1FLAA

Clostridium beijerinckii flavodoxin mutant: g57d reduced
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
b'MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMDDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1flaA00
4HS4A 4ZVKA 5ULLA 1FLDA 3NHUA 3NHKA 1CZHA 5LVAA 4XDHA 5F12A 1AKVA 4DIKA 1XI2A 5FUQA 3HLYA 1YKGA 1AKTA 1J8QA 2AMJA 2ARKA 5TGZA 5LBTA 3F6RA 1RLIA 4HEQA 2V9CA 3U7IA 3RPEA 3ZHOA 1YCFA 2X2OA 4FGJA 2OYSA 2BF4A 3OVMA 4C0WA 2FCRA 3OX2A 2M6RA 4S24A 3F90A 3NHLA 3EYWA 3N3AC 3GAMA 3OJXA 1JA0A 2D5IA 4LAFA 5EAIA 1ZWLA 2BZSA 1FLVA 4NULA 1OBVA 1I1OA 4GI5A 4H6PA 2GSWA 2HPVA 1GG5A 3F2VA 2F1OA 1DXQA 3FJOA 1XYVA 4M0CA 4PU0A 4C76A 2A5LA 2Q62A 1DX9A 4C0XA 2FOXA 3U7RA 1YRHA 3W78A 4QOHA 1AZLA 2FDXA 1B1CA 3HA2A 4QOFA 1T0IA 1AKWA 2FZ5A 5LJIA 4LTMA 3B6JA 3OWXA 1FUEA 2HNAA 4J8PA 3OX3A 1SG0A 3P0RA 1TLLA 4YAWA 1FLAA 2QWXA 3NHFA 1AKUA 1QHEA 4PTYA 4LA4A 1CZOA 3KEGA 4ZVMA 3F6SA 2QX8A 2XODA 3GFQA 3B6KA 4R81A 2V5UA 1CZNA 1YOBA 2OHIA 3W77A 4QOIA 3NHWA 1D03A 1D4AA 1RTTA 1XT6A 3NHPA 3JSXA 1QR2A 3ES9A 2Q9UA 3KLBA 4YQEA 2MWMA 1AKRA 5LLDA 1F4PA 3NHSA 2RG1A 1KBOA 4U7GA 4Y9UA 2QX4A 1WSBA 5EA2A 2FZVA 1C7FA 1FTGA 5F4BA 5B3KA 5F51A 1YCGA 3FNIA 4F8YA 1VMEA 1CZRA 5LJLA 2N1MA 3OX1A 2QMYA 1BU5A 4CETA 3TZBA 3N3BC 4N65A 1BVYF 5BUCA 1FVXA 1D04A 2R97A 2B3DA 5JROA 1C7EA 1KBQA 3W79A 2ZKIA 3EDOA 3LCMA 1YDGA 3KAQA 4YAOA 3L9XA 1ZWKA 3O73A 5FX2A 4YAUA 1T5BA 1AG9A 5LMCA 4ZVLA 4H2DA 1H69A 3NHJA 4PTZA 3B6IA 4NLLA 4BMOB 1CZKA 3L9WA 4QOJA 4Y7CA 3N39C 5B3LA 1AHNA 2QX9A 1E5DA 2OHJA 4YALA 2FX2A 3TEMA 4FGKA 4FX2A 1AMOA 2Z98A 2XOEA 1FLNA 3ESYA 1QRDA 3FX2A 3GFRA 1DXOA 1CZUA 2WC1A 4QOEA 3G5MA 1NNI1 1RCFA 3OWHA 4CF6A 4D02A 2KLBA 3FW1A 3NHRA 2FAXA 3ESZA 4QODA 4ICIA 1OBOA 4FGLA 3O2NA 1FX1A 3ESXA 2BN4A 2W5UA 3K20A 1WSWA 1J9EA 3QFRA 2Z9BA 3HR4A 3TE7A 3GFSA 4DILA 3K1YA 1SQSA 5LBUA 3OJWA 2M6SA 2MTBA 1YCHA 3R6WA 1QBGA 2X2PA 4ZVNA 2FVXA 2QMZA 2BPOA 4XDGA 3W7AA 4OXXA 4QOGA 3QE2A 5FA6A 2R96A 3UXEA 4DY4A 1V4BA 2MOKA 1H66A 1TIKA 5EMNA 5NULA 4LTDA 2FLVA 2OHHA 3LT5A 3NFRA 4ESEA 3S2YA 4C14A 2MT9A 1J9ZA 4N9QA 4GQIA 4U7HA 1CZLA 3SVLA 2QX6A 2KQUA 4LTNA 3UXHA 3KAPA 1ZX1A 3B6MA 4BMPB 1JA1A 4U7FA 2V5VA 2Z9CA 1OFVA 6NULA 2BMVA 2QR2A 4N82A 1XYYA 3NHYA 5A4KA 3FVWA 2HNBA 1RLJA 4Y9RA 3D7NA 1AKQA 2Z9DA 4YAFA 3NLLA 3QFCA 4GR9A 5NLLA 1X77A 1J9GA
chains in the Genus database with same CATH superfamily
1RLTA 2XMQA 5CFPA 4LXQA 2C5BA 2IFTA 3T5TA 2QEQA 2FOIA 1JEJA 2YWDA 3ZI7A 5HYVA 1B6GA 3T1YB 3OZCA 4INAA 4PONA 3QSYA 1PNVA 1DBVO 3K4QA 4KBGA 4PANA 4U7WA 2HCTA 1P33A 2BFPA 3K0AA 4JLJA 3FYHA 1BS2A 1GR0A 4GRAA 3Q9UA 4ARUA 4RKEA 3CW8X 4K87A 1BXRB 3U7QA 3VVCA 5I4KA 3SQNA 2BGLA 5BXQC 3DYVA 4I5FA 3ZDDA 4WDQA 4EW1A 1P44A 5JADA 3T7SA 3KZ1E 4UDXX 3THRA 3RVKA 4QTUB 4TYMA 5C8YA 4IOMA 3BTUA 1K4MA 2IP4A 1KYZA 1LUAA 1ZOOA 3ZZUA 3WGKA 1ZGJA 4FWTA 3MM4A 3PDUA 4JB8A 3FYDA 3ZWYA 4PIMA 3DKKA 3RPEA 4B3FX 2ZRCA 5FWYB 2NXCA 3TLGB 5KOIA 1TEHA 2B3TA 4QYXA 4XX1A 1SEPA 2GN1A 2FMXA 2H5EA 3D2AA 4BGUA 1DAHA 1W1WA 3FTFA 1Z34A 2FPSA 4UU7A 4ZC8A 1MQSA 2X4GA 4UVIA 4HDRB 2GS9A 5G02A 5TQ0B 5HVNA 2HV9A 3IAM6 3SJ7A 2XADA 4G4SO 1HMYA 4DDVA 1HE3A 3MTBA 2ZK7A 5KYYB 3EFOA 4EKDA 4UPDA 1G20E 3JQBC 3ZVKA 1E1NA 4WK4B 1E4YA 1N0VC 4H6XA 5LBIA 2QR3A 5JXWA 3VDMA 4KIWA 4BNJA 1YF3A 1E9RA 3DR5A 3FLEA 1Y5MA 2I0FA 2QXTA 5KYKA 2ACKA 5AM4A 4WJKB 3UWDA 3V3TA 2ZIEA 2IPNA 1QGUA 2C07A 4EJMA 1QHHB 1MDFA 4EFKA 2PMKA 4LKRA 3SDBA 2BHLA 1E2NA 3B1FA 4YTEA 1YB5A 3CE6A 1IQ0A 3AJEA 4L5BA 4B7UA 4IBOA 2HRCA 3L4JA 3TX2A 3ESRA 1KMNA 2GSWA 2WHQA 3JQFC 4N5IX 2IDKA 3WJAA 3KK0A 1Z5GA 1KQPA 2BGJA 3BRCA 3FWKA 4GG1A 2C2GA 4HUJA 4Y2UA 3PDCA 4YP1A 3T3EA 4MW9A 3QY9A 2WA2A 1FYFA 3L6RA 4IEIA 2QLLA 3CC8A 9MHTA 1T9AA 3FJOA 3MCZA 2DFVA 3DE3X 4OMFG 4Q1CA 1U3UA 1NXQA 1NYRA 4C7OA 3T94A 1DE0A 2NVUA 2F7SA 2QRZA 2PD3A 3W2HA 4L9SA 4TV8B 2R8OA 5CD1A 4WDRA 1E7WA 1HE8B 2WIGA 2PBRA 1Z16A 2I1LA 1TCAA 3A9TA 3SM9A 4A6EA 5DTIA 2O8NA 2SHKA 4LHSA 5IXJA 2P9JA 3CU5A 3R75A 2ODWA 3AKDA 3GJTA 1AZLA 4QOHA 4TPKA 4KGZA 5A03A 4L8GA 3X1MA 4J9VA 3V7YA 2RH5A 3DTNA 2J9YB 1TEZA 3KPVA 1H5NA 1T6ZA 3TAUA 2B4AA 3L0OA 1OMOA 4HN9A 1T0IA 3A8TA 4MCJA 4QOFA 3SXUB 3S2ZA 2GZ2A 3CEJA 3FTPA 4M0MA 3V9AA 4QJIA 1SBYA 1PR2A 1OWLA 2NT3A 3FCXA 3M9LA 3OWXA 1OJ7A 3MGKA 4JGGA 1E89A 3OIVA 3S70A 3I32A 2W43A 2ZIUB 4IRXA 3W6UA 1M5UA 2ONKA 3WKCA 2AKAB 3F9CA 3TO5A 4AO8A 3PUJA 4EY6A 4ZOAA 3H5TA 3HXOA 1E69A 4M38A 1C7ZA 5KQMA 5CPFA 5K0CA 3HR7A 3SC4A 2PWAA 3TD2A 4DEYA 5DXFA 2XB2A 1SC9A 3OP1A 1Q7EA 1U9ZA 3ETDA 3FIJA 5ICSA 3JPWA 5DNEA 1I6MA 5T6MA 4CLXA 1SEVA 5T5QA 4HDQB 3VV3A 2GTIA 1LNZA 1ZQ9A 4L4ZA 2OORC 4XDYA 1P2VA 2ZU6A 4G1BA 2P11A 4PO9A 2QRVB 2G1JA 1GZ4A 1IY0A 1YCDA 3S2SA 1YB2A 4Q4DA 3MW8A 3B6KA 1AK9A 3NORA 4LXIA 4N41A 2EZ8A 1C2YA 2DJ5A 2FPRA 3O7MA 1CJVC 3IEXA 4JFAA 4YJDA 4G1MB 1TTTA 2AEJA 2NZXA 2Y05A 3DDUA 3G0BA 1GKYA 4AMGA 1OROA 1KSGA 1G1MA 4RTOA 1UEJA 5SZIA 3L0YA 3ZJ5A 4PC7A 4N7BA 4E7OA 1O6CA 1AKMA 1QQ6A 2H5IA 4P0TA 5DM2A 3VC1A 4BVJA 2F8TA 5JBIA 2Z09A 9LDBA 4UDOA 4O1MA 1F4VA 1QUEA 5F2KA 2RH4A 2WP8J 1YOVB 4BVFA 