1FLAA

Clostridium beijerinckii flavodoxin mutant: g57d reduced
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
b'MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMDDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1flaA00
2QX4A 4QOJA 1AKWA 1E5DA 3D7NA 5JROA 2FZVA 3OX1A 1AKVA 5NULA 2X2OA 5B3KA 1SG0A 5LJIA 3W7AA 2QWXA 4HS4A 2ARKA 3OJXA 3EYWA 2XODA 2OHJA 3TEMA 1VMEA 3JSXA 1T5BA 3FX2A 1FX1A 1X77A 2R97A 4N9QA 4Y9RA 3GFQA 1FLNA 1FVXA 3OWXA 3QFCA 1FTGA 3W79A 3W77A 4H2DA 1RLJA 2M6SA 1RLIA 1AMOA 4N65A 1AKRA 1YCGA 1ZWLA 4C76A 1XI2A 4LA4A 1J9ZA 1C7FA 4QOGA 3OWHA 3KEGA 2FX2A 3NHUA 4LTNA 1AKTA 3NHLA 2BPOA 1ZX1A 3TZBA 4FGLA 1TLLA 1ZWKA 2WC1A 2M6RA 1QR2A 2A5LA 3U7RA 3K20A 3ZHOA 4S24A 1NNI1 4YQEA 4ESEA 3S2YA 2KQUA 4ICIA 3UXEA 1KBQA 3N3BC 2Z9CA 1H66A 3OX3A 1YCFA 1XT6A 2AMJA 5NLLA 1RTTA 1YCHA 2Q9UA 2BZSA 3LT5A 1H69A 4DILA 1GG5A 4R81A 1XYYA 2BMVA 2FCRA 1QBGA 3B6MA 3NLLA 2MWMA 4YAWA 3ESZA 2FAXA 2FZ5A 1CZRA 1AG9A 1AZLA 1CZUA 1YRHA 3GAMA 4FX2A 4OXXA 4GQIA 1JA1A 1OBOA 2Q62A 1YDGA 3L9WA 3NHYA 4ZVKA 4Y9UA 1AKQA 1C7EA 1J8QA 1FUEA 2B3DA 5LBTA 4GR9A 3QFRA 1CZNA 1YKGA 1JA0A 2QX8A 4H6PA 1J9EA 5FUQA 3R6WA 1KBOA 1I1OA 3FJOA 1V4BA 1BVYF 4XDHA 5F4BA 2ZKIA 5A4KA 5TGZA 2FVXA 2QMZA 4CETA 3UXHA 3OVMA 2RG1A 3ESYA 4ZVMA 2R96A 2V5UA 3B6IA 4LAFA 3L9XA 2BF4A 4QOIA 5B3LA 2QMYA 2XOEA 1D04A 3FVWA 4QOEA 2MTBA 2QX6A 4LTMA 3ESXA 3KLBA 4ZVNA 3KAPA 2MOKA 1WSBA 3B6KA 4QOHA 5EA2A 4YAFA 3K1YA 3HA2A 5FX2A 5LLDA 2X2PA 1YOBA 4C0XA 3NHRA 2OYSA 1AHNA 1RCFA 4C0WA 4PU0A 3F6RA 5F51A 3W78A 4D02A 3B6JA 4FGJA 2BN4A 4Y7CA 1FLAA 1CZLA 2Z98A 2W5UA 1TIKA 3OJWA 1F4PA 4HEQA 4FGKA 3FW1A 3N3AC 2HPVA 3HR4A 5LMCA 3HLYA 1CZKA 4GI5A 3RPEA 5F12A 1OBVA 4U7HA 2D5IA 2KLBA 2V9CA 4BMPB 3FNIA 5EAIA 3EDOA 4XDGA 3NFRA 3O73A 4NLLA 2QX9A 1QRDA 2Z9BA 5LBUA 1DXQA 2V5VA 2FOXA 3G5MA 4U7FA 1FLVA 3NHSA 3SVLA 2FDXA 5EMNA 1J9GA 4N82A 3F6SA 4QODA 5BUCA 4CF6A 2N1MA 3GFSA 2OHIA 4PTYA 1DX9A 3NHFA 1OFVA 3F90A 4M0CA 3ES9A 1BU5A 1FLDA 4PTZA 2F1OA 5LVAA 1XYVA 3U7IA 3NHKA 4ZVLA 3KAQA 3LCMA 2HNBA 4F8YA 4J8PA 1WSWA 3N39C 4YAOA 3NHJA 4YAUA 1D4AA 3NHWA 5LJLA 1B1CA 2HNAA 3QE2A 2QR2A 6NULA 3F2VA 3P0RA 4U7GA 2Z9DA 5FA6A 5ULLA 4YALA 4BMOB 4C14A 1QHEA 3OX2A 3NHPA 1AKUA 2MT9A 1T0IA 3O2NA 2FLVA 4DIKA 1CZHA 3GFRA 4LTDA 4QOFA 4NULA 1SQSA 2OHHA 1CZOA 2GSWA 3TE7A 4DY4A 1DXOA 1D03A
chains in the Genus database with same CATH superfamily
4WKCA 4U6QA 5MN6A 4TSRA 5L45A 3OKFA 4L15A 1TI7A 3KJXA 4UDXX 2I71A 4UHKA 3UJPA 2O2YA 3UWPA 2PQ6A 3JZFA 1T43A 2CF6A 2ZRAA 3OKAA 3WWOA 4J0FA 3HUEA 3QKRA 1NN5A 2KJQA 2AR7A 2IGBA 3MNFA 4HATA 4ZYLA 5FOUA 3OHSX 4MR9A 2XPCA 1R50A 3NDBB 3KV3O 5AKEA 3S7ZA 3GGPA 2DY1A 5EKUA 2YQZA 4Q16A 2HCTA 5CXXA 4O4IA 4WGGA 3KR9A 4P31A 4G41A 1AKVA 4LRTB 3UCXA 3BDAA 3NV9A 5AW8A 5EE3A 5EUCA 2BR5A 1EVYA 1QJCA 3FYTA 2AC7A 3GJ6A 4LPKA 4E7OA 2XBMA 1P9RA 3EBPA 1VLHA 4DRYA 5AI4A 3C16C 1S96A 3GA0A 4HZUA 4BNVA 4XGRA 2ZB3A 3ADBA 1UK7A 1R0CA 3P5BA 4LV8B 2H4XA 1A77A 4AWXA 3FLBA 2OESA 1YZYA 2FZLA 5TVKA 4D8UA 2W22A 4Z49A 2DERA 4JZKA 3EA0A 3GPCA 4DSOA 3ACCA 4MMZB 2VJQA 4FQ8A 4U7TB 4WEQA 2OMEA 2IPNA 2HD4A 4MS3B 3JRXA 4CG3A 1JEYB 1W85B 1T6ZA 4NESA 1ZC4A 1QR6A 1VJGA 1XTRA 3TSOA 1CB7A 1PEKE 1IY8A 2J7KA 3S44A 1PEDA 3IL2A 1EP9A 2ZYDA 1VIMA 3AGQA 4JEIA 2CJWB 4WXYB 2W2XA 3ETDA 2JGDA 1IUOA 1Y6JA 1ARZA 3RSOA 1XTVA 1YFZA 2R97A 1A9QA 1Y8QB 2V6BA 2YWFA 3RT1A 1V11B 3M1YA 2XJ4A 3T6KA 4EB0A 3MS4A 2C78A 5GMOA 1XMPA 1Y4AE 3AEKA 2OA0A 3H3JA 3U7JA 1NXOA 2BFWA 5DISB 2BUCA 2GHIA 4Q4AA 1H6AA 1V0JA 3I2FA 3JALA 5TS2A 4BKQA 4D9KA 5TQ0B 1IBKB 1UM9B 2A0FA 2QTWB 2CDBA 2ODQA 4HKTA 4XA8A 4F1JA 4V24A 1R4NB 3AF5A 4I5DA 5GM2A 3W79A 4JLNA 1NSFA 4OSPA 3OQIA 3MTJA 2A58A 2ZUTA 3CWZA 1QG2A 1QHNA 4COKA 3VMMA 4G0QA 3D2LA 4ZO7A 3F98A 4I1VA 4URYR 1NT4A 3OT1B 2M6SA 3JVUA 1X92A 4NMXB 5A5GA 1IPFA 4XYEA 5L40A 1J23A 4LDAA 3CZ5A 2NV6A 4D41A 4EYGA 1ZSYA 2A78A 4ZMBA 3CF0A 3EPLA 1TF5A 1J0DA 3ZDCA 2M98A 4CIBA 2CGEA 1G20A 4TLDA 2Y76A 3O83A 4LA4A 4EJSC 2C8JA 3NUGA 3C4VA 5ECYA 1G4HA 4QPDA 3BGIA 1YAHA 1NZJA 1C7FA 3PF8A 4J1TA 4KDCA 1EP1B 2IDJA 2VPZA 3BFVA 1QHIA 3GH3A 4HX9A 4I1OA 1DKQA 3OZEA 4J4TA 1Z4OA 1FTWA 2E37A 2VI5A 4XJTA 5AO9A 3V33A 2HT1A 2Q50A 1ZD4A 4X54A 4C04A 3SQDA 4MAAA 3TPCA 1ESDA 3EPKA 3THYA 4PYOA 1ND5A 1V39A 4WLFA 5JDCA 3M1LA 4PTLA 2WWXA 3UUFA 4JS0A 2KMLA 3L7CA 2ZBRA 3GJ5A 3EPPA 3IR7A 3I76A 4FGLA 4LQ4A 4NRDA 4P8RA 3TVYA 1M1NB 4RIGA 1HGXA 3FETA 3K9NA 5K0LA 4BFWA 1JXMA 5I9SA 4BUZA 2WHXA 2B6HA 1XDZA 3IAS1 5J5VA 2VDPB 4OQQA 3QLUA 1PT5A 1W36D 4DS3A 5DTEA 2GESA 3KYDB 3CH4B 3T34A 2AKEA 1OPXA 2I7TA 1IOWA 2R3SA 1RJ9A 3N7AA 4S24A 2QL9A 3UHPA 5JALA 1IBLB 3AY7A 1MB0A 5JMOA 4X90A 3LQ4A 1QIGA 1SCBA 1C3OB 3V97A 4HQLA 1EG2A 4BN5A 4DA8A 1JEQB 2ADMA 3DMFA 2CLMB 2J07A 1JDNA 2ZYGA 4QUKA 2GBGA 4WXEA 3ZY6A 3WRXC 1UXGA 1IY2A 1K8RA 1TCVA 3BMCB 2YN2A 3O9VA 4MQBA 4OHVA 3OCWA 2DLDA 2WZCA 2AOXA 3A1EA 3DDNA 1X15A 4Q03A 3WNZA 4BNWA 5CVVA 2CV1A 2P4QA 4ZDIA 3PF9A 1SPXA 2J08A 3CUEF 4Y8VA 3Q9SA 3MAAC 4B3SB 1KQPA 2H7CA 2O2EA 1GPH1 1LI5A 3ESDA 2MMCA 3LT5A 4I4IA 3IT1A 3TQQA 1WUHS 1XVIA 