1FLAA

Clostridium beijerinckii flavodoxin mutant: g57d reduced
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMDDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1flaA00
2QX4A 5EMNA 4U7FA 2X2PA 1AKUA 2HPVA 2GSWA 1TLLA 4H6PA 1ZWKA 1SG0A 2V5UA 4FX2A 4R81A 4OXXA 2MT9A 4DIKA 4YAUA 3W7AA 1DXOA 3W77A 3NHSA 3N3AC 3NLLA 3L9WA 3NHRA 3ESYA 2KLBA 2MTBA 2Z9BA 5TGZA 4ZVNA 2FOXA 3UXHA 1E5DA 5F51A 5JROA 5F12A 1YCFA 4NULA 1ZX1A 2FX2A 3FW1A 3RPEA 1OBOA 2QR2A 4ESEA 4Y7CA 2QMZA 4DILA 1JA1A 1D04A 2N1MA 4C0XA 4CF6A 2XODA 4U7HA 4N65A 5B3LA 1ZWLA 5B3KA 4ZVLA 3GFRA 4QOGA 3NHKA 5FX2A 2AMJA 4Y9UA 2BN4A 2FLVA 3TZBA 1C7FA 3ES9A 1AKVA 1YRHA 4QOFA 3ESZA 2Z9DA 1FX1A 2Q62A 2QWXA 3N39C 1RTTA 2R97A 3OJXA 1OFVA 4BMPB 2FZ5A 3D7NA 4YALA 3NHWA 1DXQA 4YQEA 1AKWA 1J9GA 4YAFA 1XT6A 3JSXA 2F1OA 1GG5A 4U7GA 4D02A 2QX8A 2A5LA 1H69A 1QBGA 1RLJA 2MOKA 4Y9RA 4N82A 3P0RA 3OWHA 2Z9CA 1X77A 4LA4A 1XYYA 3B6KA 2RG1A 1T0IA 1KBQA 3OJWA 4PTYA 4QODA 3NHYA 2FZVA 3HA2A 3HLYA 1RCFA 3NHJA 4GQIA 1OBVA 4QOIA 3O2NA 1CZKA 1DX9A 4PTZA 3NHLA 3OX2A 1AKQA 3U7RA 1QRDA 4XDGA 1YDGA 5LBTA 2FAXA 5LVAA 5A4KA 3L9XA 3NHPA 4S24A 2OHHA 1XI2A 4GR9A 5BUCA 2KQUA 2W5UA 3G5MA 1VMEA 3OVMA 1JA0A 3W79A 3KEGA 2OYSA 3F6SA 6NULA 4C0WA 3TE7A 3FX2A 1AG9A 5LMCA 5LLDA 1CZOA 4GI5A 2MWMA 3NFRA 3KAQA 2Z98A 3EDOA 1WSBA 1FLDA 1YCGA 3ZHOA 4M0CA 1FLNA 3K20A 1J9EA 4N9QA 4ICIA 1I1OA 2FVXA 2X2OA 2R96A 1RLIA 4LTMA 5EAIA 1KBOA 2V5VA 1J8QA 4HS4A 3QE2A 4J8PA 5FUQA 3FJOA 1J9ZA 2FDXA 3LT5A 4C76A 1AZLA 2BZSA 2BMVA 2OHIA 5FA6A 1SQSA 4ZVKA 1YKGA 3N3BC 5LBUA 5F4BA 2Q9UA 1WSWA 4PU0A 1FUEA 3KLBA 3B6JA 4QOHA 2HNBA 1FVXA 3U7IA 3OX3A 1TIKA 2D5IA 4YAOA 3FVWA 5ULLA 1AHNA 3F2VA 1BVYF 2M6RA 1QR2A 3GFSA 3KAPA 5NLLA 5EA2A 2HNAA 1NNI1 2QMYA 2BPOA 2BF4A 5LJIA 2M6SA 2QX9A 2ARKA 1QHEA 3B6IA 1CZHA 3QFCA 3HR4A 4XDHA 3SVLA 1CZUA 4QOJA 4LTDA 3K1YA 3F6RA 1YOBA 1D03A 3LCMA 2V9CA 1BU5A 2XOEA 1FLAA 1C7EA 4LAFA 3UXEA 4H2DA 1AMOA 3F90A 4FGKA 2FCRA 1CZRA 3GFQA 3W78A 4FGJA 1AKTA 4LTNA 4ZVMA 3TEMA 3R6WA 1T5BA 1FTGA 1B1CA 3NHFA 3EYWA 4F8YA 4CETA 2OHJA 1V4BA 3ESXA 1AKRA 1CZNA 4YAWA 3B6MA 4QOEA 2ZKIA 1YCHA 3S2YA 2QX6A 1H66A 1XYVA 5LJLA 3OX1A 2WC1A 3NHUA 3QFRA 1F4PA 3O73A 5NULA 1FLVA 4BMOB 4FGLA 4HEQA 4DY4A 1CZLA 3OWXA 4C14A 4NLLA 3GAMA 1D4AA 3FNIA 2B3DA
chains in the Genus database with same CATH superfamily
5I9TA 1RKVA 3AY6A 3LNTA 2X22A 5F2OA 3AEQB 3VU9B 3LYLA 1E2HA 1QHGA 4DCGA 4WL0A 2ZYUX 1TLLA 1RM3A 3TR0A 3VDQA 3K0CC 1NV9A 2Q6VA 3GBPA 5BW4A 1PN3A 4IR7A 1N1GA 1QPGA 3BILA 4EX6A 1SURA 1GR1A 2H4FA 2VBFA 4ZPXA 1D5CA 3W77A 4HX2A 4B74A 4BRUA 2G36A 4A8PA 1Z0IA 4WGFA 1P2DA 1J70A 1VMIA 2YCLA 1T5IA 4NR0A 4X6YA 1ZNQO 2GBFA 3FWPA 5EWMB 3SJAA 1HNWB 3R9XA 1ABEA 1AH2A 3KYDB 4PX3A 4URWR 5BUQA 1EX7A 1LWOA 1ZNWA 4QNRA 1N5DA 3NLLA 1SCQA 5FT9A 2PVCA 4DBVO 4TTVA 1C30B 1WPGA 4P0QB 3C5WP 1K4MA 2JFUA 2ZJ8A 4UHFA 3PJFA 1ORRA 1VPDA 4P08A 5MN5A 1F7VA 1P4HA 1Z0JA 4EKIA 4TMTA 2B6NA 3KQNA 3WNVA 4AYWA 2P6PA 2CMHA 3I9MA 4R2JA 1S2NA 1G3UA 3QVXA 4H1VA 1PUJA 4X62B 3I61A 4B3SB 2JC3A 3HWSA 1I2ZA 4PEVA 2QD1A 4YRSA 2DCMA 2P8JA 5EMJA 1TQ2A 4O25A 4IINA 5DLEA 1T8YA 1US8B 1XX6A 2PS1A 2VH1A 3V1TC 3IT2A 4HDKA 2BI4A 3NTUA 4TMZA 5GAJA 3VO1A 5AKKA 2P2GA 2XWSA 3TQOA 2HDNB 4PLGA 3M2PA 2E48A 3DP7A 2HYDA 2ZBVA 3Q15C 4HFMA 3MGBA 3AI2A 2D0PB 4PHGA 5FOWA 3JTMA 4BHTA 4MHTA 1BD3A 1Y4ZA 2MMCA 2QMQA 4DMGA 1ISFA 2WJYA 3KLMX 3TD2A 2W6PA 4MW7A 3T7CA 5ADWA 3FPCA 4D3SA 1P4GA 2IY7A 1T36A 4D9FA 5C7IO 3IKLA 1QV9A 3WLNA 4Q1CA 3U0VA 5LN1A 3P9YA 1MENA 1NMZA 1K8XB 4GQAA 1E96A 5CW2A 5A0VA 2WWIA 2G5TA 5E1MA 1P44A 4X5OA 1KEZA 2O2EA 5KJEA 1HFKA 3A05A 1RDFA 2R66A 3A1CA 3OO1A 5ERXA 4A16A 3W34A 4Z49A 4PNHA 3TR5A 1F2UA 1LK5A 4LXQA 1ZCZA 3AU8A 3LCVB 4E31A 4A73A 5ECDA 5DE3A 3PFIA 1MAAA 3JQCA 1Z37A 3VPDA 1P75A 2QZZA 1Y8QA 3GA7A 5AXAA 1NX9A 1CXZA 3VZSA 3F67A 2PUEA 4XX0B 3DKIA 3WQSB 5AM0A 1VI5A 3F1LA 3BWXA 1E1NA 3AKCA 2LCFA 4IG9A 5CM9C 3DLBA 1Z8FA 3C3JA 4Y9UA 1E98A 2R11A 1J0DA 1KDTA 1NVMB 5KDDA 4DS3A 1QHHB 3JQGB 3SFVA 4Q39A 1LBTA 3SS8A 1YAHA 4GC5A 1NPDA 4TT8A 2J46A 5ALYA 5B1DA 5PGMA 2QJRA 4J0GA 1GFZA 2E4AA 2VDPB 4IIJB 5IARA 1J0AA 2ST1A 3KCNA 3EFEA 4JMLA 5D5PA 5LQAA 1BO6A 1HF3A 3A1FA 3NOVA 1ZISA 3BSFA 3S0JA 1W5SA 3C15C 4S05A 3HI4A 5K0NA 1YZHA 3ACCA 4YCSA 4D0SA 3CT4A 1SUDA 2X4LA 3G82C 3JQAA 5LP6A 3OE7D 2PSJA 2NO5A 2RAPA 1H6BA 3DDSA 2AG6A 3QOXA 4QXQA 3L6UA 4KIUA 2IVZA 2RGNC 3AF2A 5KHAA 2X8LA 4K9NA 4DUGA 3EEIA 3TMAA 1CR0A 3DEKA 1UXOA 1RLMA 4U9UA 4UU1A 4HNRA 4RULA 1QZZA 5H82A 4O6VA 1V1RA 3FKQA 4MVJM 1E2UA 1V7PC 4R2WA 3T7JA 2IEIA 3B1YA 5EN4A 1B0PA 5EMMA 1IVSA 3Q7RA 1KETA 3TKLA 1VHJA 1BH2A 3DE0X 3OZWA 4QFCA 1CNMA 5BMVF 2YKGA 1UCFA 4N3GA 1PWYE 2F3PA 4B0OA 3D8TA 2FPGB 3QKUA 5JY6A 4N0DA 3WRWA 5B1EA 4IL5A 1RJ9A 4EA7A 1HE3A 5C2JB 4N0QA 4G36A 4RKEA 3UMJA 4L4XA 3P4UA 2HEIA 4DV5B 2WA1A 3DBRA 4NJMB 3FPJA 3HU1A 4XWYA 3MINB 2A9QA 3VSBA 1HNZB 4I9GA 4KQ1A 3ICQB 4N7BA 3KALA 2Q3MA 2Q21A 1KI7A 4HNAB 4PYMA 4B3RB 1P0FA 1Q84A 1QVVA 1CERA 2NSHA 1Q1QA 4PE5B 3CYFA 1T9ZA 3UFXA 1T1GA 3MOGA 3ZCUA 1SHUX 2I6SA 4NIMA 4MRVA 4PINA 