1OXUA 4B71A 4YAJA 2FSPA 4NPHA 2WEKA 5E6RB 5ALZA 2C7OA 4GPD1 1RMQA 2MJLA 1F4PA 4FZVA 2RG1A 3KG2A 1P6UA 3RVQA 2WQZA 3VR4H 3WFIA 1MAAA 4ES6A 1R8QA 4F60A 2IVZA 5EEHA 3OTOB 4E0BA 2GJ8A 2YIVX 5LL6P 4HTFA 4YC7A 4KAJA 3K9GA 3M6FA 2WAOA 3CTPA 3QMVA 4PZDA 5DCWA 2XMBA 2W42A 4QAJA 4Q6BA 4E1VA 5KI6A 2UYYA 3GVHA 3RAFC 4NOLA 1E7SA 4F8YA 2XR1A 5BYAA 2IZ6A 2FK7A 2ZCUA 2B99A 3K94A 4CKWB 1IXRC 3SX4A 2B83A 4B9AA 4RVNA 4ITUA 2VA9A 4YJFB 4HNUA 5HXAA 4F3CA 2PUWA 5E2BA 4P35A 5IC6A 3RYHB 3EZ2A 1D2RA 4A7PA 3LHDA 1B8UA 1Q15A 4AU1A 4PYKA 4C30A 4UXIA 1BO6A 3KPYA 2N1MA 4P7JA 4DUPA 3PC3A 2WFLB 3M1AA 4D5EA 4FD3A 1A7AA 4ARIA 1CRLA 4R41A 5AW6A 2D2VA 3QX7A 2AMLA 3JAMA 3R7WA 2F55A 4Q7JB 3C3BA 1CU1A 1FVXA 1V6SA 2ZRKA 1RR6A 1M72A 4OQ4A 5IKEA 5ECWA 3WLAA 1OA1A 2QRUA 1ECCA 5FQOA 4L0CA 4MWTA 4XSHA 1C5KA 1I2DA 1X9IA 1TYAE 2GKSA 3F5SA 4Z49A 1KQOA 3DUFA 1RKUA 5LQNA 3SYRA 1FJGB 1PZFA 4CLDA 4YFVA 4QOSA 1ISSA 3GELA 1V4NA 3NHZA 1U5BA 2RBKA 3R09A 3P9XA 2AFIE 2G71A 5EKUA 1BJRE 3CVVA 6ADHA 3VXKA 2AJLI 1IQRA 1BIFA 4MHTA 4KXVA 5CVEA 2A6PA 4DLXA 3F96A 2X2FA 1ZINA 3P9ZA 1ZW1A 2C29D 1PSZA 3G2NA 4RPGA 4ETNA 3PQ6A 1CYDA 3LG2A 5EP2A 3DCIA 5FF9A 2P30A 1BWSA 1E1QA 2O7VA 1F14A 1M8JA 1Y81A 5E2IA 2WUVA 1U1DA 1ZOPA 3AC0A 2YMQA 3P94A 1ATIA 4J7XA 4FFPA 4ND5A 1N2CE 2IZZA 1C1XA 1YR7A 1U8ZA 2OESA 3BXFA 1SCKA 4DGQA 1JR6A 5HILA 2DQZA 2CBXA 3DC2A 2LDXA 4PLPA 1QYDA 3HDQA 3N86A 1IIBA 1H8HA 3UM9A 2HCJB 1QHGA 1FRQA 2ZYAA 3KTFA 2VNKA 4YQZA 4WUVA 2Q3HA 3KWMA 2HRZA 3AKCA 3I3OA 5HQJA 4Q0MA 3FWYA 3H97A 4EITA 1SVSA 3I01A 3O74A 4JOCA 3MSCA 1E8NA 5CNMA 4YRQA 2Q5CA 3DHNA 5DYTA 5DHUA 4TZ6A 2P0AA 1CJUC 4MB6A 4EGSA 2FF5A 1QF7A 1CDEA 4JK3A 4ETWA 3VNUA 1NYTA 3DE6X 5GAJA 2XEXA 3VM6A 1A5TA 4KPYA 1SKAA 1Z5OA 3DEAA 1JB1A 1P3DA 4MKGA 4EY8A 3RT1A 3UFXB 2PLRA 3PBKA 3BD8A 4PNPA 4EW3A 3E3AA 1NMEA 1VIVA 1VLQA 3LQ4A 1AMOA 2IHKA 2LZ0A 1CP3A 1THTA 1Z3CA 2OPHA 1L7AA 2YOHA 3OUZA 5A06A 4MGYR 2GCPA 3ESYA 3NQ41 1QRDA 2C3PA 3B12A 3IAEA 3LXXA 3RSHA 3RV3A 2CYCA 3ACBA 1Z36A 5DK6A 1VJ1A 2PGAA 5DV9A 4D9GA 1GP2A 4TKUA 2VYND 4QT0A 1I10A 3LHIA 4AS2A 3NUZA 1UIRA 4MV9A 1FSZA 4DCUA 4EYQA 2NZUG 4F2DA 5JJ5A 2AVDA 2X5NA 1IM5A 4L6AA 1XWIA 5CEJA 4IFBA 1Y5RA 2WFMA 4L02A 3TGPA 1R0SA 4ZEMA 1OBCA 3LL7A 4DCOA 2CLFB 4CF4A 1XQ9A 4FFBA 1XZLA 1NP3A 2IYRA 4U9HS 1KZ9A 5HEKA 2Y1XA 4QTZA 2ZYRA 3NBMA 3VO8A 1IVYA 1D1QA 4KVGA 3KHTA 4AKTA 1V7QA 3T3NA 1KERA 5IAEA 3L06A 4B1FA 4DVGA 4K26A 4ROTA 1XZHA 1XELA 1OBOA 1P6XA 3O3OB 3OF2A 4B87A 2GN0A 2SKEA 2X5XA 5HZGA 1KYIA 2PKEA 3ZWDA 4CDMA 1J1UA 4RWZA 1U7WA 1NT2A 1C9EA 1QGOA 5JR3A 4NFYA 4QBKA 3AR5A 5C8XA 1KDZA 1E6MA 3DOUA 4U9UA 4F1JA 4FMCB 3THYB 3BE4A 2PV7A 4OMUA 1DBIA 2QAGB 3IP1A 2ZE7A 1P7WA 4O4JA 4AP9A 5C37A 1YFKA 3EZNA 1JR2A 1UC9A 3V00A 3V55A 2AF3C 3BL8A 4ADSG 3HR4A 2YWHA 1F9AA 4MROA 1JXAA 2QRPA 3GFSA 5DLPA 1UK7A 3AJDA 2VP4A 2HIHA 3PI6A 5CP8A 1UZLA 2FFAA 5FL3A 4NV3A 4S1OA 1R4MA 4CN8A 3ADKA 4C01A 3ND8A 1FTNA 5IBRA 4CQMA 2NU6B 5HHTA 4KQFA 1E6KA 4MWOA 5E3IA 3ZXXA 1ZI8A 1CUSA 1E61A 4C08A 2EFJA 3TLXA 3IQXA 4Q01A 4Q9DA 3QYAA 4GF5A 3KQYA 1ICEA 2DKFA 1KP2A 2YMPA 3HUDA 3IVGA 3N8KA 4PAGA 3SJAA 4CW7A 4XE5A 4BB0A 2WWIA 5CG1A 3DJFA 2DTDA 2HSZA 4K0KB 4B5LA 1L4GA 3LY8A 1DGQA 4RQUA 3PFFA 4XUDA 5AVSA 5FTWA 1ORTA 3GEMA 1AGRA 3O4GA 5GY7A 1LPNA 3GD5A 4J6FA 1XD2B 3EBPA 3IEIA 1KZ7B 2QW8A 3GWZA 2L19A 4NMHA 4CT0A 2AZXA 4EG1A 4X1YB 1NBOA 3SEAA 4YRKA 5JAMA 2PWBA 1M0EA 3DMNA 2X9LA 4DR1B 1XVUA 4FXPA 2VJKA 1DKPA 5L9AA 3W1WA 2QGZA 3F9RA 5KDDA 3HDYA 3JQ8B 4YPOA 1N5KA 1TYBE 2YXEA 3H87A 2VT3A 5GM2A 2UDPA 3RYFA 5BSHA 5FI3A 1K5DA 2RHJA 2WKPA 4XYEA 2EAUA 5FNVA 3T99A 5GZ1A 4FFWA 3U3DA 4TS1A 4LWPA 4WD3A 3O8OB 4UAVA 2XUZA 3WL3A 3F5FA 5CXUA 2RGGA 2IH4A 4JP2A 4LGVA 3BXHA 1B8PA 3IDAA 5EE3A 4M1ZA 1KWGA 1AUPA 1E1MA 1HLFA 5ALTA 4HH3C 1PDWA 4DLAA 4TLCA 3R9KA 1MW8X 2X40A 2FJUA 4RMIA 4BX8A 1JECA 1TCUA 3F8SA 3I5YA 1UBKS 4UULA 1JFSA 2PTHA 1VTKA 4X8LA 3TIFA 3UJCA 3FBTA 5CJ2A 3S0JA 5CDFA 1KYTA 1QDEA 1XTSA 3OOYA 4R9RA 2EP7A 2CLDX 4JOSA 1JA1A 4JIGA 4U7FA 5TARA 5JXIA 3U7GA 2XDQA 1L4NA 2NSJA 3EXFA 4HLUC 5I7EA 1Y1SA 3KVOA 1Q0RA 1E5TA 1YR2A 2WD7A 3T1TA 2GPNA 2EU8A 2F59A 2PWYA 4NU5A 1ZHOA 3F49S 4HVAA 2PBFA 1N8NA 2BI7A 2QTVA 4G2TA 2PKRA 1IAQA 2WDPA 1U7UA 1D6SA 1R6DA 2VPTA 4M49A 1DWUA 3E0QA 1YVPA 3QVTA 4UM8B 3KZMA 1YD7A 1H23A 1K7EB 1KR5A 1JTEA 1Z2DA 3IE0A 4Z8XA 4DDWA 2J9FA 5FL7A 4KH1A 1PV2A 5I45A 1U4SA 1Z6TA 1NMYA 1LLDA 1EQ2A 2HMUA 3GGSA 5CVTA 5EIEA 5CX1A 4N5NA 4DLBA 1LQ2A 3I9JA 2A1UB 3GIWA 3V4PB 2P9YA 2R5WA 4NYIQ 2H2GA 5T8KA 4BUCA 3FRJA 1AHPA 2FRDC 1TI7A 3WKBA 2IOFA 5JNTA 4MV3A 1XQVA 2QG4A 4UHHA 2C4NA 3NOOA 4CCYB 1PUXA 1C4OA 4NQRA 3UTCA 3L0DA 3PSAA 4K7JA 4DNXA 4ETMA 4XWGA 4HFMA 3RJ9A 2JDIA 4W7HA 1XA4A 3DLAA 3K53A 3WLNA 4C89A 1YRLA 1CDDA 2CT8A 1P7PA 1XJWA 1J1IA 3PIIA 2ZYIA 4QO7A 3T9FA 3RBAA 4M36A 2V65A 1V3QE 5CBKA 4ZI3A 4TMTA 5BN3B 5DHRA 3C2QA 2R8YA 1FP1D 4B8YA 4NBRA 1E2IA 1W7AA 5KTNA 3B82A 2JCGA 3AR6A 2EQBA 3DCNA 3H6GA 5EZ6B 5EIBD 3F47A 4C7VA 3JWGA 1AKTA 2W6CX 4RE5A 2BFDB 3EFHA 4DIEA 1WU7A 5JAIA 4OL9A 3TQCA 2C0PA 2IT1A 1AA9A 2Y1DA 3RRYA 1XPJA 2HGZA 