1FMCA

7-alpha-hydroxysteroid dehydrogenase complex with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1996-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fmcA00
1O89A 5KKAA 5LCXA 2C2XA 1PJ2A 3OSUA 1JKFA 2PD4A 4GSKA 3SC6A 5JDCC 3R0IA 4JQCA 3TDKA 3WXBA 1WMBA 2JD1A 4AJHA 1Y5RA 4Z9YA 3ZCXA 4FOOA 3F5SA 4J9UE 4B7CA 2OORA 3RC1A 3KO8A 4MKXA 4RZIA 3KVOA 3DZHA 4XIJA 4BNZA 3DFUA 2Y1OA 2B0JA 2HK7A 4RLHA 3N7UA 5ENVA 3WMXA 3BIOA 3RUEA 1GYPA 2Q2QA 3FTNA 4NK4A 5T57A 2Q1SA 4UUNA 1ONNA 4J4HA 1BSVA 3E82A 4IMRA 3OEYA 2Y1CA 1MLDA 1NR1A 2GZ3A 3ZHBA 1QRRA 1DC4A 1UXKA 5CPFA 5KJEA 5EESA 4DYVA 4MIEA 3UH1A 3U5TA 2H5LA 1BWSA 2Q1UA 1HZJA 3DTYA 3NTOA 4BNKA 3AOGA 4WNCA 4D45A 1P33A 1KVSA 4R5HA 4FC7A 1ISIA 1YBAA 1KETA 3AUSA 2GN8A 4TKMA 1E1MA 4RL6A 1OBFO 2IZ0A 4AVYA 1XHLA 1ID1A 1BTOA 1U2DA 3ZV6A 1UZMA 1ZJZA 2P4QA 4XDYA 1T1SA 2ZIZA 4XQCA 1V35A 2OHXA 2DQ4A 3AM5A 4BNTA 2YQ4A 3JTMA 4IXTA 4WCDA 3H65A 4E2XA 5BSHA 1GUZA 5LDHA 2HK9A 4G65A 3ZWCA 4IS2A 4JIGA 1IULA 3H9EO 3GEMA 1G1AA 3HN7A 3PFFA 1E1LA 5A9TA 1KBZA 1JWBB 4AJEA 4ITUA 1FDVA 3I9LA 1N5DA 4GKBA 2O3SA 2D59A 3PLRA 4H15A 2YJZA 2EXXA 4E33A 3EAGA 4WOKA 3ICPA 4BO6A 4GVXA 2WM3A 1PJCA 5EN4A 4E0BA 1B8PA 3FHLA 1QMGA 3Q9NA 2E6UX 2QQ5A 2BFOA 3AU9A 4MP8A 4Z9XA 5B37A 1N2SA 3EC7A 4EZBA 5KKCA 3DHEA 5AOVA 4CM8B 3GZ4A 4PLZA 4YT8A 1Y9AA 1Y1PA 2QG4A 4CV3A 1U8XX 3VZQA 3ZNPA 2RHCA 2DKNA 1HTBA 2RCYA 1ZK0A 5L7YA 1MB4A 5IJZA 2X0RA 4TQGA 2PK3A 4H16A 5I7EA 4BGVA 1YB5A 5FI5A 1NPYA 3JSAA 4Z0PA 1H2BA 2QX7A 4XCVA 3QVWA 4E3ZA 2QHXA 4B7XA 3JQFC 3WDSA 4MIOA 4IDBA 2CD9A 4ALLA 1R4NA 2W2LA 3FBGA 2ZTMA 5I7SA 5KTKA 3JD1A 3SJUA 2DT5A 1I36A 1KC1A 1YL5A 3MCVA 1PIWA 5A1TA 4ZJUA 3GNTA 5TIIA 3GVIA 2J6IA 3D3EA 4J1NA 2JL1A 4DREA 4D0SA 1ZUD1 4E2YA 3E1KA 3SJ7A 4BB5A 1C1DA 1I0ZA 2EJVA 1PL7A 1EQUA 4CLOB 1HE2A 3E5MA 4U6SA 4AJJA 4YDRA 4ZA2A 4AJ4A 5H81A 1TA4A 4PLGA 3T7EA 1UXGA 2Q1WA 2YZ7A 1I30A 1PR9A 5G0TA 5L45A 1QV7A 4LISA 2FRDA 1SO8A 5IAAA 1V8BA 1N7GA 4ZICA 3ASVA 3TOXA 2G1UA 1NASA 5AXAA 1V3TA 5G2OA 2POQX 2Y05A 3PHHA 4MDHA 4NPCA 4GVLA 1N92A 4S3MA 1UP7A 4FJ1A 2GDZA 1B8VA 1R37A 3WNVA 3TL2A 2I5PO 3Q1LA 3ZV4A 1PQWA 3B1KA 2VRBA 3VOSA 5K6AA 4DC0A 4PLFA 3JYQA 1KC3A 3PWZA 3UCXA 2WDZA 2DBVO 2PKRA 4FW8A 1XIVA 2F00A 2D2IA 4XDZA 4DQVA 5FWNA 5JDCA 3IS3A 4P4GA 2W8ZA 1GQ2A 1D7OA 1UDBA 3OQBA 1R4MA 3PHGA 5TX7A 3W8FA 4CMIB 4RPGA 3ROQA 2YV1A 1ZMTA 3I4FA 3GUYA 3AOEC 3V8BA 5C7IO 2FMUA 4XR9A 5DDIP 1UR5A 4BOYA 3PGXA 1P77A 4E12A 1F17A 1UP6A 4U0JA 1UH5A 1P1IA 5JMPA 1MA0A 4YJDA 4CQLB 1VLLA 2NV6A 2BFAA 2D5AA 1EEHA 2VYNA 4WLUA 3RKUA 3C85A 2P68A 3ANNA 4XQEA 4XX0A 4D43A 3JQGB 4GBJA 1NYTA 2X7HA 4YR9A 1B14A 3HDYA 1JAYA 3W6ZA 1UAGA 1YO6A 1IUKA 5C37A 2X0IA 4A03A 4E30A 2IEBA 1T4BA 1XU7A 1WDLA 3QRWA 4W6ZA 2ZJ0A 1R66A 4BO3A 4FOSA 3BMQA 4U5QA 3U0BA 1ZEMA 4DRYA 1IOLA 2G82A 3GC6A 1ENOA 4GSLA 4MVJF 4FS3A 3IJPA 1GDHA 5FEUA 1E3WA 5BNFA 4CMHA 1H9BA 3O8QB 4R3NA 2DBRA 2ZYDA 4ALNA 1NPTO 1ISMA 4R54A 5JO0A 4YRAA 3D4PA 1EBUA 1WVGA 3QQPA 4R5MA 4BKPA 4BS9A 3I9JA 4HFMA 1D4FA 1UZLA 1MP0A 1SEPA 2EP5A 3FF4A 2GLXA 4IGEA 1U2GA 5A3VA 1LSUA 4AICA 5JAQA 1UJMA 5KNLA 4JBGA 3JYNA 2GO1A 4QUKA 3PI7A 3QE3A 4YJFA 1DPGA 2ZATA 3HG7A 3I6IA 5HBRA 1EK6A 3NGLA 3IOYA 4FJ0A 3GDGA 1CETA 1EUDA 1NQAO 1I2CA 1PJSA 3ZWVA 4HADA 3N74A 4YQZA 4JROA 4JP3A 1M6WA 3HSKA 4YPOA 4M54A 3OQ1A 2CDBA 4W7IA 3H5RA 5GMOA 1A7KA 1DHRA 1GU7A 1ZXLA 2HRZA 1KVTA 3MOIA 3O9ZA 3WICA 2O3JA 3CKYA 3HHPA 4P4LA 5CEFA 1DEHA 3VPHA 1YDWA 4YJGB 1R4NB 3CZRA 5K6AC 4IJVA 2OFPA 3CE6A 3TN7A 4E5YA 4ZQEA 4XD2A 4XEHA 4PG6A 1YWGO 3B20A 1K5HA 1WP4A 3DB2A 4NZ9A 3PEFA 1JWAB 3GRPA 4L4XA 3AUTA 3EVTA 1NXQA 2VWHA 3GG9A 3GPIA 3OQ6A 3WLEA 4XJTA 2XXJA 2FSSA 1HT0A 3DZBA 1WDMA 4ZHSA 3EDMA 1HYGA 1N1GA 1NX6A 3PXXA 4DPLA 2AQ8A 3K30A 4D3SA 2LDXA 2VN8A 4BO8A 1AXEA 3RUIA 1YRLA 3LVFO 5I8WA 1T2CA 1KEVA 4J6FA 2CVQA 3FWZA 4BKUA 4DMLA 1TI7A 1QKIA 1VSUA 1CQIA 2FWMX 1NVGA 4IGFA 5CP8A 2IXAA 4LRSB 1RM5A 2JAPA 2GNAA 3RBVA 4CV1A 1YQDA 1F8FA 1UXIA 2PGLA 2Y93A 3T4EA 3K73O 1VSVA 3WWYA 2X1HA 3Q2IA 4OQZA 5IF3A 4CM7A 4U8GA 2IRWA 1ZIDA 4P4NA 3LK7A 3CPSA 3MTJA 4A10A 1EFKA 2X58A 5DT9A 3FPCA 3PJEA 1IZ9A 1PGQA 3IIEA 4K9DA 4ZQHA 5F1PA 5F5NA 1FXSA 1OFGA 4XQ9A 3PWKA 4QX6A 1ZZEA 3OIFA 4FN4A 1PJQA 5FI3A 4IS3A 3JYOA 2C82A 2EW2A 2V6MA 2VRCA 3BMQB 3BXXA 2PD3A 4K6CA 4YCAA 3ZNOA 1M66A 3ZWAA 3JQAD 3GT0A 3RJ5A 1K89A 4CJXA 3IKVA 1NQ5A 4TZKA 4IJUA 2YDXA 4WKGA 4NI5A 3L4SO 3ZH2A 4E32A 2BFPA 3HB4X 2EG9A 3JD4A 3DBLA 4FGSA 5A5FA 4MVJP 3NYWA 4IZHA 4UEOA 4CPDA 3ZWBA 4CMCA 4WGGA 3TSCA 5JBIA 2WYVA 5CDGA 3Q2KA 5G0SA 3MJSA 1LSSA 4TRJA 4R69A 4YB8A 4WLEA 1RM3A 1Z7EA 2CY0A 3ON5A 1XLTA 1HE3A 3DXFA 4H7PA 4YJFB 3VKVA 2GUGA 2E4AA 1BW9A 1M6HA 5TNXA 2AHRA 1MXFA 4KUGA 1DFIA 3F6YA 3KXDA 4YAJA 2O7SA 1C0IA 3SC4A 1I10A 2X4GA 4BKOA 1N9GA 3ENNA 4DUPA 3GDFA 4WUVA 4WOJA 4O59O 3I83A 4IDDA 1AHIA 4YT4A 2Z5LA 4RQUA 5IDXA 1ZJYA 2A35A 3DEYX 3FI9A 4WCFC 2RHRA 1VJ0A 1SBYA 3W4JA 3DZGA 1ENYA 3AFNA 2YUTA 1EQ2A 3DBHA 3Q6IA 1F0YA 2ZK7A 1BMDA 3PGJA 1X0XA 3W8EA 2NTJA 2ET6A 4NBWA 3TFOA 3S1LA 3CIFA 3UF0A 1U3UA 4OOEA 3AI2A 3WS7A 