1T3GA 3F9CA 1Z5ZA 4PX2A 1VA4A 2IZZA 2JJ8A 1MEJA 5FQOA 3NBYC 4EG7A 4E5PA 4M1EA 3OM1A 2C2KA 5G53C 3T9BA 3LZCA 3I9LA 2YYSA 3MRXA 5E6RA 1WP9A 2G77B 3L7DA 3N6RA 4MSUA 1U3FA 2ORVA 4HLDA 1XA3A 3HKCB 1OBCA 4QBFA 3WO1A 4ZFNA 1LBSA 1IOZA 4UW9A 1SKBA 4P34A 4ZT3A 3Q6IA 2J30A 2ODWA 2CDRA 3E5NA 1YB1A 1Z6TA 2C5SA 3ZXIA 5CVTA 3IA7A 4U2EA 3HA2A 1LZKA 2ACEA 4NBSA 1FVOA 5CA0A 1WCIA 4GUAA 4H1UA 1RE0A 4ZHQF 1NAIA 5KWIA 3UCEA 4DR5B 1PW7A 4EZIA 1KSGA 1IEXA 4MUFA 5TPZD 3ZZUA 4CMIB 1OAOA 3TQHA 4IM7A 3I32A 4LMBA 5J4KA 3RYHB 1YB2A 2XOKD 1DX9A 3QKTA 1XZ8A 3IS3A 4GM1A 4NPAA 3LBHA 2HDOA 2UV8A 1PTJA 3HDTA 4NCJA 2FG7C 1Z0UA 3W2IA 2Z5LA 4O2LA 3RO7A 5LQMA 2IX9A 5ALLA 4QATA 1SVMA 4JOCA 1ZH2A 5ALTA 1N2BA 5F5NA 3VSDA 1G20A 4D99A 3F6BX 4DHEA 2VA8A 4EG5A 1CULC 4RSMA 1E66A 4RLSA 2OBBA 4M9UA 4MUMA 4YNBA 5C51B 3C98A 4R3WA 3BL8A 3I8SA 1MXHA 4M8SA 3T34A 1LPAB 2Q49A 4ALIA 3VMFA 4YRMA 4Z7OB 2Z2YA 1OR8A 4TV9B 4GEGA 2FQ1A 2V6MA 4ZGGA 5ILOA 3HHPA 2VVTA 2C54A 2OHHA 4XQ0A 1DSSG 2O1SA 3OMLA 4PN7A 1JJIA 4NBWA 2E0IA 8ADHA 1O4WA 3WHPA 3I1FA 2BFFA 1J1IA 1A9TA 1P1CA 4P9NA 1M74A 2C4VA 2O4CA 4BQSA 1VIAA 3OPYA 3A04A 3G5MA 3N2GA 4CKYA 3AEKB 3KIPA 4C7OB 2I4TA 5IYZB 1NRWA 2QDXA 4HK4A 5ELMA 4OLAA 4FI3C 1QIMA 4MCHA 1L6IA 3ZE8A 4BKRA 1NVGA 1ULUA 4X7BA 1U9ZA 4FEEA 1Y7LA 2F1JA 3TE7A 1DQYA 1NR5A 1QE5A 3F7TA 2CXRA 3AT1A 2OCLA 2XW6A 4TLLB 4A0HA 1WBBA 4WA7A 4Y2SA 3WDMA 5C5CA 2PZGA 1OLUB 3R7FA 3U62A 2O54A 1TF5A 3E8XA 3B2EA 1UT6A 3DGFC 1U8TA 3QTLA 3LP5A 4NQZA 1UWVA 2PZEA 4DVGA 1W4LA 4C2UA 4MVJF 4YLGA 1T6NA 2WM2A 1E1QA 4PC7A 3LS2A 1YHNA 5HVNA 5DNEA 2H1VA 2ILVA 3WMGA 3S81A 1L7BA 1CY6A 1PHPA 4JJFA 2EIHA 2C9BA 3F49S 4RCVA 4Y0VA 3TLKA 4EYEA 1VGQA 3LBAA 4AG6A 1TW2A 3BHNA 5BP7A 4N9QA 1Y82A 2GD6A 2C94A 3LE8A 3QBJA 4MGZR 5AHWA 3RWMB 2BSXA 1OJ7A 4WVLA 1V5EA 2RHTA 2XVYA 4PLWA 3T3EA 2BP7B 3UTDA 1NG9A 1LJUA 4QFDA 1O8BA 4LTMA 4UBLA 1T9DA 3RKSA 4L8GA 4C3OB 3SQWA 1WB9A 1E4OA 1KEUA 2OFOA 4K9RA 5A1JA 5IM4F 1AIPA 3F3SA 4QU8A 4UZSA 1W44A 4S1PA 1HORA 1K6IA 3AB8A 3L05A 1JQBA 1MTZA 3FI0A 3QVMA 2CKDA 1II8A 2HBQA 3ASZA 1TD1A 3W5CA 1UINA 4N5MA 1XR3A 1NM5C 2VZLA 3KEOA 3O4RA 5CTAA 2F9MA 4Y0NA 3KKLA 2OUIA 1WW2A 5H1YA 4HSGA 4B2IA 3FB4A 1UBGA 3QELB 2C07A 2X40A 3AFNA 3HKBA 2VDLB 1HLDA 3QE2A 4TYPA 5EE1A 4Z0PA 3V6MA 1EVYA 3DWFA 3MTEA 3QBDA 3WLMA 1ZL0A 4B6FA 5A5FA 2YC2C 3EVBA 2B35A 3EBLA 1GPYA 4HEA1 4QVKA 4ZARA 4X24A 2FDXA 1EZ4A 4RVCA 1M1ZA 3U3RA 3UB3A 5HQTA 1RMQA 2B83A 3BZWA 3O0TA 4LKRA 1LPSA 4ZDJA 3ZJ4A 1P80A 5HMMA 3BL5A 5JJLA 1KAQA 3PLRA 2AFVA 1S2LA 3DO8A 3FTCA 4Q21A 1TI7A 4Z7JA 1B00A 3ENKA 4N18A 4QGAA 5ECYA 1U9IA 3ADPA 4EA9A 1ZMXA 2R8EA 1X8LA 3PLAE 3W4JA 5EINA 2C95A 1NJGA 3ESBA 3FDZB 5F4BA 4OP2A 5IN5A 4KI0A 2TYSB 1PFGA 3N58A 4JLAA 1ZRMA 3BIXA 3CPEA 5HKLA 4G09A 4JI3B 1T1RA 3B1JA 4QDTA 3NHAA 3QUTA 1JDBC 3KLBA 4IWYA 2JFHA 3VR3D 4YRTA 4L85A 3ZHBA 1EFTA 4L57A 4E14A 3JSAA 1XCOA 1JI3A 5C4MA 4CEJB 1DARA 1E1YA 3F4KA 1V11A 3L1KA 3ND5A 4Z7QB 4YBRA 4E6EA 2PKQO 4J7XA 5HK8A 3SJ7A 3WOVA 1X7ZA 2JCBA 2BEUB 3FPHA 2QE7A 3OX3A 2XQJA 3BB4A 2D5IA 3BXFA 1CW2B 2XNCA 1N8NA 4DDVA 4B6SA 1G17A 1PFYA 1GEEA 4LGYA 2I7DA 1SD5A 1TO2E 2HMUA 3ZIUA 1L7MA 3AXSA 4B2PA 4XX0A 3EWSA 3BDIA 3T9EA 4JJGA 5JRJA 2IEBA 3D43A 2QZ9A 1CY2A 3GGJA 1DZ3A 4KXVA 5CXXA 4AJ4A 3SX4A 3N28A 4IMRA 1QHHA 1UBUS 3AF5A 3F5MA 3H2BA 3ON5A 2HJWA 3TQCA 4GZMA 5BRJA 3QIVA 3P0EA 1Z12A 1SCIA 3PPXA 1FC0A 1NE7A 1X1CA 1X39A 3GYGA 4U9HS 1B8VA 4FR5A 2M6SA 1IAVA 1NW7A 3OCCA 1QLHA 2GN1A 1Z15A 1D6MA 2X13A 2ZJ5A 3DFUA 1KZYC 3DFFA 3EJWA 3W2EA 4CM4A 3RVPA 1C4KA 5TEWA 1M0WA 3OKPA 4KEAA 4QOJA 1OVMA 1GD1O 4OQEA 3FUCA 3PTZA 5JPDA 1D2EA 3SU8A 3GMSA 3E7WA 1NQOA 2XOEA 3C1TA 1EX6A 2BMAA 3ILXA 3MVEA 5DM1A 2DB3A 1FLAA 3GXBA 1XPUA 3SYRA 2HN9A 5J47A 3P97A 1ND6A 4A26A 4YJFA 3C70A 3RNLA 1AGXA 2C5EA 4XLTA 4V0LA 1XRSB 2VSQA 1M73E 4RY9A 3K9WA 2ZQYA 5FORA 4RPHA 1KZ1A 2OECA 1U2EA 3B7PA 1XTIA 1E4EA 4QELA 3WQBA 1QU3A 2ZRHA 4EI2A 1H05A 1RFLA 3H97A 5K3OA 1FYVA 3ZJYA 1C7QA 1CJTC 4XI9A 5T6MA 1KK3A 3U3OA 3VNBA 2GZAA 1ZCAA 1SU7A 2VDKB 1HV8A 3PNLA 3FCEA 4JJ8A 5JQWA 3E82A 3TQTA 3PNYA 5K4HA 2LTAA 3TCKA 3D4LA 5EJEA 5TE9A 3RKUA 3MW8A 3P4XA 1YR8A 2QAJA 1FJHA 3R7DA 1QQ7A 4TTTS 1PVOA 3ESXA 2D4HA 4YAWA 1D2NA 1A7JA 5AT1A 3CMMA 1NL3A 2IDMA 4WK2B 4JC4A 4BQPA 3FYCA 4XJTA 2AMLA 2GVDC 1YE3A 4JSTA 3GUVA 2FNAA 1YR7A 2WJ4A 1LLCA 4QLAA 1YVPA 2H2FA 4YRBA 4DABA 2D8MA 3G9XA 1NBAA 1P9OA 2X0DA 3R3SA 1ORHA 4YR9A 3C8ZA 5FPSA 5E4TA 1TA9A 2PMDA 3T1OA 5AW0A 2GZHA 1L8AA 4KFTA 4KBYA 1J99A 4JEIA 4WIAA 3R3VA 1JAIA 4BRZA 3NWJA 3ZLBA 1VLQA 4E30A 1JBQA 3K71B 2B1QA 2AS0A 3AG5A 2VJKA 1F4PA 3PZRA 4Y6QA 3PPVA 1N6KA 1POXA 1VM6A 5C32A 4J94A 2C3MA 4ISCA 1MA0A 2WUWE 2G4VA 5JSZA 2V4ZA 2ZOSA 1DO8A 3V7FA 3DLCA 4O2AB 1DEHA 1CZLA 5KHLB 3MYYA 5BSMA 4MWOA 1S0UA 4AWBA 3TG2A 1CRPA 5ER6A 1HO3A 2JBAA 5I45A 1RE1A 1U2DC 1Y48E 4R3UC 2X58A 2ATCA 5CDHA 2B69A 4Q7QA 3CPHA 4H7KA 4DEXA 4NJOA 1VPVA 4ZO7A 3UWMA 3NDRA 2YZGA 2OHFA 2R7KA 1X6VA 2NTNA 4G5SA 4J91A 2B5WA 2QX4A 3U13A 1J97A 3KB6A 4LRSB 4XLLA 3TS1A 5AKEA 5EKTA 4E5UA 3RFTA 1AKUA 1QVZA 4Z54A 3UXMA 4EEXA 1MU0A 