3LQFA 1EVLA 1VFPA 1DVRA 1J2YA 4ZV4A 2ZXEA 1U0BB 1N57A 4AJ1A 1DEXA 3F7MA 1GWNA 1P3Y1 1LK0A 2OO5A 4DR6B 4YIHA 1K92A 1NRIA 4BFVA 1VKOA 1IBKB 2Y1EA 1E2FA 2HA6A 4UAGA 5JRJA 5G1OA 3B3FA 5BMVF 4AKGA 5JYDA 4V0OA 4BMVA 4MV1A 2EBUA 3PWKA 1NASA 1DRKA 2Y27A 1K68A 3DFMA 4BFWA 2SCUA 1X0XA 1N8KA 2Z2YA 5I7WA 2OP0A 1JI3A 1PJ8A 3LFUA 4FOPA 1HETA 4A3SA 1LZLA 1NVDA 3G2IA 3JQAB 4K9MA 4XLLA 5DTJA 3T9DA 2EF0A 3FPHA 3KWFA 3HM9A 3RUIA 5DBGA 4MARA 3RREA 4XGKA 4EX6A 1Q1GA 2C95A 2G83A 4QG7A 3KKKA 1O9GA 2XIQA 3ASYA 2X1HA 2WT8A 4WK6A 3WLEA 5JQWA 2G4LA 2EVWX 2ZAYA 1IJBA 1YS4A 4CI9A 5FFNA 2WM3A 5IM4A 3TLYA 3UAOA 1JHDA 3DWIA 1B6RA 3HCDA 1SC1A 3BH6A 3ENVA 3MTQA 4FYJA 2OD7A 3ZEAA 4FBLA 1W88A 4S2EA 2WU1A 2R2GA 3HN7A 2XMDA 1TF7A 1Y3HA 3T3HA 2ZRPA 3FFWA 2B61A 1V2HE 4LZNA 5IH3A 4PEVA 1T13A 3TMYA 3BCHA 4QXPA 3QZUA 4N76A 1KKUA 3PPWA 4IIXA 4O2BF 4WBSA 1VRWA 2FZGA 1S7GA 5LQAA 3GT3A 2PZFA 3ZWNA 4OSOA 3MMSA 3BFVA 1ESZA 1UT8A 5DBIA 2X13A 2ZSUA 1P9NA 3F5QA 5L45A 1IN8A 2O54A 3GCGA 2Z5FA 2BFAA 5DIZA 5F1PA 4C0XA 3LT1A 4P4LA 4ODIA 5CEEA 5HSGA 2EGGA 4GR5A 4EW6A 3IH5A 3U7RA 1NMZA 2C8VA 4Q1VA 4CTJA 1U1EA 3DQZA 3PB3A 5DLDA 3HWSA 4PG7A 2NMVA 1Y1PA 1APBA 3JAKA 2NGRA 1XNHA 2VYFA 4C43A 4CLHA 2A58A 3NWEA 3U60B 4QSMA 1FNSA 1V43A 3RLFA 2PR2A 2GHRA 3DLIA 1AKWA 2QN1A 1POWA 3U6BA 4QM7A 1SMKA 5KYNA 2FX3A 1M8PA 2Q3CA 2VDUE 3GJ3A 5EMHA 2XKKA 1HQDA 4O02B 4PZEA 3LX8A 4D0LB 3GF4A 2MDTA 1L4BA 2AA3A 5ADHA 1U0FA 1N2JA 4F21A 1F5SA 1UAGA 5K5EA 4N3NA 1QGZA 3SYTA 4BIIA 1SG0A 4EPXA 4YROA 4L50A 2G8NA 1XG5A 2VRCA 2ZYSA 3AETA 1FLAA 3DC7A 4LSWA 4BX9A 5E9WA 1QWSA 4DDUA 4UNPA 2GB4A 3W5DA 1P39A 3AXTA 3P1JA 1RPNA 4M21A 3J7AC 2VJMA 3IQDB 1P72A 5TXGA 5T4EA 2JZOA 1DRJA 2QL7A 4Z7NB 4BAUA 4JB0A 4PFKA 3T1OA 221PA 3L0SA 4IWYA 3JQRA 3BDVA 1E0DA 2YWXA 5THKA 1D2HA 4ZDIA 4KPFC 1B14A 2P91A 1OAOA 2QVZX 2V96A 1TZ2A 1BGXT 1V7CA 2INGX 2VN8A 2W8ZA 1Y5NA 3DTVD 1OHHA 3G9XA 4HEHA 4JP1A 1DMRA 3DZGA 4PCAA 1NT4A 1SQ6A 1Q5PA 1U3TA 3RHFA 3HY3A 3EIFA 4GHWA 3P2IA 4BO2A 2BMEA 2LV8A 1SPBS 4OOEA 3AF5A 3NBFA 1IBRA 1DWPA 1CHDA 3Q0TA 5DHPA 5A71A 1D03A 2FW7A 2H5JA 1E4EA 1PJZA 1YZHA 4FS8A 2QRMA 2ZIWB 5HM6A 1RRVA 5F9FA 2YXDA 3PC4A 3DT9A 1TK2A 1U3DA 4FD2A 1DEAA 2V45A 2QM7A 4XCQA 4FGUA 4BGVA 5IBCA 2D1FA 1BN7A 3ZR4B 4AF8A 5MF6A 1M6HA 1L3BA 4YCBA 1CY8A 4C1NA 2QTTA 2PX5A 2WIJA 4OV6B 3GT4A 1FBNA 2OC9A 4RORA 4ACBA 1HYHA 1MC8A 1VLVA 5GM1A 2RHRA 2FXIA 2GZAA 1HQYE 2QMEA 5LB2A 3MUFA 4ZK6A 2O3JA 1HOXA 1PL8A 5JNVA 4DV0B 4QU9A 1LSJA 5E9QA 2FW8A 2VUUA 1LXCA 1ETHA 3WKEA 4ABTA 1QFMA 4RZUA 3IMCA 4NAUA 1KBOA 3TYXA 3BXZA 4Z0NA 4PX3A 1V5EA 4E4TA 3C4JA 1MO3A 3O95A 2A2ZA 2QZ4A 4QGFA 2NYVA 4A23A 3J81A 2PLAA 1ZEMA 3VVMA 4EPWA 4WZ6A 2WIKA 2YY6A 3BAZA 2O59A 5F4BA 5C1DA 3W8RA 4DCGA 1TUGA 2J30A 1ZIOA 4GU5A 3N5KA 1J0DA 3NANA 1VHTA 4C7BA 3F6EX 3LRTA 4PRZA 3DMTC 2Y2VA 4I1IA 3SIRA 3T0IA 1R6VA 1JS1X 1LSSA 3IMFA 2ZQZA 3EEQA 1JIJA 3RYFB 3V6LA 4ZVTA 4DN6A 4OI1A 2D7DA 2MSNA 3MGGA 3HVIA 4D0GA 3GZJA 2C42A 3CLSD 2CJWB 2QQGA 4Q1AA 4G26A 5A3VA 3HFSA 3ZDEA 3ICQB 4ER7A 3ZCRA 1AZTA 1UAYA 2R4UA 3GRPA 3P5SA 4G9EA 1GU0A 1KGDA 1SBQA 4YO7A 3UATA 4EMTA 2PL1A 4K9PA 1QJ4A 4MRMA 3T5MA 2OCAA 3WQHA 2I2XB 2Q1WA 4OHVA 3RTGA 5JH7F 5KC9A 1T5TA 1NUQA 1WAMA 2YWGA 3DBRB 2PA0A 2QJRA 2ZI4A 1QZTA 2ZTSA 4GMDA 3IGFA 1C7EA 2WRZA 4ID3A 1P4HA 1N6PA 4RA9A 5PGMA 5TPZD 1PZNA 4PNHA 4BQSA 1J2JA 3C4VA 2WWXA 3LCCA 2ZPAA 3Q7QA 5TEWA 3C6KA 5B57C 1U02A 4R54A 2LDBA 4CV1A 2QGNA 3BWXA 5K8VA 3DVLA 3FNGA 2AD1A 4PNZA 2FSHA 3G7UA 3EDOA 4KJZA 2DFLA 4OXIA 3BRQA 1CY7A 2VI5A 1Y9JA 2HK8A 3EGDA 4L7VA 2Q2QA 2C61A 1V1RB 2W70A 1YDGA 2H2FA 5EUQB 3L8MA 1L5HA 1TU0A 2V5AA 2W2KB 2WR8A 1PQWA 1GQOA 4LE0A 2RI6A 4RH0A 3O73A 4FYPA 2GF2A 2H4WA 2ZT6A 2X23A 5F3RA 4Y6OA 1NMQA 3CCBA 3H8JA 1UBCA 4Q24A 4MW7A 1HLDA 4TUYF 1L7RA 1EBUA 1CKEA 2FTKE 3A6GA 1UODA 3GL9A 3I0ZA 1MJFA 4CMHA 4PNEA 3MINB 1H69A 4UU1A 3QEAZ 2Q99A 3PHBE 3ZBPA 1FNNA 2AUNA 3RSCA 3B6IA 4TLDA 1MGPA 4JI4B 5CA0A 3JX9A 1Z38A 1QK4A 3HBJA 1RABA 1O0CA 1OV4A 3ANTA 2C9ZA 2ZETA 4V0ME 3NVMB 5DX1A 2BZ1A 5AM1A 4KZKA 1BHJA 4KNWA 1Z35A 3INTA 5IVPA 1SKYE 2RH9B 2X0FA 4P4UA 1M2FA 4I4CA 5B7QA 4KMMA 3OQJA 4C0HA 1ECLA 1MW9X 1Q0ZA 1FDUA 4DYDA 2HEGA 2H4XA 1LDMA 1B00A 1PR4A 4JQCA 1RI5A 5FTMA 1NW4A 1IMJA 3PSHA 4HQLA 1THZA 3JD3A 3ISJA 2WMYA 3TDNA 3GLRA 3DVQX 3N0VA 3LF2A 4I9HA 1XYGA 1U8TA 2VH2A 4IGEA 1W36B 3TF5A 1EVJA 5C4IA 4H31A 2ZAIA 2P5TB 4YONB 1O94A 3F5MA 2XYRA 3GFRA 4KQMA 4FINA 1GQSA 1CQPA 1XTKA 2GO7A 3WQRA 5CNKA 3WFJA 4AKEA 1KFBB 2AG0A 2FPWA 3G0CA 1AS2A 3D02A 1IN4A 3A3YA 1X7YA 1YS7A 2ZWAA 2V7WA 2I8LA 2GKGA 2I99A 1NBWB 1LSUA 2XMRA 4NENB 1T24A 2GXSA 2NYAA 2QU7A 3VPGA 4OU5A 2QKYA 4UVHA 3QJ5A 2HOQA 1MNQA 2IIQA 1SVOA 2PZBA 1KAEA 3C1TA 5KQRA 5LP6F 1QOZA 1VRVA 3LX4A 3OCYA 5B2EA 3SLKA 1NXOA 1O95A 2F3PA 2VH5R 1CNFA 3JATA 1CVLA 1A7KA 4Z99A 3M0EA 2V6JA 4J0EA 4XIYA 3PD0A 1KQ3A 4IZIA 1U9YA 2VTDA 4JC4A 4P3XA 4Z1MA 2GFIA 5BOVA 5BT8A 3FOZA 1WEHA 1EFKA 1YO6A 3ESXA 3PC6A 4IJMA 1JBKA 3ZDBA 2ZG6A 5AK6A 1TJYA 1BX1A 4QELA 1RI4A 4JELA 4MEJA 4PHCA 3LBIA 1P2SA 3LYHA 3CLVA 1XDZA 3QKSB 1K63A 1EFCA 4LZLA 3HJRA 