1FM2A

The 2 angstrom crystal structure of cephalosporin acylase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
QAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPEVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
publication title The 2.0 A crystal structure of cephalosporin acylase.
pubmed doi rcsb
source organism Brevundimonas diminuta
molecule tags Hydrolase
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 3.5.1.93: Glutaryl-7-aminocephalosporanic-acid acylase.
pdb deposition date 2000-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 1fm2A00
4PELA 1KECA 4WKTA 4BTHA 2ADVA 1E3AA 1JX9A 1AJNA 3JTQA 1GM8A 4YFAA 1K7DA 4E56A 4E57A 2AE3A 1GK9A 1GM9A 4WKVA 1GM7A 3SRCA 1PNKA 3S8RA 4E55A 4K2GA 3L94A 4YFBA 2WYDA 2AE4A 4PEMA 4M1JA 1JW0A 1AJPA 1K5QA 1PNLA 3JTRA 3K3WA 1AI5A 1OR0A 4HSRA 4WKUA 4K2FA 2WYBA 4WKSA 1AI7A 3ML0A 4YF9A 3SRAA 1FXHA 2AE5A 1FM2A 1H2GA 2WYCA 1GKFA 1AI6A 1KEHA 1GHDA 1FXVA 2WYEA 1GK1A 1GK0A 1AI4A 3SRBA 1PNMA 1AJQA 1CP9A 3L91A 1JVZA 4HSTA 1K5SA
chains in the Genus database with same CATH superfamily
4PELA 1KECA 4WKTA 4BTHA 2ADVA 1E3AA 1JX9A 1AJNA 3JTQA 1GM8A 4YFAA 1K7DA 4E56A 4E57A 2AE3A 1GK9A 1GM9A 4WKVA 1GM7A 3FGTA 3SRCA 1PNKA 3S8RA 4E55A 4K2GA 3L94A 4YFBA 2WYDA 2AE4A 4PEMA 4M1JA 1JW0A 1AJPA 1K5QA 1PNLA 3JTRA 3K3WA 1AI5A 1OR0A 4HSRA 4WKUA 4K2FA 4BWCA 2WYBA 4WKSA 1AI7A 3ML0A 4YF9A 3SRAA 1FXHA 2AE5A 1FM2A 1H2GA 2WYCA 1GKFA 1AI6A 3FGRA 1KEHA 1GHDA 1FXVA 2WYEA 1GK1A 1GK0A 1AI4A 3SRBA 1PNMA 1AJQA 1CP9A 3L91A 1JVZA 4HSTA 1K5SA
chains in the Genus database with same CATH topology
4PELA 1KECA 4WKTA 4BTHA 2ADVA 1E3AA 1JX9A 1AJNA 3JTQA 1GM8A 4YFAA 1K7DA 4E56A 4E57A 2AE3A 1GK9A 1GM9A 4WKVA 1GM7A 3SRCA 1PNKA 3S8RA 4E55A 4K2GA 3L94A 4YFBA 2WYDA 2AE4A 4PEMA 4M1JA 1JW0A 1AJPA 1K5QA 1PNLA 3JTRA 3K3WA 1AI5A 1OR0A 4HSRA 4WKUA 4K2FA 2WYBA 4WKSA 1AI7A 3ML0A 4YF9A 3SRAA 1FXHA 2AE5A 1FM2A 1H2GA 2WYCA 1GKFA 1AI6A 1KEHA 1GHDA 1FXVA 2WYEA 1GK1A 1GK0A 1AI4A 3SRBA 1PNMA 1AJQA 1CP9A 3L91A 1JVZA 4HSTA 1K5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PEL A;  1KEC A;  4WKT A;  4BTH A;  2ADV A;  1E3A A;  1JX9 A;  1AJN A;  3JTQ A;  1GM8 A;  4YFA A;  1K7D A;  4E56 A;  4E57 A;  2AE3 A;  1GK9 A;  1GM9 A;  4WKV A;  1GM7 A;  3SRC A;  1PNK A;  3S8R A;  4E55 A;  4K2G A;  3L94 A;  4YFB A;  2WYD A;  2AE4 A;  4PEM A;  4M1J A;  1JW0 A;  1AJP A;  1K5Q A;  1PNL A;  3JTR A;  3K3W A;  1AI5 A;  1OR0 A;  4HSR A;  4WKU A;  4K2F A;  2WYB A;  4WKS A;  1AI7 A;  3ML0 A;  4YF9 A;  3SRA A;  1FXH A;  2AE5 A;  1FM2 A;  1H2G A;  2WYC A;  1GKF A;  1AI6 A;  1KEH A;  1GHD A;  1FXV A;  2WYE A;  1GK1 A;  1GK0 A;  1AI4 A;  3SRB A;  1PNM A;  1AJQ A;  1CP9 A;  3L91 A;  1JVZ A;  4HST A;  1K5S A; 
#chains in the Genus database with same CATH topology
 4PEL A;  1KEC A;  4WKT A;  4BTH A;  2ADV A;  1E3A A;  1JX9 A;  1AJN A;  3JTQ A;  1GM8 A;  4YFA A;  1K7D A;  4E56 A;  4E57 A;  2AE3 A;  1GK9 A;  1GM9 A;  4WKV A;  1GM7 A;  3FGT A;  3SRC A;  1PNK A;  3S8R A;  4E55 A;  4K2G A;  3L94 A;  4YFB A;  2WYD A;  2AE4 A;  4PEM A;  4M1J A;  1JW0 A;  1AJP A;  1K5Q A;  1PNL A;  3JTR A;  3K3W A;  1AI5 A;  1OR0 A;  4HSR A;  4WKU A;  4K2F A;  4BWC A;  2WYB A;  4WKS A;  1AI7 A;  3ML0 A;  4YF9 A;  3SRA A;  1FXH A;  2AE5 A;  1FM2 A;  1H2G A;  2WYC A;  1GKF A;  1AI6 A;  3FGR A;  1KEH A;  1GHD A;  1FXV A;  2WYE A;  1GK1 A;  1GK0 A;  1AI4 A;  3SRB A;  1PNM A;  1AJQ A;  1CP9 A;  3L91 A;  1JVZ A;  4HST A;  1K5S A; 
#chains in the Genus database with same CATH homology
 4PEL A;  1KEC A;  4WKT A;  4BTH A;  2ADV A;  1E3A A;  1JX9 A;  1AJN A;  3JTQ A;  1GM8 A;  4YFA A;  1K7D A;  4E56 A;  4E57 A;  2AE3 A;  1GK9 A;  1GM9 A;  4WKV A;  1GM7 A;  3SRC A;  1PNK A;  3S8R A;  4E55 A;  4K2G A;  3L94 A;  4YFB A;  2WYD A;  2AE4 A;  4PEM A;  4M1J A;  1JW0 A;  1AJP A;  1K5Q A;  1PNL A;  3JTR A;  3K3W A;  1AI5 A;  1OR0 A;  4HSR A;  4WKU A;  4K2F A;  2WYB A;  4WKS A;  1AI7 A;  3ML0 A;  4YF9 A;  3SRA A;  1FXH A;  2AE5 A;  1FM2 A;  1H2G A;  2WYC A;  1GKF A;  1AI6 A;  1KEH A;  1GHD A;  1FXV A;  2WYE A;  1GK1 A;  1GK0 A;  1AI4 A;  3SRB A;  1PNM A;  1AJQ A;  1CP9 A;  3L91 A;  1JVZ A;  4HST A;  1K5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...