3CIOA 3THXA 4YJHA 1DT3A 2ZE8A 2NVUB 2H3HA 4FOSA 3AZQA 1JVSA 1ELOA 1H6DA 1SG0A 1W1IA 1E7SA 1SXHA 2BAGA 2QP4A 2YVUA 1L4NA 3C3YA 4DQ0A 5HBRA 1OKKD 3OHSX 4DYVA 1BSVA 4GMKA 4MQ4A 3JQFA 2FUCA 3KVVA 3V00A 1BXGB 1Z62A 4WBSA 4P4UA 5BNFA 6CHYA 3QE9Y 2WFLB 3BK7A 1TAUA 3EEOA 3AEKA 3IURA 5EWLA 2IV2X 3TLZA 4P3PA 3WICA 2VUTA 3K09A 1GQSA 4MDFA 3OZDA 1INLA 4YDRA 1RPTA 4HDOB 5JDIA 1P0MA 3AH8A 5IUKC 3T7EA 5JC8A 1CRZA 3DNPA 1GA1A 2XSZD 4JSYA 5FJIA 2GK6A 4DANA 2PPVA 2AFIB 1D2RA 1Y5RA 2R6AA 3GGPA 4LCEA 2ZRCA 2P77A 3GAFA 5HHTA 3ZS8A 2OK8A 2XE8A 2I4RA 2Z4SA 1LRJA 2CL0X 2PRJA 3CEMA 4DMUB 1R5BA 3RGGA 1QIDA 4GF5A 1BOFA 4ZPJA 4ECEA 4OHXA 2P90A 1GNVA 1EX1A 3ESYA 3ET4A 4WA8A 1FMTA 1HMPA 2D5LA 3K0FB 4PXAA 1DRKA 2Z9BA 3TW8B 4KX5A 3I9V6 4TROA 1KI4A 2ZRNA 3HZZA 4A0FA 3B3AA 4CLOB 3NHZA 4EHFA 1OIWA 2PSDA 3WMWA 1I2MA 3MTGA 3N8NA 4GX0A 1N92A 2JI7A 3BCUA 4TRNA 5GV7A 3S70A 3SZOA 2JLVA 4MKHA 1RRGA 1PL7A 2LBPA 2NZWA 2O1WA 2ZE5A 3D3JA 1ZINA 1KDYA 2WKPA 2JCSA 3HVIA 3CRNA 4PLVA 4P36A 3DVRX 3CLSD 2QIPA 5THKA 3JD4A 4HSEA 1ENYA 4Q9NA 5HS4A 4UUOA 3DJFA 3ZV6A 2IQ5A 1GL9B 1D4OA 3L4BC 4LBYA 1ZM3A 4W8OA 3I2IA 1Y8ZA 3OZCA 2JJ1A 2B0JA 2XD4A 4UXHA 1T0HB 3U48A 5FTJA 1QGZA 2PZ8A 1V1JA 2JGFA 4UOEA 1IOVA 3DD1A 1RZUA 3A27A 1YIAA 4NPHA 1E92A 1KQOA 2Q6TA 5DTIA 2CMFA 3QF7A 1JPVA 3JWPA 3ETGA 3FFWA 5EZYF 5CB4A 1SWWA 5J5VA 3OTQA 3TXXA 2PSEA 4G89A 3UWSA 2J3JA 3ZV3A 2C3PA 5LD2C 2AYZA 1O9HA 2IHUA 2MIIA 2QU7A 2V6JA 2X0RA 2NT4A 2ZTHA 4YUVA 3U49A 1KS9A 4XM1A 5C52B 1XZEA 2VQSA 3D6FA 3NBQA 4AICA 4C4TA 4YCLA 2JFZA 1FL9A 3QKRA 1U0HC 1ZWLA 4P3NA 3PX2A 4XTCS 3U3JA 5FR2A 5LKAA 1FNNA 4Z4EA 2CHVA 2O07A 4MDYA 1HH4A 4GL2A 2FLVA 1V8ZA 3VKFA 1G8HA 3TZBA 3I2GA 3C39A 1Q0HA 3D8NA 3QVKA 4W9MC 3KAKA 1AV7A 1R3UA 3LPDA 4BO6A 3TNLA 1RWVA 2R6HA 3NM6B 3C48A 4P6VF 5F77A 5IRCD 3D54D 3KLNA 4L8VA 3WGNA 3ZYCA 3IP8A 3RUPA 1JB9A 2DJIA 2D2IA 4UOQA 2PJDA 4EHLA 3ZE6A 5EJ5A 1I1QB 3TF5A 2GXAA 1NPTO 1G6HA 1TE2A 1DKOA 2FVYA 4GH5A 3BD6A 4H0NA 4X1OA 1W93A 4MAMA 1K8QA 3MBIA 5CH3A 1PX2A 4RZ3A 4ZV7A 1T2UA 1OH6A 1IQPA 2G25A 1NXVA 2PWYA 2WVAA 3C5VA 1QNLA 3F9IA 4W5HA 4EY3A 1QCCA 1QVRA 3FSGA 1NXQA 1AKWA 1GKUB 4JUAA 1Z22A 4B3DA 2QRZA 2XIQA 4FYXA 1MLDA 2D7JA 3BZBA 1L7RA 3RRJA 3ZWMA 4EMUA 1GXSA 2FY8A 4KXLA 2A3NA 1MCZA 2FZCA 3GCXA 3JWEA 4OUKX 5CXSA 3USZA 1BXZA 2O3UA 1BHJA 2QTAA 3I2KA 3Q2OA 5HJ2A 2VQ6A 3HYLA 3RRZA 2E6KA 3WK6A 3RF7A 1ECLA 2ZIXA 2IPLA 3NAQA 2XNJA 1OX6A 4JCOA 5DPMA 4DSTA 5H9WA 2WK1A 3NC4A 2VH5R 4K05A 3RIYA 1I30A 1KJ9A 4GLFA 1N8KA 4HB3A 5L3QB 5GIPE 2D7DA 2KW5A 5BW5A 4EQ6B 4C87A 2B6HA 1O57A 2UZ1B 3GA5A 1KAOA 2ETVA 2XMGA 3HB1A 5F5XA 4C3ZA 1YO6A 3VC7A 3H5NA 4IDOA 4BCDA 4MQEA 1YI8A 5BSWA 3N6VA 5DCWA 3VZQA 4HQOA 4MI9A 3RROA 1UBRS 5IKMA 2JIZD 2ZRIA 4PFSA 3HUEA 1V2GA 4L15A 4U6NA 3A28A 4EHHA 3VR4D 2Y71A 3WRXC 6ABPA 1I6KA 1RQ7A 1FVFA 1QV6A 2ZLBA 3QP9A 2FWMX 4K2AA 1P8JA 2JH3A 3TLYA 1XRRA 1JHQA 2CY0A 3DB1A 2VHCA 3NS7A 3DTVB 4YCDA 4KRGA 4DRZA 5AVJA 3CO0S 3NFYA 5JS7A 4AYXA 3NANA 4OHCA 2RE8A 4Y0AA 4FCTA 1XP5A 2FKNA 1X7WB 2N9UA 3AUJB 4DPKA 4XPIA 2VEOA 3BBLA 1OYVA 5DHAA 4R54A 1J0EA 5HZMA 4LF5B 4MICA 4O63O 1NUSA 5LNK1 1ZI8A 3GFPA 4I8IA 3MWEA 1L4FA 1IHYA 2PUTA 4U2CA 4DSOA 4QOIA 3O2NA 2YJZA 3T3IA 3QJ5A 1YDEA 2FW7A 2WU4A 3AYZB 1T6XA 1CUSA 3VOBA 1L5YA 4YGXB 1NR7A 1PJZA 3R4CA 4HXGA 4OQQA 1KYIA 5ALGA 4NU6A 2J45A 1SEVA 2ISQA 2B4QA 3K0AB 3UK7A 3A1DA 4A36A 2PQ2A 3HPQA 4ANFA 4L5YA 1JPJA 3LX8A 5JNWA 4HZUB 3EX7C 2AG8A 1RAGA 3PF9A 3A3OA 1M2VA 5AO9A 9ABPA 3TDMA 2HGZA 4DLTA 4M99A 4ETNA 4S24A 1PGQA 4CE6A 4CDGA 1X1BA 1D6NA 3D7KA 4PSUA 1BC5A 3A4VA 3P0FA 2PCLA 2CCGA 1NNUA 4DR1B 3NNNA 5AI4A 4EVQA 2WYWA 3OMXA 4PAGA 2BISA 1QAMA 2EJWA 1NYRA 4Z6KA 2Q5CA 3LTNC 2W7TA 4MW5A 3TQIA 3GEDA 3O95A 5ITVA 1W4AA 2W2MA 3B52X 3L79A 1D0IA 3DFKA 1SNYA 3E0QA 4IIJF 1GSOA 2FG6C 5B58T 3ZCXA 1GG2A 2GRJA 3Q7SA 1QS0A 1ISIA 4MGEA 4EKYA 3SYNA 3UH1A 2W2QA 5BY2A 5JBIA 3PD1A 4JYBA 1YBVA 5CHYA 5D01A 1PQ4A 3HCBA 3FOBA 2ERYA 1P17A 3KEGA 4WWHA 3RJZA 3ICVA 3R9WA 3P32A 3KVYA 4TL8A 1YZNA 2WUEA 5A9SA 3DKRA 3SX0A 1UJBA 3CVOA 3GJRA 1T26A 1ZM4A 4CEIA 1JR3A 1ST2A 2WTNA 3AHDA 3H5VA 4HT3B 1WMFA 2A7XA 3GFGA 2Q5JA 3T95A 1QB8A 1W9HA 1UXIA 2OOSA 4ER3A 1KMQA 4N49A 1JV2B 1E3LA 2ZRLA 3B53X 3KTAB 2W6NA 1KZHA 2O57A 4WXRA 2Q0XA 4OGLA 4RTPA 4V0SA 4MW1A 3H0KA 3S8YA 3OQMA 3BGOS 3C85A 3DUFA 3IEKA 3ILHA 2QLJA 4A6PA 4KQ6A 4Q1VA 3HN6A 3FM9A 3QH4A 4LVCA 2A0WA 3U4HA 3TTSA 5CLLA 1EFHA 2H2WA 3LT4A 3ZQKA 4KHZA 3SOPA 3WADA 1ZONA 3O6VA 4IDHA 2P8SA 3ZWPA 1BXGA 1KY3A 1Z13A 3P19A 3B89A 3KTDA 1J49A 3WJAA 3I5YA 1KIMA 3RJMA 1L4YA 4XQ9A 2AV6A 4KRFA 4J6EA 1M33A 2IDJA 4DJDC 3TGPA 1WM1A 1R0ZA 2G40A 3FWZA 3GOQA 4FFPA 4IFTA 4L6CA 1FDTA 4GWLA 3G9TA 3KUXA 4ZQCB 4QJ3A 1NF3A 4B2YA 1SZCA 1FX0A 1ZC4A 2GUGA 3BH6A 3GLIE 5FBVB 2FR8C 3UTCA 4F60A 4LJYA 3FLAA 5MGNA 3B82A 2ZRQA 3PXCX 3P96A 5IKXA 1O1YA 2BJWA 4PBSA 4YJ3B 1EA5A 4I3GA 4B1FA 3KVRA 1ZXXA 3N2NA 1X8JA 4CCWA 4BDSA 4EKNB 1LDGA 3RC2A 2LV8A 1G8YA 3LH5A 4MAFA 5EIOA 3PI7A 1QQ6A 2NZVG 2C4KA 2PK3A 3TW8A 1VLMA 4C4XA 1Z75A 4D92A 1DAEA 3DLHA 1WUHS 1NVTA 5B53A 1ONOA 2R00C 3OAAD 