4FDAA 3WBBA 3OJEA 2YFQA 1X1TA 4A26A 3DZIA 4GI2A 3U62A 4CMJA 3U4HA 4QT0A 3ZWWA 4GWKA 2FZEA 4YJHA 4AJPA 1DBVO 1PGJA 2OMEA 3CZMA 2D8AA 2Y99A 2ZQZA 3RD5A 4BGEA 2VHXA 4M87A 3B1FA 1R12A 4FR5A 3K2BA 1AN9A 1XWFA 4J2HA 5KJCA 5K0ZA 1Z82A 3D4OA 2X86A 3LQFA 3AI3A 4BUCA 4CV2A 2YV2A 1BHSA 2DU8A 3UN1A 1LI4A 3STHA 2DFDA 4Z0HO 5EJ2A 1XELA 2QYSA 4IIUA 4RVSA 4A5OA 4EBFA 3JQ7A 1F06A 1HDXA 3QP9A 1E1KA 2Y0CA 1VL0A 3PQDA 4CQMD 1Y6JA 2NQ8A 4NG5A 4OKNA 3KLPX 5DN9A 1C0PA 2DM6A 3L6OO 3RFVA 1Y9EA 3G1UA 2GN6A 1MG0A 5DULA 4M86A 1IZ0A 4GL4A 4RVHA 4RVDA 1JW9B 2J5KA 1U3WA 3DOCA 4PG8A 3R6DA 3WLFA 4B3HA 2B5VA 3VKUA 4F46A 2EGGA 4BGUA 4DLAA 1FDTA 4H3VA 3ZU3A 3FR8A 3RBXA 1OOEA 4IQ8A 1LQUA 4INAA 1MFZA 1VKOA 1H6CA 1TEHA 1U4SA 2FZWA 2P5YA 1YGYA 1Y7TA 1P1HA 2FSVA 3LSYA 4J91A 4D0RA 3VPSA 5ILOA 4DYDA 3OJOA 3AW9A 5GZ3A 2NUAA 4RLSA 3ZWOA 1YJQA 1CF2O 4O1MA 3A14A 2WWRA 2AEFA 3SX2A 3VAZA 1CRWG 1CDOA 4E31A 1ZEJA 1GYRA 4GAEA 5EERA 3Q9UA 2DTEA 2ZB4A 3WG9A 1W0CA 4TRMA 3GNQA 4NNJA 3UKOA 4LCJA 3NEPX 1UDCA 4GH5A 5AVOA 2NTNA 1Q7CA 3L6DA 3WIEA 3WJAA 3KUXA 5MDHA 4PIVA 3TQHA 4C7KA 1I8TA 3JQBA 3UCFA 2V6BA 3W4IA 4ROSA 1MV8A 4QO8A 3A9WA 1LA2A 2EF1A 1BW9B 2G5CA 1HDYA 1MC4A 1SEVA 4KQXA 4M55A 4CM4A 5C5IA 2BRUA 4N54A 3ABIA 3T7CA 4ZRMA 4KWIA 2PZLA 4XWYA 2E37A 5IN5A 1Q0LA 1PR3A 1GZ3A 1YH3A 1HSOA 3ZHZA 4IY1A 4BO1A 3WFIA 3HZZA 4OQYA 3UUWA 1BXGA 4IINA 2W2KA 5FF9A 3P5SA 2C5AA 3RAJA 4ZQGA 3MEQA 4GLLA 4PRKA 2CVOA 4L75A 2O4UX 2AQIA 5JLAA 5A9SA 1G6KA 4N7RA 3F46A 3B1JA 2XXBA 4PZCA 2GZ2A 1GPDG 3GQVA 3RFXA 4BNMA 3G49A 1JQBA 5L9AA 4F45A 3O38A 4OYRA 1N7HA 3U9LA 2V6FA 4P22A 5G4LA 1DFHA 4R1SA 1PTJA 1QLJA 3KOUA 3E6AA 4IJKA 4JJFA 3CUKA 4U0KA 4DBZA 3SXPA 3LT1A 2WD7B 1H6AA 4LW8A 4YRBA 2NSDA 1CYDA 3H8VA 4M8SA 1ZSYA 4WEOA 5CDYA 3LC1O 2AEJA 3FCOA 1NQTA 3QHAA 3ITDA 4CUJA 1TVEA 3PDJA 5TSDA 5T8KA 3WB9A 4FFOA 2X9NA 3D0OA 2I65A 5JW6A 5I8ZA 3OJ0A 1HYHA 3BTSA 3NUGA 4ZU3A 1ZXBA 3ST7A 1Z74A 4R4JA 4EITA 3HADA 3V1YA 2WYWA 2C7VA 3JQ9C 2GF2A 3M2PA 3F9IA 3DDNA 4JBHA 5JO9A 5TT1A 5EPOA 3QY9A 4NU5A 2FOIA 4M49A 2B35A 1E77A 1YB4A 1PS9A 2HCTA 4KMSA 3L77A 4L0QA 3L07A 4NH4A 5KVQA 2Y1EA 2OXIA 3WJ7A 1T26A 5ICSA 5L95A 1GUFA 2BI8A 1MUUA 2PGDA 1NFFA 2W98A 4IPTA 5BR7A 2GR9A 4U6QA 1PZHA 3GH3A 5A06A 1EVJA 1LUAA 3KV3O 3LLSA 5T8KC 4MIYA 4IDAA 5JCXA 2D3TA 2NLOA 1JA9A 3M2TA 4BO7A 5HTOA 4NFSA 4ILKA 2H6EA 3UAGA 1DIGA 2A92A 3R1IA 4JK3A 4XQGA 1ZW1A 3TPCA 5IXYA 2CSUA 1TT5B 2UUOA 4MVJD 4EDFA 2YV3A 5JSFA 4C4OA 2Q3EA 4XGKA 4DA9A 4OMUA 2XF8A 1BVRA 5DOVA 3CMMA 1N1EA 3C1OA 3LDHA 1HLDA 1VPDA 2HMTA 5BT9A 5L7TA 4HFJA 2GN4A 2O3RA 5HS6A 1I33A 4NBUA 4FC6A 3NRCA 4KQWA 3JQAA 1GAEO 3AY7A 3GMSA 2O3TA 4I8XA 4G2NA 4CMGA 1ADGA 2E82A 4ND2A 4RV9A 1WLYA 3PVZA 2G17A 1PZGA 1Y8QA 1PX0A 4ND3A 1XU9A 2EKLA 1HF3A 4BQRA 4PVDA 1GV0A 4PZEA 1R0SA 1RKXA 4ZQBA 2C20A 2LDBA 4UEJA 2Q1TA 2YYYA 3PZRA 3JQ9A 3TJRA 3RUFA 4S1VA 3U3XA 2VUTA 3BHMA 3NJ8A 1DAOA 4IMPA 3AUUA 5KJFA 1P31A 3WYBA 1QYWA 1NPDA 1RYEA 5IDQA 3PYMA 3SVTA 1E5QA 2F1KA 1Y8RA 4FFLA 4FQ8A 5TRTA 4C7JA 2TMDA 4BVAA 1EFLA 4QQRA 4KDFA 5JNLA 1V3UA 1BXGB 1N8KA 1P3DA 2X8LA 2P9EA 1XSEA 1VRWA 5COBA 3EY4A 4FCCA 5L51A 3RQSA 5AYVA 4D3FA 4E6PA 1R0LA 3GG2A 2Q2WA 4TRRA 3O4RA 1JDJA 2FR1A 3JQ8A 3ZV3A 4ND1A 2O7QA 5IZCA 4BL5A 5JC8A 2OUIA 4CR8A 4MPDA 2NTVA 3LT0A 1DB3A 3C1TA 4EUHA 5ICMA 1ML3A 2BI7A 3D3WB 1R4MB 4CMIA 3AY6A 2Y0DA 4XJSA 5G0VA 2ZQYA 3P19A 4I9UA 1BDMA 1RJWA 3ZV5A 2NU8A 2A9FA 2AEMA 3VC7A 1ENZA 3GGPA 1ARZA 3I52A 1DJNA 2JD2A 3KBOA 1KOLA 1ZVMA 4RPHA 1PZFA 4YA6A 2QYTA 3W8DA 5KVVA 3MWDB 4B3IA 1KERA 4UVEA 2VQ3A 1LX6A 4NHEA 5THQA 5EL0A 2O4CA 2IODA 2ZYAA 4OM8A 4B3JA 4ZVVA 1UXHA 3RVDA 1PJTA 2J3KA 4YAGA 3E03A 1IYZA 1Q2XA 2G0TA 4RZHA 1E3JA 2AE1A 2WSBA 2ZYGA 1HETA 1K6JA 2NQTA 3C1AA 3G3EA 4OAQA 1WZIA 1JAXA 1Y5MA 3UHAA 2IYPA 4XYBA 2PD6A 2VZ9A 3TZCA 2VHZA 1SB8A 4MP3A 5KIAA 2VWPA 3WR5A 1BXZA 4B8WA 3RFTA 4BO2A 2VT3A 1VL6A 3QWHA 1DSSG 2NVBA 3GVCA 3ZHYA 5FYDA 4UAGA 5F1KA 5JPIA 2Y1DA 2PZJA 1GV1A 4PLYA 4MVJE 3BHIA 4HWKA 4I9HA 4KUEA 5A9SB 1KS9A 3BTUA 2FPGA 2OL4A 4RPLA 3MJVA 4EI2A 1AE1A 1A72A 4PG7A 4ND4A 2IE0A 5GY7A 1Y8RB 2HJRA 3DHNA 2RH8A 2V65A 1SCUA 3ADPA 3PHLA 4XB2A 2AMFA 4Q3NA 3KYDA 3H3FA 1QR6A 4FD3A 4ZGWA 2HUNA 1CJCA 3IKTA 2HMSA 3SBOA 1TXGA 3BTOA 4Y67A 2HO5A 2VTDA 3HFSA 1B0AA 3ICCA 2RBEA 1G0OA 1NWCA 2QW8A 4JX8A 2ZCVA 3I5MA 1SAYA 4W9NC 4WLFA 3KTDA 1H6DA 3U4DA 5EIOA 1O95A 1YL7A 4XR4A 4YQYA 1YKFA 4J2OA 3PHJA 3DZFA 1DC3A 1W4ZA 1YJ8A 3K8ZA 4YRDA 1E5LA 5GZ1A 5IZCC 3FNEA 1YQGA 4XYEA 1HDCA 4ALMA 1E6EA 4OXNA 5G4KB 5JY1A 4YJGA 3GN2A 4IJWA 3H2ZA 3EK2A 5EQFA 1LEHA 3DR3A 2B83A 4LMPA 3NV9A 4EEXA 5F3RA 2RH4A 3HB5X 1E92A 1J5PA 2DUWA 4CMEA 1GFSA 3VH2A 3VZPA 4J90A 2VWGA 1PEDA 1V0JA 1X1EA 5A3JA 5DCUA 5A04A 3OMLA 4EUEA 4OH1A 1ISGA 4YT2A 1D3AA 2Y67A 1RPNA 3EZYA 2HAEA 1PJ4A 1ADFA 1GEEA 5MGBA 4E13A 4DQUA 1XDWA 3WOHA 3MWEB 2DTXA 2R6JA 4OGWA 5IFLA 4J7XA 4KWHA 3PYLA 1E3WB 5G0WA 4DLBA 4BNWA 1X7DA 4L4RA 3IP3A 1Z6ZA 1I3NA 5JCJD 3F47A 2P9CA 3A1NA 3DO5A 2Z1NA 3PIDA 4YAIA 4EEZA 2ZB8A 3H5AA 5AXBA 1LRKA 4RF3A 5F5LA 4BHTA 2X22A 4GX1A 4Z0TA 4LGVA 3OP4A 