTA 3MLYH 1GGIL 2R69L 3SJVD 3MTRA 4PJHE 3WHXB 3ULVC 2YK1H 1M1SA 3O4OB 1U8NB 4NQDE 4NJ9L 2A77H 1CICD 2K7PA 1LNUB 3HG1D 4QYOB 5K9QG 4WW1A 3VFSB 3GMLB 5T1LB 2WP3T 3ZYOA 4OKVB 4X99B 4WUUB 1AY1H 2XN9D 3V8CA 1IFHH 4BH8B 2BY2A 3VH8B 3LKSA 4HFWB 1FZOA 1ZLSH 2OP4H 3DVNB 3KPRE 4XVSH 1NBYB 4LEOA 4P2YA 5SWQA 1ROWA 5GRUH 3G6JA 3FQUB 5JPNB 4WJ5B 2ID5A 1X5KA 3GKWH 4PJEA 5IR1B 2ZCLL 5ALCL 4F2MB 1DEEA 5HGBB 4Z8FL 1Z3GH 1RUKH 4F7CA 4U1KB 4JANA 4N1CA 5KSAC 1IGJA 3LEVH 4N9GA 1MRDL 4LRNL 4LLMA 1BX2B 2NCMA 4NN6B 4LPWA 2LV4A 2AKRA 2ZKHL 4FS0A 1RZJC 3RTQA 3X14A 1R5VB 2AJVL 3FQTA 5D7KE 1ZLWK 3FT2B 4HUUB 4CVXA 4OCWH 4BYHA 5ISZA 4RIRA 2AXFA 3B9VA 2DQJL 2XA3A 3A6OA 1P6FA 2C5DC 1XF2A 1OWRM 4PJXB 4X80H 1UADC 2NLJA 3DRQA 5IHZA 2HP4A 2Q7YB 4KKBD 3SCMA 1G0DA 5AWNH 3SGJA 5K9KB 1E28A 1FVDA 1XFPA 3ULUC 3OB0K 5ICZA 3IDYC 4ZO9A 3GGWA 5TE4L 4Y5VA 3TBVA 4Z7WB 4MCZA 5FUOL 3QUXA 4XWGH 3STLA 3LEYH 3O2WH 1QO3A 3WXWL 4UZGA 1A9EB 2DB8A 5DJ6B 1BQLH 2HA1A 5CAYB 1E0OB 3HHRB 4GLRH 1KTKE 3O45B 3T2NL 3UTPE 4H25A 4K7PY 4NQCE 4NQEA 3ZKND 5C0GB 1MFEH 1U8KA 5MEQA 4QRRD 4MD4B 4L3ED 1IAKB 5B4MD 1RURH 1PYWA 3EW3B 1I7RB 2C7UB 3RGVB 4RWHA 1LP9F 3MRKB 3RFZC 5L2KD 4X5WA 2J2ZA 3LZFL 2ICEB 1HH9B 1GRWA 1HHHB 2FEDD 3QA3A 4P99A 4R3SA 4PJGF 4PJDB 4FXKA 2E6PA 3OJ2C 2J3SA 4BELD 4NC2B 3HAEH 3C60C 3QI9A 4FNLL 3QDME 5AUMB 3LIZH 1QA9B 4ORZC 2WLYA 2FHBA 3FB8B 1D5ZA 4BUHA 3OKOA 2OXHA 3GSWA 4AQOA 3GSQB 5DK2A 5IMOA 1RI8A 5LXGL 3VFTA 1B0RB 5C0DA 3CSGA 3VDBA 1QG3A 4JQIL 2L7UA 1N6UA 2BNUB 4X7SL 5GIRA 3NA9L 4M9OA 2DMBA 3V5HB 3SGKC 3PV7A 5HHQA 5JW4Q 4YHPA 4J3TA 4LLDB 4MS8D 3CC5A 1P2CA 5FK9A 2XV6B 3BIBX 1H0DB 2AJUL 5L8KB 4NZRH 1QNZL 4G42A 4LLQB 4NWUL 1M7XA 4O02L 4QOKE 4OZGE 2CDGB 1MFBH 4ELMA 4LVOB 4EKXA 2DI9A 1G1YA 3KPSE 4PJ7E 2EDJA 4MWFA 1N8ZA 4OT1L 2IPKA 1FLTX 1PEZA 1NAML 2P1YA 2P48B 4O2CA 3BN9C 5SWSD 3QJFA 2FATH 4AEHL 5DYOA 4J8RB 4F33B 1FC2D 4JHAL 3NCYP 4KRNA 3JZ7A 1N64H 3WO4B 1M7IB 3LQMA 4UU9A 3RI5F 3HZMA 3MV9D 5EZJA 3SQOL 3GFUA 4MVBC 4XZUA 5HGDB 3RY6C 1EPFA 4JN2A 3PL6A 5CD5D 1P7QB 2AJYH 4D0CB 3L1OH 2IADA 4WCYH 3STZA 1NGXA 