1FLTX

Vegf in complex with domain 2 of the flt-1 receptor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure at 1.7 A resolution of VEGF in complex with domain 2 of the Flt-1 receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (growth factor/transferase)
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR
total genus 17
structure length 95
sequence length 95
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1997-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fltX00
4NUGH 4DUWA 1XFPA 3NFPB 1F11A 4DGIL 1CLZL 3C87A 3G5XB 3IFLL 1KXQE 5B39A 5J89A 5IB5A 1CD9B 5EU5A 2IC2A 2RCSH 2X9WA 4Z7WF 1G6RL 5HPMB 4APQC 4KPHH 4POZC 4WHYH 5D7LD 5EUOA 3L3DB 3A6BL 5ESAA 4D8PB 4ETQA 4JVPA 1ZT7B 3BH8B 2CDFA 1F4AA 5HPOA 3F58L 2EE2A 3MV7A 1AE6L 5C70A 3VGAC 4JFED 3B9KC 3O3DA 1KTLA 4NZTH 4ZYKB 2AI0H 3MGTA 4EI5D 3HR5B 2DD8H 1U58B 4IRSC 2IANB 5DRZB 4MGXA 3L95B 4U6YA 4MCYA 4NRXA 3NTCH 2IAMC 4CVUA 4X5LA 2JK5A 4DVBB 3VFOA 4G8EB 4JCLA 4HJGA 3GMLB 3T1FA 4WW1A 4QRUB 1KT2A 2AJSL 2YR3A 2P47B 3SPVA 2XWJA 2VSCA 2D0GA 2X1WL 4YHIA 3FMGH 5FGCE 3V95A 1AI1H 5EBMB 4HUXA 4KU1A 5FO9A 5LAXB 4JAMA 4RIRB 3WIFA 3JTSB 5IHBA 2ZJSH 1MWAA 4R8WL 1YYML 1INQA 3K0WA 1BFVH 5GRVL 2A6JB 4U1NA 4BKLA 4P2RA 1AGDB 1OGAD 2ICCA 4F7PB 1EHLH 4I5BA 2R0LH 2R69L 4L8DB 3VWJD 1JTOA 1ND0A 5D7IB 3QDJE 1W2KT 5JDSB 3GMQB 4PJAA 1FYTD 5A2JH 1T89C 2I07A 1G7HA 2OJEB 1NMCC 2H2SC 4Y88A 5KOVC 4TN9A 4I77H 1RMFH 3U48A 3DO3A 4KKAC 4C56A 2RAMA 4TQEL 2VXVL 1CFQA 2ARJA 1LILA 3O3BB 3HI1A 5BOZG 1C1EH 4H26A 5FM5M 5I19L 3RA7H 5GRWA 4XB7A 4JDZB 3MRKA 3HZYB 1B0RA 2Z91B 3BZFA 2NZ9C 4PRPE 5DJ0B 3UTQB 1IGJA 2WUBL 3L6FA 3REWA 5JW4N 3FO2A 4ZD3L 1S5IH 4KKLC 5E8DH 4HIIB 2DQJL 3ZYIA 1MFCH 4PJDA 1UADC 5GZNC 4HS8H 2V2WB 2Q20A 3QEQD 5HGAA 1Q72L 3HUJE 2OR7A 3S36L 4MWFA 3TNMA 35C8H 5CSZB 3QDMA 4WENB 5D7IE 4PV8A 3QO0B 5DHXB 2HFFB 5F7HA 4LRNH 2OLDA 5CGYC 5L2JA 4NKMB 4PJDF 4LEOA 3BWUC 3F7RA 1FYTB 1JNHB 1FO0H 1MRCL 4LHUG 3U9UB 4OJFL 4F9LC 1S7XA 3SE8L 5JA9A 5I1AB 4NN7C 1X4XA 3B83A 3HC4L 4PRNA 1HNGA 5FYKU 3N1QC 3DHMA 5DD1L 4M9PA 4NO2B 5CZVH 3WJLC 4ZNCD 2VLJD 3FCTB 4XB8A 4C56D 2VXTH 1QLEH 1T1ZA 4MLSA 4JG0L 1BBDL 4PRPB 1T21A 3WHXA 5EIQA 4OAWB 4B41A 4PGCA 1B9ZA 1GGBL 5C0IB 1IGMH 3QI9A 1H15A 5DQDH 4KVCL 5D93C 3TA3B 1AHWB 5L8LB 4Y5YB 4KPHL 3P4MB 1CXHA 3TH3T 1I8LC 1HEZA 4RMRA 3Q6GH 1G7LB 3C60C 2B4CL 2MCG1 5CJQH 1N26A 1NFIA 5IG7A 1QSEB 4GXUM 3T0VA 4LEXL 3H42H 3WSQH 2NX5D 4JN2B 3WL9B 1BBDH 4EI5C 4P5TB 3G6JB 3SGKC 5HVHB 4S1SL 5DD5L 3NCMA 4PJEB 2KZ1B 3MLXH 2AXJA 1TJHH 4HIHA 1F2QA 4IOSD 1Q94B 1P4LB 4I3RH 1A6UH 4RQQA 4YO0B 1ES0B 2R0KH 2Q6WA 3U9UA 2ICWB 4RGOL 4KDWA 2RR3A 3HG1B 5I8KH 2XZCH 4MA8H 4NNPL 12E8H 5JXEA 1MI5D 2FATH 2ICEB 2ENYA 5GS1B 2BSTA 4MJIB 1AQKL 3RVVD 3V52L 4H0IA 1LK3H 4P3CL 5D1QC 3TNMB 3TN0D 3RA7L 1INDL 1O0VA 2VDNL 3R1GL 4M1GH 1X5FA 4PS4H 3QIBA 4MDIB 2FJGB 5TDNA 4KZEL 3S34L 4O58H 1YYMH 2PF6A 2N1KA 5BRZD 2W92A 2WIIA 1HH6B 3ZTNH 1GC1H 1YY8A 4OCRL 2R29L 1E4WH 3GNML 4R6UA 1KIUA 1ADQH 5DR5L 2AJXL 2Y5EA 4N9OB 1NAMA 4N0YH 5E6ID 3KPOB 1K5NB 3MLTB 1KULA 1H3PL 5F1NA 3PQYD 1RUQH 4M6ML 4PIRF 5C0BD 1VADA 1YQVH 2VC2H 2VR5A 2EYRB 5ERWB 4O58L 2W60A 3FB5A 4MJ2A 4NZRL 4P3DB 5I16B 1IBGH 2ID5A 4ONGL 1G7HB 2ZCHL 4NWTH 2HA1A 5CKGA 5DJYA 2APFA 2A6KB 4HWBH 2JJSA 4FMFA 2AJYL 2HJKB 1OAXH 4JFYA 4IOIA 2HKHH 3WFEH 4EVNB 5D5MA 4QT5A 4G42B 3WS3A 4RZCB 1PG7W 5F7DA 5HHQB 2OZ4H 3QEHA 3THML 4GG8A 1A7PH 5DVLA 3MLYH 4GG6F 5TFSH 1ITCA 1XF4A 2XXCB 4LSQH 1NQBA 4FFYH 2FX9H 4LGPB 1NANI 5EOCL 4XP4L 5GXBB 5D5MF 4Z77B 2HN7B 2QADB 4JKMA 2GUOA 4QHUA 2BRRL 4HZAA 1F97A 4KUCF 3MRLB 3K8KA 2DTML 3ALWA 2DD8L 4JN2A 1BVKA 1KJ2L 3ZKQD 3QIWD 3BP5A 1T1YA 4JZOB 5J7CC 2AEPL 1G7LA 4OZHA 3TYGL 5D7JB 2GTZB 3IYLW 3QP3A 1TPXB 3GMRB 4OTXL 5M95B 2MOVA 4Y5YA 1FFPB 4DGVL 1UWEH 1BEYH 3QCTL 3ELAT 1MLCB 3G04A 2ATPB 3UP1A 4HW6A 1YEHL 2L0DA 3KJ6L 2P5EA 1AKJA 3ARSA 5L88H 2BNQE 1YUHB 1IM9B 1HOCA 3QXDB 5DXWA 5BMFL 4ETQB 1KIQB 1MJJA 1BHGA 4F80A 4HFWA 2EDTA 3FHAA 5HPMA 4PRIA 4CJ0A 4ETYA 4WU5A 3JWNC 4NQEE 2BP3A 1DL7H 2ZG3A 5DWUL 3L3KB 3U6RA 1RK0B 1T0MA 1NCBH 4HGWB 4GJTB 2DJUA 4QHLA 3KPSE 4UILH 3O8XC 1NCNA 3WNNA 5KTEH 4X6CF 1ED3B 2R1XB 5ANME 4AM0A 2AQ2A 3ZTNL 3NZ8B 1CBVH 5T5NG 5H2BA 1A1OA 1XH3A 4JFFE 3QCVH 3WDIA 1ZGLA 5IV2A 1C16B 2I27N 2EICA 5DLML 4NFDA 2H32H 5A1AA 1AFVH 2OM5A 4Y1AA 3NFNA 2OJZL 2F54A 1YJDC 1ZWIB 4BUHA 3FQWA 4KQ3H 4ZD3H 3S88H 1FFOA 1MRFH 2XQYG 5IB3B 3MREA 2Y36L 3V4UH 4K55A 1MAJA 5IOPA 5KAQF 3QUYB 4MB4A 1CZ8L 4R7NB 3IAGC 5JOEA 2VN4A 1N7MH 4GG6A 1G7MB 3I75A 2Z35B 4ZTOL 4JFEA 3VXNB 4Y5XC 3KPRA 3V0WH 5T3XE 4XPFH 3SE4C 3J7HA 1MVUB 2P8MA 4RA3A 3GMOA 1HHGB 4H20L 5D7JA 1HI6A 4ZOCA 5HY9A 2HYMA 4H8WH 2FDBP 2VDKH 5FK9A 1X4ZA 1PBYA 4GXUN 4WFHE 3OZ9L 1OB1B 4LLQA 4PLKC 3O6MH 2Q7YB 3EYSH 2OCFD 4WHTB 4XVTH 1EA9C 3KLAA 4YH6A 1DN0A 1JN6A 2CH8A 4H1LB 3GBNH 4XP1L 2WNGA 3V5DA 4P46D 2Y1VA 1SY6A 5B38B 4XNYL 3K4AA 1KTDA 1U6AH 2GITB 3H3PL 3BQUA 5GIRB 3WFHA 1XGRB 3DV4A 1ORSA 4LHUD 1FV1B 4JY5L 3T1FB 3VRJA 3T3PF 3E2HB 4ONHA 5CP3H 3MA7B 1EVTC 4FXLA 2OL3B 3ETBF 1YNLL 4YC2B 4S0SD 3DIFA 2P8MB 1KELL 5IROA 