3MFYA 3DDSA 1FNMA 4R81A 2WF9A 2R11A 3N76A 1R6XA 4R7TA 5LA6F 1L7EA 1ULZA 1Z9BA 3ASZA 4DFDA 2WAMA 3NLLA 2JJ8A 1TU4A 4A8PA 1EUDA 1YR7A 3CLKA 1CVRA 1L4KA 1J70A 1TM1E 3HKCA 2ZI7A 4W7SA 4YA6A 3PXDA 5E9WA 5TC4A 5H3LA 1Y1LA 4ZPXA 1X8XA 3CNOA 3D2AA 1JJAA 1MIOB 4LK2A 1D5CA 4Z7QB 2LV8A 4PNEA 1JGTA 1RQLA 2WVHA 4QXOA 4C87A 1MV8A 1R1DA 3OSUA 10MHA 5LKRA 2J85A 1LNZA 4JN6B 1RM5A 3HVIA 2W00A 1D4FA 1WVGA 2QDXA 2XE8A 2AZMA 2GDZA 1RMYA 1YGYA 3DBLA 3Q4GA 3QZUA 4ZALA 3UWKA 3WGQA 2BGIA 2FMKA 2QT9A 4RGVA 3BKWA 3VU9B 4B6RA 4X61A 2Q27A 1XRMA 4OXXA 1RLMA 4CL2A 2O1XA 1OVMA 2JJQA 3BYZA 3LU1A 3EDYA 5GAJA 3PEWA 4IQGA 5ENZA 3IULA 1C7EA 2O20A 4O59O 2B3DA 1KSHA 5E4YA 2IV2X 1KJWA 1LLCA 2L0XA 2VG8A 1V5EA 3NBYC 1JA0A 5A7GA 4GWLA 3SDSA 5JISA 1IVSA 1VMKA 3G8CA 1YFKA 4R8RA 5FQNA 3AQIA 3VJKA 2IITA 2C0PA 4KN6A 3D9QX 4OUKX 1WMSA 2C0CA 1WB4A 4RQBA 1P75A 2B99A 3BJEA 3O3OB 3RARA 1H2YA 5BRNA 1AHHA 3PHLA 1SWVA 2ZIAA 1XRLA 4JI8B 3BMQB 2FCAA 1E1RD 3KZCA 4FE4A 4O4IF 2IYPA 4F4FA 1JAXA 1OT3A 4MNTA 4BNGA 1FRNA 3A2KA 4MV1A 1CJTC 1SH7A 5THKA 1CJCA 3H6KA 4Y9DA 4H4CA 3GK3A 1U2QA 3QUTA 4Z5XA 1ZOLA 4PQEA 2BFDB 2Y1EA 1ISSA 1WF6A 2QORA 2JAHA 2GFHA 4F9FA 1SR8A 3HMQA 5D01A 1WDKA 3HBJA 5AM4A 2HHAA 3K2IA 4D2IA 3KVOA 3SFTA 4F3TA 3H05A 1KI2A 4Y6GB 1LPPA 4QL3A 4ARCA 4L85A 4PHFA 3TTYA 2IY7A 2B92A 5BWOA 4CKZA 1T34A 1QUFA 2BRUC 1V9LA 1X1BA 1X7ZA 2DWQA 3EG9A 4HYYA 5DM0A 3S4YA 1X8JA 3MILA 1IHXA 3JWJA 3SX4A 4KRXA 4L3OA 3HWRA 1QG6A 4M0MA 2D4AA 2G7MC 2EJUA 2NU9A 3TQOA 3C74A 4QLBA 1NLZA 2LXNA 4ZHSA 5FTLA 1BS1A 1H2XA 5FULA 2X7XA 3HLKA 4YUVA 1VL0A 2GAIA 3GDOA 2E5LB 1SXPA 2F8LA 1CY4A 2VZEA 2XOEA 5BO5A 4QTYA 1YTLA 4BRSA 1EVLA 5CNJA 1E2IA 1Q0ZA 1WXQA 3GJ3A 1S1CA 2PAAA 2BFFB 4LE1A 3UATA 3RQIA 4QYIB 2FDCA 4WBXC 3P19A 5E2AA 1O94A 3BTSA 3H2JA 3M34A 4ZO8A 1MQ8B 4E88A 4QLOA 2Z6AA 2LIPA 1L1EA 1YE8A 2JH8A 2WF6A 4NAVA 2VNJA 3ANLA 1JPJA 1NVBA 3GG2A 1DARA 3PFNA 3IVCA 4PFJA 3U3MA 1UP6A 2R8XA 1Q0QA 1C0KA 2FRXA 3K8YA 3IP6A 2B1QA 2C82A 4ZQFA 1CUAA 3FMPB 1SHKA 3EN0A 3INNA 3K1YA 5FNVF 1ZXBA 2D59A 2QE7D 3RIHA 3TZLA 4FCCA 4QEKA 2FB9A 3KT8A 4BN4A 2O3QA 3ZWVA 2DMRA 3CGGA 4RVSA 5IMSA 4TM8A 3ZHQA 1T1GA 2BMFA 2JBAB 1QC5B 1RSZA 2PA0A 1E2BA 2GN2A 5DLDA 3Q7RA 3KEMA 4ZGGA 4MVJD 4AQYB 1EJ2A 3NAZA 1E2UA 2HT6A 4RCZA 4MKXA 5EJGA 1E7RA 1IB6A 1H0HA 2X5JO 1N6LA 3OBBA 4LNAA 4PFSA 4FT4A 4QFCA 4C0WA 1QYVA 3KYBA 4A1OA 3THWA 4H7DA 4ITRC 1BFKA 2AI3A 3GJRA 1KOFA 1NFRA 4GMHA 3RJ5A 4AU1A 4ENSA 4N01A 2D4HA 3JCZA 3TIVA 3MCAA 2CBZA 5L53A 1JIVA 3QMWA 5BXYA 2O4UX 1EFCA 2UUOA 2FN4A 2PV0A 2WKSA 5IEJA 3R3JA 4Q9DA 2VBFA 3O2SB 4G9EA 3KYCA 5LBIA 4EF4A 3COJA 3N2EA 5KYUB 4D9HA 4E51A 2ONKA 4Z0TA 1ZM4A 2P6RA 3PNSA 3P9PA 1KPGA 3RVRA 2ZBGA 4WDRA 4V2IA 3BHNA 3MWDA 5AJXA 5ALTA 3AI2A 3Q3GE 4NS1A 3RDPA 4PN3A 2D8AA 2VDLB 1UBOS 4XQGA 1XQ6A 5F5LA 5DEOA 1SGWA 4N6OA 1M33A 5F12A 3QKIA 4DIBA 4EOGA 3ILSA 1XXHE 3WHPA 3C45A 5KX5B 3AVYA 4QQFA 1A0OA 1DAMA 2H9IA 3EF3A 1GXSB 2V9CA 1L7BA 3H9JA 3Q85A 4XUDA 1KAHA 2IP4A 4KGZA 2H07A 3ETEA 2VJKA 4M4SA 2FN9A 5D5QA 4A0RA 5CBPB 2ECQA 2ZBPA 1Z07A 2BMAA 5BN3B 1PJ3A 1YUNA 1W1UA 1SVLA 4ZI3A 3C5VA 1FY2A 2ONCA 4DCOA 1E6WA 1ICEA 3JQGA 4EW6A 5HHTA 4LPSA 3IAUA 3C7AA 3NP7A 1G41A 4OBEA 4K9SA 1Y5NA 5KTYA 1EX1A 2DECA 4I66A 5KNCD 1OC4A 2QRLA 3OOSA 3QE9Y 5F3WB 1YOVA 5JSHA 4NONA 2RKBA 3N8NA 3LWNA 4IZHA 3HSSA 4ZI2A 1TJ3A 3E61A 3L6CA 4FT2A 4NENA 4U2DA 3PR3A 1JRLA 1M9NA 3M5CA 4A10A 4E1AA 1P9OA 2C7BA 1CR0A 2RG7A 3I58A 3HC7A 3SD7A 1E5QA 3AR6A 2ID7A 4PNHA 2YUTA 1TFUA 5CNKA 3SVLA 4XX0B 2HN9A 3OECA 1AJEA 3TL6A 1JIQA 4ZU1X 4AM8A 3UIEA 4FHDA 2OO5A 1JQAA 2I99A 2IY8A 2AYYA 4Q3OA 1S5PA 4YP9A 3VOAA 2BGTA 5IABA 1LBHA 3Q7TA 1J25A 1GGMA 3E9MA 3ROKA 1O03A 1YU9A 1CHNA 4UD6A 5BQ3A 1GWNA 2ZU0C 3PQ6A 1BRTA 1ZOIA 1F9AA 2FE1A 1HDOA 1MAWA 1DL5A 1TEXA 1T9BA 1PQYA 4MAMA 5DLYA 1M76A 4AWAA 1DJLA 5KPJA 3OIVA 3K70B 5ALLA 4YAGA 2CNBA 3C8HA 5DXJA 3U4QB 3B1JA 4P3XA 2GN8A 2DX7A 2B1IA 4B4KA 2H31A 3GGCA 2Z5LA 4Z6KA 2VSFA 1X1QA 3F3YA 1G7SA 3HA3A 4CE6A 4DM7A 2H2WA 3OURA 4N39A 4M6WA 3COWA 3FDJA 3BGVA 2KB0A 1O4WA 4JJZA 1YVDA 3TFWA 4RTQA 3A32A 1DGQA 4YRLA 4OFXA 4RMJA 4YFYA 2E87A 1ZGZA 4Z9XA 4YJ3B 1U9IA 3WI7A 4AZ3B 5A4MS 2PWPA 4DL9A 2EGUA 3RUAA 4R1PA 1NX6A 2BSXA 4MP3A 1ZJYA 4OUDA 3T38A 1F2TB 2NG1A 1T25A 2YUIA 2YWXA 2ZBVA 1AA6A 2XE6A 1QP0A 1US8B 3OD1A 2H4ZA 1X87A 3UJ9A 3GJ8A 2P4HX 2AB0A 4EJ2A 3VNRA 4GW3A 4FEGA 1VBMA 5CIWA 3GDFA 1RBMA 4ZQCB 5CFMA 4GLFA 4P1ZA 2J7PA 3FVRA 2GTHA 4JLOA 2FJUA 5B6IA 4JUBA 5T3UA 1M6VB 3E70C 2QPOA 3OCUA 1HTTA 4D4MA 5AKIA 4F4IA 2C4MA 3H8VA 4GYJA 1FFBA 4TXMA 1QHEA 2QGZA 5JSYA 1Q22A 3U0VA 5HXAA 2F2TA 5BVGA 4WA7A 3KETA 1P17A 4W5QA 3HO8A 1TQ2A 4Y6QA 4WOKA 1NWCA 1NW4A 1YL5A 1VPDA 4V0LA 1XNRB 1XROA 1J0AA 1N0UA 1PVVA 1BZYA 2H1SA 1QOZA 2VHWA 3O95A 1H4QA 4OHYA 1FP1D 5IU6A 2WSSD 2PVPA 5DULA 2Q4DA 1XB2A 1VPVA 2Q9BA 3G85A 3ILVA 1ZVJA 4L9RA 1O89A 1P7ZA 1LRKA 4OA8A 1WZUA 4TXLA 4POAA 1HMYA 4DCJA 4MHTA 2LUOA 1JHZA 1X9HA 3H3FA 2RKWA 5GP1A 3AI7A 3OPMA 1FX0B 4JB2A 2QM8A 2X0RA 1SG6A 2HRQA 2HCBA 3EGIA 3ORSA 2J0QA 1NSTA 1Q92A 1X0XA 1H5QA 5GJWC 2QTAA 1VRWA 3KSRA 4WJKB 