3RIAF 3ARBD 4JKKA 4HCRA 4NP4H 2I26N 3MRDA 2YMXH 4GG8A 3EDDA 4Y4FB 5BV7B 4RQQA 2EXYC 4J4PD 3U48A 2XNAB 4G80A 3QHZH 4B50A 3EOTL 3NPSC 3DXAB 5I9QB 1HILA 4XXDA 2VLJA 5FF6A 2A6DB 2FJFB 1CD8A 3KYKH 4N5EC 1W72A 5D1ZA 4LSTL 5C70A 3P4NA 5B3JE 1MHCA 2IGFL 4R7NB 1SEQH 5DURD 3BP5B 4R7DB 2W91A 3OXRA 2B1HH 3F12B 4P57A 1ZT4A 2JCCE 4L8CB 1T2QH 4C58B 1JYWA 2A0LC 1NL0H 1Y6KR 2EYRB 2GAZB 3MYJB 1A4JB 1CF8L 4LPXA 3FOMA 1OB1A 5GGQL 5FKPA 3ULUH 2DN7A 1HZHH 1WZMA 1YEJL 4IRJC 3KG5A 4U6VH 2CD0A 2QQKH 3FT3B 1P4LA 5EA0L 2BFVH 1KF9B 2YA2A 4PJ5A 3VD5A 1KIRB 1FAIH 1A7BA 3JBG7 3T1WA 3BSZH 1LO5B 2L7JA 2R2CA 3QQ3A 4NFDA 1G7IA 3T0EC 5IFJA 1K5NB 4I0PC 4PB0L 4YGVA 4EN3B 4XP6L 3WD5L 4MDJA 3U36B 1NGWB 1Z2KA 2G75A 3PUCA 12E8L 2BNQA 5GXBB 1A5FL 4HH8A 2WZPD 4JM2C 2FYYB 1OOAA 4QRPA 5EN2A 4XNXH 1ZT7A 1YY8B 4Y19B 1F6AB 1FIGL 3T2QA 4AEIL 3WNLA 5HYQA 1QVOA 4H20L 4OLZH 4Q6IB 1J8KA 3A67L 1G7QA 4Z7VB 2X4QB 4E9LA 1T1WB 3TN0B 1C5CL 1MIEH 3KPNA 3WL9A 1Q9WB 4GW4A 5IFHH 1F90H 4JRXB 3RU8H 2FB4L 2VZ1A 4BZ2L 2MKLC 3IU4H 3MQIA 2OI9B 3N1MC 4V1DD 3ARDA 3QUZC 1AJ7H 4EDWH 8FABB 2VZVA 2YUVA 2YK1L 1AE6H 5IVXA 4FFVC 1VEMA 3U9UA 3G6AA 2A77L 5HGHB 5DJ0B 1U8MA 2VLKB 4Q0XH 2Y4SA 1ZHLB 1GPOH 1VADA 4KI5D 4Y2OA 3U4EB 1H3UA 4X4ZA 2IAMA 2R2EB 2VSDA 2XWTB 1AY1L 2P5ED 3AREC 1U8JB 2IMMA 4QRSA 1YZZA 2NY0D 2WWKT 3WIFB 1ZLSL 4PG2A 2OP4L 3IVKA 4XVSL 1UM4H 3ZYIA 5D93B 5GRUL 5C0BA 1G9NH 1PZ5A 2VXVL 2H2SC 2NX5D 1NMAH 3GKWL 1H15A 1R6VA 2GHWB 1ZT1B 2WQRA 1Z3GL 1RUKL 5SX5H 4MJID 1PZUB 1BJ8A 4JRYE 3U0TB 4MD0B 3LEVL 4U3CA 5DD1H 1R3LA 5D2NA 1ZHKA 1U8QA 1T5WA 3NCJL 4PP1C 2VR5A 1JWSA 4U0RC 4X6CE 2AJZA 5JHDE 2LTQC 2RQ8A 3BH9B 4OCWL 4WV1C 3UYRH 3ZDXF 3ZKQD 1YY9C 43CAB 2YD9A 3Q5YA 1J18A 1WISA 4F9LA 4KI5F 3VE0A 3AS2A 4X80L 2X09A 1F4YH 4Y4KD 2EZ0C 4QT5B 5AWNL 4OV5B 5BVJB 4HIXH 2CKBA 4PGZA 4ACPA 3F65A 4QRUB 1VEOA 1XR8B 3OXSB 3VXME 1BJ1J 4ZNEE 1IM9A 4XWGL 4TOYH 3LEYL 3O2WL 5EUKA 1AGCB 3UTSA 2E6QA 4G7YH 1CDBA 4GG6E 2DLEA 1F11A 1WIUA 3PF2A 5D96C 4JQXC 2OMNA 5H8DA 2B4CH 2YD3A 4QHNB 1BQLL 1TNMA 1Z0MA 1HHJB 3QYCA 4PLOB 2D9CA 5IMKB 1JPST 1MFEL 2Y6SC 