3RNOA 1XTQA 1PFGA 1W5EA 4FONA 2WJPA 1AS3A 2G07A 1RFGE 4OXKA 3OEHA 2A9OA 2CJXA 4NF2A 5T3UA 3EGOA 3CLRC 3SZRA 5BUQA 2XE7A 4U2EA 5ERXA 1JPJA 5F64A 1Q22A 1M73E 4GMFA 1AXEA 2ZE5A 3BJEA 1PDVA 1I24A 1BQ3A 2C2BA 2Q21A 4MVWA 4PC6A 5B37A 4Z5XA 1WRBA 1SKBA 3K1YA 4EJSB 3I6ZA 5EMJA 3SJBA 5JJBA 3KXDA 3R0XA 2W6ID 3BS4A 3OLVA 4MUEA 2XHZA 4XRGA 1T6NA 2DCUA 1SULA 2RARA 2MTBA 1UKBA 1JL3A 1PJAA 3GN1A 5LD2B 1EP1B 4AY4A 4RGVA 2CVOA 4FGZA 3VR5A 2P3QA 1ZH6A 4I5DA 5M34A 1RPAA 1ZZEA 2C9CA 1V5IA 5LA6B 1XZNA 2VPIA 2IUSA 3CUUA 1XLTA 5EYPB 4C0KA 4F45A 3G2QA 4KVAA 1Q0LA 3N2EA 4TL7A 2P65A 3JTEA 4HQFA 2EV9A 3TJZA 2C54A 3PNPA 2NZ2A 3TI7A 4W5RA 2ZR8A 3DM5A 3QE2A 3CUYA 4OQEA 1JG1A 4IIJA 3GJSA 4A5OA 1MO6A 3RC1A 4DPMA 5IKMA 3IXMA 4ZRMA 1O58A 2R96A 4EUFA 1EVEA 2XVYA 3EGVA 4MEAA 1UT6A 2PKQO 3ORRA 1TIKA 3UOWA 2V7TA 3BMCA 1UDAA 3VO9A 2JJMA 4DLWA 5I9LA 2HQRA 3DEYX 3IP6A 4HYQA 4F3RA 1G21A 2LKCA 3L7DA 1E8DA 2J7PA 4IIUA 721PA 5ISMA 4CUJA 2O14A 1BFUA 4DHWA 2HO5A 2F3QA 3X1WA 5GTDA 3CMCO 1NA5A 1KFKB 5AVXA 1S02A 1IOVA 3HVUA 5BPHA 4Q9KA 3WLJA 3OCCA 3R9IA 1KYQA 4R2LA 4BY9E 1VZ3A 3AGQA 4C0JA 2HCRA 2IUTA 1H2HA 1TDJA 2IITA 3DS8A 5AMXA 4LYGA 3GUYA 4RHYA 4JXXA 1U81A 1OXKB 1X80B 3BEDA 2N47A 3S6JA 2Y66A 1XTBA 5HTKA 1DWOA 4NFHA 2HAEA 3NT5A 4ZVPA 1HK7A 2QTRA 1R10A 3PJFA 1SCBA 4AMBA 1R0WA 4DXDA 3VSEA 3R3VA 2YW9A 2Q5FA 3GZNB 4URXR 2IHZA 4R83A 3HK2A 1JEOA 1BRTA 1ZRMA 2Q50A 1J0CA 2HYDA 4JXKA 3OPNA 4NCKA 4AWXA 2D00A 3LLVA 2Q2NA 4LISA 3WX0A 3TQQA 2BMVA 3GLIB 1DJOA 3UMGA 1XYYA 2OFWA 2Y1WA 1XWWA 1XJ5A 1BWRA 1D4OA 1FRVA 4ND3A 1FDIA 4D4HA 1VYTA 2PT7A 1CQJB 3SY8A 2HV8A 2X8AA 3QPUA 5JRDS 3II6X 1C50A 2A0XA 4YRFA 3AK4A 2DBVO 1UP4A 2FRVA 3OIDA 4X1KB 5IN4A 3EEIA 4PZLA 3DAOA 1GADO 2WM9B 2EZTA 4KYVA 4YT5A 3TSAA 2YMLA 3RD5A 3OICA 4FQ8A 1A97A 5AYVA 4BBAA 4BVHA 2A30A 1V1JA 3UGQA 4BJHB 4AQYB 1FU7A 2LIVA 1MQAA 1EJ6A 2TYSB 2EKLA 4L5AA 4Q4JA 5AFSA 3U4QA 4QUGA 5AK5A 2C4WA 4AY3A 1RRGA 1VG8A 1Y4SA 2HLNA 4GOLD 3CNEA 4UZSA 2QD4A 4NS4A 2IE0A 5AJUA 2HMVA 2WFAA 1M6VB 4IY1A 3LL4A 4H7PA 3AFGA 5E1OA 2FW9A 4MRAA 3N75A 2P0YA 4HP8A 4PC3A 4TM8A 5BNWA 1LJLA 5GONB 2KS6A 4UVEA 2CCKA 3QUSA 5JVDF 3E5RA 4JBYA 2PRSA 3LC1O 1IHUA 1A5SB 4IWXA 1XRSB 3HLYA 4GZMA 4EG7A 5ES4B 2XXAB 1K5GA 4MQMA 2PCLA 2FPGA 4ND8B 1Q57A 4U02A 1MO2A 3UKOA 3DXFA 3ANNA 5FEUA 5M04A 3DQQA 4RU1A 4UCQA 5AHRA 4O0LA 4URYR 1RI1A 2G28A 4GC5A 5AJTA 4ASUA 3WY9A 3HU2A 3ZHOA 4RCZA 3S29A 3LXUX 3JQBA 3OJ0A 4TS9A 1P60A 1VMKA 4LHXA 4BN4A 3KQNA 2DUJA 4I6GA 1E9CA 1WB4A 1DEHA 3ZZNA 3STHA 2IEIA 9ATCA 3VA7A 4K6KA 4MULA 3WDLA 2RJ3A 1SA0A 4Y1GA 2V7UA 3FSGA 2X5KO 3HVKA 1J0XO 2RJOA 3CNOA 1KAHA 3JD4A 2CDNA 4U6QA 4AN1A 5LR6A 4BHTA 2M6RA 3CO5A 3R24A 4ZYLA 5DYWA 2IYEA 1GO2A 3KB2A 1GL3A 5CJPA 1PFWA 3H1PA 4TZTA 4UUNA 1AQJA 2G08A 4LCEA 4RHFA 3EOAI 5J43A 3PDJA 1UOEA 4NYJR 3CG4A 4ROSA 2IX3A 3H2GA 2WV9A 4DR4B 3G9TA 4G5HA 1Y1KE 3UT0A 2Z57A 3FBGA 3JQFA 4QA9A 3H2BA 3L93A 1NHWA 2MYTA 3S8EA 1DADA 1VB3A 2NZ8A 4KH0A 1LBHA 1NI4B 5EXPA 3FZQA 5AOAA 2GUWA 1IK4A 3PFIA 4UBMA 1YI0A 1P4GA 3G17A 3QVGB 1FLVA 2RHDA 4PAOA 1DIGA 3HUFA 2KLHA 4IS3A 5IMSA 2YBDA 3TLAA 3TZKA 3GLGE 4RPJA 4GLJA 4Y2GA 5A0VA 4EDHA 3PCTA 4X7MA 2JGEA 1ZESA 3IOYA 1B0AA 1J0AA 4HT3B 4CLEA 4MYHA 4PQEA 5DBFA 1W4RA 2VHJA 1P5FA 2PH5A 3ORSA 1LI4A 2CEKA 2P6OA 3TRIA 1ZI9A 2VP2A 3MK31 4MX8A 1X2BA 1J07A 2O8CB 2PGNA 2ZSJA 3W5UA 5ICMA 4C76A 3AJ9A 2P6UA 5KNDD 3CX8A 2H6EA 2YWFA 3ST7A 4YWJA 5EJ4A 3GXOA 2WUFA 4TQAA 3IFSA 5FAXA 4XOUA 3OD1A 5IFKA 4F9EA 4RFSB 3C7AA 4OK3A 4URUR 4QBTA 3EVFA 4ZPJA 1Y7TA 4OJYA 2WWWA 4Q5IA 2AWNA 2R751 4ML3A 3TOCA 2K7FA 1O9BA 3D2BA 3E3NA 3H2JA 2HQBA 3HA2A 4P4NA 5ALVA 4YHBA 1K0FA 1MX5A 5HF9A 3UMVA 4F38A 3LBFA 2O8BA 1U6KA 4B84A 1K2VN 4ALMA 2PZAA 1I7DA 1PW7A 5A05A 1DSSG 3LPLA 1L8QA 2QVYX 2VJDA 5AK4A 1CJSA 1GPDG 2BWJA 2XCIA 4WLNA 1XDBA 5BVHA 1C0IA 1N2SA 3HCAA 2EYUA 2RGDA 4BN5A 1EUYA 3WGTA 4PLYA 2QSJA 3OJOA 1UBEA 2OORA 3TUZC 2XBMA 2JKZA 2XPCA 3KYCA 1IPEA 1W19A 2DOKA 4V0QA 3RTAA 3TNFA 3ABZA 5AW3A 2PQ6A 4RSMA 2VOEA 4HNAB 1QIMA 5AVRA 1UBHS 2ZJOA 4D5GA 1I3CA 3AHEA 1XK6A 1J7KA 5AJZA 4EZEA 2I4MA 1YJXA 4HNVA 3DDZX 3I72A 1RZRA 4WAUA 1OU0A 2XUPA 3MWDB 4O4HA 3D3KA 3EVZA 5SY4A 5IYZA 4TZ0A 4MXDA 3O7WA 5IH7A 1H2RS 3T7RA 3UCXA 4MUMA 2YXBA 4BE9A 1JB9A 2GCEA 3WGMA 4GR4A 1D4ZA 1F2TA 1P29A 3V4ZA 1X1CA 5F5NA 4RDHA 3W77A 3OC6A 3MYYA 1J4AA 3DE1X 4QOIA 2V0GA 1VYVA 3LGXA 1WOYA 1SIOA 3NHPA 3P52A 4R2JA 3DFKA 3KUXA 4CTMA 5I51A 2BTOA 2GPAA 4D8VA 2QG6A 1O2DA 2PCJA 4PTLA 5J1TB 4Y67A 5CW1A 4EF6A 5CDFE 4EYOA 3KUUA 2HF8A 2LPMA 3TKAA 4E94A 2AFHE 1N7JA 2GTPA 3GDOA 5CT5A 3V4VB 4JWKA 4WBNA 2FR8C 2ETVA 2IEZA 1NOJA 3O94A 3MWKA 1TMGE 1DG9A 1V0JA 5HJ7A 2ZJYA 4LRTB 4OLJA 4QICA 4XUGB 3RAEC 3DKIA 2W90A 3B1XA 3AI2A 1YONA 1JI0A 2NO9A 2WYHA 1HTBA 4QJ5A 2MSCB 2PX3A 1OLSB 1OW3B 1JILA 3FUWA 5IAOA 3GGJA 2GDJA 1ODIA 4INZA 2ET6A 3C97A 3FHLA 3W5HA 2W2LA 3JQGA 4RK7A 1WSBA 2B98A 3CZAA 3LY7A 4PLGA 3FDZB 1B43A 3G2KA 2RGEA 5I8PA 2NNLD 3K0KA 3C3XA 3K1ZA 3GLVA 4O2AB 1P4RA 4OHZA 4D25A 1JHAA 2H63A 1GRVA 5EGSA 4JLPA 5KOHA 2UU9B 1DO8A 4B4VA 4ER6A 1KE2A 1W48A 1JIKA 3B9RA 