5IBRA 3QEJA 5SZKB 1EGAA 3BFKA 1PR4A 2FSGA 4TTJA 2P2LA 2P2CA 4PLWA 2OFFA 3BFPA 3TIGA 3BGOS 1BXZA 1T9ZA 3QUBA 1YDEA 4QOJA 1VIAA 1VE1A 3EQ2A 3F7OA 2A33A 1T3LA 1Q0SA 1B7GO 1Y48E 2CNOA 3A6GA 3A8TA 3QH4A 3EFHA 4HTFA 4YDHB 5HS6A 5JXJA 4E5UA 1PGJA 3D0KA 3O3CA 1U8UA 3WK4A 1G42A 2OZPA 2OLEA 2YQ5A 3IQGX 1FDTA 1PSZA 3IT2A 4JJ6A 5DOZA 3MF4A 3SICE 2PWBA 5IC5A 1HFWA 3LC1O 2FZVA 1ML4A 1Y5RA 3ER6A 4P9NA 1JE0A 3RVPA 1CBUA 4IV8A 4K6CA 4M1KA 3RSSA 3VUFA 1MNQA 1ZXLA 4NJEB 4AY6A 4NFHA 1Z75A 2V45A 4L27A 4JR0A 1I7SB 4AUMA 2PQ0A 3Q40A 4KLRA 4S12A 3W7AA 4CMEA 2G4VA 2P79A 4I5EA 2B7BA 1GP2A 2YVLA 4XCQA 1HUQA 3KSMA 3SKYA 4WOBA 2PZ8A 5EE9A 4DOMA 1F7UA 4KR6A 3ZCXA 4DANA 1SZDA 1U1IA 4L07A 1ZGBA 4WH0A 3INGA 1LS6A 3MJTA 4D42A 4E22A 2ZE8A 4XOUA 3SC4A 2C8LA 2M6KA 3MGAA 1UWLA 2OHJA 3I4CA 2G0NA 3BCRA 1ZNYA 2WINI 3FI0A 4RNDB 2JFXA 4WK0B 3CNEA 1BTOA 1MAUA 2CLEB 1FSGA 3JTEA 1P0QA 1Z29A 3EE6A 2H48A 3IAXA 5J5CA 5GM1A 2FGJA 3A4MA 3G13A 5IJAA 1K6JA 2GJ8A 3W90A 3LNTA 3F71A 1O4VA 1JJVA 3G49A 4AC9A 2OFPA 1JALA 4EHBA 4PYRA 1FZQA 2F4NA 2JGKA 1WUJS 2AN5A 2ZIZA 1PGPA 4JASB 2QRVB 4MQFB 4P4LA 4RLFA 5L4LA 2PMFA 1CG6A 3KKQA 1K0UA 5GVSA 5M04A 2WD9A 3THWB 4B3GA 2FPRA 3G9UA 3OFVA 3K1TA 3RTCA 4BFSA 1N2JA 1KMQA 4RKEA 1CU1A 3QUQA 2ZCVA 3LLSA 4WESB 5KYVA 4DDMA 2C5FA 2ZUDA 3DFIA 3BIOA 3W77A 4A2CA 1T3HA 2ZTSA 2VP4A 4TRJA 1J56A 3AG6A 4LNHA 4BP1A 5BQXA 1E8MA 1G6OA 3CJQA 2UYQA 2OBLA 3AC0A 2FEWB 2XWJI 3D0QA 1BE6A 3LZDA 1N2CE 4JOCA 5G4KB 3NAMA 4WECA 4FI3C 1MT3A 1TGYA 2RFLA 3BDIA 2YIJA 1E6CA 3PUWA 4PPNA 5B4UA 1FP4B 1SUPA 4PRKA 1GITA 4X1OA 3W5BA 4DJAA 1DJPA 4KZKA 3AJ8A 3RTGA 2Z08A 4UVIA 2O5EA 3BVPA 2IEZA 4PLHA 4KO1S 2VA9A 1I7LA 3LE8A 1G16A 4N5LA 3L8FA 4N9WA 3ELDA 3KEGA 3SEQA 4BNZA 4HAWA 5KKCA 4P3PA 4UE2A 3ZCTA 3TFOA 5IKXA 3AUFA 1HURA 1C1XA 2X0IA 2MSNA 1MABA 2C20A 2VDKB 1UK6A 3N58A 3VSBA 4ENQA 3GOQA 3FOFC 1R5BA 1U7TA 4JLDA 2VL7A 4GO1A 1Z5UA 3V32A 5KNBA 2WKWA 1RM3A 1Y98A 1NE7A 1PNQA 4UPDA 1NVTA 4Q7LA 2Q9CA 1FK8A 2WOOA 1NTOA 2XIJA 1DKRA 3P2IA 4JYMA 1J20A 2V7QA 3SF8A 2H92A 2RBGA 2XUFA 1ZWKA 3DFKA 3E3AA 3EVTA 1Z4PX 5AVZA 1QR2A 3NXKA 1MO5A 3GN2A 3N75A 4BCBA 3UC9A 4HVLA 1L0BA 3U7RA 4XM1A 3DYIA 4AK9A 3BPSA 3GCGA 2BMDA 1WCV1 3CU5A 3ADCA 2VF4X 2CUTA 1EFRD 4F6RB 3FTQA 3W4JA 3UWOA 1ZGGA 2ZFUA 1PR0A 1DCFA 3T4PA 4BNDA 4COOA 4N7JA 1OT5A 4F5DA 4UEJA 3D4OA 1C29B 1OSNA 3WQHA 3DLPX 5BW8A 4HR7A 4PRLA 4GGPA 1NMXA 4MO2A 4CCWA 3FMGA 4PYIA 4D0GA 3L1HA 1KKLA 3MM4A 3MTIA 4DQVA 4ENTA 2ZIXB 2V0NA 1H0KA 1WL8A 2JB9A 4RV9A 4HQFA 3U31A 1CRLA 3OX3A 4UFOA 1P7CA 2VK1A 4R2JA 1JR4A 2SKDA 2Z8XA 4R1SA 2A4MA 2BZSA 4RAOA 2X6RA 1QCYA 3HDTA 5CUQA 1U3VA 2E4UA 3NZEA 3R3VA 1TZKA 3IESA 3GRFA 2B5WA 4D56A 4KXUA 1WBBA 1SXIA 2J9YB 3JD0A 5HCNA 4M83A 4G01B 1E1LA 3BHJA 2XDWA 5CGQB 2E55A 5AVOA 5BSGA 1NR1A 3JQ7B 3AIIA 1L7OA 4FQ5A 4JT4A 3D02A 4RSGA 4ZKEA 1T0BA 5ELXA 2Q28A 3T54A 2YFQA 5H80A 5F52A 2B1RA 2LGJA 3DOFA 3OMLA 3VZSA 3ZYZA 5KMGA 1TAUA 2ZYHA 1ETUA 3OE7A 3ZVKA 2WJPA 3WB1A 4OPMA 1NXPA 2OP1A 5FO0A 1OROA 5C3UA 3ZZ0A 3PRJA 1GNLA 4GQIA 2IHYA 1X80B 2Q62A 2BFCA 2N75A 2G17A 3F4BA 1F8XA 4RS4A 2YVQA 4S0ZA 4ZVKA 3V46A 4I3HA 1R7RA 2CLFB 2E49A 4CUKA 5JBIA 3TZEA 2EZ9A 1FUEA 5CH5A 2RKOA 5A5FA 3PRHA 2C2XA 4A3SA 3QYAA 1JDSA 4HMOA 1BD3A 4WXRA 3STXA 3CZ9A 2HDHA 4BHTA 4QELA 1YZFA 4CIVA 2JFQA 2H3EA 4OQZA 2NZUG 3KZVA 2NTNA 2HQBA 5GPBA 2YW9A 2VDRB 4QUGA 4OYRA 1UR5A 2H63A 4MQ5A 3ZHBA 3GV0A 4RETA 1KOLA 4NECA 1B8VA 4B75A 2B98A 3IVGA 4EG0A 2JG3A 1NW3A 1T10A 1KOJA 3LUJA 4KYVA 4WW0A 2XAAA 1NXWA 1CD5A 1O5TA 3AM5A 1V7PC 4GBGA 3WNBA 1GUAA 1QNLA 5EJ5A 5ES4B 3WKEA 1LDYA 1DBPA 3SBOA 4M0FA 3A26A 3S2EA 1KFJB 1QIEA 3NWPA 3COZA 2B4YA 2ZYWX 5C37A 3U56A 4IVPA 4R51A 2QD3A 1J0EA 2V7BA 3Q6NA 5EP4A 3WZMA 1FYFA 2DZDA 2EZ8A 1E0KA 2FUG1 1NNUA 3NALA 2PHZA 2BI4A 3OTWA 4BZWA 2GWRA 3L5KA 1N4DA 5KDOA 4KYIB 1E2MA 2PNFA 1JLSA 3RD5A 4QYSA 3T8YA 1QO0A 1JS1X 1LLQA 4TTAA 1S3FA 2KYRA 2GS9A 4PQRA 1R8QA 4HVCA 1TVKA 4ARIA 4ZOLB 1V16A 2VLBA 3O84A 1FXSA 3P4YA 1Z5OA 3IALA 4OSEA 1BFUA 1Q15A 1YH3A 3M70A 5DNVA 2BHSA 2E1RA 4DMFA 4LAFA 1MC5A 4MW7A 5DJ5A 1EVQA 3JS5A 1ADBA 1D4ZA 3IR5A 1D04A 2XUPA 3ZZMA 1H1LA 4U0JA 16PKA 2QAJA 4MS4B 1F1JA 2QX6A 3JWGA 2WWWA 3RJTA 3FNQA 4KN5A 4B3IA 5BW4A 1J8FA 3VJLA 4MDEA 2Z95A 1W88A 3JTMA 2PLFA 4BMZA 1UJ6A 2UXDB 5ITVA 1UOOA 3IV9A 4HRVA 2R1UA 2YXLA 5T4BA 4KNYA 3P9YA 5AK3A 3ET4A 4DLZA 3DQZA 5BUZA 2EATA 4ISCA 5FPPA 2WKRA 1W5AA 1QHGA 4HDSA 3WO0A 3X2FA 1IXYA 3DP9A 1CQJA 4AJLA 1BWRA 4NBWA 3MZ0A 4HV4A 3RYIA 1BDHA 4B6EA 1Y7IA 3KQQA 1VG0B 1EK0A 2ILTA 2QXTA 3WQBA 2F7SA 3B9RA 4JJ4A 3ESQA 5DHRA 5MFPA 4UMVA 1R64A 4RY0A 2Q5JA 3U1BA 3JQAA 5DX0A 2BW0A 1SD5A 1L4BA 2BEWA 2YWEA 1BHJA 3EZ6A 3GIWA 1RWXA 2OBBA 3NC4A 3QPWA 3ZKWB 3PVSA 5A02A 3IILA 4ZT7A 2QVZX 2Z57A 1CF2O 3H1BA 4MINA 4NCBA 2YHAA 1NOIA 4XPIB 1BHO1 1HE5A 3WLPA 5I7VA 4EUHA 5FWYB 1W581 5B1IA 1VMDA 4HAUA 3I6MA 1MH1A 1U0TA 5T4FA 5KYYB 4E5SA 5C4MA 4PWZA 4LOJA 1CRZA 1WMBA 1UBMS 5IXSA 1NKVA 2B8NA 1I2ZA 4UTZA 4X00A 4YYZA 4CM8B 5D51S 4OBBA 3BJRA 2I3AA 1A76A 5L3VA 5E4JA 1ENYA 1TVEA 1ZEJA 3G5AA 5TE9A 3VNQA 2WZDA 1G0OA 3LYHA 