4A7PA 3GHHA 4UVGA 2NU9A 1E0DA 1DC5A 2C7GA 2WEKA 3GF4A 3C8MA 3HQ4O 4GMGA 3AFMA 4BO0A 1B26A 4I5GA 3WGYA 4PLTA 2WD8A 2GSDA 4Z9FA 4OJNA 1WPQA 3L6EA 3LLVA 3JQDA 4AL4A 3JD3A 1MFPA 3MTGA 1S6YA 2X5JO 3JD2A 1W6UA 2CFCA 3BAZA 2EP7A 4ESOA 1T1RA 3L9XA 2UUPA 2EERA 3OIDA 4GGPA 4LMRA 3GK3A 1A9ZA 4BNXA 3NDIA 3PHIA 3UW3A 1A5ZA 1LC3A 4Q3CA 4LVUA 4Q3AA 5DP1A 1PJBA 3PPIA 1M76A 1B8UA 1FDUA 1YS4A 1T2AA 2HRBA 3HDJA 3I23A 1BG6A 3NTRA 2JCYA 5TJHA 1MG5A 4NQZA 1QP8A 3ETGA 1SOWA 1XYGA 2OOSA 3ZU4A 5DBGA 1N9GB 2SCUA 3PFWO 3FD8A 3ETEA 4OXYA 1CWUA 4NBVA 4M1QA 1J0XO 1HZZA 4GQAA 3MJCA 3BA1A 1ZH8A 1NHGA 2BLLA 3GY0A 3W6UA 2EEZA 4BNYA 1X0VA 4YVFA 3I4CA 3UICA 3H9QA 1O9BA 4DIFA 2JCXA 4CLEA 2AG8A 4CV0A 3NDJA 3RSHA 1QSGA 3H3JA 2FR8A 1K2WA 4YYZA 5BNIA 1OAAA 4E5KA 1GL3A 1I2BA 1VJ1A 3K2EA 4OXKA 5CEJA 1KEUA 1B15A 2WE7A 1DDOA 2ZB3A 3P2YA 2VNAA 2PTGA 1C1XA 3TZ6A 3IQDB 3QWBA 3ROKA 1UXJA 4Z6KA 2PNFA 1DHTA 4HFNA 3Q0EA 3S55A 3GVHA 1U5CA 4PG4A 2I67A 5CDTA 4FB5A 3DZKA 5A03A 1T24A 4J4BA 4PFJA 2O2SA 1DRWA 3WQQA 3TZHA 1ZK2A 4I9NA 3QLJA 4XRRA 1YQXA 5ENDA 1HE4A 4LSMA 4QO7A 4BMVA 2H1SA 4JP2A 1DO8A 3RJ9A 4E2WA 4XYMA 4I5DA 2W2LD 2AG5A 4F6LA 5JYDA 1SC6A 2OP1A 3AOEA 3PLNA 4I1IA 3CMCO 4Y8VA 1L1FA 1I01A 1WZEA 2FN7A 4TKLA 4Y9DA 5G4KA 4NK5A 2EW8A 4XIYA 2JHGA 3H6KA 1NTOA 3AU8A 5LC1A 3V5NA 1I3KA 1I5RA 1PS8A 1PGOA 3K31A 5JFOA 3PQFA 4XA8A 1TB4A 2XPCA 3NT5A 1DJQA 1P0FA 4PVCA 3WTCA 3UCEA 4JGBA 2X0JA 4BKQA 4OKIA 4PLHA 5DBFA 3GHYA 2A4KA 3LF2A 5HA5A 4R16A 4B7UA 3KRTA 4CM9D 3FNFA 3UVEA 2Y0EA 4NIMA 2EGHA 4WCFB 1CIVA 1M2WA 1F14A 4GMFA 3RKRA 3HE3A 2VOEA 3OICA 3GA0A 2IYOA 3PZBA 4GLOA 1UZNA 4IBOA 3O26A 3AUAA 1S7CA 4NJMA 2X23A 5B1YA 5B4TA 3H7AA 3D1LA 1QYCA 1YDEA 3OHSX 3GGOA 2Q46A 5B12A 3FPLA 2VRCD 3WGTA 2QRKA 2C2YA 4CL8A 1E7MA 3GUCA 4O63O 3JV7A 3ZGYA 1HYEA 1QXSA 1WW8A 3G79A 3G17A 1H9AA 5TGDA 1XKQA 1LLQA 4MO2A 1RM4A 2GASA 5ITVA 3UFXA 5U1PA 5DZSA 3LZ6A 4R9RA 2NU6A 3ETDA 4RPJA 3EW7A 3ZWMA 4QXMA 1D8AA 3ROPA 2DPHA 1GZ4A 4QSMA 5BSEA 2UV8A 4OSOA 3IC5A 2W2KB 2Q49A 3NX4A 4RF4A 5FFFA 1EE2A 3D5TA 5KOIA 1DXYA 4Q3BA 4UVHA 3RUCA 4EJ0A 4FBGA 4YACA 1U4OA 3JQFA 3A06A 2DUUA 2O48X 5CHEA 3GFGA 3S2FA 4HBGA 1KY5A 1VM6A 1J6UA 4BNFA 1W8DA 3DBVO 4AFNA 4JCOA 2JHFA 5AXDA 4BQPA 4R1TA 1ISJA 4LVCA 1C1XB 4RF5A 3RU9A 2FP4A 1F8GA 2DTDA 4OHUA 3V1TC 4IQ0A 3LYLA 3QW2A 1ZK3A 2QZZA 3X2EA 2P5UA 1NNUA 2C54A 4CLOA 4FFNA 2FPPA 4TWRA 4WPGA 3AM4A 4M89A 3H9UA 3TFQA 4AJIA 2QZ9A 2WD7A 3D4NA 1ZCJA 3KYCA 1NVMB 3F4LA 1H6BA 4L4SA 3KSZO 4RVGA 2VYVA 3CEAA 3PRJA 3TZQA 1O5IA 1LDNA 1E3IA 1U9JA 4DPMA 1YL6A 2JFGA 2O3QA 5BNTA 1HSZA 4UUMA 1KIFA 4BO5A 2CZCA 1R6DA 3ASUA 4CQLA 2YY7A 3KLMX 1YBVA 4JNKA 1KVQA 2PR2A 3AJRA 2BD0A 2W90A 4KUHA 1CERA 5JAZA 2VZ8A 3K9QO 3L4BA 2DFVA 1KVRA 1NQOA 2CVZA 1KEPA 1LU9A 3JD0A 4J1QA 3L4BC 4MKZA 2PH3A 2DC1A 4BO4A 3IJRA 2VNSA 3UXYA 1NBOA 3F5QA 4KTTE 4WCFA 1DIHA 4WLVA 2CDCA 1H93A 1O6ZA 1RYDA 3QVSA 1B16A 5G0UA 1HDOA 3DBRB 1E7SA 4IQGA 3JCZA 3ZDFA 4RPKA 3VPFA 1U8FO 1SB9A 4HNHA 3U49A 4XB1A 4L9RA 3INRA 5J23A 5F1OA 3MJEA 1T2EA 4O0LA 1SNYA 1HKUA 1AXGA 1L7DA 3NDRA 1NFRA 3RBZA 5JYEA 2V7PA 2WYUA 1QYXA 1NVTA 4EJ6A 3V1UA 4W9NA 3QVXA 2J3HA 3ONFA 4FFPA 5JMWA 3WNQA 1LLUA 1A7AA 3TF5A 5HM8A 1OZAA 1P1KA 3EZLA 3VPGA 1PJ3A 5L40A 4Q9NA 3WQSB 4J16A 5TQVA 4RQTA 3EVNA 3ZWXA 4R01A 5I9NA 4DPKA 3K6JA 1LDBA 1B7GO 1GZ6A 1YVEI 3E9NA 1E7WA 4BB6A 3GLQA 2BGMA 3BMCB 4I08A 5TT0A 4BNVA 1GY8A 1XCBA 4HNGA 4A27A 1U5AA 2PY6A 5THKA 2EJWA 3RASA 4AJ2A 2ZJ1A 5EINA 4FFMA 1NFQA 3W4KA 3PJDA 1Y8QB 3QIVA 5ILGA 1U3TA 3S2IA 4JJIA 3D7LA 3KYBA 1BXKA 4HKTA 3FTPA 3HJAA 1D1TA 4BNLA 5KVSA 2ZTVA 2PH5A 1DC6A 2WJPA 5I9MA 4W82A 2YQ5A 4GGOA 3WWZA 3CSDA 1EUZA 5JAIA 2FPIA 1U7HA 1JKJA 3HDQA 4BV8A 3RUHA 1IB6A 1YBMA 4CMAA 3RUDA 3NTQA 3Q11A 2BKAA 4YWJA 1LDMA 1K6XA 3LT2A 1ONPA 3BZUA 4J49A 1NAHA 5IZ4A 4ID9A 2AW5A 3GDOA 4CUZA 3ROMA 2C0CA 1NAIA 2VUSA 4E5NA 3OETA 1KY4A 3DAFA 1KYQA 4QEDA 4CMKA 9LDBA 1EK5A 3WGHA 1E7RA 4MINA 4RVUA 2YHIA 3HWRA 3ZNNA 4RDHA 1M75A 3VH1A 1K6IA 3K96A 4BV9A 4AJ1A 2AQHA 3JYPA 2VWQA 1Z75A 1JKIA 4CM9A 1Q0QA 9LDTA 1NWHA 3DMYA 1OMOA 4B8ZA 3RI3A 3QA9A 5CDSA 1VI2A 1PL8A 4D41A 3PJFA 3DFZA 3ZU2A 1H5QA 3HUDA 1EUCA 2PKQP 3RU7A 2VYND 2YFHA 3JQGA 3WYEA 3LT4A 4DGSA 3AWDA 2AA3A 1GCOA 2EV9A 4QECA 2CUKA 4NDNE 3V2HA 3H9JA 4J3FA 1KVUA 4FSHA 4YEDA 3KEQA 3NKLA 5CG2A 3HNPA 1E7QA 2W4QA 4GWGA 5KVCA 2EWMA 1X7GA 3ANMA 5IG2A 1DIAA 4IUYA 1ZMOA 4KP7A 5EQDA 4FGWA 1P9LA 4K1LA 2HDHA 3O03A 3WGIA 4NFYA 4BNNA 3ONDA 1I32A 4IDGA 3O8QA 1GQQA 1A27A 1O94A 3ZNQA 3GAFA 4K28A 4ALJA 1K0UA 1UDAA 2NNLD 2B4TO 2JFHA 2DBQA 4G81A 1Q0HA 3HN2A 3S2GA 4XKJA 4N5LA 2ZB7A 3DONA 4MP6A 3INTA 4E21A 5DF1A 1LBEA 2G76A 4MVJI 4PLPA 4JN6B 1A4UA 3PP8A 2Z1MA 8ADHA 4HXYA 2UVDA 2X9GA 1HDZA 3DMTA 3QWFA 1FDSA 2EKQA 3D64A 4JXKA 5ER6A 1B3RA 2C5EA 4IIVA 3AY3A 5L7WA 4U7WA 5T6BA 1A71A 4R51A 1HEUA 1FMCA 1WNTA 4R1UA 1HWYA 2GZ1A 1VL8A 2D4AA 1Q1NA 4RF2A 1MX3A 1QYDA 1T2FA 4RORA 4D44A 1GPJA 2I6TA 1FF9A 1PQUA 3ITKA 4IDCA 5TS3A 4PZDA 3VH4A 5T64A 1I2ZA 3BMOA 1IHXA 5U9CA 4XGNA 1PSDA 4RGBA 4O6VA 3JQ8B 4CM8A 3GGGA 3GZNA 2HMUA 3ANLA 