5F6HI 2F8VA 4RBPK 5C07E 2NXYB 5IKCB 4YFEA 2XY2A 3MV7A 2ZJSH 5CHNB 2YEZB 1RURL 1ZV5A 4ESKA 4HUKB 4LOUD 4NCC1 3ULUF 2CIIA 1X7QB 3QDGD 5EBMA 2AV7A 5DSCA 3RZCB 4XI5D 5HVFB 4EUPB 3IETB 3P3YA 2VXTH 5C0RH 1A1NB 5IWLA 3CPLA 1SYSA 2BMKA 4HXBH 1JBJA 1WK0A 4HFUH 1PW3A 5DS8B 3CX5K 2HKFH 4I9WE 3LIZL 4L4TB 5JOFB 3CDGB 5DMJB 2NY5H 1J8HA 1J1PH 5IVOA 3C6LA 4FG6D 4JO2H 4MA7H 2Z0BA 3TZVD 1S78D 5F9WB 4Z7NE 4WUUE 1EO5A 2LQRA 4JPVH 4MDIB 4H0IA 3L7EB 2WBJC 4QY8A 3OKNA 4HSQA 2V2TB 4EQ3A 1CXEA 1K2DB 2BSSA 2Z31B 5FGRA 2J8UA 5DC9B 3V0WL 3V95A 2P8LB 2MJWA 2EXWC 4HS6A 2ICWA 3H9HB 4GQ9H 3F7VB 4POYA 1LEGA 3CH8A 4Y5XB 3MOQA 2HJFB 3TVMB 3BPLC 1IAMA 5IJKC 4NZUH 2P5WD 4FZEH 4NZRL 5CWSB 1Q0YH 2UYLB 4DGYH 2VDOH 4CKVX 4ZFZA 2R0KH 1YEDA 3IKKA 4LCIH 1OPGH 1MFBL 4ZFFA 4MQXC 1N3NB 4LVEA 2EIZB 1EXUA 5JIIA 4X9BA 3GO1H 2MQ0A 4I8DA 5BXFA 4PJCF 3E6HB 4R6UA 1YMMA 1I3RB 5B22A 3CDFA 3EUUA 1VKXB 3WLWD 4PJXE 1FRGH 2QQLH 2FATL 3QWQB 5HHOA 2R56H 3CFDA 1TQBB 4P49A 2NNAA 4QO1A 1N64L 1BP3B 3QIUC 3JWOC 5JDSB 5IF0B 1D9KA 4CAGA 3DNKA 1NSNH 1XH3B 3EDKA 4P23A 1HSAB 3K2MC 4QHUA 5E7BA 1WBZB 2AJYL 4Z7WE 1R0AH 4OGXH 3L1OL 4P5TD 3OHXA 4YHNA 5FO9B 3P40A 4NRXB 1LO0H 4NP4L 2SEBB 4HIHA 4UNVA 3D2UA 2YMXL 3X12A 1A2YB 2OJEB 5DD3H 4UMGA 2VIRA 3QHZL 2D03H 1JGEA 2JIXD 2P44B 5CBAA 4XBPB 3C5SB 2Q3ZA 1MQ8A 4NN5C 4LLVB 4ZS6C 3KYKL 4W6WB 2B5IC 5HJ3A 2EDLA 3H3KA 2YSSB 1ZK9A 5GSRB 1SEQL 2B1HL 4OM1H 3PWPB 1JJUA 1HI6B 4CDHA 1T2QL 2GY5A 2ZWLT 4PRPE 1JGDA 2XACC 3RWDA 3K1KC 1HINH 1NL0L 1UENA 5T1KA 3P4OA 4PRNB 4Q97A 3MACH 2ADGB 5F1IA 2AQ3A 4XBGB 4OD2A 1FYTE 1NUNB 2VABA 1XF5A 3BP4A 4NKMA 4P5MA 1DUYB 3S4SA 3ULUL 1HZHL 3BP7A 4LSUH 2D9QB 4B7LA 3EO0B 4NQDD 4U6VL 1W0YT 2QQKL 3IFOB 1WZLA 3ES6A 2BFVL 4XNQA 2NTFB 4CW1A 3OKDB 1FAIL 1JZ8A 4IOFC 3G5XB 4C55A 2EIEA 3OB8A 5E4EB 3EO1A 2A6JA 2BOBB 4PP2A 2AEQL 3RVUC 3QIBD 4M43H 1FZJA 3ARQA 1DTUA 1G7JB 2GTZA 3KPRD 3IJHB 4BK5A 3MJ7A 4MJ6A 4WW1B 1R3HA 1XGQA 3QP3A 1S7VB 3M45A 3RVVD 4XB8A 3T4AA 1A1MA 4XNXL 4X7FC 1CXKA 1JN6A 1KB5L 3P73B 3SE3A 4I1NB 3ZL4H 2DJSA 5H2BA 1MCLA 1FIEA 3RNKA 4DVBA 5IB4B 3JXAA 5D7SH 