5H9WA 1DJNA 3GEMA 4G1EB 4J90A 3T0IA 5ESXA 4KZPA 4JUFA 1KEWA 4JQSA 4LWZA 1M5UA 2OGWA 3LTNC 1VSVA 5A4JA 1QYDA 3HCEA 3PQ7A 2FG6C 2GCOA 4H77A 4P86A 4MWOA 1WQ4A 1F0PA 4IHKA 2IBSA 4NABA 3AIMA 3EXEB 1CYEA 1ML3A 5A7HA 3WLIA 5B5SA 4U7HA 4XSHA 1CE8B 1XQYA 4V0KA 2O8EB 4AS1A 1Q6YA 4PW0A 2KBFA 3EY9A 1W1WA 1SU8A 1KDOA 3NONA 4FEYA 3PCTA 4JYCA 2AE1A 4PG5A 5A04A 5JR3A 4E31A 3OFSA 3IEIA 4KAFA 2CMHA 4J0JA 1T1JA 1YDHA 2BEUA 3RFCA 1AMNA 1RBYA 3JYPA 3ADPA 3QELB 3RAPR 3DF9A 1XTBA 4KB5A 4MRMB 3HG7A 3TGWA 3ZE8A 1S8FA 3SP1A 5JEDA 1MLDA 3NFRA 1U1GA 3Q1LA 1UMBB 2M32A 3PPVA 5EXTA 1SPBS 2JIPA 3CLUC 4JI5B 1M0SA 4G5GA 2JJYA 3IP9A 4LCBA 5JS2A 6REQA 2YX1A 3DBVO 1HT1E 3DV9A 1SIOA 2V5VA 2QU7A 5BWMA 3G8YA 3H1EA 2YKGA 1D2HA 1QDLB 1NBIA 2UU9B 2IZ7A 1ADCA 1QZZA 3EB9A 4FJ2A 4HK4A 4MVJH 4OF4A 3PNKA 3JAWA 5AI9A 1NW9B 1OLXB 3GJZA 2I8LA 4PZUA 4GG1A 4R2LA 1M66A 5AKHA 3VV2A 2C97A 4EB6A 2LKDA 4V39A 4M7PA 4J6EA 4D96A 1SA0A 3UNXA 1U8XX 5HZHA 1KZ9A 1XRSB 3JVEA 4M98A 5FT9A 3RVDA 4G86A 4W8HA 1ZCFA 3AP3A 4BNFA 4U63A 1T8WA 2YXEA 3NIGB 1W9MA 4AD8A 5AVKA 1QDUA 1E66A 3QOYA 3PHHA 4IINA 4KJZA 1G3MA 4MW0A 4QUJA 1AB6A 1FU8A 2F1RA 3GLHA 3SIPA 1IXKA 5KYTA 1GU1A 3C39A 4ID3A 4NS4A 4U2CA 2B4KA 3JPYA 1IU9A 1M2GA 4JOQA 2DH5A 4OEHA 2XNKA 3P20A 3T9FA 5A9SA 4M49A 2L17A 1SQ6A 1GKYA 5EJ8A 1BU5A 3U4HA 5GZ3A 1X74A 1GM5A 4RL6A 3FCEA 4CCYB 1QKJA 1ZD9A 4YRRA 3LC2O 3RK0A 4PLFA 1I6WA 1YC5A 3HCDA 4DUGA 2W58A 1XEWY 1WZIA 5D84A 2CW5A 3JASA 3ROZA 1ZVQA 2CHUA 4HLQB 4KSYA 3S2ZA 3SNHA 1IIBA 3C8UA 2F62A 2PFKA 3PUVA 3LCRA 4O1IA 3IUSA 1RLUA 2ZANA 4OQDA 5B58T 4DG9A 5I6DA 5JRDS 2HNBA 3V1UA 5LQAA 1WLSA 4N8EA 3TD9A 3UMCA 1HQYE 2HO5A 2X4DA 3OIGA 1SCAA 4LK3A 2TSYB 2WA2A 3P94A 4WKBA 4PY2A 2C5BA 3C43A 1DUSA 5DYTA 4UVGA 4D9GA 2Q4BA 5FJJA 5A1JA 3UFXB 1MB3A 3DDWA 3NEJA 4M9RA 1JFFA 1H4SA 1TO2E 1X9IA 4LBYA 3PJDA 2V96A 1K9VF 4TMKA 2Z09A 1NN1A 1RPTA 4WCFA 3I3SR 4KUEA 2PTGA 3O8RA 4JI7B 1DRVA 4IMIB 1EX9A 1HOXA 4MWDA 1MNAA 1VXRA 2B0JA 4HNTA 1M2OB 3DO5A 3WJ2A 3GNQA 2OV2A 4WFJA 2QTHA 3E3MA 3ESRA 2Z9DA 4JSYA 5FA6A 3EVBA 3KVRA 4IFTA 1P61B 1GG8A 2VDMB 4IXNA 5J58A 1W4ZA 2XTNA 5L95A 1SCNE 1XZCA 1H1DA 2XECA 1VLMA 3KJFA 1MBZA 2WOJA 1HLPA 1OR8A 1BNCA 1E9AA 3NHPA 4FE7A 5FLYA 3WV5A 4EUNA 4E3ZA 1ZEMA 4DGQA 3QSGA 3SJCA 2IWHA 1KI4A 2QM0A 2JFYA 2XGMA 3K4HA 1NJGA 5I4CA 1BQEA 3TL2A 4EA8A 1VYTA 1DTWB 4ZAWA 5G0UA 1PCXA 5KTRA 3OQNA 2POQX 2B2XA 1KMNA 1RRMA 1PFWA 4GDMA 2L2QA 3AR8A 5DTMA 4PO9A 5IDXA 2ZUFA 2ODTX 2I6XA 4P5DA 1T6YA 3EZXA 2Q46A 3TSAA 3TW8B 3VU3A 3BOSA 1RCTE 2GZ2A 2CZGA 5HYVA 1C2YA 1QV9A 3H4IA 1JXQA 2EKPA 2EAUA 4LY6A 1V8PA 2ZS8A 3KV1A 4DCCA 1T5DX 5E9JA 1D1SA 1D1QA 2ZI5A 3PXUA 4BO5A 2JIZA 1SCQA 4NMHA 4XWGA 3VOSA 3LY9A 5EPUA 2C1ZA 4LQDA 2QVGA 2VDUE 3HU3A 4PR0A 4Q7JB 1KVRA 1J1UA 4ENVA 4X63A 1VA5A 1IJFA 4JLWA 2I6TA 4FEEA 5JD4A 1BE1A 1SC3A 2PKXA 1WY7A 4FCWA 3USCS 5AVUA 1JHPA 1OOEA 2EGGA 1KMIY 1OAOC 1WDWB 2BM8A 3GA5A 2YC2C 3OM8A 3PE6A 4JEHA 5DHPA 5K3BA 1G9SA 4AP6A 5HQ3A 1Y9DA 5HWSA 3QJ5A 5IVPA 2XCOA 5C5IA 2PBZA 1R0WA 5AW5A 1QRTA 4JODA 5JROA 1HI9A 1EM8A 3D7SA 3GGOA 2CHEA 4G56A 2VKTA 5CYOA 2J9RA 3G2HA 3JQDA 1FNNA 2VZ0A 1TTQB 3L6DA 2UDPA 4B3MB 1FFXB 1PT8A 4J3JA 4RADA 3U1TA 5H02A 3RJZA 4DR3B 1JQDA 1SXJC 2FR1A 1NI5A 3DOEA 1KK2A 1HYBA 2VSXA 5ALRA 1LPMA 1M5RA 1CW2B 1XZ8A 3HCBA 3OPVA 4MKZA 2VHUA 3ZLBA 1EJ0A 1JSZA 1L1QA 1ZISA 3TIIA 3TJMA 1P1IA 1ZK2A 2G1UA 4GU5A 3W1EA 5TPZD 5ALNA 3CEMA 4C89A 1RYBA 5DCWA 1VCIA 2VCYA 2B36A 4PSDA 3K6SA 2F8SA 5FL7D 3KJZA 1JDJA 2R751 2YQ4A 4LDNA 3WGGA 1AE1A 3PRYA 2Q6TA 4LXIA 4C5AA 2YY7A 3W6PA 3KD2A 2BHNA 2G8NA 2ZU6A 4CKYA 4AX4A 3CRZA 2P1RA 2YHBA 3K94A 4KYTA 3DAPA 4RM2A 4QUHA 1JHXA 3WGHA 4MGKR 2PKWA 1J6UA 3FPCA 2JGNA 3D6UA 4RY2A 1PLJA 3UAYA 4ZV4A 1XMQB 1D1TA 2BKEA 4ZU3A 1BVHA 2YHUA 4ZP1A 3BCHA 1E4YA 3SR3A 3E9QA 5CT9A 4DJDC 1E1QA 4ND7A 2DBYA 5EHZA 1Z8FA 3ASYA 3R0XA 3KCQA 5C5EA 3M3DA 2QBYA 2F9FA 5DBHX 4B2LA 3FUUA 3M6MD 2EFJA 1WSDA 2Q5LA 4FOLA 5KQSA 2C98A 3GVCA 3GJ0A 1HE3A 3S8EA 2OV8A 2JCXA 3BD8A 5G0TA 2IP1A 1IZ7A 5KOJA 5C34B 3QA9A 2GBLA 4TL7A 3TBKA 3DUWA 5EWMB 3ZKAA 1JKJB 3RTBA 4AAYA 2Q1UA 2BFEB 1K3TA 4S2EA 3K1ZA 1YB5A 2UZAA 1HFKA 1U7DA 4I1RA 2A1IA 2VF2A 1FTQA 1ZN2A 4RK7A 4YP7A 4U2EA 4C6RA 3ONEA 4E33A 1U2EA 4KE6A 4PONA 5H16A 3T3DA 2SICE 2XOXA 3X1MA 4LTNA 5EZSA 1NMEA 3HNRA 1ZAYA 2ONYA 1SB9A 3ETJA 4UU7A 4XGNA 3W34A 5LYJB 1XX6A 1H2RS 1Y7TA 3I6QA 3P9XA 4TTVA 1DMRA 1UJMA 1T1EA 5F7ZA 3DC2A 3TZQA 4EYOA 3M81A 3IS3A 1RLTA 3OJEA 2BEJA 1F8YA 1J5EB 3BXHA 5T3YA 3U9TA 2AMVA 3HNPA 2QTGA 1LBIA 5BSMA 4L78A 3GLIA 3C87A 1HH4A 3GJXC 1JSLA 1LQTA 4WEOA 4X6LA 5IJ0B 4PPQA 3A31A 4CDNA 2OOKA 1PWHA 2GEJA 4XM0A 3E23A 2IL1A 3HDJA 3ZHOA 3HHPA 1PT7A 1ESEA 4W1PA 4ADSG 4YN3A 5DMXA 1XCBA 4NBNA 1NUAA 3HMKA 4EGQA 4TN1A 2B8JA 4EJ6A 1YL7A 2JDIA 4HZIA 3ACBA 4RCVA 4HTAA 5LQMA 3FYUC 1K2WA 5DIFA 1E79A 2WF5A 4QSMA 5CM2Z 2D2FA 3UAOA 4B7ZA 2Z9CA 4QDKA 4GR5A 1K88A 1U80A 1H66A 2I03A 4R41A 5C1DA 1YZTA 3VSAA 3N2IA 2HMSA 4AS2A 2IS2A 3FKQA 4E70A 4WADA 1XYGA 4MYHA 2Z2ZA 5IAKA 1PDVA 1EHIA 4U3JA 4M55A 5B7QA 5L3QB 1AM4D 1M8FA 1EVKA 4DV7B 4OGKA 1YHNA 3ZDFA 