3R3JA 4PRLA 3KETA 4BNIA 1HDGO 2NWQA 1LDYA 4IZIA 3SLGA 5C7OO 2UDPA 3GOHA 1TT7A 3U4IA 3D3WA 3BMNB 4FJ2A 3LC2O 2A94A 5DCYA 2BGLA 4CR6A 1H2HA 4J0FA 3ZHXA 3IMFA 1Z45A 2HLPA 4R68A 4DC1A 2DAPA 4UUPA 2IDZA 3NAQA 3KYCB 3E8XA 5KJ1A 4TROA 3OJLA 4BNUA 4DVJA 4QTZA 1XQ6A 1JTVA 3K92A 5JE8A 2GD1O 2J3IA 4D46A 1PQPA 1V6AA 4CR7A 5A02A 4PLCA 3ZI0A 3UGKA 5KJ6A 2J5RA 2X5OA 2GCGA 3GMDA 3JQ6A 1J4AA 1PL6A 2X6TA 3WX0A 1YE3A 1T25A 3ULKA 4J0EA 4E5MA 1E7YA 1EZ4A 4MVJG 2H63A 1UUFA 2EIHA 2H9IA 1E6WA 1U28A 2DLDA 1ZK1A 1Q7GA 2HMWA 3L9WA 1BGVA 4MVJH 4F3YA 2C29D 4Q3DA 1LSJA 1LQTA 3DOOA 4AJKA 1PZEA 4CLDA 5I9LA 1IL0A 4WLNA 4NR0A 3L0DA 1U1IA 2Y1FA 3SLKA 3TRIA 3ZU5A 1HDRA 4OL9A 4NBTA 4J4TA 1Z7BA 1EBFA 3KSDO 3I9OA 5CPBA 4D7AA 4CM5A 2D1YA 5CFZA 3P2OA 2PZKA 2O50A 2Q99A 4CM1A 1B3BA 1JLLA 3OBBA 5ADHA 4LN1A 3WGZA 4GKVA 1WDKA 3OA2A 4B79A 3RCBA 1ULSA 2I66A 3DAPA 3QV1A 2CF5A 3I9MA 1ONOA 5DNAA 5HWSA 2P4HX 3EYWA 3FSRA 4DL9A 2D5CA 3E5RA 3AI1A 3I9KA 2OGUA 1C0LA 3MJ4A 4UREA 2RAFA 5F21A 3WGGA 1KEWA 1Y81A 4DMMA 3BHJA 1XEAA 2D0IA 1WWKA 3OECA 1DAPA 2GPTA 4MKRA 4BKRA 4BMSA 1YOVB 1P1FA 3E9QA 4WK6A 2HK8A 3A4VA 4FFRA 1GR0A 1DIRA 1TT5A 2BF7A 4AJLA 1L7EA 3E9MA 1SPXA 3GEDA 1OI7A 1R15A 5LDGA 1LJ8A 3TNLA 4R9SA 4DWVA 5A4DA 1E3LA 3GVXA 4BIIA 2I3AA 3GZNB 4Z3DA 4Z3KA 5DP2A 1C3VA 5A5EA 5HRUA 3DMTC 5BSGA 1ULUA 3C3XA 6ADHA 5CG1A 3VHRA 3E18A 3VZRA 4DQXA 4Q3EA 3MOGA 3H2SA 5TJ9A 1QORA 1WMAA 3CXRA 2B69A 4IDEA 3WQRA 3X2FA 4I5FA 1DFGA 1U7TA 3H5NA 3I3OA 1NM5A 1ZNQO 4YBZA 3KZVA 3OM9A 4XGIA 3GAZA 1EE9A 1E3EA 3IUPA 2QRJA 2BMAA 4FPXA 3C24A 4E4YA 3JQBC 3QVTA 4BNGA 5BQFA 4L76A 5L4SA 1ENPA 4RCVA 1T4DA 5L4NA 4HX5A 1HRDA 1P44A 3HFGA 1GCUA 3QSGA 1E6UA 1T2DA 4CQMA 4DXHA 1B2LA 2EKPA 2O3UA 2VHYA 3H9GA 4R3WA 1PGPA 2C07A 1R0KA 3JQ7B 4KDEA 3GRKA 2O23A 2OBYA 2ILTA 4WEQA 5TF4A 4CMEC 2XAAA 2I99A 4N5NA 4BO9A 5CDUA 4P8RA 3GPDG 3W1VA 2BFMA 4J1SA 1X14A 2HQ1A 3I9NA 5BSFA 4L8VA 1LC0A 4CLRA 3BMOB 1PWZA 4YXFA 2Q45A 3TWOA 1Q7BA 3VH3A 4NBRA 1C0KA 1ZK4A 3VTFA 2VT2A 4JBIA 4CL3A 1VJTA 4AG3A 3H4VA 3R3SA 4E2ZA 2R00A 1QYVA 3QWAA 5TC4A 3BMNA 4Y6SA 2CNBA 3GR6A 3IUSA 4RDIA 4CLHA 1UP4A 3DQPA 1BVUA 3RUAA 2Y68A 5L3ZA 1E1NA 2IXBA 1AGNA 3A28A 1M67A 4IM7A 2XOXA 2I3GA 3ADOA 5ES3A 2NACA 4Y6RA 1GD1O 2DBZA 4RO0A 2ZCUA 2GYYA 5TLSA 3PK0A 1LSOA 1LDGA 1VC2A 3V2UA 2VUUA 3VVBA 4CUKA 3F1KA 1MGOA 2B4RO 2HKIA 2IZZA 5HS4A 4UEKA 3WFJA 2PKQO 3INGA 5JDIA 4KTVE 4CLXA 2Y1GA 3BTVA 2RIRA 4HV4A 1X15A 3K5PA 3EMKA 2Q4BA 2VTEA 4II2A 5AXCA 3ONEA 3JYLA 1YOVA 2BELA 3KHUA 4PGFA 1LRJA 1C14A 1JVSA 4IDFA 5COQA 2J3JA 1QG6A 4FIZA 4II3A 1G0NA 4ALKA 4WJZA 4BNJA 3Q3CA 1K3TA 2ZTLA 2VYVD 3F3SA 2OBNA 5JDIC 2CF6A 3DWFA 3FBTA 3COSA 4ZD6A 1ISFA 4J1TA 2AXQA 1GUYA 2PZMA 3GNSA 4CMBA 1XQ1A 1ZSVA 5L53A 1GQYA 3OFSA 3RC9A 2YDYA 3F4BA 2C59A 3M1LA 3MJTA 2X5KO 1PU2A 2TMGA 3DZJA 1J49A 3I6QA 3WGOA 1MXHA 2CDAA 4TZTA 1VKNA 3DC2A 2B4QA 1ZFNA 4EYEA 4F6CA 5C3MA 3TL3A 4HFRA 3BYZA 4UVIA 3JQAB 1P1RA 3EUWA 3S8MA 3OJFA 1WAMA 2X0NA 4Q39A 3KEOA 2ZTUA 4RJTA 1XG5A 3IAHA 1IHYA 2IZ1A 2R00C 3GN1A 2HJSA 3VZSA 4CM3A 1EVIA 4GX2A 7MDHA 3FNHA 1DLIA 3EHEA 3ZZNA 4ONEA 3CTMA 4B4VA 3U09A 3I1JA 3RROA 4R1NA 4AJNA 2YHUA 1SZJG 3UOGA 2DVMA 3ZWPA 3WTBA 5COAA 4OIMA 4TMFA 1XGKA 3TZKA 1EMDA 2FR0A 4AJOA 2EHDA 5DOZA 3WIDA 4NMHA 1P45A 4DIBA 3E48A 1ZBQA 2PWZA 3C7CB 5L4LA 4K26A 1AHHA 4B4OA 1PGNA 2P91A 2J8ZA 1AUPA 2JCVA 3PDUA 3V2GA 4W4TA 1BDBA 2I76A 3FWNA 4L74A 4LCEA 1ADBA 5CEEA 3OEWA 1XR3A 2E48A 2I9PA 2JAHA 1FK8A 2HSDA 4EUFA 4WECA 3PYXA 3B70A 2DPGA 2UAGA 3RIHA 3DBHB 3QJ5A 3FR7A 6LDHA 4ND5A 4NJOA 1O8CA 3DOJA 1DRVA 3OH8A 3JQEA 4YAKA 4WLOA 1U3VA 3C7AA 2NVUA 4X54A 4DTIA 4CM6A 4YTEA 3KB6A 3JQCA 4Y6PA 3RC7A 3RWBA 5A9RA 1YB1A 3IP1A 3ENKA 4PN3A 1EVYA 3PJGA 1HXHA 3G1TA 4BMNA 4J43A 2OZPA 4WE3A 3CINA 4UVDA 3AK4A 1LTHR 4HUJA 1V3VA 5AQ1A 1LLDA 1YXMA 2GN9A 3KSUA 4GX5A 3VDRA 3OF2A 3N58A 4YT5A 4CODB 5JXWA 4ZRNA 3U4CA 4UULA 4NU6A 4A0SA 1Z73A 4K6FA 4XRGA 3G0OA 5DBIA 2Q4EA 1X13A 1W73A 4A2CA 3WSWA 2YW9A 4L73A 3DBRA 3P7MA 1DLJA 3VPXA 2AE2A 2X9VA 3ZWNA 3ZW8A 4DLLA 4ZN6A 4BGIA 4YAEA 5IN4A 1GTMA 2IEDA 2HU2A 3GVPA 4OOFA 4PCVA 3QVOA 3NJ4A 3LC7O 3M6IA 2NADA 3SEFA 2Z95A 1CQJA 4MOWA 3M1AA 2FY8A 1NHWA 2NU7A 3CH6A 3VDQA 3DBLB 2JFFA 3WGQA 3WMWA 3PQEA 4KOAA 5B4UA 3FRJA 1EDZA 3IDSA 4XYGA 2WE8A 2WMDA 4PLVA 4TSKA 1SMKA 4WASA 2OO5A 5U4QA 4RVFA 1NP3A 1DOHA 1HE5A 4MVJM 1P1JA 2ZKLA 3KM0A 1VE9A 4NFHA 2OP0A 3WSVA 1LLCA 4EGFA 3AM3A 3DTTA 2VZ0A 5EMHA 1JU9A 3BMCA 2B36A 2JD0A 3D5QA 1PJLA 1FDWA 2QIOA 2B5WA 3NT4A 4WNIA 4BNHA 5DCWA 1GEGA 1IY8A 1QLHA 2GGSA 1P74A 4J7CA 3PWSA 1CEQA 1WXDA 2Y66A 4XZ3A 1HLPA 1OC2A 1P0CA 1JN0A 4W7HA 4W99A 3OA0A 2QRLA 1RM0A 3LF1A 3EGOA 1V9LA 3MZ0A 4R41A 2WTBA 4CQMB 4G5HA 5T5QA 5JCJA 1PWXA 3NT2A 3PIIA 2VOJA 1F12A 2Q2VA 7ADHA 4TVBA 1C1DB 3F1LA 1D1SA 3WYCA 5CAEA 4JJGA 4CM4B 4ZQFA 8LDHA 1H94A 2PGJA 4CLRB 4YJHB 1ZSNA 5GZ6A 1GYQA 4D3DA 4XYLA 3DAGA 3KYDB 1XA0A 1OC4A 2NM0A 4HP8A 4OO3A 1X7HA 1IPEA 1H0KA 1LNQA 4EW6A 5ITWA 2BH9A 3ZWYA 2E49A 4TRNA 3VTZA 1I24A 2VHVA 4PG5A 3TOZA 2Q50A 2O2YA 3NGXA 3FN4A 2VHWA 1BRMA 2NVWA 2YHIB 4A73A 