1FMCA

7-alpha-hydroxysteroid dehydrogenase complex with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1996-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fmcA00
4GSKA 3NGXA 5DBGA 5LDGA 4IINA 3GH3A 1T4BA 1CRWG 2RBEA 2FSSA 4MIOA 1JAXA 8ADHA 1H5QA 5CDYA 1DAPA 3ONEA 2VZ0A 3HQ4O 1UDCA 1CJCA 3ASVA 4B4VA 3DFUA 1R0SA 4ID9A 4PLTA 1D4FA 1N8KA 3ZWVA 4XIYA 4YA6A 1JU9A 4CL8A 1H2BA 1U4SA 4R9RA 4CQMB 2BFPA 4XYLA 1EDOA 1Z75A 1JDJA 2FHSA 4PVCA 3SJUA 1EDZA 3ZWOA 3M6IA 1NPYA 1C0KA 3OQ6A 1E3WA 4L4SA 4HP8A 1RM0A 4L73A 4WLUA 5G2OA 1KIFA 2CUKA 3KRTA 4MINA 1DO8A 4Q3NA 1NM5A 4HFJA 2PWZA 3TFOA 1A9YA 1EUCA 2Q2VA 4BKQA 4B3HA 1R16A 4N18A 4ZQHA 2BKAA 1F17A 4WUVA 4Z3DA 1HZZA 3IJRA 2BF7A 3DTTA 1GCUA 4OQYA 3DZJA 1ZEJA 1P1RA 2PGDA 3ONDA 3H7AA 3DBLB 4GAEA 1EFKA 1YWGO 3GDOA 1X1EA 3ZH2A 4CMJA 4A0SA 3EVNA 4OOFA 4JNKA 3F9IA 2YFHA 4J90A 3VH2A 5CDGA 3Q9UA 1YB1A 1VJ1A 1QV6A 4YPOA 1O5IA 3BTSA 5JC1A 5K6AA 4R1TA 1Y7TA 5A9TA 1UP6A 2HK9A 4RL6A 4BNJA 4AICA 1LLUA 3EZLA 4ZU3A 4QO7A 1IE3A 4MKZA 2YHUA 4R51A 1YBVA 3PIDA 1NX6A 3GFBA 5TJ9A 5JBIA 2AA3A 5T67A 5JDCC 4BNXA 3E5MA 4E31A 4WLVA 4EZBA 1B7GO 1PJCA 4ND4A 4AJLA 2G5CA 1PJ2A 2O7SA 4NJMB 4RDIA 5ENDA 2Y1FA 3B70A 2HRBA 6ADHA 1I3KA 1BRMA 4XGIA 1DC3A 1JKFA 3QE3A 1Z73A 1Y8RA 5K0ZA 1P77A 3FNHA 1PL6A 4Z3KA 4DLLA 3JD4A 5AXDA 3CPSA 4M49A 1B3RA 2X0NA 2JJYA 4RPKA 1OOEA 3EDMA 4WEOA 3GAZA 1LDEA 1Q0LA 4C7KA 2DTEA 3TZQA 5BNFA 3UICA 3ZDFA 4HFNA 1J4AA 5L3ZA 3SLGA 2JAHA 1JKIA 4NFSA 4EJ0A 1QLHA 3KB6A 4CR7A 3HN7A 4JCOA 3RASA 4NU5A 4IQ0A 1LUAA 4BO7A 3CE6A 4CLRB 4DL9A 1VJTA 5T5QA 2I3GA 2VRBA 1D8AA 4HNHA 2YFQA 3BMQA 3ZV4A 1ZIDA 4QSMA 4HADA 3O9ZA 1C0PA 2EIHA 3UCXA 2OHXA 3A1NA 1DIHA 3RUIA 3P5SA 