4M7WA 1QRTA 2GXSA 4N5IX 4GXQA 2PT9A 3FYUA 1K3UB 4P3XA 5CAEA 1M1YA 1KSFX 2OHIA 3E7PA 4GOLD 2DQZA 4WBNB 1ZOPA 3R23A 3QG1A 1H1DA 4HYQA 2HWKA 3RSHA 3MQFA 3TDNA 3IT3A 4NU8X 5HKKD 2WP0A 3M5WA 1JYSA 4O4HA 3MSCA 3WYBA 3O8OA 4L4SA 3H0EA 3ZI7A 3IQHX 3ITNA 3AUUA 5LZ7A 2Q1XA 4HY3A 3D1VA 3ZE7A 1P7WA 4DDTA 5L3VA 4A4DA 3GD7A 1XLVA 2WRZA 3OCWA 5KKAA 3BK1A 1DBQA 1NNEA 2QEQA 4MMYB 2PX0A 4RV9A 1UJ5A 2NAFA 2Q4OA 3EOZA 1ODFA 2J3QA 3VZBA 3WBKA 3KLOA 2EHJA 3NWEA 3P45A 4Q00A 4TV9F 3MD0A 1WHSB 2GTHA 2P7IA 3CO5A 2VJMB 1JFFA 3IUJA 3KSUA 4P3YA 5AHKA 4BLPA 2NACA 1GHTA 2IDZA 3EXHA 1M1NB 4Q3OA 2L17A 3EGCA 3LPMA 3U60B 4S1WA 1CJUC 1A5TA 1VL6A 4RHFA 4BMVA 4NZOA 4DCSA 1JDBB 4JC8A 2YHUA 4YQYA 3C8DA 3D6NB 3L7KA 3DONA 3QYJA 2E6UX 2ZWPA 3IT0A 4JL8A 5CH5A 4K9OA 5AP9A 1E6CA 3GT4A 1Y8RB 3E48A 1YMVA 1P8AA 4TLMB 3RE1A 3RVRA 4CL3A 2GLXA 2WYIA 5ICEA 3MK31 3ZWBA 3Q7QA 2OBXA 3VC1A 2HK7A 1MH1A 3H1GA 4KK3A 1T1IA 4DLYA 5A5GA 2AW5A 5EJ4A 2A5DA 1P33A 1MOSA 2H06A 2UVPB 2EDCA 1X1EA 2VRBA 5I7RA 2Q9AA 4BGUA 4NZNA 1C9JA 4JH0A 4F3NA 1XVLA 4D5GA 3NT2A 3I1YA 4RQUA 1PJSA 4QUEA 3V34A 1AHPA 3T3OA 1XHFA 2YWDA 2QPAA 4AMUA 1BQEA 1C2YA 4BMDA 2K4MA 1A5BB 1CLUA 3GPBA 3VHQA 2A78A 4MLDA 4PTLA 1BRMA 2VYNA 5GWXA 1P2FA 4TT3A 1YOBA 3CFYA 2CB9A 4FSDA 2JLBA 4QUBA 5J3JA 1UMBA 4FONA 1O08A 3A4TA 5K8UA 4I5GA 1WVGA 1WOYA 1BH6A 4XKJA 1NPYA 2ET6A 4R1PA 3M6XA 4C89A 4DWVA 3HVHA 3KBBA 1SC9A 1XVTA 4H0CA 2VAVA 1TUBB 4HWSA 4JSRA 4WCFC 4E94A 3H2JA 1C7ZA 2X8JB 3L92A 1D4FA 3NP9A 4EATA 1WA5A 3WBFA 4Z4CA 1TTTA 2I87A 4CTOA 4ZI7A 2OBLA 1QFYA 2FP4A 4BQFA 5HW0A 5LOVA 1JJFA 3QFSA 2OO5A 2H2HA 2VK4A 4WVFA 1IBMB 3OFJA 4H1TA 1OH8A 3Q4GA 4Q34A 1HKUA 4QTUB 1QH8B 3GZNA 4CIBA 1C1HA 2ZJ0A 1TEZA 3R6WA 1E2JA 1BS1A 1HURA 1I14A 1LB1B 2HA6A 2P62A 2MHCA 2VN8A 3BERA 3EXFA 3S2FA 1YSCA 1FNBA 1B1CA 2IXBA 4FW9A 4GLBA 3L8GA 4JA0A 2GF0A 5LMNB 5T64A 2R7AA 4LJ7A 1R0YA 1HPLA 3NHFA 3OPVA 3V9AA 4LRTB 3VTZA 4I99A 4KNWA 3ANMA 5JD6A 3H1TA 1QU2A 2CLSA 2DPYA 3FA2A 4BNZA 3LO8A 3R7WA 2HCJB 3GLVA 1GGEA 4KSYA 5CBPA 3AGQA 3RAFC 3PQ7A 4ILEA 4CKEA 4D8TA 4NJEB 5FFMA 5G4KB 4JJ4A 4F9FA 3A2NA 4I0WB 1UM9B 3KV3O 3LZ6A 1OTXA 5BNTA 2WWYA 3QSGA 4JYCA 1ENPA 4MHSA 4CMEC 1GCGA 1P7ZA 4PO1A 3DTVA 2IYZA 2W93A 5H81A 4JFAA 3ISVA 4GX2A 3S7TA 3DBHB 4KPGA 5KTMA 1D9ZA 2EFHB 5KYXB 1QC5B 5DYYA 4YPOA 3SDZA 4QO8A 5I5GA 5LZ5A 4ZV4A 3SEFA 1UJ6A 3WIUA 5DI3B 2C2OA 2C1ZA 3OJCA 1DXHA 1HDCA 2I76A 4DY4A 4MMZB 2D0OB 2WTBA 5ALEA 4FLFA 3F46A 4H08A 2D06A 5F4ZA 3G49A 2VDNB 4IBOA 2C03A 4P98A 3HKDB 4GYKA 5JEEA 3HTXA 3NKFA 5JISA 3L3BA 5I9BA 1Z7GA 3CIFA 3HH8A 1PLKA 2WKSA 4EF5A 4M1ZA 4HZUA 3VU0A 1H5UA 1ABFA 1XMSA 2VLBA 4LE0A 5TT0A 2HTEA 4E88A 1JJ7A 2L2QA 2GPNA 2PUHA 1PGPA 2BFWA 2H1IA 4QYMA 3UAYA 3H8WA 3PBKA 4JLSA 2P4SA 1GQRA 3OLCX 1C3OA 3S2ZA 5A0FA 1T4CB 1OLXA 2ZK7A 5FPPA 5HJ5A 1ZMBA 3O82A 3C6XA 5U4QA 1ZOIA 3RTBA 3SXUA 1YK0A 3IJ5A 4POOA 1NNLA 2NU8A 1T5LA 2P5TB 4PIPA 4FQ8A 2BMEA 2F48A 1DXOA 1H5QA 3DHWC 4OUDB 4O4IB 1T5SA 2DPGA 2F4NA 3KZ1E 5HFJA 3V8RA 2AOUB 1YVDA 1LSOA 3UJ6A 3BD8A 2F6RA 3WIBA 2ZRAA 1V3TA 3O1HB 2CVFA 4P92A 2QRNA 8ABPA 5IWCA 3CUSA 5JMOA 2D2VA 3EIFA 3ZDRA 5CM8B 1XRJA 4TQGA 3D0KA 4C3VA 5M34A 4PCUA 1KPGA 2ZB3A 4MJXA 5MFZA 3LW8A 1HRDA 1ZOLA 3MXTA 1JMYA 1E7MA 4N01A 2ZIUB 2R0QC 3D31A 3CUWA 2H1OA 3AEZA 4C06A 4WESB 3LA8A 1A2KC 1JYFA 3DEFA 2HT1A 2Y0EA 1P7PA 4FR0A 5TRTA 1YC5A 3DXZA 2BEJA 4HLNA 5FHQA 1QYWA 1QIFA 4RANA 4BQIA 5ITZA 1JALA 1GZ3A 4MWZA 2DE0X 2Y1EA 1IPHA 3ONFA 5CX1A 1GPNA 1HM5A 2Q5HA 4MB0A 4X63A 2P9GA 1T1EA 2PBZA 1P18A 3CKKA 4QQNA 1ZVQA 1TFRA 4ZDKA 1BHQ1 1ZH8A 4Z7NB 4EAQA 3LBNA 3OZEA 3WMEA 2UXBB 1I6LA 2EKQA 5DJ5A 1HOXA 4IX9A 3VHLB 2IZOA 3WNDA 5K6TA 2VATA 3RHTA 2JD0A 5KOYA 4N03A 4QL3A 3L7JA 3UHAA 3CVYA 4E51A 4WACA 3VAYA 1XF9A 3LYUA 1S4QA 3FCXA 3ONEA 2C78A 2FHPA 4MS1B 5IVDA 1EVLA 4CMHA 1T3HA 3W6OA 1GFSA 2I1LA 4FKZA 3H2KA 4G0VA 3KQWA 3F3KA 1DAFA 2ZJAA 4YJ3A 1OZAA 4MA0A 4R8VA 5EJAA 5JS1A 2IK8A 3LUAA 4MQ5A 4RETA 4PS1A 1I5OA 3ABOB 2WYHA 4BV3A 3HB7A 3PHLA 4MGKR 1SFRA 5AI9A 3CNNA 3ZVKA 1T0BA 2ODBA 4BJ1A 4UNPA 2SICE 5LYJB 1MC8A 1EFDN 4N3CA 3B1KA 3K3PA 3KKNA 2R8YA 3KU4A 4CLEA 4NABA 3JYHA 4BE4A 2ZWMA 5KQGA 2J48A 5DHSA 4XGKA 3JARB 5LD2B 1Z2DA 3D6JA 4O2AF 1DCTA 1WUYA 2G80A 4LY3A 4PQEA 3LV8A 3OQBA 4ZREA 4LOKA 3EOAI 2I4OA 4Y6LA 3TSOA 2Q62A 4KVZA 1U8FO 3PGJA 1RTTA 2NO0A 4ZICA 1G21B 2OXFA 4HJRA 1BXRB 4F5WA 5HM8A 2CJWB 4KNVA 3MT0A 4RM3A 4RLFA 4OGGA 1MIOB 2PXHA 1Z7BA 4PC2A 1AB5A 5LA6F 4MIKA 4UCQA 3K9GA 4KDEA 3VJMA 3I1IA 4ODIA 3VR6A 3ZKAA 4ME6A 3I72A 4F4FA 3TZ6A 2JCYA 2VHUA 1PUXA 2QIOA 4KREA 2H0AA 2MR6A 3ABSB 3KSDO 2ODTX 5TQ2A 1IB0A 1ZOSA 1KO8A 2FOIA 5KX5B 2FSFA 1PP4A 1BN6A 3FGNA 1Z5VA 2EKLA 1F6WA 2YV5A 3OOYA 3M0EA 2JS7A 1P2BA 4KQCA 1EVJA 4NBVA 2ZI3A 2QXUA 2YVQA 4WDQA 1W73A 3T5TA 1OFTA 3D6UA 1GRQA 2REQA 3M4ZA 1BWQA 2Q4TA 5HCNA 4DCTA 2JATA 5FPHA 2IHBA 4WOPA 1JDUA 4KAJA 1RBYA 1TGYA 2CVQA 3FHJA 3U4DA 2B7CA 2IZ5A 4RVSA 3OHMA 4GI1A 1CG6A 2NYVA 1OZHA 2ESRA 3C87A 5BWOA 5EJ6A 3BHMA 5JO9A 4KO4S 5EUQB 5C8DA 2EFDB 5CVJA 4KYUA 4RVDA 2Y99A 3H2SA 4IXTA 4IWNA 3L01A 2I6UA 4XE5A 4ZV9A 1BROA 