3R0IA 2BP7B 2HF9A 4HLNA 4AS1A 2V7GA 2BGUA 1U1GA 1WJGA 3JVDA 2IBTA 1N3IA 3DUWA 1VM6A 3D3WA 3PJRA 2DP4E 1OU4A 4QQ8A 1JSCA 1RJ9B 2ZSHA 2PR7A 2V6IA 3C3KA 1DV2A 1M8FA 2QMYA 4CEHB 3WGYA 1BU5A 1YJQA 3LV8A 5CYFA 3RUEA 1LDNA 3N3BC 4K6CA 2HGSA 3KE8A 4EQ6B 5J47A 1BEEA 3NEYA 5KTYA 4H18A 5T41A 1TECE 3KUDA 1M74A 1VSTA 3MOSA 2AQKA 2CFTA 3LUDA 1FP7A 5BW5A 5JI3E 5LZ2A 3MTEA 5BQOA 3FRIA 1IEVA 1K97A 3IPXA 2NU7B 2CZGA 2QA5A 3ET5A 3LUKA 5ALOA 3MVEA 3KL4A 3FAZA 2D8AA 1UK6A 1FDOA 1Y1LA 1G4HA 1FMFA 5IJ0A 2ZKIA 2PUAA 1Y63A 3IIMA 3LY5A 4BNTA 1MZPA 1TJPB 3QU4A 5JZ9A 1ZPDA 1W1UA 1E0JA 1BX0A 4LWQA 1PJ3A 3ZWXA 5A9SB 4QXQA 3H3XA 2HJGA 2WUWE 1SUCA 1QYXA 3IIKA 5A3JA 2B25A 2TMGA 1TYDE 1VMAA 1WXHA 1XZBA 3AM5A 3GP5A 1NN3A 3PHGA 3EVGA 4HDAA 4CG2A 10MHA 4YO8A 3AYXB 3JASB 4XD2A 4F3TA 1TUIA 1Y4ZA 2QDXA 3GGDA 3KJZA 4Y9SA 3A9UA 4WN9B 1L1EA 4EA8A 3OT5A 1I2CA 5CMLA 2ZUSA 1EPUA 3ONVA 4PQYA 5D3MA 1G8FA 2J5RA 1SUBA 2M9MA 3H99A 3WLRA 2VYCA 3GOHA 3MELA 3OTQA 3UK0A 1MIOB 3KZNA 5J2TF 2OZPA 5K7SA 1SJ9A 1A2QA 2WA1A 4PO3X 1LWOA 1SCDA 1N4DA 1J8MF 2CVFA 3ORFA 1UMBA 4YMVA 3FDFA 4RADA 2NV2B 2D74A 3LOQA 3KVRA 2XQFA 1VECA 3CUKA 2PUFA 3T3PB 1NW5A 3CRRA 4REMA 2GXAA 5C1BA 4KUGA 3R7AA 4DLKA 2R8EA 3IUMA 4XPZA 3IJEB 4B9EA 1ZUIA 3AY3A 4BTVA 4K88A 3HG7A 1E7YA 2P1RA 3LK6A 1TW3A 3RS3A 3ABOB 2A67A 4ZZ3A 4RULA 1J09A 1PKXA 2GAOA 2ZRMA 2WHPB 2XOKD 1CJTC 1G7RA 2XCLA 3ADOA 3DH0A 4V0LA 2VZLA 2GVDC 2R2AA 4DWOA 1KOJA 4KWTA 4UOZA 1IBSA 1UT5A 2R6HA 3OOEA 1Y4DE 3WZMA 1IOWA 1FP2A 2I76A 1FDRA 1TCBA 1AMUA 2Y1OA 1I5RA 4BJ3A 3F6BX 3KR0A 2WJYA 4UDYX 4YP7A 4HYEA 2QIPA 4RY2A 4FN4A 1CY6A 1K75A 4MUXA 1VBNA 2QL6A 3B78A 3QBTA 1KRWA 1RRFA 5K3OA 1E9VA 2NO4A 3GLHB 1T6YA 1QSGA 4PSUA 2I4TA 1QQAA 4RH1A 1ULZA 1LS6A 2EZUA 3DBOB 2OG2A 4RY8A 4CCAA 3BULA 4QODA 2FYTA 3D3JA 3DHWC 1EFVA 3QY0A 4ICIA 4QU8A 4GZ5A 4ENVA 2I3ZA 1N2ZA 2G9QA 3CQ9A 4B3XA 4GMHA 2X86A 3P20A 3M5WA 4LMBA 1Z4LA 2DULA 3K96A 1F2UB 3G89A 4PICA 1ML3A 3JRNA 4G0ZA 2YJ3A 2GZ3A 4M8KA 1JFRA 5B6IA 5AUNB 1WLSA 2BBOA 3EZ7A 1P8AA 2GN2A 1Z37A 3I2HA 1W6UA 5DHFA 5KYVA 4EJ0A 3H11B 3CPEA 1FFSA 4YECA 2EFEB 1WSWA 1Z4PX 2E6KA 3EPLA 5LOVA 5DGDA 2XE4A 1O6BA 4EPYA 1BCRA 3BZUA 2TMDA 5FPKA 2XZPA 1RLOA 3AERA 3M2TA 2D1TA 1HRKA 1G3MA 4EAAA 1OI2A 2XCRB 3JYLA 4DSOA 2NZWA 2W4IA 3OMXA 1G55A 4Z0PA 4JMLA 3K5IA 3DVAA 3CUSA 3IUNA 2NUAB 2A5GA 3BZWA 2QUIA 4U4AA 4B17A 2JAPA 3DXYA 4QZVA 3LP6A 2QJTA 3PQ3A 3K5PA 3AB7A 3R6WA 4XFJA 4I55A 1M10A 3IJPA 2HU5A 5T3YA 3UUFA 4RTSA 1QM5A 4HAZA 1S2IA 2DFDA 3HV2A 2QL5A 4D8TA 4XJVA 4Y6LA 4Q66C 2H0RA 2H2HA 4R1PA 1C9YA 3ANLA 3BL6A 2NP7A 4L95C 1OAKA 2C5AA 4LBYA 3ZDXB 4HWGA 2O57A 1SRRA 4N0EA 4NIMA 2Q7DA 2IW3A 3X43A 4AJLA 3BXGA 4W5HA 4ZAXA 3VC2A 4PPGA 3CZ4A 5E9JA 4RDIA 5EPEA 2GWHA 3VOBA 1TEVA 4H7HA 2OBLA 5G53C 2O8FB 2I6QA 3K9BA 2BCGY 3BRSA 4K9QA 3D3EA 4PPFA 4CKBB 3UQYS 4POOA 3IOCA 1JLHA 4A82A 2YC2C 1NW7A 2GHIA 1J0EA 1NU6A 1NQOA 2GNPA 1IDOA 4XM2A 4CHGA 4TRNA 1YRAA 5C2JB 3VDQA 4MSUA 4EAQA 2AXQA 3S5UA 2JGKA 1S6YA 2G7ZA 2VWGA 4DSZA 1LPAB 4CF7A 1IVNA 3MBIA 2Z1MA 5KMGB 2JGLA 3H19A 4YMWA 3AQ4A 4GRIA 4IGKA 3HA7A 2DT5A 3K8YA 3AY6A 4O4LF 1HDOA 2C58A 1Z7BA 3MT9A 1P19A 1RYFA 3N6XA 4HDNB 5FQNA 2ZRLA 5B1IA 4FSDA 6CHYA 4OYYA 1EFAA 1E1QD 2GEKA 5AKJA 4AY2A 2Q5JA 3IAS6 4M1SA 1RC1A 4TXHA 1QO0D 2C20A 4FJ1A 5E3HA 4HLUA 4J0DA 4CR8A 4QUJA 3HHPA 1VLZA 4G0MA 5C3MA 3HKEA 2YZ2A 2O5RA 1CUUA 4BKUA 2GCOA 2QX6A 2WIDA 1XMJA 4WFJA 3A2KA 5HE8A 3PLAE 3PF8A 1KFCB 1SD2A 1M2NA 2PKXA 4WINA 1HDIA 1H8HD 1OXBB 4BCDA 4GKJB 2IHTA 4MLZA 1ZX1A 1B0PA 1QVWA 3SZLA 1BH6A 2PJRA 3RU3A 2BW0A 2V3VA 2Z8YM 3VHXA 1SXJC 3IIEA 1I36A 5KTPA 1XCJA 3WO0A 2YHUA 4M99A 3BB1A 3ED1A 2XMZA 4PO8A 5SZKB 4F3YA 4JI3B 1JQ5A 4PW0A 2MSLA 4PIVA 2BJWA 4AJJA 3DMGA 3LZCA 3A28A 4QRIA 3RSQA 4A6PA 4BQFA 2BCJQ 2Y0DA 4GEGA 5G0SA 1MIHA 4AVYA 4A15A 4JUAA 1GKLA 2HHJA 3DF9A 3R7NA 4BPBA 2UZAA 4D9BA 3GZ4A 5D3QA 4ZEWA 4ZIRA 2FPIB 3CUTA 1W5BA 5LYYA 1S9DA 5I7RA 2FRDA 1AQNA 4Q4LA 2WD9A 1Y3BE 1KIAA 2BH9A 4JI5B 3PFBA 4TTIA 2JFVA 4W1RA 3RS2A 1WR8A 2XGJA 2PS3A 3K09A 4WNYA 1S3IA 4FNAA 5AW7A 1DJQA 3MT7A 4BFXA 4HWKA 4GVXA 3WNZA 4EF4A 3RRXA 3U1TA 4OGFA 5KKCA 4D3ZA 1W4LA 2ZBDA 4ZOLF 2HB6A 3FUCA 4IILA 1LF0A 1U2DC 1N25A 4OQPA 3WXBA 2G1PA 2NPIA 3TVTA 2JFNA 2W2TA 1GSHA 2WP0A 4QYMA 4KN9S 3N74A 3ZCVA 4EOGA 3B5JA 2G6TA 4OHBA 4JLVA 4G5XA 1T36A 4HS4A 3ZX4A 4MVXA 4V1CI 1MLDA 1GUDA 5B7PA 1A5BB 4W5TA 3ELBA 5TJ9A 2FPPA 2VWPA 1TK9A 1M1YA 1VJ0A 2B82A 3A31A 2VYVA 1NQTA 2UVQA 3UA3A 5JD5A 5GJWC 1SVNA 1ICIA 1P2FA 4IXMA 1CZHA 3AOEC 1ULTA 2JPDA 2B8NA 3ZY4A 4MV6A 2VHEA 4CKCB 5KJCA 4XDHA 5CNIA 3JVUA 5KYXB 1WKCA 2GAJA 2OHXA 4LKOA 4YJGA 1I7PA 4A2QA 2PNJA 2O1SA 3DZBA 2FUKA 4IYRA 1YHYA 4X0EA 2W48A 3IBFA 4G97A 3QA3E 4HDKB 4CM5A 1GKKA 3STUA 3H9CA 3KOOA 2D5AA 1MF7A 1FNCA 1XDGA 3LZ6A 4WZZA 5CNJA 5AOCA 1V3TA 4B4OA 5IT4A 1E0AA 3FPAA 4MW5A 3L7KA 4DIBA 4GRDA 4EO9A 2WJ4A 1YR8A 4HEQA 3FBWA 4MI3A 4NAVA 3MWEB 1HC7A 2C2HA 2YRXA 2ZRNA 2P90A 3QVUA 4IHJB 5HIMA 5CFLA 3PTAA 1OB5A 2Z3VA 3LMKA 5AK0A 5AW2A 4EG4A 2IOHA 2XTJA 3LWDA 2BFOA 4KZPA 1P91A 3D3QA 5CVVA 3W6NA 2DXIA 4TVKA 2JCBA 3PENA 3Q15C 