5JPIA 4FIZA 1PR3A 4IM7A 4R69A 2V6FA 4CMEA 4NNJA 4DVJA 1UZNA 2YV3A 5ICMA 1LSSA 1NPDA 2D8AA 3I4FA 4IMPA 3FNEA 3VKUA 4EJ6A 1HLPA 3ZW8A 2CNBA 3RKUA 4JBIA 1WVGA 4YAGA 2X5KO 3CMMA 4BNGA 1HLDA 2D3TA 4BNVA 3ZU3A 3ST7A 1C1DB 1JLLA 4LGVA 1WPQA 4MPDA 4U0KA 3DOOA 5KVQA 5KNLA 3ZU2A 3DMTA 4K1LA 1ULSA 3L4SO 3EZYA 3AU9A 1W0CA 4DYDA 2IEDA 2WD7A 4EI2A 4J7XA 4E3ZA 3B6ZA 4TQGA 4EYEA 1ISJA 4LSWA 5F3RA 4GL4A 4ZGWA 3GVHA 4YRAA 3S2IA 4FPXA 3D7LA 3BYZA 3CIFA 1EBFA 3H9GA 3S2GA 2P91A 3TL2A 4YRDA 4J1QA 3U49A 1LI4A 2C7GA 2ZQZA 1KC3A 2P9EA 5B37A 1DBVO 2AHRA 3WSVA 4H16A 2Q49A 3MJTA 2VYVA 4J7UA 3UCFA 5BQFA 3KBOA 1GPDG 3PHJA 2RAFA 1ZK3A 1NNUA 3QRWA 1LRKA 4DMLA 3IC5A 4BNNA 5A5EA 1TT7A 1PSDA 4E30A 1DRWA 5ILGA 3WX0A 1FDVA 5JW6A 3KTDA 4GGPA 1PJLA 4OIMA 2V6GA 4XYGA 2H6EA 3BTUA 5CG2A 4NH4A 1D3AA 4XEHA 3WBBA 3DOJA 3PJDA 4YR9A 2IXAA 3JQGB 3IJPA 4OGWA 2UAGA 1HDCA 1ZW1A 1TVEA 1GUZA 1A27A 1ARZA 1H0KA 4IDBA 4IS2A 4BGIA 1Q0QA 5CEEA 1ZUD1 1M6WA 4NPCA 5G0TA 3ZHYA 1NP3A 2W2LA 1IYZA 3DO5A 1HYHA 4TVBA 1E7RA 1P1JA 4NU6A 1UJMA 3OHSX 1GDHA 2AE1A 1QYCA 3GT0A 1EE9A 1SEVA 4O6VA 4UVDA 1GY8A 2PZKA 1CYDA 4J9UE 2YV1A 3DBHA 5TLSA 1ZH8A 3D4NA 1E3SA 1OMOA 4E0BA 3W8EA 5ER9A 4MKXA 3RU7A 4MVJP 1WP4A 4Z6KA 5DP1A 3ROMA 1VL6A 4ALJA 4DIOA 5CDTA 2O4CA 3ROKA 4Y9DA 5JE8A 4BNWA 4HNGA 5IXSA 2VHXA 1CF2O 1SAYA 3F1KA 2Y1OA 3NTQA 1UDBA 4YJFB 4YTEA 4NJOA 3AOEC 3MWDB 4LVUA 4RF4A 3ICCA 4WK6A 1R4MB 5L7YA 1JVSA 1E6UA 2BFOA 1GPJA 3E9MA 3H9QA 3HUDA 1L7DA 3ON5A 5IDYA 1DIBA 2PY6A 1E3IA 4PLWA 3MJVA 1V6AA 4LMRA 2FSVA 4DLBA 3WSWA 1X0VA 3WGQA 4KZPA 4PN3A 2DC1A 2V6BA 1X7GA 4HKTA 2X0IA 5TNXA 4YAJA 3ZWXA 5KTKA 5F5NA 5HA5A 1RYEA 5HRUA 2B4QA 3TJRA 4L8VA 3RUEA 1P1HA 3OJ0A 