4OLZL 2BZDA 3EO9H 3LSOB 1X6LA 3K3QA 3O8XB 4Z6AT 1S9VA 4JAMB 4PJHF 3W39B 4HLJA 1TJHH 4G9DB 5IFHL 1F90L 1SBSH 5ESAB 1U8OA 3GMQB 2R0WH 3F7QA 3MLXL 4YUEH 1KBGH 4MAUL 3VXSA 3ESVF 2CIKA 2R4RH 1AJ7L 5J57B 4EDWL 4PGBB 1AE6L 4GRWB 3LAFA 1MAJA 1FL6A 5AD0A 4KQ4H 5E9DA 1TQCB 1IAIH 3S4SG 4JFEB 4YXHH 1MWAB 4HUVA 1W0VA 4Q0XL 2BOCA 5LBSH 1GPOL 3I6GA 2CDEA 2EKSA 1JRHH 3UZVB 5GGSB 4IIQA 5DFVD 4APQC 3BMWA 3C5ZB 5I1DA 4FTVA 4JLRB 1TLKA 2BHYA 4X4XB 5IMMB 1M6OA 2F5AH 5J13C 4F7MB 5ETUB 4RMVA 1UM4L 5C09A 1G9NL 3PP3H 1CTNA 1A6WH 1CVRA 3DXAE 2FX7H 3BIAX 2XKUA 2C3WA 1E28B 1FVDB 2W0PA 4X6DB 4M00A 1EHAA 3UTPD 3GGWB 4NQCD 1S9YB 4LSDA 1T89A 2YN3A 4S2SB 4PREA 1GXEA 3QEHB 1QO3B 1V7MH 4KJPD 5FV1L 3MLSH 3IAPA 4J3OC 3B9DA 5C0FA 1F3RB 2VRAA 3UYRL 1S7SA 3WDJA 3L5XH 4H25B 3ARZA 4P2OB 1ADQH 2HFFB 2WM0A 1MAMH 4HC1H 1FYHB 1A02N 2HT4D 2F53B 3GK8H 2HVJA 4LHUA 1EGJH 2CSPA 3QDJB 3QDMD 3TO4B 2YWZA 4UB0H 3HI1B 1G9MC 4HIXL 4DKEH 4Z0XB 3JUZA 1L0XA 1JF6A 1GHFH 3QCUH 4ZDHA 3PDGA 2CUIA 2BNRA 5IM7A 1QLRA 4PGDA 4E0RB 1YEHH 4TOYL 1KJMA 2OR7A 4G7YL 2K3TA 1T83A 3ZSTA 1NKRA 1I7ZA 2B4CL 3NZHH 4Y19E 1IL1B 3SDCD 2CH8A 5IMLA 4JZNB 4PRIB 1VFMA 4HHAA 1UB5A 2ZJSL 4X8JB 3DECA 4Z9KB 5IESH 4QOKD 1GZQB 3G5YA 2QV2A 5GIRB 2K7QA 4RFNC 4UAOB 1JPTL 2Q86A 3KPSD 4PS4H 5CZVH 1S8DB 1JTTA 1F13A 3PWUB 2VXTL 4NN6C 4WU7A 5C0RL 5I8EB 1MI5A 5I73C 4HXBL 1F00I 2OS7A 2VZTA 4XCEB 1I1YB 2HKFL 1I9IH 3BDXA 4U1JA 2VLKE 4MJ2A 4LHUG 1AXSB 2NY5L 3GMOB 1J1PL 4XPGH 3TBWA 2DKMA 5SWZB 4GMTH 4M3KB 4JO2L 4MA7L 5B39A 2LU3A 4JPVL 2MQCA 4KJYA 5J3HC 4P3CL 1BJ1H 1DBBH 4M3JA 5JXAH 4K7FB 1YJDC 4L9LB 3RVTC 2IPKB 2AABH 5LCVH 4Y5YC 1MLBB 3KPLA 3O6FD 4W4OA 4BA8A 4GRLC 4X9GA 4JFYB 4NWTH 4KK9C 5CSZA 1C1EH 4ZUTB 3TBTA 4NO2B 3QIWC 1G7LB 4GQ9L 5JNYB 4OZGF 3K8LA 1GGBH 4PLKC 2AJ3A 5D1XA 4FZEL 2IADB 1Q0YL 1SYVB 2VDOL 1X5XA 4PJ7F 2R0KL 1UA6H 2WBWB 3PGCA 1T7ZA 3D3VA 4L4VD 1OPGL 4JHZA 43C9A 2DQDH 5ERWB 4HWZA 4UILH 3FFCA 1ZGLP 4O2FA 4HUXA 4NC1C 3HZVB 1FAKT 1PLGL 4IOIA 1IC4L 5D1ZB 4XAKE 4Y2DB 3F7YB 4IRSA 1FRGL 2QQLL 3LN4A 4LCCA 2R56L 2FEDC 5I1GH 2QJDA 1DJSA 4DUWA 3ZTJG 