1P4SA 2XCTB 1X0XA 5ES3A 2WVHA 3OJWA 3GCWA 4INJA 2QSJA 4JJAA 4WZBB 1DQZA 2VSFA 3PDIB 4LXUA 1EAYA 2IYRA 1CY4A 4PTYA 4QODA 3RSSA 2H9YA 1NURA 4DGQA 3OSUA 1RZRD 3CTMA 1H0HA 2W8BA 2WOJA 5ALJA 5C31A 5L95A 2J33A 3I83A 1JTFA 3K16A 3GLHE 3S29A 3T38A 3H9QA 4ZCIA 2OBYA 3HHEA 4IVPA 2X8JA 3O7MA 1CIVA 4QFBA 5FTKA 4EUHA 4DA6A 2O7NA 4OKIA 3TBHA 1IQUA 4HTAA 4PHHA 4K1LA 4DTCA 2LDBA 3TZQA 2KI5A 5J1SB 5ITSA 3O7WA 3THYB 1YA4A 1ZMRA 3SJZA 4N48A 3I8XA 2CSUA 4UEKA 2B61A 3MAAC 3OJ0A 3C97A 2RK4A 1XNGA 3CMCO 3NHLA 4OJTA 3VH2A 3FSRA 3NAMA 3F0TA 3DPUA 3RYCB 3ZU6A 1VL0A 4LYHA 6AT1A 1U7ZA 3AKEA 3E81A 4P5PA 1YDGA 4H4CA 2P2SA 4UQPA 2VJBA 4WY2A 3RBZA 5CCXA 1W4BA 1E7QA 2HDHA 2KSQA 5M5BA 1TYAE 1T5TA 4J9VA 4YO7A 5FUYA 2CXOA 4K26A 3GQVA 3RU2A 4BNFA 4H15A 3A1NA 3WWOA 2Z8ZA 4A0SA 2FHSA 4M8NE 4JQCA 2J0QA 1G3IA 3ETCA 1K6JA 4TYYA 4NJEA 3N2IA 4D8UA 4Y7DA 1U99A 3DZ8A 4MRAA 1ISPA 1M83A 1ND5A 2DLDA 1DQRA 4M8IA 1ZA2A 3PQ8A 1RZ3A 2X9NA 4L4YA 1NN0A 1LS6A 3OKAA 3F8TA 4PAMA 4E5DA 1MRSA 3AEUB 2XOXA 4OD0A 3ZY3A 3F7NA 4ZYYA 2DFVA 5ED4A 5DWDA 1B14A 5JV5A 1FTQA 1PK7A 3BREA 2ZAYA 3KPVA 5E8RA 4UTPA 1A8IA 1QO0D 1UJCA 3IXQA 2JFFA 4JS0A 2GZMA 1TTQB 1ZKMA 2C2BA 1P1IA 3K72B 4FGSA 3ZCVA 1OXXK 1SPBS 4BX9A 1MVLA 3M82A 1KYWA 2GTPA 2V8OA 3FX2A 5KWVA 3LI2A 1XD8A 4B33A 3AUTA 4JVMA 4YUZA 2IWRA 3ZGYA 1JPUA 5BV2P 1DWPA 4IXWA 5JALA 4BXOA 2IXEA 4PGHA 4XJVA 3NFRA 2NTVA 3H99A 5EVJA 5SY9A 4EUKA 1NJ2A 3O75A 3PQFA 3EW9A 3WWEA 3SOZA 3QU2A 4D4LA 4G1MB 1FNMA 5G02A 3WP0A 1FLDA 3FOCA 6YASA 1Z6PA 2A3RA 1Z73A 3HVUA 3SQOA 4QYWA 4XSGA 1T9GS 2NX2A 4AX4A 3JATA 5FLXA 4M0CA 4KSBA 4RKRA 4TKLA 4BO5A 4KIWA 4US1R 4QUJA 3UT0A 2GK4A 3C3CA 2ZM6B 1LKZA 2EYQA 5AXBA 1LDYA 1WHTB 2A94A 2WIGA 5HX7A 5IULC 1OJLA 2CHUA 1L7DA 2P40A 1GGJA 2W6MA 3L0BA 4P4GA 1YVUA 4OUDA 2Q7OE 3UW3A 2UZ3A 1UOQA 1XU9A 2HKIA 4GMFA 1Z6GA 4H9GA 4H3HB 4P7FA 2YIVX 1C0IA 3TYXA 1EWVA 2Y68A 5BW6B 4QXPA 4GSKA 8ATCA 3EGOA 1RI3A 4FW8A 4I55B 3S2UA 1PEDA 2HI0A 2VPYA 2YL2A 3N86A 4CM1A 1KO1A 1OXVA 3BJMA 2W9XA 2I55A 2EJUA 2QQ0A 2BFMA 3B2NA 2C59A 4JD5A 4B6OA 1HLGA 1CB0A 5CEFA 1DX4A 1PSDA 1CVLA 1JKIA 2H7YA 3DVAA 3LVQE 4XARA 4BY9E 2JLYA 5HPYB 1N33B 1JS1X 2WT9A 3FGOA 3QEMB 4IGKA 3LLMA 1Y4UA 3CE6A 3EGXB 3NWOA 3EPPA 3JY6A 1QG2A 1CY7A 2NTEA 2W2XA 3I1JA 1U8XX 2IVFA 2GYVA 2PQ0A 3B7WA 3K1JA 4N3BA 1G63A 2C04A 3C74A 4OJNA 4P54A 5E4FA 3BMQA 4XSHA 1TPYA 1E0DA 1KDOA 1NRXA 2YICA 2GZ1A 4G4SP 4YB8A 3E3LA 1N5RA 4XUGB 5BUZA 4K9QA 3KNZA 2REBA 4QGHA 4YAIA 2VJCA 1AB6A 1UMDA 1V47A 1ZYUA 3ISJA 4X00A 2AEFA 4LEIA 1DLIA 1DZIA 1UWLA 2NT3A 3UYKA 3ZCPA 1ZP6A 4WZZA 2EDAA 4I14A 3PG5A 2CLMB 2RB5A 2XX3A 3KQPA 3NPMA 1DUVG 2G8LA 3MWJA 1U0OC 2VF2A 2Q9UA 4IMPA 3JZAA 4MIOA 5EJ7A 2W48A 3PDCA 4I9FA 3BUSA 3TOVA 3QLEA 2I9PA 2IELA 5BQFA 1R64A 4NFYA 1WUKS 1FMJA 2GN2A 3NETA 4M0FA 3K6JA 4RJ2A 2B30A 1P1HA 2FX3A 4H4EA 3IAAA 4HNGA 2MSEB 3I2JA 3JAKA 1RKUA 4UTOA 2H4HA 3W5SA 1J33A 4PSVA 2LWIA 3IP7A 5HJ7A 5MN4A 3FCSB 2WDPA 1TYBE 1DKMA 5IZ4A 3P2IA 2ZSBA 5DMXA 1Q50A 2ORED 3OA2A 1YAJA 3NTOA 3LBYA 2JFBA 4RYLA 3IOCA 1UDBA 4WXHA 5DGXA 3UO8B 5A71A 4Y1FA 1E6KA 2ZUTA 3CRW1 4A0RA 4YMIA 2QMYA 2P6UA 2QTVB 4L3WA 2O9JA 3NOQA 1SVUA 1XJWA 1E18A 5TPWA 5HZGA 2EBHX 4I8XA 4CQMA 4HF7A 2J5BA 2IXDA 2ASEA 3PC4A 1SVNA 3ASYA 3W3AH 2JA2A 2Q3CA 4OHZA 2GILA 5BR7A 3QHPA 4G23A 2Y4NA 4BUJA 1YI1A 4GP9A 3BX1A 1G21A 1QHEA 5FWXA 4OCZA 2OBNA 2VT7A 3D1JA 4DT1B 2Z8YA 2CJWA 4FI3F 3WFZA 4YYZA 1FQWA 3NJ8A 2VWQA 4K6KA 4LV5B 1PD1A 1Y6RA 1A9PA 1YVRA 1PJ4A 1ZFNA 4AJNA 4ZO6A 2HD4A 1EXMA 1T2FA 4M1SA 4LAFA 4DARA 1F2DA 4XRRA 1KQPA 1L5NA 3VHRA 2HSDA 1AMOA 2CFTA 2JKVA 2LE0A 2VXCA 4F38A 2J1LA 3IRUA 4H4DA 4GPEA 1KJQA 4MYRA 4AMBA 5KX5A 4W7IA 3WXBA 5AM1A 1PYDA 1X1RA 2OOKA 4F45A 3LWBA 5EEGA 3G02A 1I7QB 4H27A 1OXSC 3U4IA 2QLFA 4HAIA 3UHOA 4KMRA 3HK2A 2B4KA 4QIHA 2C2YA 2GO1A 4WCFB 1BW9B 3AJDA 5EXDA 3GARA 3R5XA 4Q01A 3W5BA 5KZMB 3O4HA 4NAHA 3JZFA 4J07A 1YIOA 4L08A 4RMJA 4LECA 1GAQA 5DHQA 1ZIXA 5GONA 4EG3A 5BN4A 2L42A 4KWEA 2OHJA 1H4TA 2QNIA 2WDZA 3J81A 1ZHOA 1R88A 3V2UA 1E79A 4Y2JA 1RYEA 4ENPA 5MFPA 1U7DA 3HJUA 1DTWB 2HLNA 4XM0A 4EGFA 4BATA 2WI8A 4W1PA 3E8SA 1XD2B 3C0KA 1B23P 1XRPA 1KZ4A 2O8DB 3EDQA 1MBZA 2XVXA 4BCBA 1XK6A 1QF9A 3DMTA 4XWKA 2AEEA 4LWQA 5LIPA 4URYR 2ZT8A 5AJZA 5EKDA 4WBNF 1KMMA 3I3SR 2P30A 5LSAA 2ZQ5A 3FHLA 3D0RA 4IJMA 2YOGA 5JDCC 4XD7D 4TZKA 3NTVA 5AK6A 1TYEB 2FSPA 3DNFA 3O21A 1RJGA 4PQGA 3TL2A 5I3ZA 1OW3B 5LM3A 3ZD8A 4MARA 5EE5B 2VPIA 4UNRA 2X3FA 3GVHA 3HL0A 1LSSA 4F06A 3AHCA 2CNDA 4R1NA 4QYIA 3LQFA 2PJZA 3NVDA 3B6EA 3UHPA 1DEAA 1B15A 1CR1A 3OPXA 4XEUA 4F2HA 3KKZA 4J75A 4ZQBA 1G0NA 3M3DA 3RIEA 3V2HA 1IRXA 5J5CA 1JIXA 1IAQA 3CVWA 3VXKA 5KPJA 1SO8A 3GIWA 1N2ZA 3D5EA 4NLLA 1CK4A 3G7SA 4PGGA 2CXUA 3T7IA 3TIXB 1YRQA 3WK8A 2JARA 3NEPX 4JVOA 2DWPA 5C81A 3FKSD 1W0JA 4M2LA 2GUWA 3SC2A 3F5DA 4NAVA 5GVRA 1UJNA 1HSOA 3ESDA 3GI1A 3GZTB 4Z9XA 1V16B 2JJQA 1Q1BA 2HPVA 5JXJA 4YV0A 1NUAA 2GSWA 4M8KA 4NH0A 5T3YA 1K92A 4EMSA 5BYBA 2QVYX 4W9NC 4A7PA 1J23A 2VDVE 2AR7A 5CA0F 1EWYA 3JRNA 4PRZA 4JA2A 4DLRA 2J6IA 1WL8A 4FCWA 2J7PD 3P26A 3MCAA 4WFQA 