1QYDA 3QVXA 4JROA 1KEWA 1R66A 5DCWA 3F46A 1I8TA 3PLNA 5AXAA 4J0EA 1DC5A 1X13A 3IP1A 1HKUA 1LDGA 2Z1MA 4LISA 4OYRA 4B79A 1IPEA 1BW9A 4BUCA 5I8WA 4M89A 1PS9A 2HO5A 2RH4A 3CTMA 5JY1A 3H9UA 3WTBA 3GEMA 5DP2A 2DU8A 1TI7A 3T4XA 1MB4A 1SCUA 3TPCA 1NWHA 4Y98A 1YB5A 2Y0EA 4KUGA 2VN8A 1HXHA 1MG5A 1NHWA 1ISGA 1T24A 2VWHA 5TF4A 3QHAA 4TKMA 4BNKA 5T8KC 2CVZA 3R1IA 2Q46A 1MX3A 2D4AA 3E9QA 4PG4A 3RC2A 3AUAA 4YJHB 1E7YA 3COSA 4YCAA 4GMFA 4CLOB 1G6KA 3AI1A 1BDMA 4RDHA 4CLHA 3A14A 3JD1A 1ISFA 3QJ5A 4YT8A 3KLMX 2EKLA 2EXXA 1VLLA 3GA0A 3ULKA 3MOIA 4IJWA 3GOHA 1U8XX 2TMGA 2NQTA 2PKRA 3OECA 4GH5A 4LK3A 5C37A 2NUAA 3H9JA 3RFTA 3VZRA 2HJSA 2CFCA 3WGGA 3KM0A 1M6HA 1SPXA 4K9DA 1DDOA 2Y0CA 3G0OA 3C1OA 2GF2A 3PWKA 1E0DA 4TROA 3UFXA 5C7IO 3E8XA 3SX2A 5IDWA 3JQFA 4LCEA 1K6XA 4YBZA 5L51A 1A7KA 4L0QA 3WNVA 4ZJUA 2ZKLA 1KS9A 3BMNB 1GTMA 3ONFA 2HMUA 2FR1A 3MJSA 1XQ1A 3ABIA 3IIEA 3QVOA 3LVFO 3FWZA 4P4GA 3G1UA 4B8WA 4BKRA 3DHYA 3H4VA 4BS9A 5CEFA 2BHLA 4GKVA 2GLXA 4IXWA 1DRUA 4OJNA 1D1TA 1M76A 3L07A 3WIDA 2BRUA 2CF5A 2P68A 4IIUA 3GAFA 3EW7A 4MP3A 1SC6A 1YJ8A 2ZTUA 4BV8A 3NRCA 4EBFA 9LDTA 1DPGA 1W8DA 2B69A 1LDBA 1N2SA 2Q4BA 4XYBA 4IDCA 3PIIA 3BMCB 3OETA 1LQUA 3DQPA 4WCFB 4U5QA 1KETA 2J8ZA 4PLVA 4RPJA 4ALLA 3GZNA 4TSKA 2HLPA 1XHLA 4J16A 4CM9A 3NTOA 1ORRA 4XGKA 2VUTA 3DBLA 3UOGA 4CM5A 4L76A 2AEJA 1I3MA 1UDAA 4R54A 4UUMA 1GUFA 1I2CA 4E5MA 3VTZA 4PG5A 2G76A 3PWZA 1MXHA 5G0UA 4BMVA 3AI3A 2DM6A 4ZQEA 4DQUA 2E48A 5ER6A 2XF8A 4E21A 1KBZA 3D3WB 4Q3CA 5A05A 4DMMA 1P9LA 5B4TA 1DJNA 1YDEA 3O4RA 4FJ2A 1NXQA 4I5FA 1U2DA 4XR9A 3WGYA 4UEOA 2IRWA 4L4RA 3O8QA 3DR3A 3GGPA 4NJMA 4IDGA 3PZBA 5T6BA 2ZYGA 4TRJA 3LYLA 5G4KB 4IQGA 1KEPA 1YB4A 