4P48A 4G80A 1MSPA 2YEZB 4L29B 5GGUB 3VG9C 5H35B 3TBSB 2GT9B 5CCKH 1WIOA 2MSPA 3OB0K 1RUKH 1LO3L 3SDXA 3MRJA 4DN3L 4FFWD 1MHCA 4OF8A 5D1XC 4XRCA 5ILTH 4NJAL 1D6VL 3U4BL 2AVGA 4DJMA 1RURL 3QEUB 3ZYZA 5CEZH 2WQRA 1CLZH 1G1CA 3U2SA 2X9XA 1EO8L 2E8YA 4QHMB 2COQA 3CMOL 1UEMA 4K2UL 3U0WH 4ZDHA 2Y9RT 5D2LB 2CRYA 5KSVB 4M5ZL 4D3CH 1F11B 1IM3A 1X9QA 1WCBB 1YDPA 4WIQA 1OP5H 3L7FA 4LKXA 3MV9E 1XR8B 4HMEA 4KVCH 3WLWC 3BFOA 1CICA 1EAPA 2ATKA 4KKBC 1QACA 5FOJA 3ULVE 3ECBA 4YIQA 3PHSA 1W72L 1U3HC 4IIQB 1J5OL 3CFIC 4XWOD 2R29H 4KJYB 5INCB 4FQ2H 5LBSH 4QHLB 5C09A 1MH5A 3EDDA 1MHEB 2E9IA 1QFOA 3QEUA 3T4YB 4HJ0D 1BJ1H 2KQMA 1NFDA 4JRYA 2Y25A 4ELME 3G6AB 2IAMA 2D4DA 4LSDA 4YHKL 4L4TA 4JG1L 4WHDA 5HHOB 1JMXA 4K3EL 2DWDA 2APTA 5D1ZA 2XN9D 1WTGT 3CFKB 3WL9A 4X6FA 2IPUK 5I73C 3CPLB 1B88A 2O61A 1S9XA 4BQCA 2AJZB 5I74C 1MCLA 4GUPB 1MI5A 1QLFA 2FR4B 4HEPG 5L0QB 2EXWD 2GJZB 3LIZL 2C7UA 3OV6A 3BX7C 3L3OB 2H2PD 3UTSE 4JFPB 1CU4L 2CIKA 2JCCB 3O8XD 3SN6N 3K4DA 3QHFH 4X98B 2NY1D 3LZFL 5I2IB 3QUZA 1MFBL 4Y19E 1T3FA 4G8GB 1R3HB 1CDYA 4UIKL 1MHHA 4O9HH 1AGEA 1F4WL 1XIWC 3BN9D 3MYJB 4WHTA 4P23D 4ZS6D 2P5WA 3SY0A 1E27A 4GKOA 1F4XL 4WUKH 3SGDI 2DQFA 2HT2C 2Q8BL 5EN2A 4PBVC 2XKNA 2VLRA 1AO7D 2X6MA 1R0AH 3PQYA 1GZPB 3MLPA 3CFEB 5KJRL 3C5SB 4LLMA 3EJJX 4QTHB 1X5KA 3RVWC 4NQXA 5E7BA 4FA8A 1DQQB 5I71C 5DMIH 3KPMB 4LPXA 3FZUC 4L4TD 3PHOB 2NR6D 2C3HA 2AABL 4ALAH 4YPJA 4QRRA 3BW9B 4OCYL 5CEZD 4MJ5A 1KJMB 5DC4B 3B9KD 5TQ2L 2YUWA 3BKJL 3TT3H 4RWYL 4HPYH 2WP3O 3U1SL 2AAVA 4YLQT 3FZUD 1SEQL 3VXRD 5HVHC 1P7QD 3WKML 1Q9WA 2JB6A 3C60D 5D1XA 1A6TB 5HI4D 2NTSP 2X42A 3VXOB 2Q86B 2A77H 3LHPL 4PJCE 1TVDA 2DQGL 4ODHH 3RGVC 1HDMA 3QEGH 4GQPH 1ACYH 3UX9B 2BVUA 2EEDA 5EU6D 4P23B 1FSKC 4N0FB 3JV5A 5GGSB 3ALPA 3BZDA 1IILE 3S5LA 3LRGA 2DQUH 2EH7L 4LCUA 2FEEI 4XMPL 1F3RB 3A0OA 4MXVF 4UAOB 5J1TC 5E9DE 2I07B 4NWTL 3K2UL 3O8XB 1T7WA 3KPSD 3MLVH 2G5BB 4PV9B 5CD5C 1AH1A 1QG3A 2VDLH 4UB0L 1CGUA 4PRBB 1FNAA 2AJVL 3IDMB 4U1KB 3HR6A 2AKRA 3L3IA 5JUEL 2J6EL 3PWJA 1MWAB 2L4OA 4LQ1A 3FL7A 2FEDD 1ACYL 4JQXC 2RCSL 3H8NA 3F5WB 2BMKB 4NGHL 3TFKD 3FT4B 4ZAKC 5FYJD 3SDYH 4EBQH 1WBYB 4HIEA 2XWJB 3GB7B 5DD5H 3ARFD 4CJ1A 4D9LL 4N8PA 1P69B 1CE1H 4R2GD 1TZHA 3ARGD 4LSSL 4YHYB 2ZUWA 2DJSA 5B8CA 3L5JA 3D2UD 3N9GL 4ODBD 2VZVA 3DSFH 3ARQA 3KXFB 3P4MA 3B5TA 4HLZH 1FRGL 4IHOA 3RNQA 3OJDB 5EU4B 4FQXD 1EHNA 4B0MM 1Q9LB 4Y4FA 3IDJB 3MJ8B 4DEPC 3T08A 4ZXBC 2IAMB 4PG2C 5F9WC 2J8HA 1IAIM 4LEXH 2QSQA 2MNUA 1HSAB 3WFZA 2WLZA 1UQSB 3L3DA 4C54A 2NY3D 3CK0L 3ULUD 1PY4A 5E6ZA 1IGCL 1QFHA 3BD3A 4UZGA 1RZFL 4K8RH 3HC3H 2JJWA 3N1GC 2ZJSL 4NNYB 4LDOB 3BUYA 4PJFF 1FNEA 2V2XA 1BOYA 4F57L 5KVEL 4ZUUA 5ISZD 5CD5D 4NKMA 1HCFX 1T2QH 4FQCH 2P1YA 4X7CC 1LVEA 4EN3A 2X05A 4QYOA 2B4CH 4NT6B 2JKXA 1KN2H 4Z78B 5DMJB 5IW1B 1GGCL 4KTDL 2CKNA 4A6YL 4JFFB 4CVZA 5FFLA 1M71B 2AV1B 5I18H 1I1RA 4MQ7B 4LHUB 5B22A 3DX6B 3E2HC 5DJCA 1LDSA 4Y4KB 3LH2L 4U6VH 5C0BA 5D1XB 4YC2C 4NZTL 3DWTA 1P2CB 4ELMA 2R56L 1JGDA 1A21A 4IEFB 5E2TH 4OZGE 4L29A 5GGUA 5J11C 3SKJL 3WKNA 4BYHA 1WBZA 3PWPA 4R0LB 4YX2L 4PREB 2HRPL 3HPJA 1CDUA 3TVMB 3VW3L 4U1IB 2CO6B 2A83B 3RWIB 2Y07H 2VE6A 1M7DA 1YZZA 2FBJH 3OF6A 3MOQA 4O51A 1SEBB 3WFHB 3P2TA 1BVZA 1FPTH 1HHIB 5C09E 3E0GA 2AV7B 3RWEA 2PXYC 2EDQA 3TO4C 2JF1A 4YO0A 3KLHD 5DTFA 5GGSA 5GGVY 2E6PA 3BD5A 3MLZL 5DVMA 1TFHA 1I9EA 4XHJC 3SHSA 1R3JA 1CE1L 4LCWD 4YNYB 3VFPB 1HDMB 1VB9A 3U46B 4FQXB 1N0XH 4BK4A 5AEAA 4QRQA 1NBZB 2DRUA 3MLUL 4JGMA 2DAVA 4NRZA 1JVKA 5F3HA 2D4FA 1XZ0A 3B43A 3TYFA 3T3PE 1KXVC 2WSKA 3DARA 3ARGC 4NQDD 5D70L 4NZDA 5FHAH 1AHWA 1QNZL 5I8OL 2X70A 1G7JA 5SWQB 4LVHB 2J4WH 2VXVH 3D9AH 1I3RA 1MCJA 1GGBH 4KRPB 1DSFH 3RX5A 2VN7A 5JPNA 3CFKA 3DURA 3VGEA 2DLTA 5DVOA 1PDKA 3MFGB 4Q97A 3RX7A 3O3DB 1TZGH 1IEAB 4KZDL 4TRPH 2XKNB 3CVIH 5EDXA 1PG7L 2UVEA 2X4NB 1UH4A 4Y16C 3DTXB 5KW9H 1TJIH 1B4JL 3OMZA 3EYVB 3JV6A 5C09B 4YDKH 2VLMD 3E8UH 2E7CA 2X44D 1FRGH 1NL0L 2H1PH 2HLFD 1X4YA 3MTRA 4OZHF 3JTTA 2ZG2A 4M3JA 3LDBC 3P0YL 5HTSA 4XCFL 4N1CA 4RAVA 3OJMB 2B5IB 3VFSA 2D9CA 4UMGA 2R1WA 1GSMA 4KUCD 4MA3A 1W72B 2X2YA 4MJID 1MNUH 2FIRT 1KJVB 2LFGA 2ERJC 1GZQB 2QHRL 2W65A 3L1OL 4WEUD 3WXVL 4LU5L 2C4FT 3WS6C 4NQUA 1F00I 1OARH 5CLTA 1YEHH 4FG6D 3S37L 3GSNH 1TCMA 2RFXB 1WICA 3ARDA 3OKLA 3HZYA 4OD1H 3BIAX 3RVTC 5CEXA 1IAMA 3I2CH 4PJ9D 3HI6H 2AK1L 2J88L 3G6AA 4QOKD 1DQML 1NAML 3P40A 3UZVB 1IKNA 1MIEH 2AK4D 3O3AB 4JFOA 1GRWA 4JFHE 3LQAC 4UT9H 2UV3A 1DVFC 1VACB 3MNWB 4YIQB 5GJSL 3D3VA 1FBIH 4AIOA 1ND0B 5D7IA 5HYJB 1JGLH 4JZOA 5H37H 2M26A 4Z5RA 1XR8A 5FM5O 4MHHG 1NSNL 5LWYH 3RIAK 3BIKB 4AL8H 3GRWL 3CLFL 1C5DA 4RGMC 3HUJA 1O7SA 4TSBL 1OPGH 5TQ0L 1FC2D 35C8L 5EBMA 2FL5A 5F9AC 5IVOA 3M1BA 3QEQB 1BZQK 2HG5B 1FNFA 2Z92A 3VE0B 2JIXB 2H6PB 3PP3H 4BH7B 1DDHB 5HDQL 3UJIL 1ZA6B 2H2PC 2YD7A 5AYQA 5ICXA 3GMLA 5E6IB 5TF0A 4FXGB 1FAIH 1GAFL 4WWKD 3DBXA 1BFOA 4PRHA 1S7VA 4R3SA 3AM8A 4I0PA 1DEEB 5I30L 4QNPF 1WWCA 2BZDA 2YZ1A 4D0CB 3LKNA 3TZVA 2ARJQ 1IGTA 1WZLA 4B7LA 4AEHL 3F7YA 3HUJF 4CDHA 4HG4J 3CZFA 5IVZB 2P5EE 5T1MB 3QQ9C 4PJ5D 3GNMH 1T7YA 5T1LA 3CC5B 3WLBB 5GIRA 3SDAD 