2OILA 1XZGA 3KPWA 4GKBA 1L4NA 4FM9A 4BEWA 2P2NA 4AYWA 2BZ0A 3GCDA 1DBVO 5HKAA 1NX9A 2BKUA 4II2A 4UNIA 3AEUB 1BKYA 5EEHA 3PDIB 3VR3A 1YI1A 1QGYA 1E5LA 2F17A 2GTIA 4BAGA 1QBGA 1JBEA 3GPDG 4J0EA 3TD2A 1FDVA 1KEEB 1USKA 1XC7A 3HKBA 3MXTA 4EY6A 3P2EA 1ZRSA 3P9RA 1OGJA 4F71A 1ACMA 1M0WA 4WDQA 5AYVA 2O8FA 3QJGA 1ZH0A 2Q2WA 4ZRNA 1KI6A 2NM0A 3MB5A 4DCMA 4HAVA 2HSEA 3PNMA 1L3BA 5H70A 5JG7A 2RSLA 5KSPA 3THOA 3WOVA 4WT7A 3SC3A 2R86A 3CF6R 3R75A 2NUPB 2Q3BA 3ASVA 2H5LA 5U9CA 3R7BA 2H8GA 4MUAA 1GCGA 2YVUA 2JGIA 1C8BA 1TKRA 3T1OA 1NWHA 2I7VA 3NVDA 4OFZA 1WAMA 2RJOA 3JWPA 3KTAA 1U0JA 1EWVA 1SO8A 2DQKA 3IKMB 2DULA 2PNJA 1OI3A 1U90A 4X8OA 2PSJA 3R0VA 4IXWA 4RF5A 5FOWA 4U2BA 1QOQB 3EZ2A 3PZRA 3X2EA 1GCOA 1WHTA 1NBMA 3CPHA 4RK6A 4IIHA 2OGUA 1J9EA 1PR2A 3JWEA 1FE8A 4DMHA 2X9LA 3T3GA 2XNJA 5FPSA 4EUFA 4EPRA 2Q3EA 4IOMA 3DT6A 3EBLA 1C1HA 3LBIA 3MGBA 3OZUA 3FWPA 3PFBA 5GINE 1Y3FE 1CUIA 1R2QA 3C3AA 4PPFA 4BJHB 5BV2P 2XLBA 3IHWA 1EAMA 2ADOA 3MMSA 4IKPA 3UQYS 4GLLA 4L72A 4ZCSA 1SD1A 3WK6A 3AL0C 1X6VA 1YRQA 2WD7A 1TYCA 1P4SA 2I80A 2J30A 2RB5A 3O6VA 5EG5A 4RX1A 2EKQA 1R0ZA 1IY0A 1IXSB 3AZOA 4QZVA 4TL6A 4G63A 2HQRA 3WO1A 4LDPA 2YJZA 4QQNA 4KQWA 3DMNA 4PZAA 2JZNA 3OLYA 2JD2A 4YT4A 2DRIA 2GJ4A 5K6TA 3AZQA 4R9UC 2X19A 3ILXA 1D9XA 1QF9A 3ESYA 3P2KA 3FF4A 1G2OA 2GILA 3A1FA 4YAEA 1B23P 1GD1O 4X3OA 4DBLE 2JFGA 2P9QA 3LHKA 1DC3A 3H9EO 3QWBA 4KN8A 5J2UB 3MERA 3OLCX 3IBTA 2WFAA 1OHHD 4R16A 1GCIA 2F8MA 3ZQJA 4D5EA 1QRSA 2XTMA 2ZJ5A 3UAXA 3A36A 1OTYA 2WAYA 4M0LA 2C99A 4QO8A 3LOPA 4TMVA 3SZGA 1K68A 2WHRA 1Y63A 3GGDA 3ZTWA 2C2WA 4OXRA 4B76A 4YASA 5DH9A 1O6GA 1F51E 1NXTA 4J03A 2AKYA 2GJKA 1ZUNA 2B94A 3U5ZB 4UBKA 2CDAA 2CKMA 1JJFA 1MTZA 5CM8B 3OIUA 3SQMA 4E07A 4XH9B 1HDGO 3I04A 3MINA 2EZUA 3L8EA 5BOVA 4E2YA 3OH8A 1B73A 4C21A 2OCAA 2WJ6A 4GI2A 3W8EA 1PR6A 3LFHA 5HM6A 1AZSC 2IHKA 2LE0A 2DWOA 1PR3A 5AH0A 5FPTA 2X76A 4GUDA 3ZY5A 3VOBA 5FUWA 3HYCA 3A4NA 4HGZA 3GLGA 1VDMA 4UTRA 1P7YA 4KFRA 2XCSB 1KZGB 4GAEA 2XTAA 2C3OA 3HJHA 1Z2DA 4G36A 5IZCA 3AW9A 4WLNA 5KDDA 5BSHA 1BFDA 1W4RA 1I4LD 2QUHA 3AF2A 3FR7A 5K0JA 2EBHX 5KTMA 1NW6A 2QRQA 4GBED 2HK8A 3SFZA 3T7JA 2FVYA 2JC3A 3BRWD 5B2EA 2FKAA 2XRZA 4ZQBA 4MGHA 4X71A 3AKYA 5AJHA 2QHXA 2WTXA 4TKZA 3UK0A 4EVQA 2YV3A 2ZIUB 1IMOA 1KSGA 3V1LA 5IAOA 2KBEA 3GLQA 3LW7A 3W1VA 1CNFA 2PBFA 4OGFA 1JHOA 2ZBQA 3P0EA 2O07A 4ALNA 1PBNA 1U28C 3EMDA 3IIJA 4NAUA 2VDVE 5AD1A 4XTRA 3R09A 4Q4CA 4EPWA 1SOAA 4ETWA 2WSMA 3ZW9A 2TYSB 2DSTA 1HETA 1XG5A 1Z38A 2IV7A 5LQNA 4AJOA 4CM7A 5LQUA 3IUPA 5BUSA 3THXA 1TKCA 3K0AB 3ACDA 4BGUA 1DZ3A 5DMHA 4J7CA 4XSVA 2GK7A 3TEFA 2WKPA 1TD9A 2PWZA 4MGEA 2JAWA 4AJKA 4C78A 1ISIA 1DCTA 1PN3A 1NP3A 1U8CB 4MPDA 1BCSA 1IEVA 1ZUWA 1Z4QA 2E4XA 2VJYA 4L0QA 4DXDA 1VE5A 1F7VA 3WYFA 5B3JA 4M1TA 4PZYA 2PUCA 1XD2A 1K8ZB 4XYMA 4B09A 3FNIA 1QF6A 3PQ2A 1P2TA 4M0DA 3K2BA 3R9XA 3P71T 2INGX 4QYMA 3LT4A 5BPFA 2BI7A 4QRIA 1P3DA 5D86A 3HXTA 1NC3A 5K03A 2RMKA 2BDUA 2IH4A 1IQ0A 4WX2B 1U3TA 3GD7A 2OC9A 3UEOA 3KB2A 4F06A 3G88A 3WRYA 3S70A 2Z9BA 3CLVA 3LVBA 2XA2A 4RVOA 4LBWA 2C3MA 2GKSA 2XE4A 2VSYA 4ZOEA 4OV6B 4FSHA 3DZDA 3G5MA 5L8VA 1LTQA 4K2HA 3MJDA 4HMPA 3GLGE 2H1VA 2C9MA 3E7DA 3IP7A 4P4SA 2N42A 2A0WA 2A8YA 3FNHA 1MG0A 5TT1A 3T95A 2CMDA 4D0LB 5ADUS 1TADA 3TK1A 3BTUA 4UVEA 4US2R 1QRUA 4XDYA 4LOKA 1BIFA 3WQSB 1DOZA 1UOPA 3I5UA 3K71B 4MQLA 3G0GA 5EJ6A 1L1FA 3OUTA 1YFJA 4QQRA 2J1LA 3T1NA 2ZTVA 4G0PA 3NOVA 4PR3A 2K5UA 3EDQA 1W46A 4K1XA 5HF9A 1LI4A 1G5TA 1PK7A 1E3WB 3A27A 3QVUA 4MP6A 1NQWA 5JYBA 1BGVA 2QVBA 1Y9EA 3TZCA 2WFMA 5L7WA 3CMCO 4EG4A 3QXSA 3LI2A 4TV9A 5ABPA 2Z6QA 3FSGA 4I46A 1VJRA 3BIJA 3WGYA 4FFBA 4YJGA 5IT0A 3OM0A 2C4KA 3K05A 2P5TB 4WOPA 1U7OA 5FYQA 4NDAA 4EF5A 4ONEA 1B00A 2CD7A 5BV8A 1K6XA 5GADl 2O5CA 3CSSA 4S1TA 2A7QA 2CWWA 3EOBI 1TE2A 2LNDA 5CB4A 1ZO8A 1B3RA 1EAYA 3BWMA 1WU8A 3IIMA 4G0MA 2IDKA 3ZHCA 2HL6A 3C6MA 1UKAA 4TWRA 2H1LA 1UZAA 4I2VA 5B2ZA 3W8NA 1QG4A 4XUEA 3ZGOA 4U0KA 2OTCA 2X7HA 5AHRA 3UW3A 4EDHA 4ZKDA 5IHXA 4MPPA 3I3OA 4RGYA 1WUKS 2J3HA 1PYDA 3AR5A 4JP2A 1JMKC 1K5DA 1ZBDA 4LHXA 4YLEA 3ZWWA 4DMKA 1CNMA 1JMYA 3NHJA 1VSTA 1FEZA 2R1TA 1JKXA 1FTNA 1SVOA 2CHGA 3HHEA 3OY7A 5KKAA 3CZCA 5REQA 1SD2A 1W25A 3EZ7A 5TV2A 2ZI3A 5G1PA 2QR2A 4LSWA 3IQXA 4OHFA 1UZNA 3RUHA 1O77A 1GSIA 1K92A 2I55A 2P9TA 3PQ8A 4N6NA 3MQ4A 4M99A 3KWFA 3ZNNA 4B48A 5LYJF 1GAQA 4CKCB 1H4TA 4YR7A 1FVHA 2N47A 1DIOB 3CX7A 1O2DA 1JN0A 1SUWA 3DEYX 3E48A 4L22A 5HKKA 5I8PA 3IPCA 1T4BA 3OT4A 3K2QA 1DQNA 3A6HA 1X7GA 1Y7LA 1ZZGA 1P0PA 4FFOA 5COAA 2AIRA 1ULBA 4N41A 1UPTA 4LC1A 2Q41A 1L4UA 1NL3A 4PO1A 3Q7QA 1E6EA 1R8JA 1JH9A 3F6BX 3VR4H 1QHHA 2Q1YA 3PIIA 3WLNA 3ZWBA 5BXQC 1LDBA 4EAQA 1XJ0A 5JMTA 1H2HA 4AZ0A 1ZNXA 2YV5A 2OB2A 1GAXA 3ANMA 1YBAA 2G76A 4X41A 1K5GA 3D4NA 3E2PA 2ONZA 1V5WA 4R5MA 4O5OA 1ZCBA 3DWFA 4ZVRA 1JHMA 1F1BA 1C4KA 3EXFB 4O4LA 2R0QC 2FMHA 521PA 5JPCA 4CPDA 2VQFB 1G6Q1 2GD2A 1ZCJA 3C98A 1QIJA 3E0QA 1RPZA 5IJXA 4S1VA 1PG0A 2JEZA 1DXOA 2OBNA 1WNFA 3CT6A 1GZDA 3OEHA 2UYOA 4MRVA 3TXYA 3BT7A 4FOSA 1RNLA 3KYJB 4LC0A 4D4GA 2C31A 2Q4OA 2P7IA 1SUDA 5IAAA 