1SNYA 2PTGA 1IULA 2C5AA 3GK3A 4I8XA 4JX8A 3RUAA 3VTFA 1A9ZA 3IAHA 4B4WA 4CLDA 3UAGA 3KETA 4BKPA 4MJLA 3C7DB 3KZVA 2JFHA 3ORFA 2EW2A 4DXHA 1PU2A 3VH3A 1C0LA 1C1XB 3I9OA 4NDNE 4UREA 3RC1A 4BGVA 3OJFA 2OZPA 2CVQA 4CMBA 3SEFA 3BAZA 1PJ3A 1KOLA 2VWQA 3AY3A 3DBRA 3AUTA 2VOEA 5H83A 2D5CA 4UVGA 1S6YA 4CLRA 2VZ9A 5CEJA 1TT5B 4KUEA 1LTHR 3E9NA 4RLSA 4BNYA 2P5YA 5KJ1A 4JP2A 5JXWA 1AHIA 3AU8A 4IXTA 4RPGA 1VJ0A 4QUKA 4WLFA 2EG9A 4C7JA 4Z0PA 2AQIA 2BI8A 4B4UA 2RIRA 3FNGA 3I9JA 3ADPA 3NV9A 3LT4A 3STHA 3IP3A 4FGSA 3ZN2A 5JDIC 3ZWAA 1I36A 4N5MA 1C1DA 4GBJA 1Q7CA 2BI7A 4YT4A 1HSZA 1LX6A 3O38A 4BO5A 2GASA 4MP6A 2Y05A 1DFGA 1XIVA 1A71A 1LRJA 4G81A 4XQGA 4XB2A 4YJGB 1HF3A 3JTMA 1ZK4A 2WDZA 5K9ZA 5H82A 4ND2A 2OP0A 1NASA 3G79A 1ZXBA 1NBOA 5L40A 2WM3A 4RVHA 1HRDA 1JWBB 4BQPA 2YDYA 4IPTA 4MOWA 3UKOA 1F14A 1UH5A 4BO4A 2FR0A 3CEAA 5B4UA 2AQ8A 1NHGA 4IJKA 5BNIA 2YQ4A 2O2YA 3NUGA 1DHRA 1Y8QA 1MFZA 1VKOA 1QMGA 4NBWA 4ITUA 3DZKA 1P33A 4O5OA 4LW8A 3P19A 4JXKA 4AJNA 3CKYA 5A06A 2DAPA 4K6CA 3SVTA 3JD2A 1GR0A 4IDDA 1IY8A 3FPCA 2CY0A 2Q50A 3JQ8B 4OL9A 1JKJA 5I7EA 3PYMA 4YEDA 4KQWA 5U9CA 2GERA 3OH8A 2XAAA 5CPFA 3JQGA 3W4IA 1JVBA 3PFFA 4CM8B 3I1JA 4BGUA 5L4LA 2GN8A 2Z95A 2OBNA 1HDOA 3H9EO 1PZHA 3FBGA 3PP8A 3LF2A 3ZHBA 4L75A 2W4QA 4W7HA 4YQYA 3NJ4A 1J49A 1UP4A 1AUPA 1N7GA 4PZEA 2B0JA 2X1HA 4U6QA 5KVVA 4FB5A 1V8BA 2NM0A 4DPKA 5I8ZA 5JCJD 2J3JA 4R16A 2VYVD 1QP8A 4ZN6A 3R3SA 4W6ZA 4WEQA 3GFGA 3K8ZA 1A72A 5JO0A 2CMDA 3MEQA 2W8ZA 3WQQA 3FN4A 3JD0A 3OF2A 2FZWA 4AFNA 3GPIA 2UYYA 1BXGB 3JQ7B 1LBEA 2C2YA 4BKOA 4J9VA 4NQZA 4FN4A 3IQDB 1ADGA 3DC2A 1HWYA 4TZTA 2EP7A 3H5RA 3VVBA 2DVMA 2VHYA 1UUFA 1XKQA 3ETEA 3RCBA 3ANNA 1LU9A 2OFPA 