5B4VA 5ER9A 4LK3A 4QFCA 1ISHA 1O0SA 1JVBA 2P9GA 4Y98A 1RWBA 4UUOA 2PFGA 4URFA 4IXWA 1YONA 5H83A 3RC2A 1LXCA 1EDOA 3ZW9A 1NR7A 4KZPA 3QWIA 2FHSA 2R2GA 5T67A 4B4WA 4D79A 2PA3A 3LU1A 1FJHA 2JJYA 4PLWA 5IDYA 5C7LO 3WBFA 1DRUA 5JAMA 5I7FA 4MJLA 3VVCA 4LSWA 5JC1A 3OIGA 2JKVA 3PTZA 4B4UA 1E3SA 2CMDA 5K9ZA 1A4IA 1MC5A 2PV7A 3FNGA 4D42A 4TVOA 4DBVO 1HL3A 2VCYA 4OSPA 1IPFA 1QV6A 1PS0A 1I3MA 3DL2A 1SOVA 4QFDA 3T4XA 2NVUB 3B6ZA 1I3LA 4J7UA 1EVZA 3GFBA 4P38A 5KCZA 2GRAA 4GPD1 3ZN2A 5JS6A 3HDHA 4ALIA 1R16A 1UAYA 5H82A 4GX0A 4DIOA 5A05A 4N5MA 1TLTA 2PLAA 4N18A 4O5OA 1ZKMA 2HMVA 5JY6A 3ORFA 2AQKA 5KWEA 1LRLA 2B37A 5IDWA 4MVJA 3S2EA 2BHLA 4I5EA 2J5QA 1IE3A 3GEGA 1LDEA 2BGKA 1DIBA 3IL2A 1ORRA 4JLWA 4E5PA 1ZO8A 2GERA 2P2SA 4LRTB 4HY3A 2UYYA 4NJMB 4J9VA 4EJMA 5I7VA 5IXSA 3DHYA 1ADCA 1A9YA 2V6GA 3C7DB 1GADO
chains in the Genus database with same CATH superfamily
1O89A 3A1FA 5LCXA 3L8MA 4FFVA 4UBNA 1VSQA 2O5EA 1GKIA 1XTJA 2FWIA 3DWGA 2PD4A 4EJSB 2BR5A 2F1HA 4ZI3A 1NR5A 1M2OB 3OPNA 4L4UA 2XCOA 4Z9YA 4AJHA 3LZCA 2NUPB 1IVSA 1NXTA 2LCFA 3N0VA 4MGHA 2IPAB 1GCIA 2OORA 2ZT8A 3RC1A 2J33A 2EW1A 4H4CA 3ABOB 4RYDA 1XTTA 2QMYA 1X39A 2KW5A 1FPMA 4EG5A 3BE6A 1FTWA 4UZSA 4MW2A 5E4YA 2OTCA 4YMUA 1DARA 2H0RA 2XWPA 3KVOA 4FS8A 5ALKA 4KZKA 3NTUA 4DG9A 1QTQA 1C9EA 3GLIA 1X19A 4RLHA 2A0XA 3S7TA 2RE8A 4Q24A 1FXUA 3GJ4A 3IGFA 4V0ME 1WQ1R 4AJ9A 2BMFA 4NK4A 3G68A 2Q1SA 2GFIA 5T57A 1NA5A 1Z4OA 3KYIB 4IMRA 4REOA 5EKSA 3OEYA 1M83A 2GCIA 2Y1CA 5GVSA 2GZ3A 2Y77A 3T95A 1OH6A 3KXIA 1QRRA 3MTIA 4RJ2A 5J3JA 3I72A 5C8DA 1XROA 4ABTA 4MYTA 1JEAA 1HZJA 1FSZA 1H0SA 2JAXA 3DTYA 3C43A 5HMLA 5IXJA 5EPUA 1RRGA 1RABA 1Y8AA 5DSZA 5ALXA 1DC7A 4L2IA 1RZRA 2W37A 4IWXA 1K27A 2H16A 3AUSA 1YASA 2ZRKA 4RL6A 2IZ0A 3R7DA 3GDHA 1P7YA 1XHLA 4GUDA 1P72A 1BTOA 3NTVA 4RMHA 1RHRA 1JHQA 1UZMA 1ZJZA 2O2DA 2P4QA 2WD9A 3O83A 3DH0A 2ZUVA 4PV7A 4XX1A 4EYOA 3A2KA 1G64A 1QM5A 1V35A 4QM6A 3CH5A 3FPSA 3ET4A 3G8AA 1WZNA 5JTTA 3KPWA 1KBQA 2A6PA 1BFKA 1I9GA 1G4AE 2VDWB 1X1SA 5DLEA 1JDUA 4E2XA 5FAKA 1J07A 2IZ6A 2ZRAA 1XD9A 2OZKA 1JSZA 4B40A 3BAFA 1AK9A 5K8LA 1YAJA 2Q0QA 1KBZA 3LDUA 2JIMA 3EARA 5H0IA 4ITUA 1FDVA 3I9LA 1N5DA 4IIYA 2O3SA 2D59A 4L15A 5FBKA 1E18A 2EXXA 5F35A 1Z7GA 1FUUA 2CL6X 2JHPA 3QEOA 1B76A 2QP3A 2UYHA 2G71A 4ECAA 4HQ6A 4BO6A 1PJCA 3K9HA 3G9TA 2XTNA 1ZMXA 3NDBB 3E61A 5KQSA 2B1GA 2YS7A 2NPOA 5F3DA 4B83A 3K6SA 1GL6A 4KH1A 5J9FA 1PX2A 1D6SA 2E6UX 1IJBA 3PV0A 5REQB 4KOEC 3BT7A 4EB3A 1XZIA 3UMBA 2C57A 2I7CA 1YS2X 5B37A 4E15A 4P7JA 2JJ1A 5JJCA 3CLHA 3U9TA 3QBEA 3TTXA 4MNTA 4CT4B 2X8JB 4NAUA 1MORA 3UNXA 4DNOA 3U61B 3ZNPA 1T9BA 1TM4E 1UFRA 2QSUA 4E08A 4Q02A 1IBKB 4CF5A 1ZOIA 2RCYA 1Z5NA 3TR5A 2AMVA 3N0WA 4N0DA 3VZBA 1Q3TA 4UCWA 4LJ4A 1CR1A 5TQ2B 3A6LA 3M1YA 2YH2A 3CC8A 3HKBB 4FBMA 4H16A 1H0RA 1R6AA 1ZRMA 1GITA 1XN4A 4X6UA 4EFDA 3ZDBA 2ISSD 2FU5C 3DO6A 1KU6A 1Z0FA 3VDMA 3JQFC 4NYJR 3T6KA 3U6KA 2YZKA 3NBXX 2L19A 3U37A 1RMYA 2CD9A 2C58A 1Y1TA 3A9UA 4BX0A 4KNWA 3TE7A 1BEUB 3FVQA 9GPBA 2OT3B 2R5NA 2K87A 2ZTMA 3NOXA 5EKDA 4N7MA 2PUVA 4D8WA 1YKSA 1I36A 2HCBA 5A1TA 2VHQA 1UINA 4ZJUA 3GNTA 5TIIA 1G7TA 2QV0A 4JB3A 3A4YA 5F5XA 5JHHB 3EIEA 5K8CA 2H2FA 3JVEA 3V6MA 1Z2EA 1AUXA 3HYRA 3F78A 4XVCA 4MJ3A 1I0ZA 4OFXA 4M0EA 4D26A 3ZDYB 3T3GA 1GLGA 1EQUA 2QVBA 3A7EA 1Y4SA 3LPCA 3QPBA 3NHYA 1KI4A 4AJ4A 2Z4SA 2GCNA 1TA4A 1EX7A 4GOLD 5AH0A 5H81A 3T7EA 1E1DA 5HZHA 2RIPA 4P84A 2YHSA 4BP1A 3NHRA 2QJWA 1VKHA 5DI3B 1QV7A 4ENQA 2H18A 2UVQA 3IIMA 4J7AA 2PLFA 2GHQA 1V8BA 2O0KA 3MCTA 3SHWA 2A1TS 2RJNA 4JEMA 2HI0A 1UK9A 2G25A 4RMGA 2G1UA 2HPVA 2QQ0A 2P8SA 4ZVLA 3L82B 1J39A 1W5AA 5AXAA 1G2QA 2DJIA 2POQX 1L7XA 2Y05A 1F2DA 3PHHA 2RHMA 4MDHA 2DWUA 4NPCA 2O54A 1QFMA 1RJ9A 2E6KA 4FJ1A 3CF4A 2AZTA 4QU0A 1V7PC 2W11A 3U0VA 1AX9A 1PD1A 1XN1A 1J33A 3UJBA 3HACA 5M3BA 1PFKA 1PQWA 3B1KA 3FFXA 4KIWA 5DM60 4DC0A 3H5TA 5IT0A 1S0UA 3WMFA 1E60A 1L5NA 2WDZA 2DBVO 1VHJA 5K8UA 4WINA 5I4BA 2ADMA 1UC9A 1Z2NX 1BJTA 2JA1A 1NUSA 2F00A 3CLSD 4PZPA 1KE1A 3G02A 5JDCA 4R9UC 1QHGA 3IS3A 4DXDA 2W8ZA 2VNHA 1GQ2A 1D7OA 3LS2A 5TX7A 2WIKA 2QTHA 3W8FA 1N6NA 4B0OA 1L4GA 4NBKA 4DNXA 1E9FA 4GBED 3ROQA 3W3AH 1ACLA 1KKMA 4NQRA 1UDXA 2QVGA 2FCRA 1S8FA 3HWX1 5DDIP 3RYIA 1QWOA 4N3BA 1UR5A 5AP9A 1U0GA 2XMSA 3N2GA 4YIKA 3PGXA 4I3HA 1P77A 2BHTA 2CL5A 1F17A 2QSYA 2WFLA 3ONNA 3DE1X 4LOAA 4YR7A 1QQBA 1UM8A 3DEAA 3OT4A 6PFKA 2OAEA 4IHKA 2BGNA 3C4QA 1GA4A 4CQLB 4CQNA 4LDZA 2NV6A 3U48A 2CCKA 2D5AA 2L18A 4B3TB 2O1SA 1LK5A 2CKDA 1DEXA 1F1BA 4BB9A 3C6BA 5DNVA 1U3GA 2I80A 3ANNA 1E2PA 3JQGB 2MSWA 4ZFNA 4X8LA 3KQKA 1RQ7A 1ZISA 2C2BA 1CQXA 1Y4UA 2O2IA 2WQZA 3F9RA 1X3SA 1SUIA 2K2QB 4N01A 5K6TA 3I0MA 2IEBA 2OO7A 1EU1A 2PIDA 3TLYA 3WSVA 3LTEA 4L9WA 2EKBA 2XRFA 3A70A 2V7BA 4KQMA 1EG2A 1AD2A 2H54A 2XDQA 4FOSA 3NHBA 4P0QB 2PQMA 1IBSA 4U9IS 2G82A 4FZ3A 3NG1A 1ENOA 1VZ3A 4GSLA 3U56A 2QMZA 3NIGB 2PPVA 4HDKA 1GDHA 3A1TA 5AHOA 5AW7A 3SBDA 1H9BA 4GP9A 1CJSA 3EVBA 3EWSA 3ZTWA 2GHIA 4F4DA 1NPTO 5TPWB 2O8BB 1OBVA 4YRAA 1SVNA 4JMLA 2BDEA 3QQPA 4R5MA 4Q4CA 1FJXA 1P17A 3CLTD 5BW4A 