3OXRB 4LIQE 3LD8C 3TJEL 2XG5A 1NSNL 5CEXB 3GMMB 3TLRA 5IW6B 1NC2B 4HKXA 1R0AL 1SHMA 3FOMB 1OB1B 3WE6B 1LO0L 5FKPB 3W9EA 1IEAB 5I1AB 4GKSA 4RA0C 3BHBA 1FFOA 4FQPA 4BH7B 5DD3L 3FO9A 3OKYA 4HWBH 1RIUH 1ACYH 5F7FA 3FFDA 4HK0B 2P43B 1KJ3H 5IB3B 2D03L 4MHHG 1WTGT 4ZPTB 2CQVA 4N1EA 2VISA 5ANMA 3SKJH 3W9DA 1JV5B 1KC5L 3FAXA 4MS8C 5DVLA 1SM3H 1G0XA 2WIMA 3BWAA 1CLZH 4WDIB 3QUYD 3IDJA 4OM1L 2D3VA 2ZSVB 4K3DH 4PJFA 3N0PB 5JOPD 3QXVA 1BZQK 4NHCH 1HINL 4JVWA 4QRPB 2H3NB 2UZYB 1CXLA 1QACA 2EO9A 4LVOC 4YR6A 5C3LD 1FZKA 4GW1A 2NY4B 3MFFA 4L4TE 4PJ9C 4LNRA 2DLIA 1A6AB 4LSUL 4IMKC 1YEFH 1LK3H 2FX8H 4HJ0D 4KDTC 4HXAH 1DBAH 1RPQA 3E6FB 3HS0A 1JZ5A 1WJ3A 2UUDK 4OGAD 1JMZA 3IFPB 3ZYZA 5B38G 3KLAA 4JRWA 4M43L 1U9KA 4MJ5A 5CD5C 2B7DT 3G6AB 4JDTH 4UUJB 4S0TD 5ABDE 1T0NB 4HLZH 2R39A 1U2CA 4ZUUB 4KRPB 3IDMB 4D0DA 2YPKA 3ZTNH 3C6SB 1VADB 1MJ8L 1S9XB 1YNKH 4J4PC 5J6HB 1CL7I 2I5YL 1F8TH 4EEEA 1V05A 3ZL4L 5E8PA 4JRYD 1WCQA 4BQCA 2WUBH 5D7SL 5IB5A 5CMAA 5D1QD 3TH2T 3EO9L 1X5IA 5I9QC 4WTWA 4UT6H 2A73A 5KOVC 2XZCH 4NQVA 1AI1H 1EMTH 4P0DA 3QEUA 2AI0H 1CLOH 1SBSL 3O3DB 1D5MA 2R0WL 3H9ZA 4YUEL 1KBGL 5JHDD 1RK1B 2OTUB 3RA7H 4LP5A 5JXEC 5LGJB 1SBBA 2R4RL 5GGRA 3CCHB 5J1AB 5E99H 3QG7H 1CG9A 4KQ4L 1FJ1A 1U8QB 1XCTB 3MNVB 4AK1A 3SJVA 4IRZH 1YJDH 3AAZA 5EU6B 3WS3A 5FHAL 1NAMA 4YXHL 5LBSL 3DROA 3DSFL 1KYOJ 4URTB 3L3GA 1CICA 3EKCA 1JRHL 2MTPA 1UJTA 2FR4A 3HG1A 1MNUH 3QNZB 4TQEH 3GIVB 3VXMD 5I8CA 3U30B 2F5AL 3MLUL 1NDMA 3C5JA 1MUJA 2XN9A 1PVHA 2R23A 3RBGA 2Y07H 3VMOA 4OUUB 4OM0H 1A6WL 1NC4D 3S36H 2FX7L 5GS3A 4HDIB 3RDTC 1PQZA 4EN3C 2HRLA 5ID1A 3MRBB 3E2HB 4JQVA 1B9ZA 2CUHA 3S5LA 5C07D 4I4WB 4X6CF 2MNUA 2VZSA 5F9JA 3PWPE 3PWNB 1T5XA 5K59E 1KLUA 1FFNA 1G7PA 1DE4A 1V7ML 2F15A 3GMPB 3H7LA 4YBLB 5H37H 3MLSL 2Q3AA 2H2PD 3GBMH 5K9QI 4UIKH 4HKJA 5CILH 2PO6C 5FYKE 4CNIA 1I85C 3CFKB 1FHGA 3L5XL 3O3BA 3VRJB 1ADQL 3P0YH 1MAML 1UJ3B 1DL7H 3FZUC 3GK8L 1JYNA 4Y8DC 4LARL 3C87A 5FCSH 1EGJL 3VFPA 1ORQB 5ACZA 2HRPH 1XMWA 1R5IB 4I9WD 5M7QA 1LP9A 4UB0L 4HPOL 5T1LD 4DKEL 1GHFL 3NH7H 3QCUL 4WUUD 3EYOB 1S7QA 4PJGA 