4DC1A 1YRLA 1R0LA 1ZSVA 4C4OA 4IBOA 4J4HA 4BGEA 1OC4A 3MWEB 2QQ5A 4J3FA 4D3DA 4XQEA 2NVBA 5AVOA 3VAZA 2JCXA 1H9AA 4E4YA 1EUZA 1LJ8A 5BNTA 3PJEA 5J23A 3PPIA 4XX0A 4XGNA 1E3LA 3JQEA 4J91A 3NAQA 4MVJF 4P38A 2J3HA 5KVCA 1BMDA 1PJBA 3K96A 4E32A 1GZ6A 2E4AA 3HB4X 4BB6A 3QWIA 4RVSA 4B7XA 2AXQA 1UAGA 3ZW9A 2RHRA 1ZK0A 1JTVA 3PLRA 1PJ4A 1BHSA 3PQEA 3HSKA 4QQRA 1YQDA 2A9FA 2NU6A 2V65A 2VRCA 2OOSA 2EKPA 3KO8A 4NBRA 3RROA 1EVYA 2P9CA 2X86A 5L7TA 2LDXA 3JQCA 1E77A 4AJJA 4MVJH 3LU1A 3JQ9C 2EEZA 4YWJA 3ROQA 4AJIA 5I9MA 1ZSNA 4MIYA 4EJMA 4CLOA 1QYVA 1MFPA 4IJUA 4HXYA 3VHRA 4XJSA 2POQX 3WWYA 1RM3A 4J2OA 4LRTB 1A4UA 3UVEA 3F5QA 4UEKA 3GUYA 4UUPA 1HDRA 1ID1A 3X2EA 3JQ6A 1SEPA 3GG2A 4E2XA 2NU9A 1DHTA 1HTBA 3SC4A 4R68A 5DBFA 2X5OA 5HS6A 4Z9XA 3A4VA 3FI9A 2J3KA 3Q1LA 4ZVVA 1NQAO 2TMDA 5DCUA 1F8GA 2WWRA 3KV3O 4MIEA 4YT5A 5KWEA 1DLJA 2WJPA 3GDFA 2HSDA 2C5EA 4FFRA 3FWNA 2DFDA 2A4KA 2YUTA 3G3EA 3JQAA 4TRMA 5HTOA 4O59O 3BMOB 2BD0A 4FJ0A 5ADHA 4Z0HO 1J0XO 5ILOA 1Q1NA 1BSVA 1K0UA 1N7HA 3LSYA 4HY3A 1YE3A 3TL3A 3TSCA 4ALNA 4L4XA 5F5LA 1Z6ZA 4NR0A 4RORA 3W8DA 3ITDA 4CR8A 1DIRA 5IDXA 1FDWA 2W2KB 2EW8A 4AJEA 1W6UA 3I9KA 4Q3BA 3ZV3A 2ZTVA 3BMCA 4FC7A 3EUWA 5MDHA 4WCFA 2OP1A 4CUJA 2NV6A 3D5TA 1CDOA 1PQPA 5DNAA 5EL0A 2O3JA 5KIAA 5A04A 4OSOA 1YONA 5ITWA 3IKTA 2YYYA 4E33A 2QZ9A 4Y67A 4TZKA 3G17A 3X2FA 1GV1A 5JYDA 2EWMA 3GLQA 4CUKA 2I66A 1LC0A 4OKIA 1MG0A 4RQUA 3PHHA 1JW9B 3PYXA 4BIIA 2NACA 2IZZA 3PGJA 3LC1O 3WGIA 5JY6A 3D3WA 1ENYA 1DFIA 2GUGA 4BNFA 4DBVO 1C14A 5JO9A 2R00C 5CPBA 2PV7A 2C0CA 3RIHA 2F1KA 4PRKA 3L6EA 1O95A 4TVOA 1HDGO 1JQBA 4IY1A 4FCCA 4DGSA 5JNLA 3K6JA 3NYWA 5I9NA 4R9SA 4CM9D 5TIIA 4MVJA 1AE1A 3PDJA 