1F6AA 2XXMB 1MRDL 5GZND 3DETC 2BY2A 3IF1B 1NLBH 3T77B 5KAQG 2FD6L 5B38A 1AJ7L 4XVTL 2QSCL 2WANA 3WNOA 1J05B 1DQJA 5HYQB 2Y23A 1X7QA 4X7SL 1J1XH 3LN5B 4UQ2A 4YQXL 3O41A 3NFPA 4X6BB 1U36A 3EYOA 4H88H 4MD5A 3W9DA 2R1WB 3QCUH 1FVDA 3OKOB 4PJIA 3FO1A 5D2LE 1J10A 4GRWE 3FOLA 4M02A 2O5YH 3STZB 4P5TD 5MEPB 1ZSDB 3IJHB 3UPRA 3TV3L 2DQIL 3V6ZB 5E0QA 3N9GH 1AXSB 4IRJD 2R2CA 25C8L 4CVXA 1PLGH 4MMXC 4O02L 5C2BL 2Q3AA 3ZDXF 3H0TA 1JWMA 1OCWL 1C12A 3ULSA 4AJ0A 4HKJB 1N64L 1ETZB 2OTUB 5GS3A 4HT1L 2HMID 1A7QL 2DICA 3QFJA 4UIMA 4JQVA 1G7PA 2R2HA 3QIUA 4X80L 4EUPA 2QEJA 4LARL 3VXSD 3EUUA 5FM8A 1QLRB 1I1YA 4HG4K 5BVPH 1VFOA 3NFNB 1EVUA 2NY2D 3VFVA 4HKBB 4P57B 5TE4L 4TSBH 4KK9D 4KK5C 4LSUL 5JW4M 1WAAE 5CJOH 2EZ0C 4OCWL 3VFTA 4JFZH 1XCTA 3OQ3B 3LN4B 1ZLWK 4DKFH 2J6EA 2OZ4A 4YHMH 3ZE0F 2DYPA 2PCPB 5IQ9A 4FTVE 1UFUA 3QIUB 1T21B 4YBHA 3VGDA 1NCDL 3T4AA 4LGRB 1VFBB 4K8RD 2MTPA 3G6JE 4E0RB 4U1LB 3NIGE 1I7UB 3S98A 3VFPA 4Z77A 2SEBB 3WFDL 3KPPB 4PJEE 3NCYP 4F37K 4ODUA 3VXRE 2Q76B 5FYLH 1Q72H 1X5AA 1QZ1A 5I76B 1CDHA 1UH3A 4GS7C 4Y1AD 5D8JH 5EO9A 1UWEL 3BDYL 3D0LA 2VJXA 4NN6B 3MV8E 4YUEH 4QT5B 2OYPA 5E00B 4X5XB 2VE6B 4PTTB 2Q87A 2NYYD 3SGDH 3JUZA 3P73A 3OKOA 4R0LA 1D9KD 3QUKA 4S1QH 4OIIH 4NZUL 5IFJA 5IT2H 2DQCH 2LAGB 4L5FL 1W0WB 2GK0B 5C0ND 3DX9B 3DRTB 3C2AL 4H5SA 1TQCB 4XP4H 4CBPA 1DBKH 1FJ1B 3ZSTA 1AXIB 3REWB 1LHZA 1FDLL 3DX6A 5F1NB 2CGRL 3QNZA 3KXFE 4LSRH 2UYLA 4Q0XH 4LVNC 3SCMD 2G60H 4NC1E 1FL5B 3D6GA 3MRIA 2NNAA 2R2BA 4QO1A 3M8OH 2UWEA 4JGUA 2R56H 3I6LD 3H9SE 3MMEA 4HUUA 4YXLH 5IW6B 5KSBB 5CZXD 2W0PA 3H7BB 4CMMA 1UWXH 3IRPX 1DUZB 3P0GB 1A1NA 3LKNB 1V8HA 3LPGA 3QUKB 1LO0H 1Q1JL 2L7UA 4RGOH 4KUZH 3GK8L 5BZDB 4XBEL 3S36X 3V6OA 4WWID 2CGRH 3KYNB 3STLA 1T1XB 1NDGB 4M8VA 4KTDH 4HFUH 1WGOA 4YE4H 4LIQL 1MWAL 4N0CC 1JYVA 2ENSA 3GSNL 4H25A 2VXSL 1HWGB 4FP8H 5KVMC 1J86A 4NRYB 4ZFGH 4M93B 4JRXD 2YKLL 4ISVB 3IB4A 2XIDA 1MPAL 3RZCA 5HI5C 4D9QD 4NIKB 2DM2A 3QIWC 4JO3H 5IFAH 1MFEH 5BV7H 3AXLA 4MNGE 1S7SB 1CIDA 2XQBL 5L7XL 4RRPA 1T5WB 4EQ3A 3NABL 4KQ4H 1MAMH 4ESKA 5FO8A 4OF5A 3VI4F 4NQVB 1TNNA 1KCRL 3DXAD 3HR5A 1MAKA 4IJ3C 3TA3A 4TTGA 5DK0A 5AUMB 1W8OA 2QQKH 3IJSB 3QFJE 5JO5B 2VLKD 1EHXA 3BGFB 5JNYB 2AW2A 1DR9A 3V4VL 4C56E 5CUSL 5A3IC 3MRDA 2C3VB 3AM8C 3RWFB 5CIPB 3FCTA 1DQMH 2Q6WB 4K2UH 1VPOL 4EDWH 1OGAA 2VISA 3FOMA 1XMWA 5E2JA 3L3GA 5F7MC 4N0UA 1C5CL 2MWCA 4U1JB 1FH5L 2F5BL 5MENE 5FYKE 3H0TB 4YBQD 2ZCKL 3O2VL 1T0NB 2GJ6A 5K9KB 1HYSD 3RY4A 4U1LA 5I66B 4LEOB 3L9RB 4EXPX 1S3KL 2YK1L 4MNGB 3QFDA 5KVDL 3EOYG 2PETA 1NC4A 5KZCD 4PJIE 1UEYA 5I15L 4NUGL 1RK1B 1FFNA 1U8JB 5DRWB 2A0LD 3S34H 2APBA 2X4TA 3AU1B 2A74A 5DJ6A 1R3IL 2VXTL 1UKTA 2AEPH 5E6IC 4BQ8A 1PZ5A 3IETA 2VXQL 3CXDL 1HK6A 5KOMC 4MQTB 1A7PL 4WGWB 5D72H 4IMLB 3WO4C 3ARUA 1CXEA 3MV9D 5TFSL 1YMHB 3U1SH 4YDKL 2GIYA 4KKLD 3BISA 2D03L 1RZJL 3MCLH 2MJWA 4GBXC 1LEGB 5GRJH 1EUUA 3CFDB 4XHJD 1U93A 3O11A 4OZIA 5ADOH 2MQ3A 4GAJL 2WBJB 3LHPH 4LVOC 1H0DB 4YDJA 4JB9L 1I3VA 4PJEF 1PW3A 2R4SH 3EFDH 5DHVB 5IBLD 5E2TL 4WI4A 1E6OL 4QTHA 4X4ME 1OL0A 1X6LA 4U1HA 5FDWB 2XKUA 4LCIL 4PRHE 4P5MB 2JCCF 5EUOE 3TYFB 3UTTD 2JIXD 3QDMB 1YMME 2BC4A 1NLBL 4N5ED 5DVNA 2DKSA 4WFFE 3OGCB 5I6XC 4JQIH 1A4KA 3DMMC 3QUZC 5I8OH 2Y4SA 3VJ6A 1LE5A 2FB4H 5IGXL 4K23L 4YXLL 3UDWA 5ADOL 4Q74A 1XGTB 1DANU 3GSXA 4UQ3B 4M43H 5ACMA 4PJIF 2D03H 3NCFB 1N4XH 1MCOH 2AXHA 1UZ6F 3L6FB 2VZOA 1A47A 1P4IL 4V1DB 1MF2L 5TF1H 2NW3B 1B6UA 2BFVL 2J2ZA 3IF1A 1J1XL 4WO4C 5EULV 2VDNH 4M1GL 4U1MA 3F6IA 3HNTL 4X99A 3AB0B 3FO0H 1INDH 4BQ9A 4MQXD 4ZFOL 3QDGE 4XP6L 3BRFA 4K7PH 1TQBC 1UZ6E 4NKDB 2ZWLT 5IJKA 4N8CH 4LQFL 1EJOH 4G7VL 2DWDB 4OZFA 4J8RB 4OLZH 4AEHH 3UYRL 1BFOB 3IDXH 4L4TE 4D9RE 4Y5VA 1AR1C 2B7DT 4OLYH 3IGAB 3T2PA 5HGGS 1FN4A 1UVQA 1I9JH 3GBLA 4LPUA 4O2CB 3C6LD 1UXWB 1BGXH 1UT9A 4KVNL 1CT8A 1JGVL 2BVQB 4G8FB 4HUXB 3RWDB 2J8OA 5GSVB 3JVGA 3RI5F 5F7FA 3VFNA 2CDGB 3KYOA 1QR1B 1I9IL 4Q2ZB 4OV5A 1QO3B 3MV9B 1QHOA 4ZUUB 1FVEA 4JJ5A 2IFFH 4G8EA 4MNHA 1MCBA 3QPQD 4LLWB 4Z7NF 5I71B 1M7IA 5HHME 5EUKB 2C1PB 3RGHA 1JZ3A 2D2OA 5MEOB 4JFXA 1MQ8A 4F57H 4U7SA 5K59E 3F62A 2EE3A 1LP9A 3DTXA 4ZUVB 4DW2L 2YPKB 4F7MB 4F7EA 4Y5VB 4H0HB 5CZVL 1CG9B 4N90E 1P1ZA 1A64A 1LWRA 1CGXA 4P3WA 4OLUH 1UKQA 3QXAA 1QFWM 2GT9A 3VGBA 5CGMA 1ZHNB 1SYSB 5IB1B 4G6JH 5GRVK 3T2NH 5AD0B 4U6VL 1TTUA 2RFXA 1LO2L 2PNDA 1K4CA 1AD9B 3O4LE 32C2B 2IGFH 3QXTA 2CLRB 3WO4B 1EGJA 3TCXA 2GSGB 3VG0L 4P2QA 1NGPL 4P4KA 5ESQB 1RULL 5HDBF 3QIBC 3RGVD 3LVEA 4YE4L 4FG6C 2WZPD 4OLVH 1F4HA 4G5ZL 2UY7A 2DM4A 4XX1E 3R8BB 1MJUH 3GSWB 4HXBH 4V1DA 3SDAB 1MEXL 1FLRL 5ESVB 1G9NH 2N7BA 5F7UA 3MODL 1A7BA 3M45A 5DZNA 1RZ8B 4NBXB 4YR6B 4LVEA 4Z76A 3TJHC 1H3GA 5J1AA 1EJ6A 3BP6A 1IE5A 4XP6H 1LE5B 2DN7A 1WK0A 1E4KC 4YWGL 1EEZA 2O5ZH 4JRXE 5DGQA 1IEAA 1O5DT 2VAJA 1CXLA 4XNYH 3V4PL 4QWWC 3REVB 4N9GB 3X3GL 5EU7C 4B5EA 3CX2A 5HHNB 4LMQI 5L2KA 3KG5A 2X89D 4OFYA 4LLDA 3HNVL 1HXMB 5EBLA 4Q9RH 2X4QB 4X6DF 1OP5K 4K23H 3ULUE 3UZEA 1LO0L 4HWUA 2P24A 1F42A 5T5FL 2DS4A 1GAFH 4ZAKD 4YXHH 4GXVH 5J57B 3TC9A 4YWGH 4MAUH 4LKCB 2Z31B 1NMAH 1VENA 1NAKL 2J5LC 1I9IH 