1SK8A 2PA3A 2IYQA 3ZCQA 2VF7A 2KYRA 5GV8A 3V4OA 2C0PA 1MAUA 2OHXA 2AN3A 3I9FA 5T41A 1ZJZA 4A2WA 1CWUA 1UQUA 2ZUDA 4G24A 1CY8A 1JSXA 3HNOA 1ZIOA 3IQZA 5F1YA 3GT0A 4LYEA 3K6KA 2HIMA 7REQB 3DUWA 4WSOA 1VMAA 2Q6OA 4FFLA 1WF3A 4FSHA 5E2IA 4DA8A 4KJZA 2PVPA 1HTBA 2JHFA 2O1EA 4YP1A 1IN5A 3H1FA 3MCVA 3PJDA 5DXFA 4G26A 5GVSA 2BDTA 5TX7A 4HFNA 1O89A 3ZZNA 1VCMA 4NZZA 4HUTA 1ZI9A 5K7SA 2FFAA 1A1SA 2MTBA 5EZYA 1I2CA 1XN4A 2AR9A 1H3EA 5F9HA 1P0PA 3A6EA 4MKXA 4NECA 2GKSA 1ISRA 1ZIPA 2WE7A 3V4RA 1RHJA 3CB4A 1FXWA 1OYWA 2ONKA 9MHTA 3OX4A 4DLBA 4BVBA 4GKJB 3HJTA 2WF5A 2C5FA 5JSUA 2VKQA 4FHEA 1YASA 1E2FA 3OTHA 1AO3A 2J5QA 3AX6A 1IHUA 3FWKA 3EXEB 1UXHA 1OFUA 1V41E 1YCFA 3UQYS 3ZHQA 5KSPA 3RC1A 4I4NA 1UL1X 2AZDA 3CBQA 2BMJA 2FX2A 3HP4A 4J16C 3W9YA 4OX9Y 5CNIA 3E9CA 3EFOA 4J3NA 4LHXA 1OLSB 2ZXUA 4TVSA 4RABA 2JGIA 3COPA 4JROA 1F6DA 3RARA 4Y7CA 4YJKA 4J90A 4TYMA 4FWTA 4MPTA 2HQRA 5ICGA 1Y7IA 3FKSA 1K7EB 1B6GA 5ES4B 2N1MA 4DKJA 5BURA 3GB9A 3K7EA 4DB2A 5HFAA 1HNXB 3UH0A 2E4VA 1Z4JA 3U44B 2EJVA 1VCHA 4IRMA 2AK3A 4X1KA 2ZWAA 3E1KA 3QEMA 1G5TA 1WULS 1JDTA 3GG2A 4PFKA 3GLFB 2PUAA 2ZR7A 4RX1A 4GBJA 4OQYA 3IQIX 3G79A 3OM8A 2NVWA 3P9SA 4WKBA 1N78A 1IVNA 2J7PA 1XQVA 2V8BA 1DC6A 3ZJ5A 1GPAA 4CFZA 5B3KA 9GPBA 3TK1A 1HETA 5FBQB 3VJKA 1NATA 1Q0TA 3C8HA 3IQGX 2AMJA 2OCYC 4B83A 2C9YA 4CM5A 1RTKA 1PKXA 3FLEA 4OBEA 5FYQA 1KA9H 5A4JA 3HBMA 3T61A 4DE5A 4HRAA 4AP6A 3M5PA 3PEEA 4F3KA 2XUKA 3PWZA 5DNCA 4CKZA 4GZ3A 1N2HA 3I04A 3RTEA 2NZYA 4DLNA 1N34B 1SXIA 5AM4A 4M9QA 1PNQA 2XMDA 4RAOA 1GKLA 2W4IA 3AM4A 1R4MB 3DO6A 4X93A 4XIYA 1HYEA 2HHLA 2QYSA 5FBLB 1KKLA 4JGGA 3Q12A 4YIHA 2I9KA 2O8EB 1C0LA 2V9ZA 1JFTA 1RRPA 4W63A 4IV8A 4UBMA 2H57A 3G7UA 2OG1A 1TM4E 2A30A 1Q3TA 2QI9C 5E7IA 3A26A 2VWHA 3HY4A 2NP6A 1JLRA 2JCVA 3ND9A 1EHYA 1Q12A 1BKYA 1DXQA 3H6HA 3CR3C 4GI7A 3WGVA 4ZT2A 2G9UA 4OM8A 1PD0A 1COWA 5EJ2A 5HQJA 1ECJA 5LYYA 1U0BB 4J1NA 3DE6X 1HE8B 1HSZA 2YC4C 3R77A 1V8FA 2WYOA 3ZWKA 4O4IF 2JLRA 1L1FA 4YP5A 5KI6A 3V80A 5DHFA 3W5DA 1CUBA 2GPJA 2QD2A 3KX2A 3ER9A 1LDEA 5FWYB 4NFSA 3TOSA 3DT6A 3A1WA 4BWGA 1E9DA 4RHXA 1X3LA 3PT5A 4JODA 3JAWB 4YMUA 1XCBA 3KZVA 2QTVA 1JIVA 3C45A 3ULKA 4DCNA 4ZOLB 5AW6A 5KTYA 3R40A 1ESCA 4L9WA 4E2FA 1X77A 2QSYA 1RAEA 4WADA 1TM3E 1N2CE 2PRKA 5DIZA 4Y2UA 1E0JA 4G85A 3SIPA 4AT1A 2JK0A 4TZ6A 1T3SA 3C8MA 2HSWA 4S1VA 3EF3A 3VSAA 4AMGA 2RG1A 4BIIA 5JC1A 2QRVB 1IHOA 3AF0A 3CZ9A 2C99A 2NQ2C 2VA9A 1YUMA 2R1TA 3KSRA 3D0OA 1JSZA 3PPYA 1TAGA 3BT7A 1CUGA 4M89A 4AW9A 1QK4A 1UPAA 3P2YA 4BLUA 4BLQA 2K2QB 3IJPA 3SD7A 1YMQA 4AJOA 4YJ2B 5KSOA 2CVOA 4MVJG 3T7SA 3ENVA 4DXHA 5CEJA 5EZ5A 2BSAA 1QF6A 1Q16A 3E27A 4ETWA 1SUSA 3EJ6A 1XB2A 2FN9A 5LDGA 3O9ZA 1PT6A 3D2BA 1E8DA 1NJ5A 3H75A 3QOFA 1FDWA 4I08A 4XIGS 4NNPA 3ROTA 2QQGA 3CU5A 2GDJA 3NHJA 1QNFA 4FR2A 4RVFA 1H8HD 4K7JA 3V1LA 1N1EA 1JG4A 5K45A 1OBVA 4EMBA 2GHIA 3GQBA 1LBEA 3ANSA 1E8MA 1OV4A 3AV3A 4V39A 5EI5A 2GPTA 3UC5A 3OX2A 4BNWA 1SOVA 1YH3A 4MRPA 4ZO9A 2YXBA 2PRIA 2OENG 5A04A 3W2GA 1M5RA 5BVHA 2IKSA 2GERA 4CIYA 2P2YA 1H85A 1D8AA 5FBWB 3ANTA 2G17A 5E8JA 2FAXA 1LEHA 2R2GA 3ACBA 3AK4A 3R76A 1EQUA 3FB1A 3NNSA 4MI3A 4XWAA 5CDYA 2G6BA 2QUIA 1FSGA 3KOWA 4UHEA 3HBNA 3FAKA 3UWDA 2IUYA 1XD2A 3D8BA 3IAFA 5HRAA 5DW3A 2VQ3A 4YA6A 5IDWA 2WT8A 5LYJF 3GJTA 2ODNA 4CG1A 3AHJA 1PYOA 1W2WB 1J2RA 1DIGA 1E1LA 2QVGA 2VK8A 2XUJA 3L49A 4KBFA 3WLLA 2GM3A 1S8NA 3B70A 3H5TA 5I8WA 4IMJB 1X1AA 4IUYA 5M7EA 2B36A 2VP2A 2YIMA 2ZYDA 1SKAA 4PZLA 3EGIA 5D6OA 3PPWA 3FUWA 1NHGA 3I9NA 4GI2A 2BMWA 3N0VA 3OZFA 3W9SA 1XKTA 2QMOA 1H9BA 1DWOA 5JXWA 4D81A 1Q1GA 2OYSA 1SCDA 2AVDA 5AM3A 1EHIA 4YH1A 1U3CA 1ILEA 2P9HA 4NMHA 3CF4G 3Q88A 4YI3A 1NBOA 4YP6A 4CMEA 4M46A 3ASVA 4QNMA 3T5AA 2JIQA 3PGKA 4IOLA 5BUSA 1V6AA 5DBEX 1EM8B 1Z45A 2X9QA 5JNUA 5CJ2A 3EDMA 5LMCA 1U6KA 1VKJA 2XXBA 2RHJA 4U39A 4QSHA 2CFIA 4ND5A 2AXQA 3LBIA 3ZHZA 4AK9A 1N0WA 4JBGA 1O87A 3KQYA 1JH9A 1MJ5A 1IFXA 2GKOA 3G2OA 1BE6A 3RS8A 2FQXA 4C03A 4CBVA 4D9BA 1EJ0A 2NZJA 4OP1A 3ZH2A 1WQ1R 2VPWA 3WHLA 3TLMA 1V16A 1NQAO 3GJ5A 3ODGA 2GAFA 3MS7A 4C88A 4RY8A 4B3CA 2Z0MA 5H80A 2CVPA 2F8MA 1ZK3A 3SBOA 1DAIA 3B5JA 1N6NA 2R1VB 4DR7B 1NBIA 1P2TA 2J4CA 3RSCA 1W5BA 4CLHA 4ER5A 4GRIA 3PB3A 1QPBA 1GZ6A 2JH8A 3SICE 4MLZA 1G9XA 3TOZA 3ETEA 1TKAA 2PKYX 1MX5A 5K51A 3V8MA 4JBLA 1LPMA 1DKNA 2FFHA 4XQEA 3ZH9B 4ZZ1A 2C7GA 1ZGBA 1EXWA 2HK9A 4HWGA 1A5SB 4Y2RA 1CF4A 5HILA 4GM0A 4YXWD 2JVJA 3NTXA 2B34A 5G1PA 2C4UA 1EJ6A 3U3XA 2Q50A 1CQIB 2HHHB 3TN7A 5CITA 3D6MA 4TRJA 2PO5A 2IYFA 2ZUEA 3WLIA 2VYVA 4NU5A 1FCJA 3AB3A 5M04A 3PGLA 3OF5A 3REGA 1OBHA 3WKBA 3F3MA 4KPFC 2P78A 3JWIA 2PRYA 3FAZA 1N7HA 3CX7A 3DV0A 1IXKA 1SUWA 3I6ZA 3ID6C 1M2OB 4FD2A 4A9AA 4Z5XA 1K0UA 2GASA 5JR3A 1Z3IX 4QKQA 2XRZA 1EDBA 1NVXQ 4ZMBA 1J1UA 2P68A 4IUCS 4X7RA 1PZEA 1BU8A 4PFJA 4TL6A 4WNCA 4PWZA 2C57A 3E9ZA 3H9EO 4ZTZB 3BJRA 2IZ6A 4ITUA 2G07A 5F1OA 3UATA 1DIAA 3EUEA 4D1YA 5DGHA 1H94A 1O03A 4XJSA 3KQMA 5F1KA 1F7UA 3GPCA 2EFJA 3AI7A 2O8CA 3A4NA 3BIWA 4QDKA 3G9UA 2IYLD 4FCVA 1G8GA 1CDOA 1G8KA 2K5UA 2XHZA 3GAAA 4GMDA 1OLSA 5EE0A 5C34B 3RJ5A 