3VWJB 5E4IA 1G84A 4GG6F 1KCUH 4UBDC 5JPMA 5E2JA 5CP3A 5FYLE 1YEHL 4NNYA 5D5MB 5E5RB 5DJ2A 4K9EC 3M8OH 4NRYA 3HB3D 2EYSB 5BJTB 4HS8H 2XKNA 4F3FB 1KPVB 4O9HH 4AG4H 5HI3C 2YD7A 3NZHL 3CXHK 3LS4H 1XGPB 3BW9B 1EEQA 3IGAB 4WWKA 1ZKAA 4NNXB 3PP4H 1J86A 4GXUN 4J23A 3V6FA 4P46A 1DVFB 2M26A 1FGNH 4CL7A 1O7VA 4LPTA 2NXZB 3S5LG 3HCVA 5IESL 3VMPA 3SDAC 5E6IC 2J8UB 2Y06H 3TYFB 1QBLH 1A47A 3VRLE 2R0ZH 3RHWK 5CZVL 4PJ8C 3OJDA 4OFDA 2VN7A 5C6PB 4GRWE 3KPTA 3QPXH 5L2KA 3QULB 4ODBD 2OR9H 4AIZA 1AGFB 1OAYH 1WVZA 3UTQB 4Z7NF 4JFEE 1I9IL 4M61B 1NGYA 3UDWA 4N0CD 2DYPB 1ES0B 1OP3H 2J4WH 2PTTA 3U46A 4GAJH 5E8OB 1VB9A 1A7PH 5C0AA 1DBBL 4FQQA 3WLBA 5JXAL 1H9VA 1GIGH 2AABL 3QNYA 5LCVL 1VPOL 4KDVA 3HZKB 5HI4D 2IQ9L 3LDBC 5HYEA 5HHOB 4NWTL 4NGHH 3RVWD 3OF6A 1WT5C 3RWIB 4FQXB 1D9KB 1L7IH 1C1EL 5I66B 4X6DE 1QSFD 1T6VN 2JB6B 4XMLL 4GJTB 3ZMRA 5DJYA 2UV3A 4X7CC 4XXCC 1GGBL 4JFFB 4Q58C 4A6YB 3QAZC 5IK3A 1UA6L 3QXDB 3R8BB 4LCYB 4HIHB 1YMHA 3RGVD 3DUSA 2WWMD 1B0GB 2VWEC 3X12B 1LEKA 2DQDL 4ZQKB 1U92B 3KPPA 4UILL 3CD4A 5F3BA 3C09C 4YC2C 4PJXF 4PRPD 2WINB 4NQSB 1MJUH 2F53E 1MFAH 4YDVB 1QR1A 3HC0B 4Z76A 5D72H 1CR9H 4JY4B 3PG2A 1C08A 1FYTD 3RVXD 2BSED 2YRZA 1KULA 4JHWH 4GFTB 5I1GL 3AXLB 2WMPA 4Z7WF 1RSFA 2VL4A 4TVPH 4QTIH 3OKKA 5EFIB 3WFBH 5DMGD 5SWSA 2P46B 4HEPG 3TEUA 1UZ8A 5B8CB 4DCQB 2XTLA 3EDEA 4YHYB 1WLHA 2GSGB 2C3VB 4X8XA 4FG6C 3LHPH 1Q72H 2C9AA 1E4XI 2VLRB 4WU5B 1P7HL 5JW5A 4HWBL 3BP6A 1RIUL 1ACYL 2EYTB 3DX6A 4FXGB 1KJ3L 1G1CA 3D69A 5MP6L 1I3GH 2QL1A 3E1F1 3OX8A 3SKJL 3PDOA 4PRIE 5CKAA 3WIIH 1AH1A 3LVEA 3IDNB 2Z31C 1R5WA 5HDLA 3EO1B 3RQ3A 4M7ZB 1SM3L 3MLVH 3KGRA 3WNPA 1CLZL 4PJDF 2I9LB 3O9WB 1A3LH 3BKJH 4K3DL 4YNYB 4KKAC 1AD9B 4WFFE 2F74B 1OARH 1P5UA 5I16B 4NHCL 3HE7D 4HMEA 4DOHB 3PWVB 1T7WA 2ED7A 3OL2A 4Q2ZA 5DEFB 3Q6GH 4LQ1A 1M71A 3B9KA 5SWZE 5BZDB 1YEFL 2N56A 1LK3L 4QXTA 2FX8L 3HAEA 1ITBB 4LCUB 2B2XH 4HXAL 4OLWL 4ZXBC 3BEVB 1FSKB 3EGSA 1P7QD 5IV2A 2N7BA 2C4FT 4TUKH 5GGUA 3VXSB 2CIKB 2FECL 2VLME 3CZFB 1I8IB 1XR9A 4G8GD 4XGZB 5IQ7H 2PKDA 3EHBC 4J1UA 5IT2H 5CJOH 3CUPA 1L6ZA 1VGKB 