4JPIB 4P2OA 1UH2A 1NEZB 3AY4C 4Q9QL 2HKFH 3C6LB 1DBKL 2NCMA 4J12A 3VD4A 1S5HA 4NQCA 4HZLB 2YWYA 1PYWB 1BQHA 1RUMH 1MFAL 4WV1A 5KSBF 4V1DD 4ZTOH 3B2UC 4Z76B 3CDCA 3NPZB 1A4KB 1CFTB 1D5ZB 1CXKA 4F33A 1HE7A 4OB5H 1A1OB 5KSAB 4F2MA 3QUXD 2KZWA 4UDTA 3SGEH 3JV0A 5DVKA 4FHBD 1I8KB 4YZFF 4DTGH 3CDYA 5K9OA 2VDOH 3MA9H 1IBGL 5FB8B 5FA4A 3VFWB 1C8PA 2GCYB 1Z9OA 2BJML 1YQVL 1DLFL 1YEGL 3I84A 5B4MC 2W91A 1QUNA 4WWKA 3L3KA 3UTTB 3CFEA 3QISA 3IXAB 4HHAB 3JWDL 1U8LB 4WDIB 1N8ZB 4IMKC 1NMCB 3GFUA 4HAGA 3KYKH 5F70A 1KIQA 5C0RH 1VEOA 5IB1A 5DRNA 5BZWB 1A3RH 2YA0A 1MHHB 1G6RA 1G0XA 5FF6B 2FO1A 1X3DA 5C08B 2MQCA 2ATPA 5DJ8B 4LU5H 3I02A 1RUAH 2FHFA 3GSUA 3X13B 1AGCB 1VGEH 3RY6A 2OMBA 1KJ2H 1WISA 3DX8A 4CVZB 4P2OD 4CN6A 1FZMA 4OKDA 3GMRA 2XTJD 2C7UB 12E8L 4GW5A 2QQLH 1SJEB 1BQUA 3CUPA 4TUOA 4LLWA 4R90L 5GGTA 1Z6JT 5TQ2H 1U91A 1FORH 1R24B 4F3FB 4JQXA 4MQSB 3L9RA 4XVSL 5KN5A 1RJCA 5GGRY 4OCYH 1KC5L 4HXAL 2LV4A 5IVXA 4QEGA 3WUWA 4ZFGL 2ESVE 4X7FC 2QQKL 3QG6B 1WV7T 3MRPA 3CDGB 4Y2OA 3SO3B 3ZL4L 1L7TH 3EYFB 2A6DA 4PGDA 1BX2B 5CMAA 4PGEA 1YMMD 4LSTH 5KG9B 1I4FA 4XNZB 2ESVB 3MRFB 5CIPA 3RRQA 3MUJA 4Z0BL 5J6HA 1PEWA 3DROB 5HXMA 3P9MB 5T5FH 1U8HB 2OR9L 4G9FD 4I1NB 1HZHL 5IW3A 2FJHA 3WUWG 1IC7L 3FTGA 5JHDB 4LNRA 4OI8A 5DK0B 4TNVF 2IALB 4GMSL 5C6TL 3PL6D 1JZ2A 2GY7B 3MRCB 3DJ9A 4NO0A 4ONFH 1J5OH 4LGSB 1RZGA 4PY8J 1BJMA 2VLKB 4KI5F 3CCHA 1RJLA 1TQBB 4WTZG 1D9KC 4PJ7A 5D93B 1OAQL 4GAFB 2VO5A 4PGZA 1U95B 4PJHF 1EO5A 1MCKA 2VLME 3D87B 3TWCL 4YEEA 1BQLH 1NC2D 4M6OH 4QKXB 1NAMB 3QDAA 1G84A 3BPNB 3BN3B 1Q1JH 3W0WE 4I0PC 1KEGH 4TVPD 1D5BA 2MMXA 2DQCL 1OQOA 2XZAL 5I1DA 3CDFA 4O2EA 1S7RA 1T66C 5HHPA 1FLTX 2YPLA 1DLFH 1U8QB 3V52H 3P9LA 4KROB 4ODXB 3TVMD 2VAAB 3BGFC 2CLVA 5D71L 3VJ6B 3GRWA 5I1LA 2D9QB 3MRGB 4LVNB 1AI1L 4KKCD 4XC3L 3DIFB 4PJ7F 5KVGL 3RTQC 4D0BB 1XGPB 2HH0H 2PYFA 4QRRE 5M7QA 2FX8H 3PGCA 4IS6B 4ZFFA 3WD5H 4OFIA 3WJLA 1JFQL 3AFLA 1NSNH 4QOKE 4U1HB 5FDWA 5LWYL 1UJ3C 3ILPA 2VQUA 1YEEH 2YD8A 1S7TA 5SX4I 1DP0A 1GZPA 3FT3B 2ED8A 4PD4K 2DWEA 4QGYA 4NHUB 4ELKA 1T66D 1HYSC 1F3JA 1N2RB 43CAA 4QXTB 3M07A 1FGVL 2BRRH 1UKSA 4OLEA 4HWBA 4XP1H 4GKSA 2R1YB 5IQ9B 2ADJB 3MNZA 5GRYA 3BPCA 3C6LA 5JLZA 1JNNH 3N1FC 1N4XL 1T1WA 3UBXI 4YDLC 4L9LB 5E70A 1QVOB 2BY0A 1S7UB 3CLFH 1IL1A 4MQXC 3GMOB 3UTSA 5MEND 2BHYA 3IFNL 3WE6B 4I9WE 4XBGA 1JZ8A 1ZHBA 4JN1L 4JKLA 3S96B 3BEVB 2VERN 3TPUA 2O93L 5TPWL 2AJZA 5E00A 2V5SA 2Z35A 4OCWH 5FAAA 3NAAL 1A7OH 1BF2A 3NIGF 4Q9BA 3MV8A 3MRBB 4XC1H 2YRPA 3OKKA 5DK2A 4RWHA 43C9A 4GW1A 4NO2A 5IJVA 5IB3A 2CXKA 2RJMA 1Q38A 2MHAB 3C8KB 1EEZB 4XCEB 2O5ZL 3G6DL 1OGAB 2EO9A 3OAYH 4HF5L 5CILL 3V0VB 3R0NA 3ZO0A 2ERJB 4FFVC 4NM4L 2B39A 3OKYA 3X11B 3OJ2C 3QT2A 5ICZA 5K9JL 2OP4L 2DLFH 1B6DA 4K7PL 5IUSA 3A6CL 1MAML 5ESVA 5JIKA 1GOFA 2KL6A 3SDCC 3QJHA 4OGYH 8FABA 1EMTL 1K8IB 2DF3A 1FL3A 2CIKB 1C5BH 1T83C 3HMWH 4R2GC 2DQTH 5EOCH 2DOCA 4B50A 4NQVA 3T65A 4L4VB 1A6PA 2EIZB 1UM5H 1K4CB 4EI5B 3VXMA 2CK0L 5K9JH 1MHPH 5KANI 2EXWC 3O6ML 4ERSL 4KV5F 4FXKA 5L8KB 4DFIA 4XC3H 1YUHA 4FQ2L 4U4BA 1KN4H 3ULSB 3VFGH 5ID0A 5T1MA 1N0XL 5D6DC 1FL6A 3DUUB 3QI9C 3NIDE 2IG2L 1IGTB 2Z4QB 1MH5B 1KIPB 4PJ5A 2OJEA 2YPVL 5INCA 5EOCJ 4MNQD 3H9HA 1UM4H 1ZT1B 2P4AB 3W9EA 3R4DA 4NWUL 4IIQA 4LMQE 4M7LL 1NGQL 5I0DA 4JFDD 1R3KA 2C1OA 2YD1A 3S35L 4X6EB 4L8DA 3EJZC 1T1YB 5I19H 2NY0D 3C60B 3V5KB 3ZKND 4GMTL 5IMMB 5T1DL 1YDPB 4YHLH 1MUJB 5C07E 2DQUL 2EH7H 3W2DL 4HUUB 4HS6A 4GBXB 1WFNA 5CCKL 2ADGB 5D2LA 1ORQA 2V5MA 4UU9A 2ZCLH 1RJZB 5IBUB 5I8EA 3CD4A 1VKXB 1Q9KA 1CT8B 3NIFE 4X4YB 3SPVB 1QKZL 3ZKSD 3KPQA 1G0DA 4K3DH 4AMKH 3VXTA 4TOYL 3CU1A 2X7LB 3RU8L 3T2OA 5L9DL 2QQNL 4OGAD 3FB6B 2NY4C 5BQ7B 3K46A 1CF8L 4IRJB 4YBLB 1JYWA 2M8XA 1OTTD 2JB5H 2IANA 5DRZA 4I48B 4K7FB 2WMPA 5JQHC 1IC1A 5I16A 3LMJH 4KJPC 3KPRD 4PJBF 1A6VL 3SCMC 1U92A 3NIDF 4M6AA 4XVJL 3LH2H 5HHMD 1MCWW 4HUMB 1OM3H 1YJDL 3G5ZA 4CN4A 1F5WA 1G7IB 2XICA 4XT1C 3WDJA 4JEGB 1NCTA 3VH8G 1KCSL 4RWYH 1UB5A 3NCJL 3UJJL 4ODUB 2F54E 2JE8A 3QNYB 3QWOA 3DGCR 4NQDE 2BNRA 5EC2A 1LK2A 1QP1A 4GT7A 3ZE2F 2NY0C 1XGTA 4TTDC 2R23B 1C5DB 1MF2H 5TF1L 2EKSA 5EOQH 4Z7QE 3TO4B 5L6YL 3FT2B 1XH3B 1FNGB 4G6KH 3MV11 1N5YL 4OLWH 1C1EL 4J1UB 4RFEA 2VXUL 5SV3A 4AQOA 3RDTA 4EIGB 4HDIB 1KV3A 4GAGL 3ZDXE 3GBMH 1NBVH 3RVXD 3S4SG 3CLEH 1HHGA 3QDJD 1KBGH 4ZSOB 5K93A 1JHKL 3VFTB 3R1GH 3MUHL 4JM4H 3MO1A 3X11A 4JFFD 2MFNA 1GHFH 3T0EC 2N56A 4GH7B 4M48L 4F58L 2EIBA 3ZYJA 1ZHKA 5AG9A 1ZTXH 2WLYA 5EORH 4I18B 4XAWL 4Z0BH 1MFBH 1U8MB 2JTDA 3VWKB 4UTAH 4J3WA 2YD2A 2H26A 1P84K 1I85A 4HXBL 4NHCH 3MQIA 1HOCB 3MV01 1SYVA 1ZAGA 3F7PC 3BD4A 5D72L 1BGXL 1NUDA 4HKJA 4HC1H 1JV5A 4CNIA 1I8IB 4M3KB 5KVGH 1X5ZA 2F54B 4E9LA 2APWA 4AENB 4W4NA 1U3HD 3LPFA 3SDAC 4K3JL 5DC0A 1F6FB 3EOAB 4KRLB 1NC2B 3BEWA 2V7NB 4G8GE 5DO2C 3TBVB 1ERNA 5F3BB 1JZ4A 5DJXA 1QSZA 3MOBL 3V6OC 3LKRA 5F1IB 2P46B 4X9GA 2BNRD 5E8OB 5E95B 4DQOL 4XPHL 1XGUA 4LIQE 4BFGA 3PE9A 4M48H 1D5MA 5CP3A 3O2DL 5GZOC 3SBWA 5BS0E 5K9QG 5BRZA 4O2FA 1MY5A 4PRAB 5AZ2H 4APQB 3KLHC 3K1KC 1A6AB 1Y6MR 2R23A 1VGKA 2F53A 2X4NA 3TCLA 5JHDD 3IU3A 1BEYL 1E4XH 