5FTKA 2PPLA 1ZUD1 5DBGA 4UEKA 5JJKA 1ZW6A 5JATA 1KJ8A 2P4EA 1FUUA 1FW8A 2JJ1D 2QAGB 5FBZA 3S2IA 1U2DC 4HD8A 4NATA 5DTRA 5JDCC 2Y99A 4C6TA 1CR2A 4D0RA 3E3OA 4LRWA 1O6ZA 1RXYA 7ABPA 2G06A 2JI8A 4G0NA 2IDMA 5K6AA 4CEJA 1CY2A 2BE7A 2WG2A 3IRVA 2Q8NA 4XD7A 5DU2A 3VKUA 3ZD9A 4YJFB 2VUUA 4KR2A 1CDDA 2X2OA 4FZ3A 3MXOA 1N3BA 5E3IA 1E89A 3O8DA 3QLUC 1Z2PX 2CNDA 1I2MA 3Q0TA 3RG8A 3ZQUA 4U2GA 4QU8A 1SCDA 3CPJB 3NOQA 2VEDA 4EUKA 1R6AA 4G1CA 1HR0B 1NFFA 4X8LA 4Q1CA 3OOWA 3QPCA 3IURA 1ZINA 5E1OA 3CUWA 4PGGA 2Q3DA 3L46A 1M2KA 4HC4A 4B9EA 1KPHA 2WG0A 1FMTA 1TB4A 1LSJA 2JA1A 4GI3A 4LISA 3GRRA 3BH6A 3WLSA 2CMKA 2DTDA 1N0VC 2HMAA 2OVBA 1JDPA 3VZRA 4B35A 1L4LA 2C03A 2DSNA 2QY6A 1WTAA 3GJ7A 1VRCA 2GUWA 3IH5A 3LHSA 3PQ5A 4G0YA 4UPEA 5IASA 2WVGA 1LBSA 3L0BA 4MVJI 4CR7A 3RWMB 3A9TA 2DPLA 1XZLA 1X1CA 4DSNA 4DZZA 3JSXA 5FADA 5D85A 3G1WA 1EI9A 1HYGA 1CUZA 3OMWA 4JP1A 3UM9A 3DE6X 4P7JA 4JJEA 3F6PA 1LSOA 4BTVA 1PLLA 4YECA 4N9QA 1VHLA 3DL0A 3LPLA 4WKGA 4B74A 4EELA 1FSFA 1V8OA 2D0DA 3WKAA 1PQWA 1JFTA 1CKEA 1E4OA 1UMDA 4REOA 3U80A 3VU8A 5B6JA 1ST2A 2HCJB 8ADHA 2HIMA 4UM5A 3RFVA 2XKAA 4JB3A 3H2BA 4JJIA 3EWNA 4YJKA 1PR5A 1S4MA 1NLYA 2AN3A 3H4TA 3FGPA 4ZREA 2I5PO 3R3XA 4JT8A 3ZZ1A 5LQJA 1YQDA 2C1XA 1WM1A 2B4TO 3NGLA 2HIGA 4QBKA 3UWMA 3EQ8A 1I14A 1PUJA 1QAOA 1BCRB 2AUNA 3K7EA 4MKIA 1LK7A 4D9MA 1RZRD 1WXWA 5GWXA 4MUYA 1IM8A 5J2UF 1PFUA 2HRZA 4I50B 1OYYA 1N0IA 1GPJA 2DOKA 2QLTA 2W4MA 1Y6QA 3C6QA 1JILA 4IV0A 1D6NA 4N40A 5AHKA 4N03A 3WHLA 3D1VA 1QIFA 3EG5A 4FFPA 1GQ2A 1UH5A 4CMIA 1AKMA 3HB5X 4R2MA 1IRIA 1J49A 1J9ZA 2Z4RA 3TUJC 2QT1A 4YXFA 4ZT2A 4A9AA 4Y2XA 1VJ1A 1UF9A 1DEKA 2PL1A 4R1NA 1IBSA 2I29A 4QPNA 4EPXA 1TQ6A 2WYWA 1B2LA 1K3FA 3TRJA 1HE2A 3AJDA 1GLNA 1RAEA 2OVFA 1LB1B 4IGAA 3V4LA 4JI4B 2CY0A 2ECFA 4DRXB 1JAYA 1AKTA 1G17A 3DBRB 3EGXA 1VI2A 3S2GA 2B5OA 6GPBA 3VR6A 1OH7A 1X14A 5D6NA 4B7AA 4PM4A 3SYKA 2DUMA 4QTZA 3UAVA 3V42A 1MW9X 4UXHA 5K0ZA 3BA1A 3RUCA 3X1YA 1KJQA 2IELA 2Z8ZA 121PA 2FMXA 4IUCS 1L8AA 3ENNA 1TZJA 2AN1A 4OL0A 4YDSA 4XGIA 2WC1A 1TFRA 2NO7A 3DOIA 2M6RA 3CBGA 1JB9A 5ESWA 1E8NA 3G2LA 5CB4F 2XMCA 5K6RA 3OAAA 1AQUA 1FYVA 2E5WA 3QVJA 3R74A 2RGRA 1XEXA 2QTBA 4QBHA 1O5OA 4B6QA 1RJGA 1WV1A 1KBZA 1A5TA 4RJTA 5I9IA 3QUAA 3S2YA 1MO2A 2KQUA 1WKBA 2W6CX 4Q21A 5LZ8A 1EIWA 1HX7A 4C2UA 1L5YA 3QYFA 2AXEA 2CVPA 3FY4A 2FH5B 2ODWA 1KHHA 3DBHA 4CLXA 5IANA 3WGIA 3KQKA 4RPJA 5A6SB 2NAFA 4JXKA 4GZMA 2HO4A 1KMHA 5DDIP 2W7TA 1IPEA 5HPYB 1XCJA 5EWLB 3HGMA 4QG3A 4KQ1A 4JBXA 4F72A 5CIQA 3GLFE 1KKUA 4BKUA 5J43A 3WYBA 1XCOA 5AUQA 5AK0A 4OI4A 4BO7A 1NN0A 4K6GA 3UJ6A 3U6KA 4XX1A 1BXRB 1Z2AA 3LO5A 4TUYB 2EKBA 1J0BA 1HV8A 1F12A 4L16A 3CKLA 3WHKA 5C51B 1WHSA 1KWKA 5F4ZA 2QNIA 4ACAA 4GZLA 3LL4A 1II9A 2XSZA 4IIJB 5JQGA 2Z1NA 3RAEC 4MVJG 5TF4A 4C9BA 3CCBA 3I5MA 4Z2AA 3PB3A 4H1HA 4OHBA 1I1QB 1AKEA 2OY0A 2J09A 2Q2QA 3AONB 4IGKA 4YP5A 3SYMA 4AG5A 1Z0UA 3MJVA 3NHZA 2P1DA 3T5MA 3VHXB 3W4KA 1S4QA 2IYUA 3KKEA 1OXXK 1UKYA 1CZUA 1Z7EA 2LIVA 2VXCA 2ZXEA 3ORHA 4WXHA 5CFLA 1TQDA 1O94D 2X3YA 4IVQA 1MOQA 3CPEA 5JCJA 4AJ9A 4BE7B 5ISMA 4GOND 2AG1A 2GAOA 4RZIA 3ZDEA 1GSHA 5LMNB 2PZFA 3E1KA 1Z08A 2BBOA 4EHIA 1OYOA 2WIFA 3CGWA 3MGCA 3GAMA 3D1LA 2HLPA 4FX2A 4KPFC 4AJNA 5ELLA 1VCOA 3UT5A 4KWTA 4QJ3A 4NPHA 1YR2A 1LBEA 2EDAA 2P90A 2OBXA 3D8BA 3KXLA 2UZ3A 2FUEA 1N5LA 3B13B 4MR8A 4PPGA 2F90A 5T5QA 1KZHA 3UV7A 5ARBA 1Y9AA 1NBAA 2ZIWB 2VYFA 2VAPA 1Z2EA 3MD0A 5LBTA 2AJ8A 4N3BA 4M60A 2ROQA 4KV9A 3HVJA 3D31A 4CTJA 2D00A 4UOEA 2RHLA 4G5RA 3R6WA 4GXRA 4MROA 4CWAA 3NVMB 3LPNA 1I1OA 2QSZA 1XVLA 1CQWA 1VL8A 2P11A 1NURA 2QRMA 3AHJA 3W3AA 4GSKA 2CUKA 5C0OE 3TKAA 3H0CA 4Z4CA 4N3CA 4YUZA 3UTDA 4FFWA 2JLUA 2JGRA 1JEJA 1VJ5A 3D7KA 4BTLA 5BSEA 1YQUA 3FN4A 3ROFA 5E6SA 1J7KA 1GVHA 1ZY2A 1ZIDA 3I9KA 2HIHA 2J9FA 2OZKA 3F6CA 2H6EA 4R9NA 4G0OA 4ARZB 4CV3A 1ISPA 1VBFA 3DO8A 3VUEA 1W0JD 4PZCA 4MUEA 2FWRA 2GXQA 1NUPA 1V6SA 5LCXA 1FA9A 2NO4A 5FBVB 4C7BA 3KKMA 3UXHA 1QO7A 1OWOA 5LB2A 4DIOA 1Y9JA 4JC8A 3KVYA 3EGDB 3N2ZB 5DN9A 1XJCA 1ESCA 2EF1A 3B8HA 4G5YA 4ZVPA 3AEQB 1YO6A 3CZRA 4XD2A 3ULKA 1KAQA 1PSDA 4TT3A 2V5UA 5DYYA 3SXUB 1KRWA 1MC8A 4MH0R 5GONB 4YVFA 1LY1A 1PAUA 4JXJA 4IDHA 4QTUB 4C30A 2YVKA 3WBJA 4DEXA 3SHVA 3FOWA 2Y4NA 1RI4A 4PX9A 5TJHA 3C1OA 2A5GA 1R0KA 2KW5A 3ERCA 2VK8A 4EVRA 2P3LA 2O8CA 4NCJA 4FYVA 3GFPA 3ENZA 2VHQA 4Y2GA 3UO8B 1NFQA 2JIOA 3ORRA 1H0RA 4F38A 3L1VA 1H0SA 4FD3A 3BILA 3F9RA 2ZIFA 4P38A 3WMGA 5C52B 3GP8A 3G2MA 3N8HA 3GQVA 3HI6A 4NEGA 2X9NA 4MV3A 4OHRA 4PZPA 4GFDA 3WVNA 4ZTUB 4H7EA 1NV9A 3ND9A 2AEMA 4QOHA 1PNRA 2VZ8A 1QQAA 1W19A 2XB4A 4K6KA 5H3HA 5FWXB 3PGA1 1BRMA 1U3CA 2IY9A 3IV7A 2EL9A 4JNCA 1KMCA 3ROQA 1ECBA 3NOOA 1U1DA 9ATCA 1AZTA 2D74A 3EPRA 3FMVA 3JD1A 5DGHA 1W5EA 1ECLA 5LLDA 5IT9A 4UW9A 2IHBA 2PN1A 3FWYA 4NZZA 3T3MB 2QDKA 2IT1A 4U7JA 4CM1A 4E5YA 2LRHA 3T7IA 2A5JA 2C00A 4OHPA 5JJCA 3N8IA 1ST3A 3AUXA 1Y3BE 3USZA 1HYQA 4CUJA 3UMMA 2DLCX 5AXDA 3WOHA 9LDTA 4BRWA 1UBGA 4ND5A 5EFZA 5E95A 3UJAA 2VN8A 3TGLA 4C01A 3H87A 3IHTA 3T4EA 1YI0A 1QJ4A 1U94A 4N18A 3VISA 3SPXA 5C1OA 3ZIAD 2ZIGA 5FJIA 