1XKQA 2F43A 4LBZA 4U7DA 4H35A 3B3JA 3GNLA 4KBFA 5KS2A 4ABYA 3ZD6A 4WNAA 3WOVA 3LBYA 2GBCA 3Q4GA 4HG2A 5EUBA 4ZYYA 4ESHA 4CQMD 4FOLA 1PS9A 2IZ1A 4GGPA 5KHOC 3H2HA 4D4LA 3FMPB 1LC3A 2IS1A 1PG5A 1XRRA 2JI8A 2P69A 5ED0A 5FFMA 1XMVA 2P0EA 3GAMA 4MMXB 4YV7A 1GJRA 5FBVB 4N6NA 4I4TB 3ZWPA 3RFXA 1SXHA 3GG9A 4JP5A 4P22A 4AUEA 5BQXA 4YDRA 4KXQA 3KYDB 3BL5A 1ZITA 1H2BA 2CKDA 3O92A 3OCJA 1N75A 1Y98A 1N7IA 2RGWA 2PLNA 1HE1C 1ZLXA 2J6CA 2IWRA 3W9UA 1K06A 1JFFB 1GTMA 3BCRA 3T0GA 1TAGA 3W1VA 1HLGA 4YJKA 2I33A 2X9GA 3O8QB 4LNAA 1AVTA 4NBWA 4YRTA 2ONYA 1YC5A 3KTAB 4RYLA 1R0BA 3ZV6A 1YQUA 5JATA 4XWWA 1PSDA 2HPVA 3S40A 2LIPA 5ARDA 2FXVA 2WTXA 3GCDA 1RC8A 1XZCA 4KAXA 3W6OA 5ILOA 3O2QB 5FYDA 1G5HA 4L9WA 3CRW1 3DWGA 1DOZA 1WEKA 2V7QA 4JLSA 2JEZA 3I3SR 4Z0TA 4Q15A 5K8UA 1T2AA 1Z6GA 1LBQA 2X2EA 2ZYTX 3G2LA 4ENRA 5KJ1A 5KIAA 4ESOA 4NDAA 5CITA 1X7HA 1L3CA 2AN4A 3OCUA 3GBPA 4CMBA 5FTLA 2FUEA 2I71A 1SD1A 2PNFA 1LZKA 2AF4C 2RB4A 3I4LA 2QL9A 3L40A 2X0JA 4EHIA 4HH0A 2J9ZB 3B36A 2B0CA 2IEGA 2QZZA 2RBEA 4J1QA 2A86A 3G8CA 5TGTA 3ZV7A 3E48A 2O7QA 3O8RA 3CPJB 4EPVA 4XGQA 3WLFA 3BGDA 1I4OA 1OVGA 4P8RA 3RJMA 2AN1A 1QF9A 2YCBA 4BV9A 3TG2A 3FDIA 4HFJA 3M1LA 2TRSB 1P6QA 5J59A 3UMCA 4D0RA 4HN2A 4PX2A 3G2MA 5FORA 4TXMA 2R6ZA 3MCUA 4GMKA 1GDHA 4LJ6A 4AIIA 4UEQA 2FWAA 5IDYA 4CGZA 1TGYA 2BMDA 3OAAA 4TKVB 5EHNA 5I4IA 2VSNA 5E4TA 2FMHA 2EJVA 2JVKA 3E22A 1VI6A 3NR2A 3SZGA 1TVEA 3MRSA 1U0GA 4QXAA 4ENPA 5FPHA 4X6YA 1X8XA 2XVXA 5KX5F 1WB6A 4BX2A 5LIPA 1BOFA 3G0DA 1K2WA 4AZ3B 4FYMA 5GPBA 2O07A 5B5SA 1PE0A 3ZE7A 2Z2XA 1NE2A 3BRWA 1C1YA 3DCJA 1CHNA 1O0SA 2H7CA 3ETGA 3EUAA 2M98A 3KEGA 3TQIA 2FQQA 4KPEC 5CDSA 2OD9A 2O20A 4IYJA 4WADA 4IAOA 3ZUGA 2PUCA 1ZICA 1B41A 4RM2A 2K4MA 4E3WA 1E3SA 2WILA 3FNQA 3TTSA 4BLQA 2WNSA 3UAXA 4DMLA 5K0GA 3JYHA 3WDMA 5FBWB 4Q4AA 5AHWA 1V16A 2ECQA 3GJ5A 821PA 2D2EA 3E5MA 3NGLA 3DTVB 1V26A 4II2A 1P3JA 2CLCX 1SC4A 1NQXA 2HDHA 2J3LA 3NHWA 4XR9A 3UIEA 2JDID 3V4OA 3X1KA 5KBYA 3QEMA 4QLAA 5AT1A 4DLLA 2J07A 1R12A 2A78A 5ED4A 3FY4A 4URWR 1PBNA 4FILA 4RV4A 4BO3A 1XUOA 5ALEA 5AW1A 1UZAA 4EY7A 4HGQA 4W1SA 4LXXA 3UQZA 4OSEA 4X5OA 5EWJA 4LJSA 3LT4A 3ZTYA 3HA3A 1NRJB 2FOLA 3LYAA 1PWHA 4HFNA 4RL6A 4REOA 2GXQA 4UD6A 3CUEF 4F93B 5KDOA 3CLTC 1SC3A 1DV1A 5LU9A 3AIKA 4JVSB 4C4ZA 4GE3A 2VBCA 1J2EA 3ZDFA 3DMTA 1VE3A 3AM4A 4U6SA 5DHSA 3NVAA 3PNKA 3AVXA 1E62A 1SZJG 1BEUB 4V3BA 4KWCA 5BNFA 4ZFNA 2HLPA 4JVLA 3H1EA 2C4TA 1EZ4A 1IRIA 4EFNA 3IO5A 1SCIA 3HCRA 3ROMA 2XCTB 4O4IF 1ODCA 1R4AA 2VWQA 4L0DA 2OLEA 1YQQA 1AKYA 2FEAA 4RDCA 5J4HA 2QTGA 4URHA 3ELYA 4BEVA 3O8LA 4LY3A 4RX1A 1M2GA 1CZRA 3LUGA 4R3WA 1U65A 1E79A 3BIJA 4KNVA 2IUUA 1H4QA 2GN4A 1G17A 5JYEA 3BD6A 4OGGA 3JWPA 4DV1B 4ZTBA 1ODLA 2RCNA 1ZKDA 4JJAA 1CBUA 3AHGA 3JYNA 1INLA 4MYDA 4Q9IA 5HS6A 3RS0A 5FOUA 2XT6A 4ZZ2A 2XJ9A 2C8LA 1CUEA 4B73A 4D0NA 4UHDA 4Y2PA 4X91A 3GMIA 3VNRA 1OILA 2FSGA 2OOSA 4CPDA 1DQNA 1CSEE 1IZ8A 4LJ9A 2PL9A 4X90A 5F23A 5BVGB 4H3VA 2EQAA 2HFJA 1EK2A 3K31A 1NVWQ 4JKOA 3PCXA 2JGJA 2HYIC 1BNCA 2FSFA 4B85A 3AVWA 2ZM6B 1MGOA 4LZWA 1MO4A 2B4QA 1QLWA 2K87A 3GROA 3QUCA 3E7PA 3QF4B 5AHOA 4TWJA 5CDHA 4C03A 2J5KA 4RVHA 4ZVOA 4CM9A 2C82A 4QXMA 5ALQA 5G1PA 5HIIA 3ZE9A 4N4AA 2AUMA 4IUYA 1G19A 1Q1NA 2FHSA 2EZ9A 2I4NA 4Y2XA 4L27A 3FPJA 1EU1A 1XALA 4QNNA 3RR2A 3V7NA 2CFCA 2NTNA 2H1OA 4C4OA 4LHYA 4Y2QA 2WPNA 1A04A 2D2FA 2D3TA 1SVIA 2JFXA 2JF0A 2YZNA 2ZTMA 3DNFA 3NDIA 1CJBA 4OVKA 5BSFA 2F8SA 4QYSA 1SIUA 3KUKA 4G07A 1G4UR 3AFNA 1Z0KA 2FZCA 2Z43A 1EUCB 1OZAA 5KSPA 3EVAA 4M0UA 2P6NA 1WVMA 1M34B 1P77A 4G5QA 3KJNA 1QH8A 3UMRA 2PGIA 4XYBA 3O2SB 3L6OO 4KKXB 5CA0F 2KJQA 1E6CA 4UEWA 3PEYA 4FUTA 3TPCA 2WHRA 4UC0A 4PTZA 4BFUA 4E70A 3TW4A 1UPAA 3C4QA 4ZCRA 2OGUA 3EPKA 4RSHA 4RY0A 5F77A 2DCMA 3EBLA 4NLLA 1P7CA 4LSMA 3W0LB 2Q3EA 3RC9A 7ADHA 4UW9A 3PS9A 4MUNA 5A04A 5LYJB 4OQYA 2V8BA 4PCVA 4G2NA 3H8SA 4AZSA 2E1RA 4M54A 3L0CA 2XX3A 1HBJA 4DS3A 1CUJA 1W0KD 2VRCD 1P0MA 1X92A 3QXHA 4I1UA 5B3LA 3P9KA 5TF0A 3ORHA 4BFSA 4CMEC 4UUQA 1MX9A 3EQ9A 2OMEA 4C4TA 1SB9A 2GI4A 4FS3A 4OBEA 2VO1A 1ZR2A 2XQJA 5K01A 1DO0A 3BMQA 4OB8A 3WMWA 3WLPA 4KQIA 1IFXA 3U9TA 4D43A 3D7SA 3EC7A 3FCUB 3GDHA 1JG4A 3UJDA 1L8LA 2W4MA 4RF3A 2VHYA 3NDPA 2DY0A 3K2QA 4UCXA 3K8QA 4RF4A 5BQ3A 3M2PA 4CM3A 3K70C 3H1TA 1UBLS 4FQ5A 1V47A 3ICWA 3U4AA 2ETXA 3DEKA 3G59A 3Q88A 2YHIB 4OREX 5LWQA 5KWVA 1DC8A 1XTVA 3HB0A 5I4CA 1EUQA 2W2NA 2ES4A 3KKNA 4X3OA 4G9BA 4XSGA 5IARA 2C4MA 4TSFA 4BNYA 4EKEA 3D5QA 1GGEA 1T9HA 1E6LA 1MT0A 4WZAE 4IM7A 1OVMA 3I01M 3K9WA 3ETCA 1TT5B 1NR1A 1YUNA 3N70A 4RXMA 4FJ2A 4YJ2F 4GKAA 1Z4NA 4UTPA 5F4ZA 1A27A 4CCSA 4DBZA 3K0BA 2FN7A 4PVDA 5C5DA 1NRXA 2VDNB 5TNXA 4DQLA 2PT6A 1B4DA 2GAIA 4X54A 3S2IA 4TXNA 1XD9A 3EAQA 3Q87B 4ZN6A 3C24A 3IR6A 3U4IA 2J9GA 2QSUA 4A8PA 1FSPA 3GIDA 1B73A 1TM7E 2DKOA 1TJ3A 3TFWA 2XGGA 1XHFA 2N75A 4GVLA 1MOQA 3MT8A 2HXYA 1UM9A 5ALGA 3AP2A 1AF7A 1CERA 1RM0A 3TWOA 2R8RA 3KAJA 4KB5A 4ZHQA 6GPBA 5J4VA 3PYXA 2IIBA 3TE7A 4HVCA 1PGQA 1F51E 4H16A 1EK5A 3M4ZA 3ZJYA 1L1QA 1AO0A 2VJYA 1GR1A 1ZONA 1O97D 2EQ5A 3PF9A 3UC5A 4FI3C 4JN6B 