1OAAA 1W2GA 3CLHA 4PU0A 3B6JA 4WI1A 5I51A 1PWXA 1NU6A 2PFSA 1EFAA 5ESWA 1TM2A 4OIMA 3H6GA 1IONA 4ZYVA 3AL0C 5JZOA 2R6JA 5CT4A 2Q5LA 4UMVA 1EGVB 2PT5A 3E1SA 1Q19A 4JT2A 1C1DA 2ORYA 4UD2A 4UBIA 3RFUA 3U44A 5F98A 3GLFA 4NP6A 4YAKA 5ULLA 2JD2A 2QAIA 4FFVA 4DDUA 2DBVO 4AAYA 1E69A 4MR9A 2XXAA 2N3ZA 1W19A 4ESHA 5I7UA 1DEXA 1Q74A 1YDFA 1JQDA 1P77A 1BWRA 2CF5A 2F2TA 2P0YA 2PH5A 2WHXA 3I9OA 5CA1A 1SCNE 4C6SA 1W9MA 3VAAA 4HDSB 2YY6A 1FXSA 3AVWA 3RYFB 4BO8A 4Q47A 4Q9JA 4E2YA 1NJSA 1D6SA 4NKRA 4U3JA 3KUCA 2VTVA 1TECE 1N2JA 2WJ6A 4FDUA 4IW3B 1HLFA 4L4UA 5E4YA 2GEUA 2KJQA 4C30A 3U19A 1LLQA 2G1PA 1RWNA 1ZRSA 2NNLD 4FXPA 2G09A 2MINA 2UVDA 1T9CA 3JQ9A 4AZ0A 4LGVA 1Y8AA 4RFSA 3UT6A 1MN6A 4B48A 2M9MA 4DQKA 1KI2A 2XA2A 3HYTA 3H17A 1SVSA 2QJWA 3WGKA 3K1YA 5IBQA 2ODEA 3OCUA 4HB4A 4NE9A 3VDNB 1YT5A 2VRCD 1PFKA 4QTXA 4TKVB 2G4LA 5BT9A 3ZGXA 2HMSA 1C9YA 2CW5A 1KI3A 3DDCA 2GWRA 3CG4A 4R0NA 3UB4A 1OFGA 2ANCA 5DU2A 3AILA 3F90A 1LF0A 1MJFA 1CZRA 1GNRA 1UKBA 2Q29A 4IDBA 4QVIA 2V74B 1SB9A 2WFZA 3LHIA 2FF5A 4G0WA 1ZZEA 4OFWA 4NI5A 2YASA 4DBLE 1FS4A 4R5HA 4ZZ0A 4HAXA 3L1HA 2QP3A 4HP8A 2GDZA 4OMUA 4RPIA 1QYXA 3NVKI 5CM2Z 3L5OA 2XITA 2XHEA 1I7NA 4WNIA 5FDFA 4H3KB 5T4BA 1GNTA 2A9RA 2RBGA 4L4ZA 5AKIA 5C7YA 1Y89A 4KO2S 4TSFA 1TK9A 2WKRA 3WK7A 4YDHB 1XKQA 4Q9KA 2VRNA 5FOQA 3N74A 1QQTA 2QRVA 1NP7A 3D02A 1VPWA 1D1PA 1WQ4A 1RCUA 2V1UA 3KEQA 1X80B 1NBHA 5FBHA 5PNTA 5TQ0A 3SYMA 3VPXA 3WRYC 3ZK8A 1JDSA 1YS6A 3T0GA 1W94A 3AWDA 3UCXA 1QE3A 3WDLA 1GT91 3TM4A 1T8TA 2IHJA 1V6SA 4IHJA 1Z6ZA 4DLSA 1WS6A 4FGWA 1FRNA 1SVWA 4HAVA 3SQXA 4DQLA 2QRQA 5A2GA 3Q10A 1IWOA 5FLEX 4WFIA 1OYYA 5GINE 5JNRA 3NHUA 4B3IA 1GRVA 1Y3IA 2WLTA 4AUKA 4BMNA 4Z4IA 1LNSA 3A4MA 1I36A 1PZHA 3E7FA 3UK0A 5CDTA 3QLTA 3FPKA 5FPYA 1XROA 1TZBA 4ER6A 1I4OA 2NXWA 5B12A 2X3YA 2IPXA 1I4DD 3NOXA 4KVFA 5ARCA 3V4LA 3WGYA 1EB8A 2C82A 3R3WA 3WLEA 5B5SA 3Q11A 4OPMA 4RA6A 2WZBA 1NYLA 3MJ4A 4P3OA 2WE8A 2JGKA 5GOTA 3M9LA 3RYTC 2KS6A 5AQEA 2PX8A 3L93A 3DCJA 1QYIA 3DZKA 3PDJA 5A03A 1ONPA 3D3QA 1N2IA 3TRDA 1I4WA 1E2EA 4WMLA 4MUAA 2QL9A 2YVAA 2H4XA 5IS2A 2VJOA 3X1KA 3D81A 2RGXA 2X0FA 3ZEIA 5LDDC 4ALKA 1NMYA 4EHAA 2Z5GA 3A25A 2WAXA 2GBIA 3AETB 2YXNA 3A31A 4S12A 3HBFA 3EVDA 1M1XB 1U7OA 2Y9MB 4IJWA 3TB6A 2R65A 3NJ4A 4QYTA 3E1GA 1TPZA 5AOCA 1IIBA 1V26A 1V0JA 2EP7A 2H2IA 3AVPA 2ZJ1A 3IPCA 1R9JA 3PFHA 1A7KA 3V8PA 2ODAA 1JFSA 1CC1S 2X5JO 1ZGJA 1L5OA 4CKXA 4W1QA 2R5FA 3D59A 5DSXA 3AFHA 5JVDB 4BGDA 2E82A 2Q9BA 3QJYA 1R27A 2HADA 3RS7A 3VU8A 5LMUB 1TYCA 4GD3Q 4R4JA 3S4YA 2MCFA 5KAPA 3QUSA 3BSWA 1CR4A 3QVJA 4CV1A 1F3OA 5BVGB 1P5FA 1JIUA 4LMPA 4GOJA 4GMGA 3EDYA 1L8OA 2UKDA 4ZI5A 5DLYA 4GKKB 1SC3A 4JBNA 5B37A 4KC0A 3MUOA 3COJA 4DFDA 4TVKA 1WU8A 3LUJA 5EHGA 4UVEA 1DU4A 4Y9SA 2JLUA 5KQPA 2JI6A 1X74A 4EYOA 1RKXA 3BPSA 3AINA 4V0RA 5DTRA 4DOMA 3TZKA 2CWDA 3QUAA 2FLKA 1T13A 2AN1A 3GLQA 1S2DA 3LCCA 4MWDA 4E1AA 4UHCA 1XZGA 2PWBA 4OXQA 2J31A 2KX7A 5LBIA 5TF4A 1YJAA 1KSJA 1BMFD 3BWEA 5KTTA 2P9ZA 4LZJA 4CIWA 2O8FA 3SHTA 2R3SA 1VYHA 3EVTA 4HTFA 3SBXA 4L5AA 1I32A 2ZXEA 2PMKA 5KJCA 2AEJA 1J56A 4TMXA 2Q3LA 5AWFC 3FRJA 3MLAA 2Z43A 1JAYA 2CLIB 4MV1A 4E07A 3HA5A 1NI3A 4NYMQ 1UDRA 4GLLA 3OIUA 1DV1A 1T9KA 2IH5A 1QMGA 5DN6A 1XE3A 1ZX1A 3L6EA 2HPAA 4NF2A 4EF6A 1A7UA 4FZRA 4JEUA 5KCMA 4EKGA 2QL6A 4JC0A 3ILVA 3FOFC 2PFGA 4TLEA 4C6TB 3R9XB 1KRXA 2X8AA 3R7BA 2WTUA 1PR9A 5LKRA 4DJAA 1OMOA 1P61B 2I8LA 2HPHA 2WF7A 3OEYA 4G2TA 4ZT4A 4F9GA 3VJRA 4HAOA 4I3HA 1VL5A 1DOZA 1V7QA 3GEMA 2H65A 5AJYA 1Y63A 4CF6A 3TVYA 3Q2IA 2CNWD 2JRCA 4WXMA 4CCYA 1Y3CE 2GJ9A 1XZCA 2W22A 4QGGA 1SULA 1SU8A 4BCCA 4QTYA 5KNCA 2C2ZA 1EBUA 3HMQA 3E22A 3JQ7B 4LV6A 3D6HA 2D0DA 1E77A 1M2OA 4FIDA 5KVAA 3KQVA 4QJ4A 3DC2A 1RRMA 5DYWA 5HIJA 4LJKA 2CNKA 1MG0A 4OXIA 4YUWA 1Q7EA 2AZ4A 2NUPB 3MWKA 3QKSB 2CJFA 4FILA 4XDZA 4WLUA 5BOVA 3SKYA 4EW3A 1Q1NA 1R74A 3MMNA 4KO8A 3ZWXA 5KSYA 4F6RA 2JJ2D 3NVAA 2VWGA 2BGKA 2E4XA 4PG7A 3LT2A 4IJ6A 3ZTYA 2G1UA 2VQDA 4LF4B 3JR7A 4ND1A 1LV8A 2J9YB 3GY0A 3MJRA 3WDKA 2C88A 1TVCA 3LCRA 4RIIA 1RPZA 3ZDAA 1BFKA 2GZRA 1YMUA 1FBNA 2PMFA 3VYVA 4BFZA 2GHQA 3D7NA 4YALA 4DW8A 3GLGB 3AOEA 1Y9DA 3N75A 4NFLA 2Y6UA 1SRRA 2P5UA 3WLHA 3TLXA 2ZE7A 5H59A 4LBZA 1ID1A 2XQVA 4FFBB 2H0RA 2F1OA 5AVWA 2F9LA 4PZCA 4WERA 1KMHB 4L0QA 2C84A 2IODA 4B3BA 1PBNA 4URFA 4UD6A 3A8TA 1GFWA 3DOHA 3ITKA 1GTSA 3RS0A 3NT5A 2XRMA 4JT9A 4BB6A 3DOOA 3K2EA 3EZLA 5DBFA 1PS8A 5IZCC 1K66A 1H3FA 1Z33A 2YIDA 3H6KA 1YB4A 4HQLA 3RYFA 4D56A 2XJ4A 2ECKA 5LUAA 1FDOA 1SIWA 5ICFA 1UZUA 3RUHA 2M1ZA 4HVAA 1IM2A 1WMBA 1IZ9A 1C14A 3I4LA 3FWYA 2FQWA 3VDXA 1N2SA 5I7OA 4FOPA 1UFVA 1X9HA 1E3JA 4IJVA 2OO7A 3EA5A 4FOOA 1CUEA 6Q21A 1GRNA 1PV4A 4QDXA 1FRZA 3NDIA 1N5LA 4HGRA 2F8LA 4X95A 4ID3A 5C5EA 1GTMA 3PCRB 3A9UA 3CLUC 4L51A 4KLCA 2GRUA 4K86A 3L40A 5A6SB 1EMDA 3NYWA 2FZVA 1VE9A 3B78A 2BFNA 4MJ3A 4BNVA 2B2XA 3IXLA 1ICIA 2AOXA 3DDZX 1NOIA 3V8EA 4G5HA 4P80A 3EVAA 4J4HA 4UFOA 3ZKWB 3QENA 4KUGA 2XR1A 1YNOA 2XF8A 3LMKA 1TJ3A 1W6RA 3SY8A 1EFUA 1XQ6A 4CTNA 5JCXA 3A9CA 2FFJA 2BGNA 3LPNA 3OQIA 1VIDA 1MFPA 2O7RA 2DUMA 