1VDGA 4Y4FD 3UJTH 1OGTA 5AAMA 1TJGH 1K3ZA 4CADB 4LFHD 3ZTNL 5FOBB 4IJ3C 1YNKL 1RZIA 1DBJL 1RZ8B 3RWFA 3WKMH 2NZ9D 4P5KA 4WGWB 4X83A 2ILLA 4QHMB 3V6OA 5I1DB 2GUOB 2WUBL 1BFSA 1GOHA 4HIJB 4UT6L 5IOPB 2XZCL 1AI1L 2E8YA 1EMTL 3FQNB 5DO2D 4YPGB 4O5LH 1OTUD 2YD2A 1CLOL 1IC5H 3ZHDA 3KLHC 1S7WB 3QCTL 4KQ3H 2V5SA 3FHAA 2FDBP 3IDIA 3RA7L 4PRAB 2R15A 5FGBA 3ZT7A 2MOVA 1T3FB 4KROB 3X3FH 4A2MA 3K7UA 4IHOB 5HYJA 5E99L 3GKZA 3QG7L 1N5YH 3UYOD 4IRZL 1YJDL 4FRWA 2XZZA 4LCWD 1NFDB 1EZVX 3HAEG 4OJFH 4KXZI 4LIQH 4PB9H 2HLAA 4K3EH 1KNOA 1KENH 1S7SB 5E94A 2DICA 4P9HH 2YD4A 1MNUL 4TQEL 1NCBH 1E6JL 1T20B 4XNYH 2KKQA 2HVJB 1H3VA 2ADFH 3BKMH 2EE2A 5GZNC 4TTDC 2P5EA 3A6CH 2Y07L 4YHMH 4OM0L 4JR9H 1FGVH 3S36L 4OIBA 2LU4A 1OHQA 5KSAA 2APXA 4XVUC 2H6PA 4Y19D 2P24B 1FL3B 2NX5A 1NMBH 2Z92A 4LDEB 5HHME 3NN8A 5ACMA 1QRNB 3RVVC 1KJMB 1MH5A 3OR6B 3IRPX 2VITA 3WO3B 5KAQF 3HZYA 3DLQR 1QSVA 4X7TA 3LKNB 1OWWA 3GBML 4QRPE 3GM8A 4N8PA 4UIKL 2NY3C 4O58H 4EI6A 3DWTA 4ZAKD 2VDLH 4EUPH 3ABZA 3MUY1 5E56A 1YEEH 3P0YL 4R2GD 3O8XC 5HY9A 1DL7L 2G5BA 2LVCA 2R1XB 4U31A 4M8QA 3LN5B 2IH1B 3F6IA 1OM3H 2HRPL 5D7LB 1I75A 2AK1H 2C4FU 2VLKD 1U3HB 5IIEA 1FH5L 3SKOB 3BZ4B 5IVXE 4WU7B 1KCUL 1BBJA 2PUQT 4G7VH 3SKNA 4U49A 1OF2A 4AENB 3BMVA 3BXNA 3M8OL 3MRQB 3DOSA 3HC4L 4HS8L 1ZSDA 2V9RA 3WNNA 4OLVH 1AQDB 2GTWB 4O9HL 1BPVA 4ZO7A 3C5ZC 4Z7VF 3LS4L 5B39B 2YKLL 3CIQA 4XHJC 1JPFA 5FYKU 2BVOB 3CSBA 1CT8A 1U91B 1CFTA 2R2HB 1FGNL 5GSVB 1H5BA 1VACB 4BFGA 3G9AB 3FO1B 4R96B 4TPRH 2Y06L 5F7YC 5IBTH 1QBLL 3TJHC 5I6XC 2HT3D 4JFDA 3J7HA 3VRIB 1UWEH 5IVZA 4BFEA 1E6OH 2DIAA 2ZSWA 4L3CA 5AZ2H 2NY6C 3QPXL 2OR9L 4WI6A 4XPTH 1OAYL 5EU6E 3ZLQC 5TQ0H 4HJJH 3RHWF 1IGFH 1IKFH 4L8DA 4RWYH 2J4WL 1NPUA 2ZP0T 2M8XA 2HT4C 3GIZH 3F58H 1OGAD 4HWZB 4GAJL 4PJCA 1PKQB 5E2VH 4B53A 1A7PL 3C9NB 4FA8A 4NNPL 5DDHA 4W81A 2BC4B 1GIGL 3L5HA 3BFOA 4MX7A 3I6LE 5TFSH 4FQHB 3GBLA 2GY7B 3SGKA 5BV7L 4NGHL 3P4MB 1MFNA 2XA8L 1T0PB 1B3JA 1EBPA 4PG9B 1LVEA 5T1MA 3EFDH 4HAFA 4POUB 1BD2A 1ULVA 4HBCH 4POZD 2NXYD 5GS0H 4BJLA 5DRWB 5E70A 1OP5K 4RGNB 4F7TA 1QOKA 3TBSA 