3VHXA 5JSZA 2HM7A 1U7UA 5LZ5A 1H1LB 4AY2A 4FLFA 3F73A 1XXHB 1I7QB 2GLXA 1WXEA 4IGEA 3GU3A 5JD6A 1UJMA 4L6CA 2BFNA 3K4QA 3LMKA 1DCKA 3QNMA 2V5VA 4GKJB 1WQ3A 3QMPA 4V0NA 3PI7A 1WSDA 1RJDA 4TL8A 1O5OA 3D4LA 4YJFA 4LY9A 5HBRA 3F97A 2RK3A 3MWLA 2CMFA 4FJ0A 4ZO8A 3WRYC 3CLTC 2FCAA 1PJSA 1I94B 2BWJA 5JLJA 1VCOA 3OLYA 1L2TA 5LXTB 3R7LA 4I4LA 3FGNA 3KUDA 4PY2A 4IHJF 5IUNC 4B35A 1TAGA 2NSHA 3QNWA 3SJCA 1XZQA 1G5FA 2WHPA 3QU2A 4BVHA 3CUEF 4YJ3A 1WPXA 2F3UA 4RPCA 4N41A 1OH8A 4U2DA 4MZDA 4WFQA 1W2WB 1P61B 1DHRA 1GU7A 1ZXLA 3GFTA 1KVTA 3O9ZA 1G20B 3HA7A 3FPBA 3HHPA 4P4LA 3JTEA 1DEHA 2OYSA 1P2VA 4F86A 4IDOA 5K6AC 3RC8A 1W4BA 2QMOA 3SM9A 1NJ2A 1RXWA 4E5YA 1ECJA 9ABPA 2VTKA 4YV2A 3U44A 1NBWB 4PG6A 2NZYA 1BKDR 1Q7RA 5KWSA 4UC0A 2YVUA 3PEFA 1UDWA 1U0NA 4MHOA 2C3OA 1A04A 1RS0A 3GRPA 3L43A 3AUTA 2WFMA 3NV7A 3OQ6A 3WLEA 1E2JA 4JI0B 1CKEA 2P75A 2FSSA 2OE2A 1T6YA 2XXJA 3PG5A 2FUCA 3VDXA 1HYGA 1NX6A 2M32A 2B1JA 3MD0A 1FB5A 2VCHA 3PXXA 4LECA 4PHCA 3IX7A 4DPLA 5AVSA 1AXEA 4QJ3A 4UBIA 5ALRA 4JELA 1PDOA 2OZLB 5EIWA 3RTAA 1MF7A 1I4LD 2AFHE 2LCIA 2PJDA 4PGAA 5E2IA 3WRXC 2ODPA 1MR3F 4J6FA 5DYGA 3RJZA 4C43A 5LDDC 4OGFA 3QA3E 5JEDA 1KQFA 2W6QA 1G7CA 1QKIA 3FMIA 2V6JA 4H7JA 2WI8A 3TW0A 1B6RA 3W5UA 3ZR4B 2FWMX 4IGFA 5CP8A 1RM5A 1ZVQA 2PAFA 3AEKB 3QVVA 4UJ3A 1BMTA 1VLHA 4CV1A 4YMHA 1F8FA 2Y93A 4OYHA 3E9EA 4WBNF 1XVAA 3PUXA 1VSVA 2ODTX 4HAXA 3USZA 2AOUB 2PS0A 1Z63A 2IEGA 1J1IA 2VK4A 3H4TA 4CM7A 2XUPA 4ZI7F 2QVLA 3SD7A 2OD2A 1D9XA 1RHMA 3WL3A 2WKPA 2RI0A 1X8XA 5KYUA 4DY6A 1X38A 3CPSA 3LIPA 3MTJA 4D9CA 1SOAA 1OVGA 4HQLA 1EFKA 3SBXA 5I47A 2O8FA 2OZVA 3O3MB 4I2NA 2C4UA 3IIEA 3FPEA 2IF2A 1JEYA 5F1PA 5F5NA 1KDZA 1OFGA 4FFBA 4LYYA 3I2HA 5G1PA 4WKBA 1YUMA 1E2MA 1JWLA 1ZZEA 3OIFA 3C3EA 2X42A 1WG8A 3NVMB 3SY8A 2WKSA 1I1NA 1PT7A 4HEA1 3BDVA 2PD3A 3BXXA 4LNUB 4YCAA 1KI7A 1M66A 4B6GA 2PQ2A 3NS7A 3RJ5A 3RSGA 4CKXA 1NQ5A 2VHJA 4LAFA 4TZKA 4ZJYA 2BY4A 2C9CA 1Y6QA 5BMVF 1DUSA 4XWOA 3FPHA 2BFPA 1DBRA 3NOQA 3JD4A 3RVJA 1X1QA 2AWNA 4M0LA 3DBLA 3RHFA 4FGSA 3SEAA 1GRVA 1WS6A 5EKXA 3CURA 5DHQA 5A5FA 2H7VA 1NBMA 3NYWA 2G1JA 1A1SA 5IJ0A 1QK3A 4ZZ2A 1XNJA 3KQLA 5E9WA 4HYQA 4Z0NA 2DHEA 4CPDA 1J1ZA 2QJRA 2ZBDA 3TSCA 2WYVA 1ISRA 4XPIA 5FPSA 4JC0A 3T1OA 5CDGA 1CY2A 1VB5A 2BCGY 1JXQA 4MR7B 4R69A 1K2VN 2RGBA 4JSTA 5AK5A 3FY4A 4C0WA 4J0JA 2PYIA 3IURA 4HLNA 3TRJA 1E3TA 4Q7JB 2E4AA 1XZJA 5TNXA 2AHRA 5CH5A 4KUGA 3F6YA 1SHLA 1C0IA 2O7SA 1DCMA 5T6MA 1VPLA 5DN6D 1GNVA 2WMNB 4O59O 4OP2A 4R81A 4OHPA 1AHIA 1G4HA 4YT4A 4KO2S 2NUTA 2ZRHA 1E4EB 3WLLA 3ADBA 2A35A 1C3XA 1C8BA 3IAM1 3L18A 4BY9E 3ZJTA 1N0HA 2XODA 3KAKA 1VJ0A 3DZGA 2GN1A 1EQ2A 2PUWA 3UJ8A 1CNMA 5FNVA 2ZK7A 4C03A 3SF8A 3T8YA 2I6GA 1U0HC 5CLGA 1CP3A 3EH1A 1VA4A 2BE9A 4NCHA 4LYGA 3HL0A 2YFQA 2RHLA 4OF4A 4RFSA 4ZKEA 4GI2A 3PCXA 4QC2A 3C70A 1UMBA 3K35A 3TLMA 4Z1MA 3V1KA 4CMJA 5JASA 2FZEA 3B6EA 3N0RA 4ES6A 4AJPA 2OMEA 4C4TA 1IDN1 1DINA 2H2HA 2ZQZA 2ZIUB 4R0MA 1II8B 3ZOKA 2DWCA 3NXSA 3OZIA 4M87A 2I4OA 3B1FA 4BGEA 5LPNA 2VHEA 4FR5A 2YRWA 1PRYA 1M34A 1X1BA 3EDOA 5BUSA 5K0ZA 1JEDA 3E3AA 1OI3A 1GGEA 2SNIE 4BUCA 1XTZA 3ZZ1A 3IOEA 4KSYA 3MBOA 3SXUB 1RI3A 3FWYA 4LY6A 1AKTA 4Q9HA 4Z0HO 4YDQA 2IH5A 2P67A 3DMHA 2QRVB 4UFNA 1SK8A 1QH8A 4FGLA 1BRTA 3QP9A 1HDXA 2FW1A 5ALQA 1AHPA 2Y0CA 3C8ZA 3R3UA 2NSYA 2FE4A 4TYNA 2NQ8A 1Y6GA 3HSYA 1C0PA 1T29A 4NCXA 3DTVA 2XNSA 2DM6A 3ODPA 4IFTA 2AJBA 4TXLA 4CTMA 1F6DA 1T5BA 2JBHA 3N8DA 3G1UA 4C0LA 3NBAA 5FDFA 2XXAA 4NHOA 1JALA 3O3CA 3Q87B 4RVDA 2J5KA 2RSLA 1KSFX 3DOCA 1SR8A 3R6DA 4QDZA 3T0FA 3F7TA 2B5VA 3QXGA 4H3VA 4PBRA 3UC5A 3IUBA 1G2OA 3OIYA 5LP6F 1CZHA 1OOEA 1VJDA 1Y63A 1P5RA 2C31A 3B48A 4INAA 5D6NA 2L0XA 5C32A 3HMKA 1YGYA 1A9RA 2IU4A 2PBFA 1Y7TA 2FSVA 2WZQA 3COPA 4EO7A 1SG6A 3VPSA 2PCLA 1H42A 3MWGA 5CFRA 1B8OA 4EI8A 4F9TA 4RIEA 1BMFD 5GZ3A 2NUAA 4JVSB 5K5EA 5DNCA 4O1MA 4DOMA 2TSYB 3A14A 4MS3A 3UT0A 2AEFA 4S1WA 3TUIC 3TLGB 4E31A 4OJKA 4LWZA 4GKKB 5JSKA 1Z0JA 3K1TA 2GBGA 4HWTA 4ZDIA 4C04A 3E3OA 4NNJA 4C08A 3EPKA 3CX8A 4TT8A 4KHPB 4IRMA 5JXHA 4ISCA 2NTNA 4LZNA 3IMCA 4PYIA 4RLQA 1V16B 3FYUB 2GK4A 3R6TA 4WZAB 1KYVA 2ZYWX 3GJXC 1XBTA 4RY2A 3THXB 4KC0A 4IJ5A 3SZGA 3T3OA 3HXPA 2DECA 1OXKB 3KJXA 4I4IA 4R05A 4ROSA 1VE5A 2PPLA 4WBXC 3ZQ4A 5BUZA 5DXFA 1H3NA 1I7DA 2EF1A 2GPJA 1BW9B 2G5CA 1WRBA 4FHGA 1E2NA 2NXWA 1G8YA 4M4SA 4CM4A 3D0KA 1DRJA 4OJMX 3W34A 1IG0A 2BRUA 1A3CA 1JV2B 4GLJA 3KYJB 3K2QA 4BKMA 4F5WA 1NLZA 1NU8A 4IIJB 4NZPA 1L5OA 4J0HA 3QE4A 2E37A 4MS1A 1XLTC 1KI2A 3CWCA 3RE1A 3B1WA 4B71A 3BA6A 3H84A 4BO1A 1HNNA 4MQFA 3UUWA 1BXGA 3VU9A 2W2KA 5FF9A 3M9XA 5K4HA 2IQIA 2MSDB 5T3UA 5F7OA 2C5AA 4Q4JB 1PR6A 4ZQGA 4DJ5X 1DXHA 4BBPA 4L75A 1YR2A 4MQMA 4G5XA 5A9SA 1S7GA 2FUG6 1G6KA 2QXTA 1WL8A 4RKEA 2D54A 3PNSA 1NRJB 1S2OA 1UK7A 3F46A 1FSPA 2KJQA 1YBHA 2VQ6A 2GZ2A 2VL7A 1V5GA 1GTG1 4JAVC 2WVAA 2WSYB 1DG9A 3HP4A 3EPHA 3O38A 3U39A 1TJYA 3QPAA 1N7HA 1GGHA 2CLHB 3U9LA 2LPMA 2V6FA 3R6WA 4OQQA 5ALYA 5I4KA 3MPOA 4JJFA 3KOUA 2H2AA 3E6AA 5ICFA 4DBZA 2JLAA 1U8UA 1PYDA 2WD7B 3UO8B 3CVWA 4ER3A 3BQNB 3QLUA 3R74A 