5AKJA 3AHHA 5A06A 4HDMB 1OAKA 3CLKA 4M7PA 2VP0A 2OG2A 4I50B 2LR0A 3UMFA 3TUZC 1W0KA 2QX7A 3TLEA 3BA6A 4ALLA 3JYQA 3A9RA 4NH4A 1CCWA 5A6VA 1YB5A 3Q2KA 4QZVA 4N76A 4B71A 3BJZA 4U6QA 1KOFA 5DX1A 5ILGA 5H0IA 3AJAA 4C4SA 2HLDA 4CL8A 5BPHA 2B9EA 2OPBA 4K6OA 3NR2A 1T8RA 3PFFA 5A4KA 2GK3A 2ZSHA 4IDPA 5J4YA 4DLLA 5K99A 3AERB 4H7HA 1GU1A 4JYAB 5CNMA 4QUKA 1B0AA 1QX3A 2KMLA 1SKYE 2BHSA 4X1IA 3AHGA 1KAHA 1NQXA 1IMJA 3CN9A 1W48A 1ECPA 3R0JA 4LOAA 5AI6A 3S28A 4RMHA 5G4LA 3T35A 4LRUA 4CF4A 4XYLA 2IW3A 1UC5B 2VUSA 1Z6QA 1ESMA 2ZJ3A 2ZQZA 3NTLA 3NUGA 4B8WA 5JARA 1ORIA 2ZUCA 2AI1A 3ELWA 5M2QA 1TF2A 2AUTA 4B46A 3Q3EA 1WRBA 2I66A 1TGVA 2KQUA 4U5XA 1TX4B 2XDQB 2G9VA 2QJOA 2NVOA 4R1OA 2OV6A 4XCVA 4D96A 3ITDA 2VFAA 3MS2A 5LXTA 2YX1A 3ZVMA 4LVNA 5K6AA 1UFOA 3U7GA 4IUBS 2QT1A 1NI4B 5FHRA 1QZ3A 2AR0A 1DEOA 4YPVA 5TMEA 3WIEA 4OHKA 5KYYA 1S3SA 3EIXA 3H4VA 2WZDA 1WUIS 3PC2A 3TE6A 1O0CA 1KIFA 3GHYA 4AKEA 3K8YA 1B93A 5G3ZA 4EA6A 2VDRB 4MULA 1W7AA 3R75A 1IDN1 2R6CA 3MGGA 3AVQA 1QX4A 9ATCA 1H0KA 1VRCA 4LWZA 1FFGA 2EP8A 3DVSX 2JBHA 1DADA 1SQ5A 2VUHB 2Z98A 2ZDQA 3H5RA 4I5EA 2OGUA 4ZJPA 2CSXA 1NE2A 1Y6QA 3ANYB 2E5LB 1EZ1A 4RE6A 1RBQA 3H5LA 1HEIA 4QQKA 2C5AA 1O7JA 3E9NA 3ZIAA 1XTJA 3QLVA 4RHUA 2KPOA 1JKJB 5F2EA 2BEWA 2J9XB 3EA0A 4RIHA 3RB8A 1J9EA 4WN3A 1FRVA 1OU4A 3SM3A 4PAWA 3DOJA 3C3BA 3OLYA 4ZOLF 1A50B 3K9LA 3PSHA 4RZIA 2H4ZA 4DMFA 2P0EA 2OZLB 4Y1RB 3MRVA 1I24A 1I7LA 5FXMA 4FJ0A 3TJRA 1HQYE 4OA5A 2DHEA 3T1NA 2EW8A 3P8ZA 5L3ZA 3UF0A 3ZVNA 4YI5A 4HRVA 1EUCA 1XXLA 4E03A 1H6AA 4HN2A 1KK1A 5C4IA 3CGGA 3PNKA 2WF9A 1GT6A 2OUKA 2BMDA 2WJWA 2EZ4A 3LZDA 3L7MA 4YONB 4KXMA 2WHQA 3EPLA 2BLLA 2FLWA 2PSHA 3IUMA 4LYDA 3STYA 4YJ2F 1DE0A 3OEHD 4O1MA 4P82A 4ESOA 6ADHA 1O94C 2MSWA 3K5PA 1JDZA 5TT1A 4N0MA 4G4JA 3VKVA 5A3JA 5J23A 3FTEA 4XXHA 2OYRA 1X1SA 3MQ4A 3FY4A 3PUZA 5FADA 3TSWA 4YYEA 2R4TA 4EG1A 1N3BA 3CONA 5EYPB 3UJ3X 1B3BA 3GP3A 1DC7A 2QR3A 3KETA 1ZLXA 4ZYZA 4R7GA 4C76A 1LLDA 1JJVA 2WUGA 2RI6A 4U7TB 3QU5A 2VYCA 5EPEA 3MCTA 3O4GA 2HPZA 3KK0A 4EW2A 4ENRA 3UKOA 1GM5A 4M98A 4XFKA 1I51A 3DDOA 1PG0A 4JI5B 3KD3A 5FL7A 3F3YA 5GP1A 1G42A 1Q5PA 1Y9AA 1CRWG 3HXLA 6REQB 3EIHA 3EHDA 3IPYA 3GNSA 4JWTA 4BNGA 4FEGA 2QN7A 4EL5A 1TJPB 3UZUA 1KQNA 4RTKA 5K3DA 3IAM6 4ALNA 4ZKEA 5L6LB 1F8GA 2RONA 3KYIB 2XTJA 1U8ZA 1KZ6A 1IN7A 1QLWA 2NU6A 3GN1A 4G1VA 4PYOA 2W2KB 3JX9A 1KOJA 2C4MA 3HJRA 1ZGHA 1O96B 3CR7A 3NGXA 4LG1A 5I3CA 1AS2A 2JFGA 3DZFA 1ZJ5A 3NUZA 3AJEA 1L1EA 1M72A 4X0EA 5THQA 1CQJA 1ILWA 2AJCA 5DOVA 3HJNA 3UMBA 3GEPA 2JAWA 1IJBA 3KJXA 2B21A 1Z3CA 1C1XA 4MEBA 4N5LA 5FL3A 3L7IA 4UBNA 4QXOA 1FVHA 3TPCA 1Z5UA 2UZIR 4NE7A 1M54A 3OU7A 4M87A 1IM5A 1TMGE 1K63A 2AFHA 3GG9A 2QS9A 1Y5NA 1C41A 5G1OA 4AUNA 4PV7A 4YFYA 3Q7EA 4BN0A 4Z4HA 2OC9A 4MW6A 2JZNA 3QKSA 1EWKA 2G9RA 3AJ9A 1Q0RA 4RESA 1PJ8A 1FYDA 3AL2A 2ORIA 2AWOA 2A5FA 2CXHA 3LBFA 3R5SA 4P93A 2PR2A 1Z39A 1R0SA 3MWDA 1K5DA 2EW1A 1M76A 2DX7A 3E23A 3S8MA 1DQPA 1XXHA 2SBTA 1PI3A 1WXGA 2EERA 3NBAA 4OAPA 4QPCA 4XDHA 4R9NA 4D9HA 2XUAA 2FETA 3HYRA 4GECA 4HWKA 4Q1AA 4YRIA 5I8ZA 1OWLA 2OZEA 2HA5A 4L8LA 1AN0A 4KZKA 4K88A 4OM7A 2V9CA 3AV0B 3PGMA 1M75A 5FOXA 2QKYA 4HLUA 1VE6A 3R0VA 1N5OX 5AUPB 2Y93A 4H2DA 4UDOA 3WLTA 4XYGA 2FCRA 4LV8B 5BNZA 4IDNA 1OGYA 1DG3A 4LK2A 4M0MA 3MA0A 1GO2A 1JHUA 5A05A 1DJQA 3DP9A 4OJYA 3GGCA 1FK8A 3JPYA 1A96A 3BTOA 4S2EA 5BV0A 2BFCA 5F9FA 1O5TA 2GJSA 4WLNA 1CY0A 4LX0A 4US2R 3EH1A 1J8FA 4ED9A 3ROZA 3H11B 1E9FA 2DECA 4TXNA 1J24A 1D9XA 3CTPA 4YC7A 4L2IA 3EVZA 3EXIA 3RUEA 3ZGOA 1V25A 1YE5A 4PANA 3ILYA 1CVIA 3QMMA 5E4JA 1ZHFA 3N07A 4I4TB 2W2LA 3MFYA 3DQPA 4D8WA 3IRVA 3BGSA 3QSYA 1KVSA 1XPOA 5DXAA 1WZEA 3HCCA 3X43A 2FW9A 13PKA 5D8DA 5IAJA 2Z2JA 2XQFA 2BTQA 1C3XA 3TI7A 2K87A 4RA9B 5AHOA 2JZOA 3UK6A 3MRTA 3DMGA 3EVCA 2WJGA 4KQWA 1CBUA 2ZRFA 3HGMA 5FUBA 4YWHA 1AQ6A 2EV9A 5E38A 2IPOA 1E1MA 3DL2A 3IO5A 3Q98A 3IE2A 4QBIA 4U0KA 3KYCB 4A10A 1RWOA 1PLJA 3PUHA 5GGXA 3QFRA 3IELA 3FIUA 1PO7A 4FN5A 4YT5A 4YREA 4BQQA 3ZQUA 1UUFA 1J8DA 3AR7A 3NDPA 1I5EA 1GV0A 1ISJA 1XMIA 1M34A 1YWGO 4UNNA 4XUEA 1VE5A 3NBXX 4A6DA 2IPNA 3Q0TA 4FLEA 4MGIR 4RXMA 3W3AD 5BOSB 5LMZA 1Y1LA 3W8EA 3O9MA 2XMBA 3IMCA 3OT1A 4I50A 2FSGA 4JHLA 5DF1A 3WKAA 4AMVA 2JW5A 1E99A 8OHMA 3GK3A 5C0OE 2BKUA 3LNCA 2PNFA 4DMCA 3IULA 3SZRA 2EQ5A 3EZFA 1WB6A 5DISB 1TIPA 3BXGA 3I5UA 1RXSA 1EDEA 2FPLA 4Y9DA 2CJPA 2GHRA 1YHYA 4S1NA 3UBMA 2FPMA 4TTIA 4EPXA 1JAZA 1SY7A 1GG8A 3EXG2 5KYKA 3EZ6A 3I0ZA 4J0EA 2DFLA 4GBMA 1K2VN 3V32A 1FTNA 3OIVA 4DUPA 4DJEC 1PFVA 2ZSKA 2X2PA 2XQGA 4OP3A 1G2PA 1PFUA 4V3BA 4Z2AA 5C46F 1WVMA 5AH0A 4PIMA 2DHCA 4QM6A 2H7XA 4FX2A 1AKEA 3E05A 5IUJC 4W5WA 5LR6A 4EO7A 4BEVA 1YZ3A 5EHNA 3HVKA 1AGYA 1JECA 3ML1A 3W7AA 4A0QA 4BZPA 1KOGA 1ES9A 3X1JA 2FUG1 2HRCA 2HIGA 2KLHA 3QLUC 1TAHA 2G5PA 4M1TA 3WNBA 2LXNA 1K27A 1BA3A 3FVVA 5IDYA 4W5OA 2ATXA 1UKCA 3CXUA 1JU9A 4BPRA 3PUIA 5GJWC 2J0SA 4P5EA 3OU6A 4UEWA 5CMLA 4I66A 1GGNA 1E5XA 3P9CA 4R7TA 1HQDA 4IZIA 2G76A 2QV7A 3RUAA 4Z1OA 1P31A 4ZYTA 2ZULA 5J9FA 2OD7A 2WEKA 1L4LA 4Q3CA 1EWTA 1LJ8A 2IT1A 3EEFA 3HJBA 3M4XA