2WJHA 4POAA 2ODPA 2ZIGA 3P9QA 1EK6A 2R86A 2YVLA 3CX3A 1U2SA 4OJNA 1AF4A 5GQSA 3MOGA 5IFLA 5H8WA 4MVJF 2ASEA 1GZDA 4BU0A 2C97A 5BN4B 1W8DA 2NTVA 2OSVA 3OURA 5BURA 2YDXA 1C8LA 3GPBA 4B3TB 1N2HA 3FMVA 1FRFS 3D7MA 4F6RB 3LVBA 4ESVA 1XHLA 2W6JD 3EQ8A 1PR6A 2QI9F 2DE0X 3D6HA 3WSVA 4CIBA 2C7VA 1SU4A 3I2GA 4MS3A 1JQKA 3RC2A 1GYPA 3ESCA 3EVCA 4E22A 2IL1A 1C7RA 3IB3A 1HZJA 3KS9A 3PKJA 3RRJA 2BZGA 4LOKA 3CO0S 1B8VA 1T5DX 5FOXA 3TNLA 2WD8A 3BN3A 2PQ0A 4IJKA 1D07A 1JQLB 2ZCJA 3QJYA 3NT4A 1WWKA 3PEVA 5KWEA 5JS1A 5K2MA 3EPHA 4Y6RA 4EX7A 2L18A 1GL6A 1OIWA 3TW8B 3LWZA 2V7VA 5JH7B 5JJIA 4R8KA 2H06A 2YNMA 2I9PA 1KEEA 3O8CA 5DJ5A 1F1BA 2Q46A 2B5VA 3OHPA 4KDCA 5B3JC 2GK4A 5A62A 2WMDA 3C3YA 3SYNA 3P9SA 2KWIA 3CRQA 1KL7A 2EJUA 4RTNA 1GILA 1LA2A 4AKHA 4D3XA 1YVEI 3JAWA 3IEUA 4YXWA 4BUJA 3RUDA 2O8DB 1RBMA 2ZI3A 3VR1A 2RAUA 8ADHA 1GV0A 1SXGA 1G2PA 2MT9A 5HOEA 2QRLA 1BMQA 1KS2A 2YTZA 3TGWA 1K7FB 5A5GA 5L6LB 2OECA 3KWJA 3MLBA 5GIPE 2IVFA 3TCXB 1R8SA 1ZW6A 4TMKA 1PFYA 4EHAA 2WSIA 4WUTA 1U5AA 1JW9B 1B93A 1JDBC 3DW1X 3GQBA 4W7IA 2GCNA 4JJ7A 2BFFA 4PYOA 4DLSA 2YBEA 2Q5HA 3KLMX 3FKJA 3U1BA 1MO5A 2EW2A 1W5TA 1NY5A 1QKJA 2BKLA 2JIQA 3DO8A 3M83A 2ZYDA 3ECSA 3KLNA 4QYWA 4ZI5A 1QTRA 2VF7A 4IUDS 4NDZA 4KQHA 5F1OA 1G3IA 1OFVA 1VGQA 1XHEA 2PV0A 3AU8A 4F2HA 1XDSA 1Z56C 2H2IA 2IV2X 4Y2YA 3ILVA 2HUPA 1QVZA 1KNQA 1AZSC 3CZMA 3NGMA 2YC4C 4I6JA 1OGIA 1Y8QB 4LC1A 3HBAA 3WL4A 4TL8A 5HJ5A 1A4IA 3G79A 3A1WA 3K0CC 5I01A 4MV0A 1F8FA 4L4XA 1PT8A 1E58A 4BLUA 4HNRA 1NM5C 4RJJA 3CZQA 3AJ8A 3FPEA 3P2EA 5AKXA 3TB6A 4EI7A 4KI7A 2P79A 2VQFB 1UDCA 4RE6A 2A9VA 1JR3E 3GEHA 3EA5A 4W5OA 1M3SA 1B15A 2H17A 4QDOA 3B60A 1A4RA 2Z08A 4Q3CA 3G6WA 2CDBA 5CAEA 1U9JA 2QNRA 1V95A 2CVHA 1NE7A 2R1TB 4HB0A 4D96A 2IU4A 1EDZA 2W2QA 3OH8A 5BN5A 1WULS 3GT0A 4JQZA 1ZOIA 4HX5A 4WGFA 5D51S 5CLFA 3CMMA 2D0PB 2B36A 4ZVKA 2I8CA 5K4AA 2V54A 3D1LA 3F3KA 3L8GA 2G06A 5ER9A 4ALIA 4M8IA 2DEUA 2Y6UA 2A8YA 1TQHA 5TSDA 4BEWA 2R7AA 3CJQA 3F4KA 4EY4A 5KQLA 1WHSA 1TUBA 2WM8A 4B32A 5DTEA 3GA0A 3O8BA 3ZZTA 2LCIA 1O95D 2OM6A 2PFGA 3LC7O 2J48A 3OZDA 2IUEA 2VSQA 2GA8A 1KK3A 3GAFA 3IX7A 1LDBA 4KPGA 2IEYA 1V3VA 3ZVLA 1TAQA 4Z1MD 4J91A 4YUAA 1NBIA 5FWAA 1ZJ4A 4MMYB 4J0JA 4LRSB 1RTKA 1TC2A 4JI8B 5L95A 4GVPA 5CU7A 1KMHA 2DFNA 2PSHA 4LF9B 1OI7A 5DRTA 4RIFA 2XUDA 5ELMA 5SV2A 5LBTA 1RSZA 3ESAA 3PR2B 5HPYB 2FZ4A 3B1ZA 1RPJA 3NATA 4E5PA 1QH9A 4UATA 2VNSA 4OGKA 2C5SA 4RMJA 2ISSD 4DMMA 4XIGS 4DA0A 4Q4CA 5FA5A 4JLMA 1CFJA 1L2TA 4Q4HA 2ST1A 2MR5A 1YCFA 2MSDB 4A91A 4RGYA 3Q98A 1VC2A 3EXAA 4UPVA 1ZL0A 2WTAA 4X65B 3T5CA 1XEXB 3BFKA 2NACA 3IB6A 3L6DA 3D54D 1W87A 3B9PA 1L4KA 1VYHA 1WD7A 1Z4QA 3M34A 2R6DA 1L5OA 3CUWA 1E6UA 3NOQA 3PC8C 4JYBA 5B1HA 2PUHA 3EEBA 1LS1A 1IG0A 4RPCA 4BLWA 5JEDA 2B9VA 1TTPB 1ISPA 2QTFA 3AWIA 4KXXA 4RQTA 5FPPA 4BLVA 1DAKA 3KP1A 3ED5A 3KOXA 4NYJQ 6LDHA 3HDTA 4DNPA 1SCQA 3VR5D 5C5EA 5FWNA 2O9JA 3GBSA 1NTOA 1XRQA 4JI1B 1B2LA 3ZS9A 1BE6A 1FQJA 1OWPA 1QYIA 4G84A 1ZN7A 1G7CA 4JV5B 1LW7A 1WXGA 5HIAA 3DAYA 2OXCA 4MVJE 4U3JA 2WG0A 4EGQA 1CRPA 1CS0A 2CNNA 1XVTA 4P3KA 2C2YA 5HDQA 4BMNA 5C81A 4JU9A 3EIOA 4ZO9A 3WIOA 3EEOA 2IKSA 2QXUA 3DVSX 4PHFA 4XUEA 3T1VA 4JFRA 2Z4TA 2IF2A 5JOQA 3TE6A 4JL8A 2X15A 5JSKA 1G6Q1 4W5NA 3EW7A 1U2TA 1XXHA 2OHOA 4D8WA 1I9CA 3GFTA 4G01B 2J0UB 4XB6B 2E55A 3K9FC 2L2QA 3ENWA 3I53A 2YASA 1LPMA 4ZI7F 1F8GA 4JOBA 1Z06A 4JLUA 1PUIA 4BB9A 2CXHA 2BFBB 2Z0MA 5CCEA 1HXHA 5JDCC 2J7PD 3SBOA 3PT5A 3QE3A 3IQHX 2QK4A 1UBGA 2BEVA 3KZXA 4OA8A 2KSQA 2Q3JA 5EP1A 3DZIA 1YZKA 1ODFA 2O0JA 2V6BA 3GRAA 3OU2A 1ZNXA 2VXCA 4H1VA 3FROA 3MXTA 4N03A 1YFZA 4P4SA 3ZHXA 1N77A 1LBSA 4ME6A 3O3CA 1B1CA 1OBFO 3O3NB 4TGLA 2H52A 4ZVQA 2JIZA 2ZQYA 4D9JA 2XCSB 1GZ6A 1ZM3A 4TLEA 3MNFA 1WVGA 3UCEA 1IWPB 2BR5A 4Z2AA 2ZKLA 2X6RA 3DHEA 4X94A 4MOWA 3O2JA 5FOTA 3C6BA 3UY4A 2RKBA 3MGCA 2XYGA 1QS0B 4OQFA 3FGPA 3WMRA 1QH1B 3L6UA 3ILYA 1W49A 4R2MA 1CF4A 1FUEA 4RZ3A 2JH8A 4DPLA 2BFCA 4GXTA 4A8JB 3JV7A 1IN6A 1E94E 5CH3A 1MVOA 2DRIA 4B4DA 1CEEA 3OFSA 2O5VA 1YR6A 1E2EA 2FP4B 3SP1A 1N5DA 2VJNA 1UMCA 2J31A 1DDIA 2PLWA 3HGQA 3QYPA 1II8B 1ZKMA 5EIAA 4FR2A 1S7CA 3WQBA 1X87A 3OZGA 4MUKA 4NCIA 2ZJFA 2IX9A 2F64A 2GRUA 2J3DA 2ON6A 3AEUB 1Z26A 1L5KA 3RG2A 2GNAA 4O4HF 4LC0A 2HUNA 2GD1O 4EMSA 4CL2A 3ZWVA 4LDRA 2P9HA 2GM5A 2FX5A 1Q3HA 2HEIA 1A8QA 4J2HA 1VP3A 2IEDA 4L85A 3OE4A 1LJUA 2QN8A 3VO1A 2HL6A 2D7JA 2PWPA 3CIOA 5MGNA 5CX4A 2PX0A 4J3NA 1WMBA 3BERA 3HCPA 2CK3D 3EARA 4DJTA 5F78A 3A70A 3IUPA 4ZRDA 3Q9SA 2NU8A 3Q9NA 2DSTA 5AM2A 4EEXA 3RQSA 2J5QA 4GECA 4G56A 3IULA 2VRWA 1F3LA 2OB1A 4Y2JA 5JPIA 2IYNA 3GJ7A 4ZXFA 4UMFA 3WR5A 3R3YA 3HCOA 3C16C 2AQIA 5T64A 2H07A 3RSOA 4B6FA 3QE0A 1HOTA 4HGNA 4MQFA 4S0XA 2FDCA 1XKLA 4MV7A 1FB5A 2QM8A 3ZZ0A 5B2FA 2NVOA 2YXNA 1Z73A 4CM8A 1CE8A 1H3FA 2L69A 3DE0X 1W59A 4Q7KA 1UKYA 3STXA 4YR9A 1ZD2P 2ZRIA 3K0AB 3O47A 1HDZA 1ZU4A 2FE1A 2FCAA 1FF9A 2Q2VA 1KHHA 2POQX 3JY6A 3OEWA 4X6UA 3U7QB 1VKNA 3N76A 3AB3A 4MYSA 4D3YA 5FHQA 3U6KA 4OAPA 4MA0A 3VBCA 1XDDA 1JEYA 2XCUA 3A6PC 3LM8A 2JJ8A 3FTQA 4S05A 3M3HA 5CB8A 3BFPA 4M37A 5TF4A 