5LAXB 1Z0NA 5EIQA 4ONGH 5I17B 4W68A 3TIDA 2J5LB 1A6TB 3RZCD 3DTXA 4DKFH 5TH2B 2DMKA 4EQ2A 2VOTA 1MJUL 1MFAL 3I02A 4ORGB 4GBXB 4K94H 2GW5A 4DKDC 2H9GB 1CR9L 5D72L 3SDYH 5FYKH 1RMFL 2PXYC 2X1QA 3O2DH 4TUOB 1AFVH 4Q6YA 1QPPA 4JHWL 1JI2A 5D6CB 4BFIA 4NKIH 1DLHA 3BD4A 4NQXA 2EC8A 4QTIL 3WFBL 3NZ8A 3B8SA 5DFWH 2ITDA 2DBJA 4MNHB 1MCRA 5D5ME 3OV6A 1Q72L 3H7BA 5DFTA 5AG8A 1J8HE 5FYLH 2H26A 1KPUA 2XTJB 5DXWA 1I3GL 3LKQA 2ERJB 3U0WH 2HJKB 4MA1B 4H8WH 4HK3J 4GKOA 35C8L 4RGMB 4U1GB 2J1KA 1J05A 4XP9H 4R0LB 5BQ7B 2A9MH 2I24N 5DUMH 4BSWB 4LHJB 4QHKJ 3MLVL 2O61A 3C2AH 2J8UE 2O26U 1A3LL 3BKJL 4L5FH 1TZGL 5EU7C 1WZ1H 4P4RA 3CK0L 4I48A 2PR4H 4TSBH 1RUAH 3DHJA 1P1ZA 1RV6X 5E6ZA 3KYMB 3OAZH 4GRWH 1IC1A 4J3UA 2OMBA 2H1PH 3Q6GL 5IB5B 5JQ6L 1GYAA 2G9HB 4UINL 3NFSH 4TSAL 1MWAH 3CNKA 4QHLB 4PJHA 2B2XL 1AKJD 3LQAC 5HI5C 3FQXB 4I77H 1JZ7A 3CSPA 2PTVA 5ENWB 1BZ9B 2ICWI 5M94B 4PPTA 5GGRB 4RFOL 5IQ7L 5IT2L 5CJOL 5HHOE 5A2JH 2LU7A 2DWEB 3UJTL 2DQUH 4K8RC 5KTEL 3LB6C 1TJGL 2C3HA 1UEMA 5FUZH 4RX4D 2N1KA 4PRHB 1DSFH 4YHZH 2GT9A 4JFFE 5ICXB 3KPRA 1NFKA 2L4OA 5MI0B 5GS0D 1I8MB 1DN0A 1J87A 3WKML 3QO1B 4RISH 2DQHH 5I8CB 1WBXA 3GSVA 5I71B 1TTFA 1NDMB 2AERT 3C5JB 3BO8A 4WI4A 4KK8D 2YD1A 2CRYA 5HDBE 1IC5L 5FO8A 4YHOH 2XWBB 3QDHA 1OAXH 2C4XA 3QUYC 3ROOA 5IHUH 1QKZH 4Y7MA 5ID1B 3GMNB 4ZS7H 1Q9OB 5FYKD 4XPAH 4YEEA 2QSQA 4P2RB 1EUTA 2EDYA 2XT1B 1N5YL 4U1MB 3RKDD 4F80A 4L29B 1KLUB 1L0QA 2X4OB 4YFDB 2VTFA 4PRBA 5JW4N 3RJQB 4OJFL 2NR6C 5CEYB 4LIQL 1RJYA 4K3EL 1QBAA 1KENL 4F7EB 3QWRA 4MNGB 1IARB 4P9HL 1XGTB 5DHXB 1NCBL 2A83A 3HR5A 5SX4I 4KJQC 4XNYL 5FYLD 1NCDH 3ZDYE 3F62A 2ADFL 5CCKH 2H45A 1I7TA 1ZEAL 4G3YH 4NM8H 1N0XH 2X4UA 4JR9L 3PQYB 1FGVL 2E27H 1GGYA 2G5RA 2Y9RT 1XF1A 3W5NA 1D5BA 4K71B 1MJ7H 3FO2A 1U8IA 5DGQA 1RQ5A 4U6YA 5K59F 2E3VA 1NMBL 4JG0H 2GYSA 3LKOA 4JG1L 5KBNC 3T3ME 4GXVH 1KTDB 1D6EB 4F15B 1YN7A 4OKDA 5F7KC 1EJ6A 2UWEB 5TDPA 1ZHNA 5TGBA 1WC7A 4NRYB 2AEWA 3V5DB 3BZFA 1CGYA 1F4AA 1UH3A 4DOHE 1IM3B 4O58L 5I1LA 1JWMB 5D1QC 4QLRA 1EFXB 3REVB 2FBOJ 4P3DA 1YEEL 1JF1B 1T03L 4FQLH 1F02I 3JSSA