3IO3A 1ZSYA 1BD4A 4QIHA 4Q7MB 4DJFC 1QZXA 4KSCA 2NXEA 4C3ZA 3FCOA 5AUNB 1SKBA 4CUJA 5IVKA 3CHYA 1D0IA 4I1RA 4DV6B 4JT4A 3F2IA 3PDJA 1YJ5A 4H60A 4YJ2A 3WB9A 3GPBA 5JQGF 1NW7A 4FFOA 16PKA 2Q3LA 1L5GB 3S2ZA 3FDJA 1WF3A 2NO9A 3DEKA 5ALIA 4FNOA 4JLDA 3DTNA 4EHBA 5JW6A 1IIRA 3VYUB 3VXKA 3VU0A 3WA7A 3ADDA 2BCEA 2VNJA 4I4TB 1S96A 3BIJA 3OWHA 4E3WA 3HJFA 3IKJA 1L1EA 3WB1A 2ZT5A 2ETXA 4C6TB 5ENZA 4AURA 3HADA 4L27A 3LW8A 5E4TA 2YJGA 3JQ9C 4QPCA 5EJ7A 3DL7A 1A97A 3AJAA 3F9IA 4L6AA 4F1WA 4DMHA 2F8LA 3DO8A 4GQBA 4HNUA 3HDTA 1F6BA 5TT1A 3LHIA 2AUTA 1E2BA 2NXNA 4X1IB 2YJ3A 4O4JA 1XTUA 3NBYC 2Q4OA 1C81A 2Z30A 4HWRA 4OD0A 2PA0A 4NH4A 3FCUB 3C48A 4CXMA 1NURA 4OYLA 3WJ7A 2QTMA 1T26A 4KMOA 4L0DA 1U90A 1MRNA 4S0XA 3TLBA 4NZZA 2IS6A 4HDSB 5JS8A 5BWBA 5BR7A 4B32A 5EJ4A 1R8SA 1VJCA 1DRKA 3IBTA 1O87A 5A06A 3NH6A 4QG7A 1LUAA 1SHUX 3KV3O 2I1VB 4CL0A 1K1EA 2JDIA 4KO1S 3HA5A 3V8NA 1PFQA 2X13A 1X7ZB 3BH6A 4HAOA 1UKAA 4NFSA 2WV7A 3DE0X 4ILKA 4BO7A 1TVKB 1KU0A 1TMOA 4U7GA 3TPCA 4DDVA 1T6ZA 1K7FB 4BMYA 3AKZA 4MVJD 2YV3A 4Y1GA 2A5JA 5JNVA 3R09A 2XQKA 1GTVA 3AR7A 2IP4A 3ILSA 3N2IA 5GQSA 2HDWA 3CMMA 5KNDA 3ZWDA 3U2QA 1B41A 1ZG3A 1OY1A 3L0ZA 4OHZA 3UHOA 2I1WA 3R23A 2OLJA 3AILA 4UBMA 4DDWA 3IPCA 4M9ZA 4HFJA 3U7FB 2GS9A 2G5GX 5FHQA 2H1LA 3LD9A 3SQXA 3D2LA 2GAJA 2GKGA 3EIWA 1GAEO 3AY7A 2QGFA 1UQRA 1T0JB 3WWOA 3D8UA 4DSAA 1CXZA 4ND2A 1DWUA 5I4CA 5IS2A 1N34B 3W0LB 3KB8A 3OX2A 4DNFA 4GR4A 4ZARA 1XOIA 2M1ZA 1WLYA 4ZEXA 3H2YA 2V3VA 3C98A 3L93A 1Y8QA 4G86A 4KE8A 5CA0B 5JCPA 2NO4A 1DKLA 1HF3A 2DE0X 3MHPA 3RS0A 3ZLVA 3LK6A 1GV0A 3RO7A 2YWHA 3EG5A 2Q5CA 2PUAA 3EDQA 5DHAA 2LDBA 4UEJA 3V8PA 2JFZA 4QEKA 3TJRA 3AVQA 3TSZA 1F2UB 1G21E 2VUTA 2O0JA 2VAPA 3TVDA 4IMPA 5KJFA 1G38A 1D5WA 3O1HB 5LP6B 2VDNB 4OV6B 3PYMA 4B5LA 1M5UA 2BSXA 5EWMA 4YUZA 4FQ8A 5KNBA 1BROA 1K7XB 2ZE6A 3MWKA 4KGDA 3GLTA 2TMDA 4BVAA 4BN4A 1VECA 3KQQA 5CA1F 4J75A 1GFZA 4KBGA 4YRFA 3WNDA 2PLNA 5CXQA 2COEA 1CLEA 1XJQA 1RKUA 5LZ7A 1QIJA 1WA5A 3HKCB 1YI8A 3G9ZA 3EBOA 1G9SA 4Y3UA 1FX0A 3LDAA 5HF6A 2P9EA 3COVA 2J9FB 4IV8A 1VRWA 3WWEA 3EY4A 2X8WA 3KKEA 4KI7A 2ZBGA 4DV5B 1HDIA 4E6PA 4QUEA 2GXSA 1AB6A 2OENG 3CF2A 2R8EA 3LECA 4WNAB 4LBVA 4LKOA 5TVGA 4DCSA 4HEJA 2M9MA 2Q3BA 2VBFA 3OZWA 4FGUA 1E1YA 4HVCA 4LXTA 1VJ5A 4ZOCA 4B6SA 1U8TA 1YFKA 5C8YA 1BD3A 3N28A 2DPLA 4DCNA 5HIKA 3OTWA 4FXOA 1RYFA 4TTTS 5IZCA 3FG9A 2OUIA 4CR8A 1DAMA 5CFPA 1NSFA 4CIXA 4D4JA 2NTVA 3BB1A 4KB5A 1XTVA 4O08A 1BYUA 1U8ZA 4X94A 1GHTA 3C1TA 4JUIA 2O19A 4EG6A 4MQ6A 3D3WB 3Q3JB 4FE7A 4HNAB 2BP7B 1YZLA 1WBJB 3P19A 3NC0C 4AZ3B 1BDMA 1RJWA 1W0KD 3MLEA 5JAPA 4O2BF 3TX2A 4QPPA 4JNCA 3ER9A 4HAVA 2OAQ1 5LOVA 3I53A 5J47A 3VC7A 1QBKC 3BJMA 4BB0A 1UBKS 4JJEA 1WX1A 5B58C 1EFPA 1S8NA 3VTKA 3FKQA 1JMKC 1NIJA 2CUZA 3DNMA 1Y7IA 4HTFA 1OFUA 3NHMA 4UXJA 1ZVMA 4WW0A 1PZFA 3W8DA 2A58A 2UYGA 4B3IA 4NFLA 2FHPA 3NHJA 4EJ2A 4MVCA 3B6JA 3FOAA 2ZE5A 4HH4A 1PKXA 1UXOA 1LX6A 1JLMA 2W2NA 4NHEA 4CCYA 5LQJA 1A5BB 1YHZA 2I33A 2IODA 5EL0A 4BEWA 5K51A 5C2JB 3ZXXA 2SBTA 1F8UA 4YP0A 5B2ZA 5IFKA 3RVDA 4YAGA 1Y3IA 1IYZA 1F51E 3VKGA 5J4LA 2PWBA 3V8VA 3F3YA 4RZHA 4C1NA 1K6JA 2HF9A 4FMCF 3P9YA 1W47A 4JITA 4NULA 1JAXA 4NVRA 5BSRA 3T4UA 3ZLBA 5JH7B 4YHBA 2QX6A 4MYHA 3AERB 1QE3A 4G8JA 3LX8A 3TZCA 3BREA 5C8YF 1NN3A 2QVCA 4MP3A 1SB8A 3G2MA 4MW0A 1CNEA 4Y2GA 3U3ZA 3WR5A 1C29B 4B8WA 1KFJB 4BO2A 1VL6A 2ZWPA 3QWHA 5HM6A 4N49A 3OLQA 5FYDA 4TLLB 2XTAA 2J0UA 5F1KA 4XWGA 3L06A 1GV1A 1OXTA 2GKOA 2V8OA 4DMFA 1V41E 2PHZA 3VR6A 3PJRA 1F3LA 3KPJA 4UCQA 1Z88A 4UFOA 3D6MA 4G1BA 1MD9A 5F51A 1W2GA 4BMZA 4RPLA 4DSUA 1PVDA 1CVIA 2V4UA 4I50B 4EI2A 5HX7A 3R9KA 1KMMA 4ND4A 5FAXA 1YQ9A 2QM8A 1SULA 3H6GA 3PFHA 1XKTA 4YN3A 2RH8A 1SCUA 2OCKA 1T10A 4MJXA 5IARA 3H3FA 1QR6A 2Y3IA 1Z3IX 3SBOA 1QUEA 2P5TB 3A4MA 3KHKA 5E6UB 5FR1A 2PX5A 4H4DA 3ZCRA 4JBLA 2VTDA 4DEVA 5HDQA 1B0AA 4MR8A 2QU8A 3ICCA 2IV7A 2QW8A 1C8VB 4JX8A 2PT6A 4W9NC 2R8BA 4XVUA 4OLAA 1K92A 1W2HA 3L01A 3GGJA 3GPCA 4DB4A 3U4DA 4LNHA 1D6NA 1TZJA 4RETA 6GPBA 4RTJA 1XCGB 4FKZA 3T5BA 4R2WA 1M2KA 2Q6TA 1MJGM 1H9CA 1RHJA 4CDRA 1JFFA 1YQGA 1HDCA 3HJRA 4U7TB 5BSWA 1NXOA 2Q4DA 1Z47A 1R64A 3UTDA 5JY1A 1C9KA 1X7XB 2ID7A 2VZLA 3ORYA 2ACWA 3VU1A 3TIGA 4F8EA 5JI3E 2UZIR 1LEHA 4LMPA 5DIZA 5GONA 3IUQA 5CYGA 2C5LA 5CLQA 5A4FS 1BCRA 4EL5A 4OXXA 2A0WA 5CYOA 5BQ5A 3ZK9A 4LZOA 4M1ZA 3R7BA 1GFSA 3DT8A 4E5UA 2Y4OA 1AKWA 1I6MA 1DG1G 1WU7A 3MUNA 4J90A 4B80A 4ZVQA 5IJAA 1V0JA 2VP3A 1TLLA 1M2VB 2I3DA 5DCUA 2SKDA 3DNPA 3JPYA 3N39C 5HZMA 2DEUA 2XTZA 4YT2A 4RZ2A 4E4RA 4MMYB 2Y67A 1UBMS 4W1QA 5HF5A 4FGJA 2NU8B 2CWWA 4L28A 2OCYC 3OFND 5MGBA 4PQYA 1Z5UA 1EVKA 1GZUA 1V5IA 3FFAA 3R0XA 5FWAA 2PS9A 3ZGLA 1WY5A 3RS4A 4OGWA 4Q6BA 5EXPA 3ZKWA 3IT1A 1BEEA 4QDJA 5IFLA 1AMNA 3HBFA 4J7XA 3UG7A 1SA0B 3PYLA 1NI5A 3A2LA 3ZHCA 4DLBA 1P7WA 2P6MA 2PU7A 1MT0A 1Z6ZA 3IP3A 1G59A 4B9AA 3G2KA 4QUIA 3PEYA 4IDPA 4OBBA 3BZBA 2CHVA 3F47A 1YFJA 4KVFA 4OAOA 4CU2A 1GT91 2Z57A 1AN0A 1GPYA 1N5KA 1MIHA 2V54A 2Q29A 2JGFA 4P58A 5CT4A 1JVNA 4MUFA 1X70A 2ZDGA 3NM5A 3W5HA 1PAUA 3MJDA 2GBCA 4RD6A 