1RZIB 1VHPA 2F5BH 1ZMYA 3NFSH 2XPGB 4G9FB 5F21B 4HPOH 4NYLA 1GIGL 3ARBA 4G8IA 3RVUC 4RMUA 2CUMA 1I7ZA 1JGUH 1W72H 1IT9H 2O5XH 3LKSB 2YBRA 2GAZB 3N1PC 3AREC 1FYTA 1B2WH 4HMDA 1SEBA 4MA7L 1WZ1H 4NCC1 1HZHH 1UACH 4V2BA 4ELMF 2ZOKB 3S96A 3TN0B 4K7PY 5ID1B 2NXYC 4XPTH 2HJKA 3L1OH 4HKXA 4EI6B 1T22A 5IMLA 1PLGL 1A7OL 1UM6L 2YSSB 3PP4L 4YHNB 3RGVB 4I3RL 1S7VB 3ZKMD 2ADIB 3I6KB 4OCSH 4S1DC 1VADB 4A6YH 4OD1L 4JHWL 2FZ3B 1QSEE 2W07A 3LB6D 5HYSG 2DQGH 4ODHL 1GGIH 3O0RH 3UAJD 2JIXA 1V3MA 1YYLH 2N4IA 3HLAB 4EN3C 5TDPB 3BAEL 2W0FA 4H26B 4R0LC 1ZEAH 3MXVL 2VZTA 5ACZA 5J06A 1CFQB 2ARJB 5KSUA 4E41D 4P5TC 4XP5H 1PD6A 4C83B 4R9HA 4BQ6A 4LNVA 3OKNB 3BE1H 3MLWL 4NO0B 4POZD 2EDXA 1F8TH 3NCEB 5FXCH 1X5HA 4UAOC 2F58H 1FNHA 4U2ZA 1B3JA 2XA8H 4PJBA 4BZ1L 4JLRB 5DEGB 2J8UA 1OTUD 1YQ2A 1QLEL 5DRXA 1LEKA 1Y18A 3EAKA 5T3ZE 5JIIA 2I9TA 2P43B 2A6JA 4M6MH 4BKLB 4IBLT 5TE7H 1XIWB 2FECI 3UJTL 1S9WB 2IFFL 3LSOA 1BMGA 2UWEB 3U82B 2D3VA 1YEJH 2Y7QA 3PABA 4KJWD 4JAMB 1PX4A 3Q5TA 4D0DB 6FABL 3S88L 1FAIL 2FJFA 2NQCA 5DC9B 2DIAA 3ZT7A 4WW2F 1I85C 3ARDB 4XPHH 4OZ4B 4YEFA 1BJ8A 2WUBH 5DMGD 3CK0H 1L7TL 4TVPL 2EIZA 4F3FA 5E1AA 4QRPD 2YWZA 4QY8B 3O45A 4L4VA 1CBVL 5D70H 2ADIA 3I6KA 3CCHB 3P77A 4PGJA 1GZQA 5IWLC 3UTSD 1NLDH 5I75C 4U6YB 2FEEL 4L5FH 5J6GA 4PP2B 4ZXBB 1OP3H 5D9SA 4IRSB 4G6MH 1QQDB 3FFCD 4OI9A 1V7NL 5EB9A 4M4PA 3VGAB 3LDBB 3VG0H 3HCVB 1IGYA 1JPFA 4PLJC 4Z7UB 3B5GA 1K9TA 3KR3H 4GAYA 4MVBC 2CSPA 4QTIL 1XGYH 4WI7A 4M7JL 1T1ZB 4DZBB 3SQOH 4M03A 1UJ3B 1GVIA 4W6XB 4RDQF 3HFML 4I2XA 2MHAA 3C8KA 2WUCH 5HI3D 2XPGA 2FO4A 2X1PA 3CDGA 4Q6YA 4OSUL 1NMBL 1P5VA 5B39B 3HTLX 3UTTA 1RURH 3EYQC 4POUB 3HS0A 4A2MA 3DURB 1TETL 1NH6A 3RL1A 2EDNA 4PJXA 4O2FB 3KJ6H 4OTXH 3TO4D 3HZVB 5DYOA 3QDME 4WTWA 4XP9H 3QCTH 4U3XA 5TE6L 4N0FA 1KIRB 5D7IF 2X70B 5CFHA 3WN5A 1RFDH 5MP6L 2FECL 4Y16D 4PJDE 4NC2B 2I5YL 1AR2A 1DLHA 4NOFA 2ZUYA 1H15B 3EHBD 4IRZL 4JZJC 2WBJD 1K4DA 3RDTC 3MLZH 2LU3A 4PRPA 3LSOB 2VH5H 5CEZL 2BNQB 3G5YB 5F71A 1ZLUH 3RJQB 1JZ5A 1QTYT 4YNYA 4DEPB 4TULL 1I3UA 5CSGA 4BZ1H 1D9KB 3S36H 1HSBA 4LVOB 2A73A 1ZA3A 1U8PB 4PGBB 5C9JA 4K3HA 2PXYB 4MJ4A 3DI3B 2WIMA 3QA3A 1YEKL 5E9DD 1RIHL 4RFNB 1J9CT 1NBYA 3O81A 4U0RB 4JM4L 5L2KB 3MR9B 3S5LB 4JRYD 3MV7D 2PXYA 1FZJB 3FOLB 3STZA 1JPSL 5C92A 1A1MA 5DQJB 1DSFL 1ZEAL 3JBG7 4FZ8L 4R96B 1L0QA 3MRGA 4NCC2 5A16B 3RBGA 5LGKA 3LD8B 2YKLH 1OSPL 1G0YR 1RIVH 2QSVA 2VAAA 2W38A 4YR6A 1TITA 3RTQB 1K4DB 2R8SL 2DQHH 3QIUD 3BDYH 4OCRH 2C9AA 4OUOA 5I2IA 4JPIA 3NCJH 2UUDH 1U2CA 1WWBX 3MRHA 3ARRA 4N0YL 1JNLL 2YD9A 3GMPB 2V9RA 1BBJA 5DA0B 3Q1SL 4L3CB 3WN5B 1MELA 1CGYA 2I60L 3V0WL 4WUKL 4CMHB 5E8EA 4OBSA 4XX1G 1V3LA 3P0YH 4DVBA 1CVSC 5EU7E 1WC7B 2IQ9H 3IS1X 5DJZA 3ABZA 4MAUL 1UYWL 5LGJA 1RHFA 3RIFK 4NQXB 5I1JL 4KKBD 5D1ZB 3C5SA 4PJAB 3JV4B 3ARBB 3OF6D 5J4MA 1SM3L 2FJHB 2IGFL 2YS4A 3C8HA 4L4TB 5DFWH 2NZ9D 5E6IA 2A1WH 3MV7B 3O6KL 1HIML 4NQEB 5L2KD 4O4YL 5HGHA 5D1QA 4GRLD 1LMKA 2B0SH 3TFKC 2PXYD 2PYEE 2W9EH 4GQ9H 3PWUB 1E6JH 1ITBB 2HJLA 3I3EA 3ZT5A 3HE7D 3ULUH 5DD6A 2YD5A 3EYFA 3EO9L 4LCWA 3HI5L 4Y4FB 5EU5B 1A9BA 4GBXA 5E1HB 2PN5A 4OQTL 3DMMD 2OR9H 4YHOH 4L8BB 1R5VB 3B9VA 1RZKH 5BW7A 3H42L 2VLJB 4BFIB 3MRRA 4AENA 3RQ3A 4P2QB 3O45B 4TUOB 2NXYB 1U42A 3QZWA 2O61B 3Q6GL 1SJEA 3MLUH 2MCPH 4RMVA 1U58A 3H9HB 2YHGA 4JFOB 1OGTA 3ZKMC 4M1DL 3VXSE 1U8MA 4EOWL 2HMIC 3KHOA 3HZKA 3PABB 5CLWA 5GRUL 3VA6A 3OR7A 1J88A 1H8SA 2DI9A 3RJDA 3IDIA 3RFZC 1JI2A 1BECA 4U1KA 3V6BR 3KLDA 4KK8C 3EHBC 4ALAL 4HCRH 4NFBA 4PJXF 4XAKD 2R0ZL 3OB0H 1H3VA 1KNOA 4HDIA 5T33H 5MI0B 1EZVX 4MZ3A 4XZUB 5FGRA 2NLJB 1I1FA 1OSZA 4U1MB 1EEYB 4YHZL 1Q9OB 5C8JA 5GHWH 1A6WL 1WBXB 4BSVA 2EDFA 3QJHB 3IKCA 1EX0A 2QQNH 1G6VK 5KSUB 1WIPA 1MFAH 4JRXA 3OSKA 3FFCB 4ZDHB 2X9YA 4KROD 1BZ9A 1CLOL 2JB5L 5INDB 5CGTA 3WFBH 4JHBA 3VXPB 3V6FB 3Q6FA 5EFIA 2EE9A 4K94L 2Q7NA 2A9MH 3AS0A 3VFUB 5B39G 2B1HH 4OFPA 3B2UD 4K3JH 4J8RA 4HWBL 2E7HA 4PJ9A 2ITCB 5FA3B 1G9MC 3GSNA 4ZFOB 4J3OC 1L7IL 1VFMA 3VI3E 5E5UB 5I9QB 5ID1A 3D39B 2XWBB 2PW1A 4F8TA 5I1IH 1K6QH 3U30C 1H3XA 3KPMA 2UZIL 5GS2H 5I1KL 3DXAB 4CRPA 2VKWA 2Q8BH 4PFEA 3Q2CA 6FABH 5HDBE 2NXZC 3TNNB 1MJ8L 4W6YB 3QSKB 1AJ7H 4L9DA 3SDDB 1QBLH 3REVA 5F9WB 1FGNH 1XZ0B 4NYLB 5CJXC 5C0AA 1D3CA 2V6HA 4M8QB 1S7QA 2VZSA 1IQDA 2PW2B 3GMMB 1L6ZA 1FIGL 1JTPA 1WUNT 4HS6B 4GSDH 4Q0XL 1MEXH 2Z8SA 3ARTA 5CEYB 4R8WH 2ZUUA 3RWHB 5ETUB 1N2RA 43CAB 4LLQB 2E5EA 1FFNB 1NCBL 1U8JA 3F6LA 2KDGA 1IFHH 3W0WD 2R15A 1GH7A 3L5WB 4XCNA 3QRGH 5DFVC 3U9PL 5IK3A 2ILLA 2XZQH 1MJ8H 3CZJA 4GLRI 1H9VA 3BT2H 1JIBA 3S9DB 2XV6B 1MVUA 4OM0H 3X12B 5BS0A 5I1HL 4R4BA 1KIPA 4KTEL 4FOMA 3BKJH 4FFZL 4XNMB 3BJLA 5GS0L 1OLLA 1DQDH 2MKWA 3GGWA 3TVMA 4X7TB 5C08E 3HN3A 3LQMA 4KJQD 4JY6A 5C08D 1A4JB 3G5YA 3ZDYF 4KI1A 1K8DB 4H8WC 1IM9A 3OX8B 1LO3H 4ELMB 2H3NA 3ARPA 3DO7B 1SBSH 1S7RB 4OFKA 5JHDE 4Y4KA 1FNSL 3DXAE 4YFLI 5E2VL 2EIEA 5DD1H 5EUOF 1C16A 1BQLL 4YFDB 2YUXA 4RFOL 1SHMA 1IVLA 3MJGX 2OQJA 4PP1D 4NT6A 2GW5A 2ICWJ 2LTQB 4M5ZH 3VGFA 2CD0A 4ODTL 5IBTL 3O6FC 1IGIH 5I66A 3DV6B 1RK0A 1FNEB 2V2XB 5F9OH 3H6JA 4JO4L 4K9EH 7FABL 3GSVA 4EJ1C 1F6LL 