3E7FA 3B6JA 1N6PA 3MG9A 1CY7A 1PRYA 1ZN8A 3B8EA 2GHQA 2QSUA 4JP3A 3MSXA 3W5UA 3S2FA 3E8XA 2VT7A 4FGJA 3CKKA 1U9IC 3PHCA 1GY8A 4NBLA 3ROGA 1Y37A 3PGJA 4GNKA 1M2JA 2GEDA 2I3ZA 3EVDA 2FV8A 4ISBA 1ZJJA 3QPAA 4O2BB 4MV5A 2W5UA 5AQ1A 1L6RA 3TCNA 1TZMA 2JCBA 2QTRA 1S1MA 2Q7XA 4ZYTA 5K9ZA 1F4PA 2ZAYA 4K9RA 3IYLW 5FHQA 3O47A 4DE5A 4FGKA 3FGOA 5M7EA 1TM2A 1XRPA 2P75A 1YZNA 4LYYA 2KS6A 4BYGA 2J9XB 5JBNA 3F74A 2C94A 1CZKA 1L7VC 4A73A 3B82A 3I9JA 4WAUA 4Y2PA 3VVMA 1KEZA 3KLOA 3RPEA 3ZGNA 1IHPA 2ZWMA 1GGNA 3G79A 3ON5A 1OJLA 3Q3EA 1XQXA 4G5XA 4OOEA 4Q48A 3UV3A 3EXIA 5JXHA 3BICA 5IF9A 2NX2A 2J59A 2Q99A 4HPWA 3WB2A 2ZWOA 1VECA 5ALJA 4BMDA 4C4PA 2DH6A 1C8KA 1RACA 2FWNA 5EGNA 3RSCA 5DI3B 3D8TA 2RHMA 3RYHA 4LYGA 3TM5A 3RIYA 1MA3A 3T4XA 4JBGA 4Y1FA 4CL0A 5LLSA 4IHAA 1ULHA 2ACKA 4X7PA 4DEYA 3JWIA 3NR2A 3HCOA 1JG1A 1VJ0A 3MJ4A 1RWKA 2HREA 1XNJA 2GI4A 1GFZA 1O96A 5K3FB 1U0NA 4G89A 4GECA 3WNQA 2XF8A 4ZT3A 1OWPA 2X0NA 4I2NA 1NQOA 1QRRA 1WX1A 2IF2A 1U8ZA 4LN1A 1T35A 5B3AA 3V8PA 4AXXA 4LNUB 1BWSA 2GMWA 4JJFA 3T7SA 4H0FA 4U7FA 4BNIA 2OLJA 2R65A 3P52A 5JQGF 1EVJA 2QW0X 1T5HX 4EPVA 1FDUA 4BIIA 4GRDA 3GQBB 4ZJZA 5U1PA 2O4CA 4MEBA 1TJ4A 1DMSA 1RQNA 3F6SA 4K28A 2VYVD 4J6FA 4NZMA 2VK4A 2JFZA 4U5QA 4MDYA 5G53C 5YASA 4E32A 1KR5A 2O2IA 1SOUA 2FP4B 1S2OA 2FW0A 2R00C 1DPGA 2WIAA 5I5EA 1GA1A 2O3SA 2XKBA 4LJ9A 1CX9B 3C3WA 2WE7A 4M1WA 2OC4A 4YP6A 3TDMA 3BGSA 2LCQA 4H27A 4TS9A 3DCIA 5ALIA 3ES9A 2Q6LA 2HRDA 5KSYA 2WAAA 3AJ9A 1KOGA 2WTEA 3AM3A 4TKVA 3MTGA 4O2RA 3VHLB 2VHZA 3QENA 2FA9A 5A05A 1X19A 4BVGA 4EQ6B 4TZ6A 2O05A 1ZJ4A 1C3EA 1KC1A 1D2CA 5JNUA 4TLLB 1RZVA 4CMEC 4GKJB 1G9TA 1MP0A 4QG7A 1A8IA 4NF2A 4GEKA 4IICA 1DBSA 1ZH2A 3I04M 1V7QA 4UTPA 2IU6A 3LCMA 2R68A 3RIGA 1AIPA 4EJSB 2FUCA 1PE0A 2QZJA 4A0SA 4YJ2A 5MHTA 3N39C 4F8JA 2FEKA 4ZICA 4O8CA 3LW8A 1E8DA 3UMGA 1QCCA 2QEQA 3IAAA 2YZMA 4NJMB 4LZNA 4QYWA 4MYTA 1NVDA 4ARUA 1ZS9A 4ZZIA 3DYVA 4LS3A 1N9KA 3RB8A 2COKA 1JG3A 3DEZA 3E58A 3R3YA 4YV1A 4Z7OB 2R4TA 4L2IB 4C7OB 4C2TA 2R6AA 3DAFA 3PNLA 3PUXA 3RNLA 2XJ9A 4QU0A 4LHZA 1WS6A 2QN9A 2PGIA 4FUTA 4RA9B 1AN0A 3INTA 4Q19A 2O8NA 3CKYA 5TQJA 4U5XA 4P3KA 3U7QA 3L8YA 1U81A 3DEHA 3LM8A 3QI7A 4M36A 1ILEA 2GWHA 4YP1A 3IMCA 4XXHA 4F7DA 3M3PA 3T5DA 2XB9A 4AUNA 4ZDKA 1NVWQ 4BZXA 2MT9A 4O2LA 2A4KA 1WULS 2GNOA 1YR1A 3ORYA 5L7YA 1TUEA 1Z22A 3TR0A 1NRXA 2V6GA 3N28A 3G0HA 3JQ8B 1YWGO 3Q5DA 3NIFB 2X9QA 4M9XA 3CWQA 1P2VA 1Z37A 5K51A 5EHNA 3TDNA 2AFIB 1AU9A 1KRXA 2YMPA 3E8MA 4JP8A 4A6DA 2VEOA 2C4UA 3KR0A 2GA8A 1U5BB 3WG9A 1GPWB 3RJMA 4BWGA 5CB6A 3GEGA 1I3MA 2A0UA 4NXNB 3B3GA 1VIDA 2FQQA 3HRIA 4FSXA 2G1AA 5ECDA 2PT9A 2FZCA 4GPEA 4K9NA 4EFMA 1TK3A 1JU3A 4M1MA 1OMOA 3MBIA 1YVPA 2VNIA 3ZWPA 5JNLA 4CLRA 4LBVA 2AOUB 3D6TB 3CN9A 4EA9A 3RYCB 1GDDA 3CA8A 4JC4A 4LOLA 3PFWO 2NAPA 3IP3A 3M6IA 2IU0A 3I09A 1AKWA 1A7UA 3D7LA 3NJ8A 4NYJQ 2PV7A 3GAAA 2VT2A 4Q3LA 3ZD8A 4BQOA 3AMVA 1HFJA 5JPDA 3CONA 3RRZA 1GUZA 2A1UA 1VYVA 2AGVA 3CC8A 1HRKA 5FORA 2QYHA 2GASA 2REQB 2WHYA 2RI6A 1C9MA 3IEKA 2QM7A 2I3BA 3CIOA 4IDGA 2NVUB 3CJTA 3M2PA 2HLNA 5KNBD 2NP6A 3F9CA 1DVRA 1WKCA 3LBYA 5LMZA 5AICA 3Q41A 4YUWA 5BWNA 3OFND 1DO0A 4HAYA 2V4ZA 4L0MA 3ZEAA 2Z0MA 5KOHA 1XZFA 3HPRA 1XMOB 1YR3A 3JQQA 4LY0A 3QTTA 3CF4G 1C0LA 4IMPA 1P9LA 3OC6A 1M0TA 1F8FA 1SKUA 3C48A 2OHVA 3TCKA 3GYGA 4L7QA 2R47A 4HBZA 4IDBA 3WSTA 4I5IA 3RUDA 5IEBA 2CVZA 2ZE7A 5JTTA 1LW6E 1VE9A 4R2XA 3D4IA 3PC7A 4XJVA 3U44B 3PT5A 1IAQA 3SIWA 3E9EA 3H5WA 4QYXA 1J39A 2AEFA 2Y71A 5DHSA 3INRA 2P6OA 3TRDA 3U7EB 1VHQA 2P78A 2X1LA 5EQJB 4Y6LA 4ZZ2A 5LP6A 1SURA 2I6SA 2PGLA 4NCHA 4TTRA 4TT8A 5TLSA 3C0KA 4RF3A 4JYAB 3RCBA 3KB6A 1OXBB 5DFAA 3E81A 3RS5A 3LUKA 1EEHA 3H18A 4NK4A 5A5VA 2J31A 1XRQA 3T9BA 1FLNA 2BC9A 2R1ZA 2WHPA 4G84A 1EVZA 2O6LA 3BD9A 1UADA 1JYFA 2J8ZA 4YXWA 3V3KA 1WBJB 2GJSA 2Q3MA 5P8WA 3QFCA 1KP2A 3OKCA 2P6UA 4D7AA 1A1VA 1G3QA 3G02A 4L4ZA 1HXHA 1YJXA 3LMKA 4J0QA 4FIZA 5SZIA 3WISA 3E15A 3B51X 2HYIC 3I1YA 4BNNA 2RHOA 1XZQA 4ECAA 2H7XA 3RSHA 4JB8A 4MV7A 2R7AA 3PX7A 1X7XA 3GUHA 2WWIA 3RYTC 1RAFA 3VKVA 1IUKA 5DCUA 1UQRA 4RFSA 1S0UA 1RXVA 3VKHA 4E13A 5F5XA 2JW5A 4X5OA 3GXOA 2EGHA 4P7GA 5DYWA 3B5EA 4IOKA 1F0YA 621PA 1XEAA 4KUHA 1R15A 3RU3A 3ICOA 4H4EA 5FIUA 2J5KA 5A0VA 4BFLA 1KQFA 1EFAA 2P65A 1JSCA 1CF9A 3OE7D 2ZRKA 4HHEA 4NZ9A 4URZR 5K0SA 3U1VA 3BG5A 5KIAA 1K0FA 2HXGA 4PLCA 2X1VA 4HGOA 1JL3A 2YHSA 1GTG1 1YGPA 2H5EA 2IIVA 3FYHA 1V1MA 4L73A 1GTMA 1WVMA 3TOXA 1LCIA 4D9CA 4HLUA 3BM5A 1WPRA 3DMPA 1JZQA 3FPAA 1V1RB 4B3XA 4YMGA 1DC6A 4KVFA 3B1FA 2IC5A 3A1CA 3AOEA 3IKLA 4GMGA 3RREA 5KJ6A 2XWQA 1XZEA 4R8KA 3VOTA 4I6EA 3U3XA 5BR1A 2VJMA 1RRVA 2OFOA 3A1DA 3DTYA 3PLNA 2QMQA 2W83A 3Q5GA 3WDSA 2I4LA 4KR3A 4B6JA 2ENWA 2XVYA 3DQQA 2PFGA 3DVAA 4WK4B 3FRHA 2WHEA 3O4GA 3V48A 2IBTA 2QUJA 4BYMA 3H2KA 2GEVA 1XUOA 5SY9A 2DQYA 3RS0A 2H00A 4NCXA 5D1NA 3NNSA 2QOEA 3FVQA 3JQ9A 2JEYA 3T1QA 3HJRA 3DM5A 3PZBA 1BX0A 2XUAA 4AF6A 3LK7A 2CE2X 3OCVA 3OU6A 3A14A 1L9KA 5SYAA 1M2VB 3SU8A 2NU6A 4X1YA 4AWBA 5C5DA 1A50B 3H84A 4BWYA 1GZHB 4KL8S 4D9IA 2AOTB 3J81k 1KI7A 2OZVA 2W6QA 3W5JA 