1BWPA 2VG8A 5C8YB 1GGHA 2ILTA 2P9EA 2I6GA 3G8AA 4FYYA 4GX0A 4ASUD 4KRFA 1AKEA 3ET4A 1TCVA 1H1TA 2OZLA 1RXUA 2FZVA 3LUFA 5TE9A 3VKVA 1BC5A 3AL0C 2F4VB 1NR7A 3GJRA 1G5QA 3LDAA 4MAAA 4RJ2A 1FMLA 5AI9A 1MH1A 2IV7A 3VZBA 3W05A 3W9YA 4J4BA 2E5LB 5L53A 3FSGD 2ZATA 3H42B 3KSBC 1BHSA 2YVQA 5LSAA 3HMKA 2FUNB 1QK5A 3CKYA 3L4EA 3D31A 1WVIA 2CWWA 3MFYA 5P21A 1G8JA 2BFEA 2YJGA 1MB0A 1O87A 4RQBA 5BSGA 3FMFA 2J08A 2ZB2A 5ALLA 3SG0A 2P77A 3L41A 4IV5A 2QV7A 3LDFA 1KVSA 4YLEA 3RASA 1JFVA 4K3VA 4DMHA 3MBKA 4O8ZA 5HF8A 3ENKA 4KQKA 1FTQA 2CN1A 1J5PA 2HBQA 3EFOB 3AR2A 3N58A 3SQOA 2X9VA 3Q6MA 4BL5A 3GJZA 1T4GA 4ARBA 4QL3A 5BR7A 5C52B 4N65A 3STTA 3GG2A 4K46A 4MKZA 1VBKA 4O08A 1WL8A 3ZJVA 4KC0A 2E49A 2YFKA 2YS6A 5EQDA 1U1IA 2DBQA 2B4TO 3VBEA 5HK9A 2JZCA 3A4YA 4N0DA 4WXMA 4M83A 4F3NA 1V8ZA 1F6BA 1RKVA 5FI5A 5J5AA 1ORWA 2QSYA 5ERYA 1QGUB 4I50A 4YY3B 5FA8A 3TLMA 2V3CC 3BWDD 3HDVA 5FUXA 3TR6A 4JHXA 4OXNA 4LRXA 2PPLA 2IEBA 1P18A 4G8JA 4WCFC 2CZCA 3P97A 5TS3A 3EMDA 2AMFA 2V7PA 1OT3A 4UKDA 4EEKA 3FPGA 1JXMA 4K9KA 4DEVA 3G68A 1NPYA 3OTHA 4TXJA 1O9HA 1BD3A 2AMYA 5COBA 3O4IA 3LRPA 1OD6A 5J58A 2ZJ2A 4QYIA 3TKYA 1P1BA 4A4DA 3CXUA 4CV2A 4F97A 1AZWA 1DIAA 3N1UA 4YQFA 3T9BA 2WQ6A 1ND6A 2JIPA 2PG3A 1D0IA 1YL5A 1YRQA 1ZYUA 2D4HA 4MKRA 2NVUB 3DDSA 2EFYA 4I2NA 4B7CA 1KAOA 1TE2A 5IEJA 3FOEC 5KSOA 5FFFA 2W2OA 1QANA 4W8GA 3I9NA 2QY9A 2OBBA 4WE3A 2JA2A 3NBAA 1P81A 1ST2A 4CF3A 5EXDA 4XFDA 4DMGA 1BS1A 4A6DA 1SBHA 3DZDA 2OGZA 1HQCA 1V45E 1QP4A 2F4NA 5E8JA 3HB4X 3TUJC 1U0TA 2MMCA 2ZBUA 4NPCA 1V7ZA 1ZI6A 4BV3A 4F5YA 2B1JA 2H9YA 3V8RA 1JU9A 3L9WA 4ILKA 3CZRA 2A94A 2XNKA 4OHFA 4Y7CA 2K2WA 1WDTA 3FHTA 3N39C 1R74A 1K98A 1WMDA 3ETEA 4IJ5A 4UM7A 5M2QA 2DG2A 4C2TA 2QX9A 1FFEA 3JS5A 3TIVA 1R0ZA 1D2EA 4YWHA 4GYKA 3A6HA 4YJHA 2G0NA 2AI2A 2EWVA 2C3UA 4QUAA 5CFMA 4ZQFA 2EFHB 4Q9NA 1LVGA 1XC7A 1M2JA 2HQOA 1ORVA 3IUBA 4OFWA 3TH5A 5JIBA 1YBMA 1RYYA 4FBGA 4D3SA 1OGYA 3P2MA 4LY9A 1DX6A 3CVJA 3E7WA 2RG7A 1PT6A 2VS1A 1F17A 4QQRA 3COZA 4DQVA 1GNVA 2BDEA 2NWQA 3LBAA 4D8UA 3NTQA 1CZUA 2JCYA 5FHRA 4MJXA 1M5TA 2XGSA 3RVPA 1PGOA 1OFUX 3DMFA 2GCIA 3GNSA 2IXAA 1IN5A 3CM0A 3VTAA 4I46A 4D1YA 5BSKA 2B5WA 3QEJA 1QBKC 3UJHA 1VHDA 3NFYA 1PQYA 1ZRSA 2ODAA 2HK9A 4QULA 2JLCA 2Q49A 3KEOA 5D6OA 1JFLA 1GNRA 2G9VA 4YDQA 1LRKA 2VEOA 3EXIA 3VZPA 2BTQA 1ZVQA 3BDAA 2DZDA 4TMVA 4MVJH 5KNBA 2J32A 5JMTA 3G2JA 3AUJB 2G76A 2XUOA 2Q6LA 3OIGA 5FLEX 2PZGA 4B31A 3H1BA 3WGUA 1DC7A 4LQ4A 2ZUVA 1EXVA 4DLUA 4ZYWA 5AI8A 1PR9A 3KZOA 2ORYA 3ZYCA 4JEMA 4WV3A 4AULA 2VNHA 2BN4A 3R7DA 3U0BA 1U3GA 3U17A 3UBMA 2VDMB 1HE5A 4EHHA 4DDTA 3AP1A 4DUYB 4PZPA 4CNQA 5EJ7A 5JSZA 4MUAA 2JAQA 1RWPA 3WGQA 5M5BA 1PT5A 4R7ZA 1WD5A 2W2LD 5I9MA 3EH1A 3NIBA 3EBOA 3L92A 3ODGA 1RAAA 1EK1A 1GZVA 4A0GA 2R66A 3KXPA 2HIMA 3JWEA 4IIYA 3WB9A 4D4KA 5E95A 4F7DA 3TINA 5BR8B 4NZYA 5IN5A 1JXOA 2C98A 2Z83A 4RACA 3CRVA 3EQ2A 4HTFB 1U0SY 3S2UA 2OWEA 3DGFC 3SC2A 3M4XA 2V7XA 1R6TA 3OE1A 2O0MA 4KQXA 2PDAA 3ZC3A 2KBFA 2NXEA 1A8UA 3SPXA 1KZ4A 2O8VA 3C74A 3IDFA 4TX1A 3O1LA 5JS6A 1AUXA 4PGMA 3RH0A 5JLJA 4H3KB 3A0RB 5DNWA 4PBTA 1W93A 4MINA 1IPHA 4NYMQ 4AG3A 4HWOA 3EVTA 1W96A 1OPRA 4RTQA 2REOA 4F91B 2Y76A 3QITA 3LXRA 4JASB 5HUQA 2H2AA 2AYYA 2P5SA 2HPAA 4KQ1A 2HA7A 1RAGA 3V7UA 4EENA 2YYAA 3KT8A 4I3HA 3ZQJA 3GUZA 3P26A 3IPCA 1ZCZA 3CLUC 1OZ0A 4C3VA 1DKNA 4C7MA 4QVKA 1OWNA 3R7WB 3DXXA 1OQAA 4DL9A 3HYTA 3KTOA 4Y6SA 1WXIA 1H66A 4B0PA 1OLXA 4RA6A 2J3KA 3WFZA 5JJLA 4F56A 3PWTA 1TJ5A 4ATNA 1H22A 1YQTA 2Y1CA 4XASA 2OAQ1 5C9ZA 5K6AC 3GGGA 3DUFB 2CFOA 3M81A 4JWTA 4IH4A 1UQRA 4AM8A 1MQ8B 3U5TA 3VPSA 3FA2A 1U99A 1U5BB 2PRJA 4G4IA 4IKPA 3RKRA 2MYNA 3GYBA 1IHXA 5HFJA 5SYNA 1NP6A 4JX8A 4B74A 4DA4A 3DE5X 1HEIA 3KQOA 4QJ4A 4S1NA 3CZCA 1FDSA 2I7TA 2VA8A 3C3EA 4OK5A 1T3LA 1GRQA 1SXJA 3BWYA 3G1TA 3P5BA 4YVFA 4YPFA 1WLYA 3DZHA 3RK1A 1KDVA 5EUCA 3KXIA 4NPAA 2WJZB 5G3ZA 1ECBA 2A1IA 5BYBA 2X3UA 2OV6A 1G63A 3AG6A 2KQUA 3FOBA 3Q3GE 3CNQS 3GJXC 4JUFA 5CIWA 5D87A 4G5OA 4XTRA 4HNSA 1C1XB 1NZFA 4FR5A 1AOXA 1VCNA 1M2VA 3HRHA 1NN0A 1L5FA 1RQRA 2W0MA 1RXYA 3PVCA 1RC0A 2G5GX 1H1LA 1SUSA 3FSJX 4Q82A 1G6HA 4IVNA 2ASVA 4TV9A 1NBME 3IKLA 4C3UA 4PSVA 4QGHA 1C3JA 3BOSA 2VK1A 5F1KA 1QPZA 4M9ZA 1U2DA 4AJPA 3QVXA 4ZAVA 4DMUB 4NL4H 1LTQA 1Q0TA 2AC7A 4G0XA 4FP9A 3CT6A 3NHYA 1D1SA 3VC3A 1ZG3A 5HKLA 3NTXA 4U0JA 2FF7A 1TQ4A 2HQ1A 2ZB3A 4UNNA 4RAQA 5I4BA 2QP3A 4D0SA 1FFCA 4GQAA 5KNBH 4EZBA 4WZBA 1VE6A 1WQ1R 2AR7A 2ZAMA 2E9SA 3VU1A 5JT1A 4W6QA 2ZTHA 4ARCA 2O4UX 4Q21A 1QZXA 3AOEA 2WVJA 2JL1A 1LB1B 3HYSA 4J43A 2PUEA 4CRWB 2MU1A 3KKEA 1H5QA 3CFYA 5HJ2A 4CKZA 1T2VA 5I48A 1PJLA 2LNDA 2PPVA 3WIBA 4JB3A 3OLQA 4TKUB 5EY5B 2XA1A 2HBYA 3THSA 1UJNA 1CTQA 2PZJA 2J09A 7GPBA 3WNDA 4XB1A 2BC9A 3MRXA 4RF2A 2X77A 1H0HA 1JIXA 4OK6A 4WI1A 4NARA 2HBZA 4HWTA 5C1IA 3TB4A 1M0WA 4YFYA 3TDKA 4EKNB 3REQA 2SKCA 4FFBB 3COPA 1OJLA 3HEMA 1AKVA 4LHEA 4QUEA 5A4JA 1B74A 1Q0PA 5DCUA 4AZVA 1W52X 1P61B 1UKAA 2DBRA 1XI2A 3V9PA 5JAZA 3RIMA 3V2UA 4FEYA 3CX6A 2WWVD 1IIRA 4JJKA 3PPIA 5HR5A 2OPBA 4KX3A 3QUAA 5BNTA 1GU7A 1I5EA 4FMCF 4WEQA 2ZJ0<