3BKCL 4U1JA 4Z0XB 4YDIL 4Y5XB 5BVPL 3BUTA 4WV1C 1CXIA 1IC4L 4M61B 2Q1EA 3LKQA 3VA2C 1SMOA 4GO6B 3SQOL 4PJHE 3RWFA 1CE6B 2XT1B 1YN6B 2D31A 2NW2A 3VD7A 5E8PA 2VITB 4L8CB 4DKDC 1T1XA 1H8OA 3BYTA 5JO5A 3TT1H 5ALCH 1ZANH 2GFBB 3T0DA 1A0QH 3E3QC 2YEZA 4CKVX 5J12B 3PUCA 3DSFL 2GTZA 3E8UL 4L3EB 4FQLH 5SWZB 4EUPH 2CO7B 4QRTA 3RIAF 3IXTA 3RVVC 1OF2B 4FQQB 3MUGB 2OK0H 2FSEB 4P2YA 3WFCH 4QHUB 5AZ2L 1KTDB 4RGMB 3QNZB 1MFCL 1JF1B 3IDYC 1Z5LB 3PGFH 3B2VL 3I02B 1YY8B 1OTUC 3PWNA 2G9HA 4FQ1L 4P5KB 3AGVA 1G6RB 4S2SB 3KDMB 1GIGH 3ROLA 2X4UA 3UYOD 1LO5A 4H8WL 1BWMA 1MREH 3UBXG 4MDJA 5I1CL 4PJHB 3TGXA 5HSFA 4HKZB 5JMOC 3AREA 4HUWA 3ZSSA 3I2CL 4R96A 5DEGA 4AQ1B 2CKBA 5BZDA 2G75A 3MCKA 4FQLL 4P5MA 1I1AC 3ARYA 5J13B 4M1CD 4ORGB 1UCBH 4HKZA 2HTKC 1RD6A 4PBWD 1UYWH 1DBML 1HKLH 4X6DE 1S7WA 2NY6C 1XGQB 4LHQB 4Z7VB 4N0UE 3NVQA 1U93B 4HIHB 2Z9TA 2P5WD 3W81A 5ICYA 1NDMA 1CFTA 1D5ZA 4F33B 1EH9A 2PKDA 1BREA 4HX1B 4WV1B 3ARFA 2CRZA 4NKOB 3T4AB 4HS3A 1GGTA 4FQQA 5F72S 3BKMH 1PQZA 3GI9H 4UTAL 3T65B 3EO0B 5D2NB 3ZE0E 5T33L 2AJSH 1KCRH 2Z31A 3JWOH 5DJ6B 1CDCA 3LKPB 3LS5L 5HHXL 1IAOB 1JRHI 5H2BB 5BJTB 2IALA 2IWGA 4R90H 4HKBA 4P57A 3PIQA 3PV7A 5D7LE 1ZLSL 1JGLL 5HVGB 2HKHL 1AE6H 1QKZH 4OQTA 5FKPB 4G6AD 4LPVA 5CBAB 2Z0BA 3H9ZA 3LV3A 4UIMB 3NZHH 1P9MA 2OXGA 4UINL 1FNSH 4JFDB 1UXSA 4M00A 1MIMH 3PQYB 3V6OE 4GW4A 4Z7UE 3T8XB 3L3GB 1YEEL 3L7EB 5HJ3B 3A67L 3HKFA 4G6AC 1LP9E 1V7MH 4JFDA 3WYRA 2D7TL 2HT4D 1EFXB 1YEGH 5BRZB 5GJTH 3OPZH 2C3GA 1ONQB 3AC0A 1QSFE 1A3LL 1CD1B 4U6XB 4F7TA 2AJUH 3GSWA 5I1GL 2QSTA 3QHFL 5EIIB 1IAOA 2CLZB 3U0TB 1HH9A 4ONOA 5GGSY 3LKPA 5J6GB 2GJZA 3SDDD 4D94A 4L4VD 1NUFA 5IFAL 3GSUB 2Z8WC 1V7NH 2PO6C 4HIIA 4L4VE 1FFQA 3RWJA 3TBWA 1JBJA 1WCQA 4JPKH 2A1WL 3G5VB 1NJ9B 1PQZB 1HIMH 1G7PB 4LASH 4G7YH 3P4NB 4XH2B 4KMTH 2R39A 5GGRA 4DZ8B 1YN7A 3KS0H 4MMZC 3SKOA 3OZ9H 5ICYB 4RFNC 2ZUQC 2P8LB 4CW1A 1Q0XH 4NHUA 5T1KB 4P49A 3B9KB 3QUXA 5GPRA 1C12B 1JL8A 4C56B 1D5IH 5E5RB 3LCYA 4LRIC 1S9WA 1EEQA 4MHHI 1NKOA 1C08B 5DSCA 4KJYA 2HJFB 4OM0L 3X12A 1JF6A 3DVIA 3PXHA 4ZUSA 5EORL 3G08B 3UPRB 3MXWL 3STLB 2NY4D 4PB0L 3NAAH 3WO3B 3MJ7B 4RSVA 1I8KA 2I26N 3RDTB 3TIEA 4UDTB 3FO1B 3MBXL 5KS9B 4ZMAT 4JN1H 1ZS8B 5SWZD 1FVEB 1VFAA 4L1DA 5DQ9B 3EYQD 1PJ9A 2EKSB 5D6DA 3OXSB 5ACLA 5IEKB 5IGXH 5KSBA 2H6PA 2X4UB 3MLXL 4P2OC 2APXA 5JUEH 3FO9A 5HYQA 5DMIL 4BSWA 4HIJA 4XPGL 1D5BB 3DECA 2UYLB 1FLRH 3CAFA 4BM7A 1IAIH 3KPOA 2N7AA 4TSAL 5SX5H 3TA3C 1JZ7A 3QQNA 1FN4B 1Q0YL 2FSEA 5CJQL 1K3ZA 3IJYB 1S78D 3U79A 3EBAA 3E3QE 5AZEH 4WFHD 3PWLA 2JK5B 4P3CH 3SDXB 5AAWA 1T6WA 3DX9A 1N59B 1FAKT 4YHZH 1UM6H 5LJYH 4XNUL 4GRWF 5L0QC 4UOJA 1T22B 3CH1A 3GSQB 3IVKB 2FYYB 1EZVY 4MYWB 4PRHB 2OL3A 3DBXB 4JGJA 4RDQG 4NKQB 5C3LD 1CLOH 1JHLL 4NP4L 5E6YA 3SDCB 1RSFA 3D25A 4HK0A 1A6ZB 4FQPA 1INQB 5DZOA 3BZ4B 4DKEH 3LKSA 3OKLB 5SX5K 3L5HA 1IAIL 5GJTL 4AK1A 1K85A 3ARBC 3CNKA 1VFUA 5LQBL 2F74A 3DMMB 2DI7A 4G9FA 1LO4L 1KPVA 1JN6B 4HF5H 3KJ4C 3WEXB 5MEQA 1JRHL 1JFQH 4KY1H 3S4SB 4QRUA 1LD9B 1NCWL 2NLJA 5KVEH 1ZVHA 3ZT6A 3B3IB 5HHVH 5J56B 5JTWA 4RMSA 5T5NF 4HAFA 3ZZ1A 5FK9B 1ULVA 4LF3B 4LAQH 4Z7WB 4GW5B 4NWUH 4FABL 3LKRB 1PY9A 1NCAL 1T03L 2BVOB 3EOBB 5EU6A 3MGTB 2BSRB 5C6TH 1KYOJ 1JJUA 2FD6H 3D18B 1CG9A 4OAWA 3ORJA 3B6SB 3MLRH 3C08H 1IGCH 3DX7A 1F3DJ 2H26B 3C5JA 1GOHA 4FFVD 3WFEL 1N8ZA 4S1DD 5FIEA 4U0QB 4Y4KD 5HYJE 1XF1A 3IETB 4RISH 1QRKA 3SQBA 5IQ7L 1KJVA 4DKAA 2NY5H 4PRHD 2ESVD 1OT2A 3GHBH 2BVTA 1BD2A 3P3YA 4ZSOA 4G43B 1NFDF 1A7NH 1VESA 5BW7C 3QIBD 4P99A 5H94A 4BZ2L 4MWFB 1YPZF 2J7LA 1RZ7L 1BD2E 5D7KE 4Y2DC 2V2WA 3ZL4H 3HNSH 4QRSA 2AABH 2CQVA 5D4QA 4RISL 4J6RH 5K9KA 3NA9L 2BX5A 1ZLUK 3SDCA 5EC2B 2KBGA 3QQ3B 1X6NA 2WP3T 3VH8B 5FGBC 2VDRH 1NEZA 2F74B 4GW4B 3P4OA 2NY3B 4UNUA 4RMQA 5EOQL 3X3GH 5JORA 1MJJB 2H45A 2HTKD 3INUL 4OZFB 3TBTB 3TNNA 1B0RB 2DLHA 4WEBL 4OLWL 5DF0A 4X83A 2R0WH 4B7IA 3BPNC 1CYGA 4HCRL 2ZUSA 3CZFB 5IVZA 1YEFH 2M1KA 3PWLB 4XNXH 2EECA 1ADQA 3UO1L 1Z9SA 5AUMA 4P46A 4PRDB 5C0GA 1ZLVK 2FX9L 1NEZG 5F89A 1FO0L 1RZJH 4OLUL 3ZMRA 3WE6A 2GSIB 1IAKB 5FA3A 3HE6A 3PGDA 3BI9X 4R3SB 1KG0B 4GLRH 3GIVA 2DDQH 4XPBL 1R3LA 2XWTA 1F58L 5FO8B 2P8PB 4BSWB 2KQNA 3BP5B 5GS0C 3EFDL 3O3EA 1DBBH 2QKIA 2X4SB 4YXKL 3QRFM 4LCCA 4E42B 1DDHA 3K74B 2IH3B 5TQ0H 3HAEA 5C07A 3SOBH 3CX5K 4AG4H 1BVLA 1L9NA 3CGTA 4OM1H 4QRRD 3LPWA 2QQQA 3QAZB 4ODSL 2OSLA 3EDFA 1PKQB 1IKFL 5A40E 4QXGH 1ZANL 3ZDZF 1TVBA 4Z7VA 4BSVB 1RPQA 1URLA 2HJFA 1KT2B 5T1DH 1I1FB 5DA4A 3ILPB 4XBPB 4XZUA 4WWKC 3C60A 3SDYL 3BUYB 3V5KA 4ORGA 3HAEG 2AK4E 4M7ZC 3QQ4A 4NGHH 1QSFA 4NO3B 4PR5B 3TIEB 4IOIB 4RGNE 5LCVH 3P11L 1KNOB 3W2DH 3ZHKA 3MNWA 3JWOC 1CIUA 4OCNC 4N0RA 4JDTH 1DUZA 4M5YH 1DBBL 4OGXL 4OCLC 5B3JE 4TRPL 5GRZA 1QPPA 1NMBH 3O9WB 3NZHL 4MAYD 4DOHB 4NUJA 1IM9D 2GYSA 1T04B 2MPAH 3CXDH 4F7EB 3QBTB 5EPMA 1NGYB 3AB0C 1KCLA 4MS8C 1JF1A 4QRPB 1L9MA 4P4RB 1X5XA 1CGWA 2X4TB 1RFDL 4H20H 2JCCE 1RUPL 4NO5B 1CU4H 5EZOL 1HQ4B 2CK0H 4GRLB 3MUGA 1KIRA 5EA0L 4NNPH 4UV4L 2DQDH 4NZJA 2XTLA 3FFDB 3VFRB 4XCFH 5CJBA 3D85B 3P11H 1T83A 4PJXB 4KZEH 1YC7A 4TUKL 3P0VH 5I1EH 2VDRL 1X5LA 1E4KA 