2ZKIA 2Z98A 4EP1A 3TLJA 3TRDA 4TMKA 3P52A 1PR4A 1DJOA 1H2WA 2GKSA 3GHHA 2ZZKA 2ZYVX 5G40A 3W3ZB 5H3LA 1IN7A 1PZMA 4DJAA 1XDDA 2W6ID 4JT2A 3C8MA 4GMGA 4HXGA 3PKZA 4BEJA 4EYQA 4EFLA 4PLTA 2IZ7A 2YZGA 1KZ4A 3IO5A 1JX6A 2ZJFA 4LVNA 2ZJZA 1VLVA 1XVVA 2H4FA 2NYAA 4OVKA 4DT1B 1MAHA 1RWMA 4DCPA 1C2YA 1NMEA 1KO8A 1NJFA 2ZETA 3KKNA 1QK5A 2YOFA 3PFGA 3FDFA 1W6UA 3Q9SA 3ZCUA 1NNLA 3KFVA 5ELLA 6CHYA 5DK6A 4ER6A 3REOA 3DV0A 1V8PA 4OGKA 3AEUA 4IHAA 4XUDA 1EX6A 2ZIWB 4ESOA 2G1AA 3UJPA 1N2EA 3JALB 4KACA 5H68A 1RKVA 2BHRA 2YICA 4EHFA 4K9OA 4MO9A 2C4WA 3F96A 1FFXA 4FEAA 2VF7A 3LA6A 3N6RA 4H7HA 4MGZR 1VKZA 2P0EA 4MV6A 3I5XA 1MX1A 2R1TB 3F6EX 4LVUA 1ZH6A 3KC2A 3ECSA 4O4IB 1M76A 5AQEA 1FJ2A 2HRBA 3DNFA 3T1TA 5LQSA 1QP8A 3VR3D 3ETGA 3WFZA 1XYGA 3IDQA 1W52X 3O4FA 3TOCA 1E2DA 1HQKA 3AR5A 4X91A 1SQGA 1J0XO 2X6RA 1U5BA 2V7WA 2DP4E 3K8QA 1XZAA 3BA1A 3KPYA 4KR0A 3W6UA 2EEZA 3N0TA 3WK5A 4EARA 1Q0PA 3BSSA 3KOMA 3UICA 3JAMA 3EOBI 2IBMA 4AKTA 4YDSA 4DIFA 1QQAA 4D0GA 1WD5A 2P5SA 5DYTA 3SGLA 3ER6A 2G36A 2QN1A 3PD1A 2YWXA 2FR8A 1K2WA 1AIPA 1OAAA 4KXLA 3SFZA 4UEQA 2P41A 2PBLA 1I2BA 4ZAWA 3F8WA 3ZHSA 4JCCA 2OPHA 1KEUA 3BD7A 4RVOA 5KTYA 1TUGA 1JIXA 2WE7A 3G5AA 4FONA 1WXQA 4H31A 1DDOA 4MUBA 4PHHA 5AICA 5CD9A 1Y4ZA 2VNAA 2PTGA 4F1JA 3AL0C 5B36A 3IQDB 3QWBA 4N0MA 1UXJA 4FZVA 1JEYB 1L7MA 1AQIA 4MUKA 3B3GA 4JVOA 4B6RA 3S55A 3GVHA 3WZLA 2VAVA 5BO5A 1U5CA 3UZUA 3EVFA 1B6SA 3LLMA 3LPAA 4CKCB 2QGNA 2X2FA 5CDTA 2OCGA 1T24A 5A03A 2ZBUA 1FOEB 2G07A 2IQ5A 2O2SA 1M1UA 3MINB 1N2CE 3O8NA 4PWYA 2R8YA 4MWGA 2VPYA 1OKKD 4M7PA 2BMWA 1G41A 1KORA 3IR5A 2H00A 2YN2A 3RSZA 4QO7A 2W70A 4B47A 4BMVA 3RJ9A 4E2WA 1AKUA 2G8NA 1XPUA 4F6LA 4N5DA 2E5LB 3O92A 4MWSA 5JYDA 2QLFA 2FYTA 3RAPR 2O8CB 1DQSA 3PLNA 2XB9A 2OILA 2WIAA 3CNBA 5IDVA 5A3QA 4LRYA 1I01A 2IE8A 5HK9A 1VKJA 5DGHA 3CG4A 2KSQA 1MN6A 4MQBA 4Y9DA 5K3OA 2C1EA 2VZEA 3M9WA 4NK5A 3QEMA 3P0RA 1I7SB 3ETLA 3PC4A 2JHGA 4XIYA 1NUTA 2RAPA 2C4HA 2X1MA 1I3KA 4QRIA 5JFOA 5ALFA 1ADYA 1VRVA 3MRVA 4MR7A 3DE5X 4YPVA 4DM7A 4EYGA 1W0JD 1TQ4A 3LUFA 1P0FA 3ADKA 4X6LA 2C92A 1VHLA 2FPLA 4JGBA 2QS9A 3GHYA 2W6MA 5HA5A 2D7JA 3WLJA 1H2EA 4WXYB 1P3Y1 4KN6A 4AUEA 1IQUA 4P32A 4OB6A 3OOWA 1YCGA 5DK4A 1QIKA 2IUEA 1Y4DE 2ZS9A 1E4EA 4P83A 5KTTA 2N75A 4GMFA 2EZ8A 3HE3A 2VOEA 5C1IA 3BXZA 1VBNA 5LLDA 4KQHA 3PZBA 2CLIB 3U5ZB 4GLOA 1UZNA 4CT5A 1K4YA 1ORTA 1S7CA 1WKVA 1YR6A 3DFIA 4NJMA 2X23A 2I29A 4Z86A 1B0PA 5IYZA 2ZUBA 3BEOA 5B1YA 1IATA 4EVQA 1AK2A 3V2UA 3H7AA 1QYCA 2WB2A 2Q46A 5B12A 1XF9A 3GT7A 3PITA 1AUVA 2VRCD 1V6CA 2QE7A 4UASA 3R8XA 3SPXA 3A6DA 3WGTA 5BYJA 4O1IA 2F64A 1CCWA 4TSFD 3VR5A 4O63O 1QXSA 1K0FA 2J7PD 3ESZA 3FPJA 5AVKA 2WVGA 5ALTA 1SJ9A 2WLTA 1VI6A 4PXAA 2EJTA 1FSSA 5BXYA 3OU7A 3QXXA 4Z3OA 2X5NA 4D9NA 4AMBA 2PQ6A 3QE2A 1Z3CA 4F56A 3NM6B 3LO5A 3M83A 3EISA 5K7SA 3IERA 4Q19A 3CLUC 5BSEA 5IVPA 2EJUA 4A1FA 2VF5X 4DHWA 4DLRA 2Q49A 2WWTA 3LUGA 3NX4A 4DXAA 4HI0E 1DUIA 3AQ4A 1ZN9A 2HHCA 4P7KA 1QH8B 2J4CA 4GOND 4Q3BA 2V7XA 4UVHA 1EEXB 1QV9A 2DXIA 2J3QA 1I1QB 2ECFA 1EI9A 2G28A 5KYYA 3O9MA 3A06A 2D1TA 4ZT6A 3S2FA 4BMCA 4ZYWA 4G67A 1E89A 1RZRD 3AR2A 4UATA 1TF7A 1D04A 1JU4A 4TQAA 1YQTA 1TMGE 2JHFA 5MHTA 5AXDA 5A3RA 4BEVA 1YK1A 1DEKA 1PT8A 3ONWA 4R1TA 1N4AA 4LVCA 1KJZA 2VR1A 4DSTA 5J1SB 5EHXA 5DBEX 1Z38A 4INZA 2VJPA 2VF4X 3RVOA 1O6CA 2CLSA 2DTDA 1FFYA 3D7KA 1EGHA 1VQ1A 3CXUA 3HDVA 1ZK3A 2QXYA 2YOHA 3X2EA 2WABA 4KR2A 4YI3A 4PC1A 2ID8A 2JCBA 4IX9A 4NMLA 3SYKA 2G9QA 1ZN7A 4AJIA 3D4NA 4ZZ1A 3SQOA 4M9CA 2P2ZA 4GMKA 4X8MA 2NUAB 3HGTA 4CTKA 2XCLA 4L4SA 1OWPA 3ELWA 4RVGA 4MS3B 4CKBB 2NTEA 3PRJA 5BW8A 3H7IA 1LDNA 1JG2A 2OHFA 3K09A 2IP2A 1U9JA 4DPMA 1BH6A 1YL6A 2EHJA 2TMKA 5BVHB 5I7WA 2BMVA 4HAUA 2X0KA 3KKZA 4C89A 1SU4A 4UUMA 1G8HA 2NOAA 1MV5A 3ROZA 4ZZIA 2P7HA 3AP2A 5EIBC 1E8NA 4DLSA 1YBVA 5GJBA 3VYTB 3FNBA 3TNDA 3QENA 2BD0A 4J29A 4M6WA 3RAEC 3CUVA 4F5EA 1XD8A 2B82A 1J0DA 3UOWA 2A0FA 3KSAC 1SC3A 1ND6A 3OLCX 1UM9B 2DFVA 2DR3A 1BWQA 5L6LB 3QUTA 1JQAA 2ZXEA 3HU3A 4AIRA 1KP3A 1WZUA 4BO4A 1F38A 2CJWB 3LCMA 3BEDA 4QOHA 1KEEA 1G3UA 3BH0A 4KTTE 4WLVA 5CCEA 2CDCA 1F4VA 3OIWA 4Z53A 5G0UA 1B16A 4IQGA 4K5QA 3JCZA 3VX3A 4PPQA 4RPKA 3STVA 2VYCA 1J8QA 1SB9A 1IJKA 3WADA 1UOOA 5IYZF 3RNOA 3BDAA 1CEYA 5J23A 5F1OA 3UHPA 2HNAA 3UW1A 5KQPA 2IELA 4GT1A 1MQSA 4M46A 2YN0A 1SNYA 4C0AC 4DQKA 5AJWA 2WAAA 3NDRA 4WKNA 1FDOA 4BLUA 2QLMA 1QYXA 1ZN2A 2JLYA 4EJ6A 3L92A 5EGNA 2PH7A 1Z18A 4DBLE 1UMCB 1RJGA 4G8CA 3OD5A 2DPXA 3WNQA 2PXCA 4LY0A 3KL2A 4JYZA 2MU1A 1LLUA 1A7AA 5FQNA 1P2GA 5JNUA 2K4MA 2OVFA 1NT4A 3UAZA 5AVTA 5FJIA 1PJ3A 4TWJA 2DUNA 5DSTA 1XP8A 2BFDA 1ZW6A 3BGIA 3AR3A 3IP5A 3WHKA 4I4TF 2AZXA 4HDRB 4Q9NA 2VRNA 3TUJC 1NJGA 2FI1A 2C3YA 3GUHA 4MKIA 4PO9A 4DLTA 3EVNA 1J42A 1KJIA 4NEQA 4JI5B 121PA 3ND6A 5EFOA 3K4HA 2WTUA 1GRCA 2W2QA 4YAWA 1JG6A 2LWIA 1PTKA 1SRRA 2W6JD 3I73A 1E7WA 4BB6A 2BGMA 4BNVA 1RJEA 1GY8A 1XCBA 2JHCA 2WNSA 3TTWA 3AVVA 4Y2HA 1RZ3A 3SI7A 2CXPA 1KBOA 3SHQA 3AETB 3G0BA 4KPGA 1P2UA 5C35A 3DZCA 4JLUA 1VL1A 2Q0HA 4X62B 4X63A 4BWVA 2R8OA 1K3UB 1XL1A 2FMTA 2DJ5<