1MFZA 3OLZA 3PGXA 4IF6A 3SJZA 4POOA 1UPXA 2IA5A 3DOJA 2D62A 2PZJA 2VJBA 2ZE5A 1O1YA 2VFAA 3CY6A 3R3WA 2IKSA 3AB3A 4XWYA 2HBZA 4I4CA 3EGVA 1XT6A 2F48A 3I39X 1M1YE 4YI3A 2VDWA 1IN1A 5L6LB 1E1RA 3HCWA 3VTAA 3OCYA 1HWYA 1W73A 3RNOA 2P3OA 4DILA 4Y30A 3K35A 4JT2A 2IXDA 2I1WA 4N0QA 4RZ2A 2GEFA 2UZ4A 1AKNA 4R1OA 4BVJA 2FCRA 2BGKA 3KSDO 3WGNA 3EUEA 4NG4A 3ZLJA 2XGGA 4B7UA 4LZLA 5K3DA 3H6HA 2PRIA 3PEVA 1O87A 2ACEA 4CFYA 5IT4A 2YWRA 1U8TA 1XHLA 5CU7A 1PUXA 4BNJA 1L5MA 3Q7EA 4ZOAA 3UA4A 3WIVA 1Z0KA 4V0RA 3HXOA 5I8ZA 4A6EA 5G0SA 4WN9B 1JQEA 2VWPA 4KXNA 3L0CA 4BJ5A 4M2LA 5JXWA 1QVVA 3DE3X 4NYIQ 2JLXA 1C4OA 2FRDA 2XE7A 3I05A 3EAQA 4BO6A 1E7WA 5EE0A 3PEYA 2CYAA 2QLMA 3ENQA 4PICA 4X7RA 5EKDA 1XNHA 4K0KB 3DS8A 2D0IA 4DB4A 3N87A 2ZT8A 3REGA 4AJ1A 4MUGA 1M2FA 2Y6UA 3LIPA 2GO1A 1OZFA 2E2WA 3L04A 3TB6A 4FFMA 1V43A 2ODBA 3H42B 5BMVB 1T3SA 1RYNA 3NHYA 4E5NA 5C8ZA 4X1KA 4Y9UA 3SZUA 1JPVA 4F92B 1ATIA 5C8DA 1N7IA 7REQB 1J8QA 3LQ2A 3QBTA 4UNSA 1WZNA 4AKEA 5FI5A 3GLVA 1XWIA 3P4UA 3JQAD 3FVTA 3TNYA 1G9XA 1JEDA 1KDZA 3GFGA 1E1KA 3RHFA 2EERA 3MWGA 2BLLA 3DM9B 3ZWOA 3W8FA 1WEKA 2HJGA 2O8DB 4W9NA 1E2HA 2FQWA 2DE0X 1UJ2A 1MA0A 2WU3A 1UBNA 4DT1A 2DPMA 4YT8A 2P4UA 3DE7X 3UWDA 3L1UA 1YS7A 4I4TA 5HBGA 1THTA 2W70A 4K88A 2AQIA 1RHJA 1CUWA 2GDJA 4EBFA 5A3JA 5JXIA 1I24A 4PBTA 2IF0A 2P35A 1OI2A 4EY3A 4MIKA 4CT0A 1VE3A 5TGZA 1FFAA 3SJAA 1JKMA 5I4IA 3STYA 2XOKA 3K9BA 4KFCA 4WLOA 2OORA 4US1R 1WCIA 2JGEA 2NW6A 3K4QA 4MUKA 2FR8A 4A8JB 5JHHB 3TLCA 4QBFA 1N34B 3DH0A 2PUBA 4QASA 3TOCA 3I28A 1TVMA 2I4MA 3HXMA 4W6ZA 2F43A 4RPLA 2BKVA 2RG1A 3BBLA 4WFKA 1A9TA 1XU7A 1YE5A 4PEVA 2HF8A 4WZBA 3TDKA 4EJMA 4TWJA 1GPYA 4ZCMA 2OV4A 3A06A 3PA8A 4N0MA 5TQVA 2OXTA 4GIBA 3T1TA 4CCAA 1T8PA 1NV8A 4J29A 2VQEB 3B6IA 2DAPA 1N2OA 3IVXA 5DRTA 3X2SA 4AQDA 2NZXA 4IOLA 3GUVA 4LVUA 2QZ4A 1IK4A 2BF4A 2R7NA 1Z73A 4N4AA 2IEGA 2YH2A 5JYDA 1JHYA 1P4HA 3D2BA 1QH0A 3LXMA 1H6BA 5ALYA 2YJ4A 2YZKA 5KJFA 5L6MB 5JO0A 1PVOA 1C8LA 1N2HA 2I1LA 4PZEA 1ZHHA 1KAGA 1Q95A 2YNMD 3NP9A 4PXSA 3SZOA 2Q1SA 4CYMA 2ATIA 4K5QA 4JVNA 1O6BA 3I9LA 1WP9A 3SYRA 3ODGA 1J0XO 2DUJA 4WKOA 5F1OA 5IAGA 1CEEA 1YNSA 1Z4MA 3CB4A 3IPXA 4KXMA 5HE8A 4S1PA 1XF9A 4M0KA 3U0BA 3CFYA 4C3UA 2UZIR 1RDFA 1NY5A 2MCFA 3QYPA 3GJSA 1B1AA 3DMTC 5CTAA 3ZX5A 4B81A 4BNHA 4LF5B 1DAHA 2EZ4A 2JJMA 2P2ZA 4NNPA 4RNCA 3ECSA 5EXPA 1L5LA 2A0XA 2PMEA 3RSLA 4YRKA 2ZZMA 3B1WA 2W4IA 4PLYA 4UUQA 3U4AA 1PQUA 4LECA 4MQMA 5BWCA 1GAWA 4HFJA 2HK6A 721PA 1OLSA 3RROA 3LCCA 1C2TA 1NYRA 2FOIA 3GAZA 2O48X 5F2EA 2RBEA 3TSWA 1NF8A 4PSKA 1MXFA 5KNCA 1L4MA 4B2YA 3UJBA 3QBVA 5DM60 1ZKMA 3AERA 2WJAA 3KDAA 5ER9A 2ORVA 4DMUB 5KTSA 2XIQA 3LQKA 1YDFA 3GNLA 2ON6A 5B58C 5HF6A 1PZNA 5BSTA 2UV8A 3E18A 3FI9A 1M2NA 3GIDA 3HA7A 3WKCA 4B8WA 2J3DA 1NW5A 2VP9A 3QI2A 3AUUA 1CUYA 2G0TA 2WUWE 3AESB 3NTRA 3O7WA 4FWBA 4W1QA 3VGPA 3ZXIA 1ZIYA 2WHQA 3GVIA 2O0MA 1V4VA 1U7PA 2H2FA 2OFWA 2VKQA 1CUGA 3CZ4A 3D54D 4YMIA 3GB9A 3N2YA 1LTHR 1Z35A 1KJIA 3FZGA 5JFGA 1GZ5A 4MV0A 3QX9A 4KXLA 1BC5A 2P5YA 3BE6A 4B6GA 3F97A 1U31A 2P6NA 1CS0A 1HDXA 2ZDQA 3QLJA 2ID4A 4HRAA 2G5PA 1JG4A 4RL4A 4XM2A 1KSJA 1MT0A 1W0CA 2DFLA 2H5IA 2O7SA 3I1FA 3SLGA 1Y1PA 4D4LA 1S7CA 3DNMA 3FYDA 1P8AA 3B78A 2DBVO 1E4EB 3PUKA 1H3FA 4MVJF 2C59A 4F11A 5JD5A 3W5VA 4XB1A 1SXJD 5B1SA 1PFGA 2E4ZA 4E21A 1NUQA 2YZ7A 3SMQA 2WJZB 4Q3AA 2FY8A 1HA3A 1UBKS 3DE1X 4IJ5A 3K96A 4FGWA 3DZFA 3NIBA 3IQIX 5C7OO 4KU4A 3WE7A 3JQPA 1N3YA 1SEPA 3VYVA 5JASA 4ZD6A 1W8IA 4U7DA 4BXOA 3AR9A 2MYTA 4YR9A 4XYBA 2GZ1A 3SLRA 5G41A 5LBUA 4MIYA 2CJPA 3J7AC 3FFTA 4QUEA 3O8LA 5BOSB 3DZBA 3UXYA 4IDOA 3SK0A 3RVJA 4HYTA 1D7AA 3WY9A 1POXA 2WF8A 4HNAB 1XFDA 1NOKA 3RLFA 4B43A 3WLAA 3G5UA 5DZSA 1JV2B 3ZPXA 1S2GA 2QTLA 3GMIA 1W87A 1N6HA 1PL6A 1KIFA 1QVAA 1JDUA 1TCCA 3A3NA 5EMNA 2Q1WA 3QLVC 4X9XA 4F9EA 1LD3A 3C8ZA 2WI8A 3K5HA 4WL0A 1P77A 1XMIA 2CLLB 3P1JA 2JKZA 5BQ5A 4C4OA 1JHUA 4H7PA 3W6ZA 1Z56C 2OHIA 1EINA 3DE2X 2PU5A 4K8OA 4UJ5A 3TQFA 3L4JA 2JIZD 4QGBA 2B8WA 3DXFA 5JZBA 2BTOA 3N2KA 1N2IA 2HF7A 2PSFA 2X2EA 4QVIA 4QRHA 4PCAA 2WSSA 3DR5A 1PKXA 1GOTA 2ODNA 3FBGA 1ZCAA 5EUMA 4KDFA 4RDXA 2ZM6B 4BB5A 4OYYA 5DRYA 4YMHA 3A70A 5LZ2A 5LVAA 2Q8QA 2ZXFA 2JH9A 3PK0A 4MA4A 1T9CA 1TYZA 1OKKD 3E5NA 3GWGA 3NJ4A 4XIYA 4ZCQA 4YT5A 1GPNA 2AEJA 5A2GA 1DAFA 1PEAA 2QN6A 1N0WA 2XUKA 3IA7A 4X93A 4Z86A 2N0SA 5F23A 3THRA 3UG6A 4KK3A 5DK6A 3P0IA 1MG5A 1NVMB 4NNJA 1PP4A 4J8PA 4R2KA 5ES3A 2IQIA 1TMGE 4BIMA 2EP8A 2FPGB 3I72A 1FNSA 4OFWA 3WP1B 4EZBA 1KL7A 2P41A 1K63A 3I2HA 5KB3A 5A2QA 4FQ7A 4GYYA 1MPXA 2E48A 1QMGA 2W2NA 5BVHB 4OMFG 5AVQA 3GDHA 3E27A 2FSIA 3CEAA 4PZDA 4B3TB 1R6TA 2X0KA 3B1ZA 4GSLA 5FHRA 3STVA 3WDMA 3TGPA 3KOOA 1WR8A 5DN6D 3RI3A 2PZMA 4B45A 3DUFA 1ODTC 2F9MA 2YJ3A 3H5OA 1KVQA 2UZ1A 1EK6A 2Q4RA 1RT9A 2BCJQ 5ULLA 1M72A 4EPTA 2NYVA 5LPNA 4FZ5A 1JFVA 4E46A 4PC3A 3CLSC 2Q2VA 2GFQA 3V7FA 3SQXA 4A1FA 1JU9A 1Y80A 2G09A 2X5XA 3DZGA 3REQB 4OBWA 8ATCA 1QV6A 1O6FA 3EQZA 3PICA 4U9HS 1OI7A 1V3UA 2FG5A 3K0CA 4OFBA 3WMEA 4EY4A 5HRAA 3U48A 4GE3A 2VZLA 2JGLA 5AW0A 1HEIA 3DTVB 1OX4B 4IZOA 5JVDB 4EH1<