2QADD 3KNBB 1CQYA 3QNXB 4CU8A 1BPVA 4OGAC 3X17A 1U9KA 4P9HH 4U6XA 4F7TB 4KI5E 1S9YB 2VISB 3DROA 2VDOL 3MA9L 3S5LG 3SJVA 3OXRA 4QWWD 5HI5D 3B9DA 4UINH 4HK0B 1AGFA 4O02H 5C2BH 4U31A 1OTSD 1D5IL 3KYMA 4EIZC 1HKFA 1AGBA 4Z7VE 4PJ8C 1CFSA 1J0HA 3MJ8A 4GAGH 4NM4H 2F15A 5FGSA 3GBML 4W4OC 2AQ1A 2CR3A 3CH1B 3GSQA 4O5LH 3IVKA 1F8TL 5IVXB 1D5XA 3OBAA 4BUGA 4HIXH 5BRZE 2YC1A 2PYED 5FKPA 5C0EA 1KSRA 4MXVE 2V5RA 3EO0A 2R2EA 5DS8A 1GHFL 5DUBA 2BCKB 4X4XA 3ZKXC 4JQIL 5IVXE 4GRLA 4JKPL 1A5FH 1FZMB 1CFNA 4JZNB 3KPLA 1S9VA 2E7LC 2IBBA 4XPGH 4LP5A 2FJFB 4ZG1A 3QFJD 4DVRL 1CFVL 4UQ3A 5BV7B 3PP3K 1FE8L 1A6VH 1NPUA 4WUUD 5FECA 1JUFB 3QO1A 2ADFL 1DFBL 3DVNB 4JFDE 4Y4HD 4HUNB 4ERSH 2DWEB 3BQUD 2ORBH 1I8MA 5E4EC 1XCQA 2RB8A 5D7LA 2DLIA 2DM3A 5SWSB 5HYSB 4R4FL 4WWKB 9CGTA 1UGNA 1NBYB 4G7VH 5H37G 3GEWB 2BSSA 3SGJA 1OP3K 3SKJH 5ECJE 5F6IC 5C9KA 3QO0A 4L3EE 1XCQB 4YHKH 5IIEB 4PGBA 4OZIB 4PJ8D 4LPYA 1FL5A 2F5AH 4X4MA 2CKBB 2A83A 2V5TA 3RWIA 4YFEA 4X9BA 3GZKA 3DVNA 1E4XL 3AREB 4HUWB 5HI4C 2O5XL 2P5WB 3E6HA 4ZOAA 4M4RA 3RL2B 2EDOA 4F8QA 4L8SB 5EG6C 4IIQC 2ORBL 3BZEB 4UNTA 2Q86A 2VZUA 4AIZA 1NJ9A 3C9NA 3C6LC 1DFBH 1P7KB 2YD6A 5IESH 1WFUA 3SKMB 3M17A 3GKWL 2R69H 3TWCH 3QXVA 5EIIA 5CD3B 5D2LF 2FR4A 1QR4A 4MJ5B 1K6QL 2MKLC 4LPCA 4PJCB 4PY7B 2R2EB 5DS8B 1BF8A 5E4EB 5JA8B 4HC1L 2D7NA 2YC1B 5FCUH 3WJJA 1FYHB 1EFXA 3RL1B 1NKRA 5EO1B 2F53E 2VTFA 1FZOB 5EWIL 3QPXL 4I0PB 3GMQA 4TQEH 2F53D 5JHDA 4MZ2A 2EXYD 5KVFL 1RJYB 2Z93A 3LEYH 4DN3H 3GJFH 2FBOJ 1AGBB 3P9MA 5ANMB 3SO5A 2WK2A 4K9EL 2NTFB 5TDOA 2NX5A 3SY0B 4LCYA 3FRUB 3WIIH 2X89A 4J4PD 1JPSH 4RAUA 3LV3B 2QHRH 5A2LH 3V2AR 1T2QL 2BY1A 1I4FB 4I3GA 3DVGB 5LAXA 1C7TA 2K7PA 5IQ7H 1OGAE 5ITFA 5GGQH 4Y5XA 4HWEL 3PIQB 4ODVL 3BGMA 1HILB 2QL1A 3T1WA 4PLKD 5DJXB 4OZIF 4UILL 2FRGP 1J8HB 4LKXB 4P2CG 4S1RL 3BDBA 3C5ZC 3EOAA 4F7CA 5D2NA 1QLFB 3HE7C 3CVHH 2XRAL 5LGHH 3RAJL 1QSVA 1HHJA 5HHMB 5J8OA 1G7QB 3L95A 4NDMB 4OD3H 4KRPC 5I1GH 4KH2A 4NN6C 3TVMC 4HX1A 1EO7A 4PJFA 1RVFH 1WBYA 1NDMB 3B6SA 2DLFL 2JELH 4TVPH 4WEBH 2Y5TB 3OAUL 4A6YA 2Y7QB 3PJSA 1BAFL 4U1SA 4F7MA 2CDEA 3D5OF 1M6OA 1LP9B 4KTEH 4NBZB 4OCMC 3EZ8A 2PTTA 5GSRA 1VCAA 1NCWH 4PPTA 3B2VH 1KB9J 1H3PH 3IFPB 4N8VB 3OPZL 2EC9U 3EIFA 4QNPE 2V5YA 4XCCL 3BXNA 4RA0C 1RUAL 3MRRB 1AP2A 1FO0B 2EYSA 2DTMH 2VRAA 4JDVB 4HGKC 3WBDA 4OZFG 4RNRB 3SDXF 2ZUQB 5HGBA 3K80A 3HE6D 4UV7L 4PLOB 5E2WH 3T0ED 1T4KB 1UXWA 4R26L 2V9QA 3TJEL 3EYVA 3O9WC 1YJDH 3RWCB 3B4NA 4I4WB 2VLJE 2WM0A 2Q7YA 2VL5B 4YDVA 3GBNL 5GISH 2QKIB 4M8QA 3LQZB 4XRCB 2KKQA 3I50L 1LE9A 3AMKA 3F7YB 3BKYH 1DBAH 3RX8A 2VZ1A 3VMNA 4XTRC 2P7TA 1OW0C 4K7FA 4LVHC 4EI6A 1MIEL 4X6CA 4U05A 3PL6B 5JOFA 3QDGB 3PG2A 1U3JA 2IQ9L 4XI5D 1OP9A 1GOGA 3TO2B 2ZPKH 3VRJB 4KUZL 2FHBA 2VDMH 3PWPE 2FGWL 4X99B 4UV7H 1JMZA 3AMLA 3VGHA 3GSNB 3MRNB 4OZGA 3Q0HA 4XPTL 4LLMB 5HHNA 1DBJH 5DK3A 4UT7L 4Z7UF 4G8IB 3BPLB 5FYJE 1P7QB 4Z0XA 1SMAA 4HK3J 25C8H 1J11A 3KPPA 2DQIH 3IAQA 1PX3A 2P5ED 4HWZA 1NBZA 4GOSA 3PHQA 1FH5H 1VGKB 3FONA 3SBWC 1KENL 2G2RB 5CINH 1A6AA 3SOBL 1MUJA 3MYZA 4OD2B 1JGEA 1XF3B 4APQA 1RZ8A 2EDRA 1E4WL 2FH6A 4GMTH 2ZNWA 1R3JB 5HI3C 4ZPTB 1XF2A 4KQ3L 3IT8D 4XVUD 1N5YH 3D69B 4OKVB 3WNKA 4HQQL 4EDXA 2V2TB 3MJ7A 1ZK9A 1W0YT 5HYFA 4ZTPH 2WUCL 3MZTA 3UTPD 1KCVL 2XTJC 1C08A 5DSCB 4Y16A 5ESQA 4P59H 5F8RC 1MCNA 1QD0A 3OR7B 1FL6B 1I1YB 3VI3F 1I8IA 1U8PA 2V17L 2Y6SD 4GG6B 2Y5TA 3CPLA 2RHEA 3BHBA 3FHQA 4FQHA 1WAAA 3CFJB 3LZFH 3PNWA 4WUUB 3LEVH 2FGZA 2RGSA 4HV8B 2VL4A 5GRUH 1EGJH 3MCLL 5E24E 4K94H 3CVHL 2IJ0C 4JPVH 4Y1AB 4HQQH 4MNQE 2VUYA 4HJJH 2NY7H 1TMCB 1NGXB 5E99L 1KLFA 1JPTH 4DUVA 3NGBC 2C1PA 3O6FD 4TULH 3VFSB 5IBUG 1WZKA 5DYOB 1ROWA 1FNGA 4M9OA 1BVKB 5GHWL 5HHOD 4U7MA 4OV6F 1DUYB 5DHVH 4X5WB 2E9WA 2B0SL 4X6DA 3TYGH 2EKJA 2G2RA 5CJOL 3WEXA 5MEQB 2PW2A 5IR1A 3QWOB 5A3ID 1IGML 1P7QA 3NOIA 3HRPA 3BVNA 5IFHL 1OTSC 3GDBA 4YHPB 1CI5A 1BQHG 1MVFA 2A9NL 3HFMH 4IOFD 3PDOB 5IESL 3GKZA 2DB8A 2W9DL 4FTVD 1A6ZA 5D1QB 5BXFA 3IGAA 5JPNB 1T80A 3RY6C 4KWUA 3CC5A 4G42A 1SVZA 4AEIL 1IGYB 3WD5L 3FQRB 4Z7VF 1AKJD 2Y6SC 3TH2T 3UTOA 3W5MA 3JSSA 3UAJC 4NSKB 4IDJH 3GJFA 4XBGB 4YK4C 3RNQB 4OM1L 3KPRE 3DRQA 4NKIL 1A6UL 1BFTA 3P77B 1P7KA 1A2YB 1UB6B 3VDBA 2K3TA 4MCZA 1LE9B 3VG9B 4LCWE 3I9GL 4NRZB 4Y1AE 2WW8A 5ICXB 4GRWH 1KPRB 4HBCH 4KAQL 4Z8FL 3VXUD 1MQKH 4OLXL 3GM0A 1YC8A 1S9KC 4JM2F 4PTUB 3R8QA 3GB7A 4QCIA 4DTGL 5A16A 1U3YA 1Z3GL 2IH1B 4Y2DA 5HD8C 1CR9L 3OG4B 3S35X 4PUBH 1J1PH 4HIJB 3HE7A 1AFVL 5JZ7C 4Y19B 4JRXB 3FO9B 1KCVH 3GSXB 5HGBB 3HHRB 2VB5A 3GSRA 3GJEA 3O9WD 2OMNA 4GG8B 5DFVD 1WBXA 1HXYA 4H25B 2NY6B 1X5IA 1VA9A 3S8WA 5IMMA 4HIXL 1TTFA 4RZCA 4DGYH 1GC1L 1YY9C 5HYSA 4JLRA 5D7LB 5HYJA 3NPSC 3MUZ1 3HZMA 1ZA3B 2BSTB 2PTVA 4OF0A 1R5WA 3GI8L 3OKMA 5EIVA 1GGCH 5DJYB 1A5FL 4M43L 4QHNA 3GMNB 4PJ5B 4JE4B 4N8CL 4WHCA 1R6VA 3H7BA 4EUPG 3IFLH 2WV3A 2EYRA 3GJEB 3KDMA 4MAYA 4U1SB 1KB5B 5D7SL 3RTQD 2B1AL 5C9JB 1JHTB 4DVRH 3I6LE 2A73B 1ZE3C 2AERT 4CW1B 3ILQC 4I2XE 1WJ3A 4DCQB 2H32A 5CHNB 1S9VB 1X5YA 2GK2A 2QTEA 2BDNL 4KK6D 2IANE 5D2NE 1OGTB 5GGRB 4DZ8A 1Y6NR 2AEWA 3FAXA 5IB2B 4EI5A 4XNQB 1CL7L 1G9MH 2EDDA 4I3SH 2WINB 3QCVL 4HBQA 5E5MA 1A0QL 3RWJB 1KFAL 1AXTL 1QFWH 3IKKA 3DUSA 1A2YA 1UB6A 2B4CC 3QUMA 5I30H 4BFIA 2A74B 2B1AH 5IFJB 3UPAA 1IJ9A 2LVEA 4K3EH 4NSKA 2F8OA 4TOYH 1YYLL 4MJIA 1RAMA 3MSPA 2H2SD 3U7WH 4OZFH 1J0YA 2OS7A 4MA1C 2IPUG 5J6HB 5K59F 1DJSA 2X5PA 3PDGA 5B21A 1Z0MA 4R97B 5EWIH 3RHWK 4PLNC 3O6KH 4X4ZA 4KKAD 3MX0A 3WV0A 3ROOA 1RZIA 4I2XB 3TCLB 2SEBA 5C0RL 3T0EE 4I0PD 1AGEB 3MYJA 1JPST 2BSED 4G6ML 4E0RA 4O9HL 4XCCH 4UIKH 2CMRH 5DJDA 4Z7UA 1BOGA 1U91B 1VGEL 4D3CL 3HCVA 2OR8A 3T0BA 3H7LA 2IPKB 5F88B 2OQJB 1TZIB 3GUTA 5F1IA 5H8DA 1T03H 5ALBL 1GC1C 5IFHH 2JCCA 4PJXE 4PP1C 3FT4A 2QV2A 5FYKD 4UNVA 1MJ7L 5F3HB 1JV5B 4Y8DC 1N3NA 2YPLD 4NUJB 4JM2C 4P0DA 3AXLB 2HN7A 1JPGA 4R97C 4LLVB 2ZSVA 2H32B 4X8JB 5FOBA 3MLSH 2VDLL 1EAJA 1AC6A 1SJXA 1KELH 2E8ZA 4XNUH 1ACZA 2G5RA 1T5XB 2OTWB 3WKMH 4IRSD 4NRYA 3MR9A 1I9RL 3K2MC 1LK3L 5C09D 1N6UA 4QHNB 1IC7H 4Z9KB 3V6ZA 4AG4L 3ULVD 5CKAA 4NP4H 4LIQH 5DRXB 2I5YH 2VOTA 2J5LB 4JO4H 5HDLA 3JWOL 3BIBX 4PV8B 1M7DB 2BFVH 3RNKA 3ARZA 3TZVD 4XCNB 4JFYB 4U1IA 1FQ9C 3CXHK 3T0EB 2J4WL 1P9MC 2P42B 5I15H 4DK3A 1NAKH 1XT5A 4QF1A 1PVHA 3BSZL 4TNWF 1V05A 4C83A 3QWQB 5IW6A 3H9SA 4MD4B 2NMSA 4PJDB 1S5HB 2HT3C 3MGOB 3OG6B 4KQ4L 3F8UB 4KRPD 2P8PA 4Y4HC 1XIWD 3BN9C 4M62L 4QHMA 1CWVA 1WT5A 4UBDD 3ALXA 2Z91A 3BZFB 3QIUC 3B9AA 4M7LH 3ZE2E 3UCRA 5IHUH 1OF2A 5TH2B 1F4WH 4QRTB 3UXFA 2JJUA 5SX4H 5HGDA 1ZKAA 4X6CB 3EO1B 1F2XK 1DEDA 3NA9H 4D0CA 1KJ2A 3GJFB 5AWNL 3QUYD 4IRJA 5JDSA 1A9EB 4LCIH 2A2QT 5DR5H 4XAWH 3WS6A 1OAUH 1FDLH 5FDYA 4TVSa 4PJ9C 3TPKA 1FV1A 2FGWH 3IU3B 1AGDA 1U41A 4WNQB 1TJGH 1MREL 3RWCA 3L5IA 2GEEA 4J4PA 4PRAA 2VQTA 4P9MH 2HG5A 3O4OB 1P4LA 4RQQB 1T3FB 1Q9KB 5FO9B 4PG9B 3V5HB 4UOW0 1ORQB 3B9EA 1TIUA 4G43A 3G5XA 3H9YA 5FEBA 3F7VA 4RGNC 1OAZL 3LIZH 1RI8A 3LRHA 1FFRA 1KEMH 1CICC 1R24A 1MI5B 3D3VB 1R3IH 3EDEA 5E1AB 3B8YA 2VDML 1MWAH 2WINA 3HG1D 32C2A 3MUY1 4HEME 5D7JD 3GRWH 3VXQA 1B90A 4HUVB 5I75B 3L5XH 2IADB 1KCSH 4E5XB 4GRMA 1NCUA 4K71C 5DHYA 1NC2A 3H3KA 4XMKH 5BMFH 5JPMB 2YZ8A 4BA8A 4KJQC 3DUUA 2A9NH 5FV2A 3CMOH 3U0WL 1KEGL 3F5WA 5DJAA 1YA5A 4PRIE 5ID0B 3ES6A 4PYGA 1JHTA 2EIDA 5D7JC 3WHXB 4L4JA 2JJTA 1IMHC 1T2JA 2DJ4A 4HV8A 5JPMA 4PJFB 3DVFA 1NGZB 5EU6E 5ISZB 3DGGA 3LEVL 1MRCH 4U3CA 1NGQH 3MO1B 4MXWL 3IDNB 2I9TB 4ENEC 4RGND 1KYOK 3CLEL 1EV2E 1FE8H 4PRNB 3RVWD 3LS5H 3LEXB 3ECBB 1JWMB 5A43C 4NQTA 2LTQC 3FB8B 1GPOH 4F58H 1AXSA 1HYRC 4MA3B 2NXZD 2NYYC 4BH8A 2P49B 3VFWA 1K8IA 2W9EL 1UCTA 4TNWK 4LHJB 3VCLB 5IK3B 1AD0B 4DKFL 4PY8I 4XMLL 4KGJA 4PG9A 3V5HA 3KXFD 3VWKD 4C57C 1NLDL 2Y07L 5ETUA 4PJ8B 1UVQB 1MQKL 1CDIA 3O41B 4X6BA 3VD9A 5IKCB 3FONB 4HZLA 2NTFA 5TDOB 2EEAA 3GMMA 3IRZA 3O3EB 5J11B 2XWTB 2Y06H 4I18C 4TUKH 1BAFH 3UTQA 2IBZY 5K33A 3GIZL 4I0CC 3EYUL 5EZIL 5J12C 3WIHH 4U33A 4LLUB 4Y4HB 4HKXB 1OAUL 5D5ME 3HI1B 4M6OL 2OXHA 4F15C 2PR4H 1PEZA 1KCKA 2X4PB 3ARDC 1I7RB 3QRGL 3U4EB 3U9PH 4NM8H 3PHOA 2AI0L 5C0CD 4LSVH 3TZVC 3MJ9H 3BOVA 4LLDB 3O2DH 2X4OB 3LAFA 4XVUC 2YBRB 1P84J 3QULA 3A6OA 5C0DB 2K7QA 2EDJA 4JREC 4GKNB 3V5DB 3JWDC 3D9AL 4JO1L 4D9QE 3P30L 1VEPA 4H1LA 3BPCB 1DE4B 5E2UH 5EN2B 1HINL 4ZUTB 3U46A 5T3ZH 2GUOB 2Y36H 4PJ8A 3TJEH 4X9FA 4LARH 4FQJL 1F3JB 1I75A 2QADC 2R9HD 4FQ1H 4LDLB 1DE4A 4PUBL 4LOUC 5DZLA 4HD9A 3Q3GA 3VCLA 3SKNB 2XA3A 1HQRB 2V7NA 3GHEH 3WS3B 3CSYA 1AP2B 2WBJA 2LVCA 1DQTA 3D0VB 3SGKA 1F90H 3QEGL 2EC8A 1FPTL 5JIHA 1WSST 4FXKB 3FQUA 5F9DC 5ISZA 1YPZB 1SY6H 1FBIL 2WWMC 3MREB 3HC0B 1NCDH 2UWEE 1FFOB 2DMBA 2Q3ZA 2WWKO 1NFDB 4JRYB 1WQVT 3D85D 5D8JL 1DL7L 5FYJH 3K2UH 1JNJA 1QSED 2BOCA 4IM8A 5DHYB 4KFZC 3QXUA 5GQBA 5J1SC 2CK2A 3VXMB 5E08H 2IADA 4RFOH 5IM7A 8FABB 1QBBA 5EUKA 4PD4J 1AD0A 2FWOA 4MNQB 4P46C 4XXCA 1EIBA 3HZVA 2W65B 3FT2A 2VLJA 4OIAA 4ZPTA 5FCSH 4E41E 3ARFC 1J8KA 3KLSA 3HS0B 4N5UA 3PWVB 3U7AA 3UBXB 5T1LD 3QNYA 2XTJE 1FZKA 5HJ3A 2FO4B 1JPTL 3DMMA 4FTVB 2FEDC 5HBBA 2XFXB 4PG2A 4RBPK 3SE3C 43C9B 4O2CA 3SE8H 2C26A 1NGZA 1LDPH 1U3ZA 4LCCC 2J1KA 1JPFB 3MLYL 3MRPB 5SWSE 4HH9B 3SCMA 5H35A 4JZJA 4MVBD 4M1DH 3KNBA 1IKNC 1ZHLA 5BJTA 1FZOA 3QPXH 3QUML 1WF5A 1W0VA 3I6GB 3MRBA 3C6SB 4QOKA 5DFTA 2W0LA 3D85A 3BKYL 4JQVC 1II4E 4TSAH 2YA1A 3OAZK 2W9LA 3PL6C 2AJYH 3C5ZA 2BK8A 4YQXH 3CUPB 5C71A 3WIIL 3ILQD 2X7LA 5MI0C 1ZHBB 3MRLA 3BPOB 5E03A 3MLRL 3ARFB 5T3ZL 3SKMA 5IMKA 4WW2A 2YOCA 3HPLA 1AHWC 1HKLL 3RUGF 1CDGA 3MRQA 5EZLB 2K1MA 3WHE0 4Y2DD 4ZOBA 2YPVH 2BY3A 1CQKA 3H9SD 4PJGF 3MNZB 2ADGA 2C3WA 4YZFE 1OAYH 3ZTJG 4Y19D 2VWEE 5TGBA 4ZUWA 3NFSL 3RL2A 2AK1H 3MJ9L 1QFWI 4PRBA 3QWRA 3T0EA 3KPNA 3OKMB 1JZ6A 1A1MB 1INEH 3VXUB 3JWDH 5C0AD 1FZJA 2HTLC 3RDTD 1HI6B 5HY9B 4WVRA 2C4XA 2V7HA 4BZ2H 5MENB 3WFCL 5IEHA 5HDOA 1YEIH 3MACH 3X14A 1DZBA 3RIFF 4ENED 2A9ML 4P9HL 1VSCA 2CLVB 1CGVA 4YDJB 5JOPE 1E28A 3RKDD 3GSRB 4S2SA 4QXWA 4NKIH 4IDLA 1I8MB 3V7MA 1HSBB 3CFDA 1U8OA 2HLAA 2I24N 2UVFA 2V9TA 2RBLA 3SKOB 2HWZL 4OCSL 1OPGL 4LLYA 1CF8H 5BS0D 1PAMA 1BIIA 2DL9A 1KPRA 3I50H 1R5IB 1N3NB 1CR9H 2WIIB 3U7YL 3TBWB 1ZWIA 1RULH 3RAJH 5C2UB 2FBJL 1PZ5B 4JM2D 4WI5A 2GK0A 5FUZH 1RZGB 1YNKH 2YSSA 3UMTA 2Z8VC 3OKDA 4KKNA 3AU1A