3ZHXA 4YDRA 3LT1A 3DL2A 7ADHA 2IODA 5C5IA 3VPSA 2VTEA 3EYWA 1PZGA 2GPTA 4M54A 3AUUA 1R12A 2ZYAA 1ADFA 1QRRA 4PG8A 3I5MA 3AK4A 4ZQGA 2C7VA 3DOCA 3U4DA 1NTOA 3ZWWA 5IDQA 4BB5A 1E5QA 5ENVA 3UH1A 3ZV6A 1ENOA 2ZB8A 1V3VA 3FTPA 3AUSA 3JCZA 4TRNA 3KSDO 1IHXA 1KVQA 1E1MA 1TT5A 2HUNA 4D7AA 2DBQA 1X7DA 1KEVA 1Y9EA 3QVWA 2NSDA 3D1LA 5A3VA 4WKGA 1OAAA 1K5HA 5CFZA 1HE3A 2B37A 3PWSA 3WFIA 2G82A 3F5SA 3NTRA 1T1RA 2HK7A 5CG1A 1IL0A 5G4LA 4OOEA 3OA0A 3LC7O 3T7EA 3TN7A 2DKNA 3HZZA 5KCZA 4N5LA 3TFQA 1E7MA 4FQ8A 4ALIA 3D4OA 2DBRA 1XWFA 5DOZA 5IN4A 4R5MA 1I33A 4II2A 3AJRA 2Q4EA 1J6UA 3IMFA 3PI7A 1KY4A 2V7PA 1PEDA 3UHAA 2O3UA 3HDQA 4NBUA 1H6CA 4TRRA 4UVEA 2I65A 4R1SA 4BNUA 5JSFA 2EGGA 2PR2A 2D0IA 3E82A 2B5VA 4DQXA 1RJWA 3GY0A 5EN4A 2PFGA 3GN2A 3L9WA 4J7CA 1VL0A 1LSJA 2HMSA 2O23A 4Y6RA 5THQA 1PWZA 4MVJM 5JCXA 4JJIA 1PZFA 1E3EA 1O89A 1P74A 4I1IA 2CD9A 4K28A 1OI7A 4LRSB 4OAQA 1CQIA 3ENKA 4OM8A 4BNHA 5AQ1A 1EK5A 3VDRA 2FMUA 3F4LA 1NAHA 1GYPA 1ONNA 3Q2IA 5C7OO 4CM8A 3BA1A 1WW8A 1PQWA 4G65A 4PLPA 4NFYA 1UZLA 1Q0HA 2EERA 2QRKA 3RBVA 4A2CA 2VHWA 4ZQFA 5TSDA 3KOUA 2VT2A 4NG5A 3AFMA 1QORA 3NDJA 1XGKA 3VZPA 1HEUA 5HBRA 4CM4A 2JCYA 1YOVA 1XA0A 3DBVO 4EDFA 1F12A 4RPLA 3RFVA 4URFA 1NR1A 1VSVA 5EJ2A 3PK0A 3MJCA 4XB1A 3SXPA 3EMKA 5A3JA 2JD1A 2NWQA 1BXGA 2PLAA 4YYZA 3JQ7A 4F46A 3QWFA 3C3XA 1VI2A 5JAZA 4EGFA 2Q1WA 2B83A 3JQBA 3FPLA 1ONOA 4INAA 3JQDA 4WOKA 1LDMA 3DEYX 2DFVA 4Z0TA 3GGOA 3RSHA 2Y1CA 2AG8A 3NEPX 3K31A 5AXCA 1EMDA 4PRLA 3GN1A 3KYDB 1GU7A 1XSEA 4XJTA 1YJQA 2PKQO 4WNCA 1E6WA 1FXSA 3RBZA 2HQ1A 2X7HA 4JIGA 2FRDA 1M66A 1ZJYA 3QQPA 4D42A 4I9NA 3CXRA 4F6CA 2IYOA 4BO6A 3SBOA 4E5NA 5G0WA 2CF6A 4K6FA 2O3QA 2QRLA 4XYMA 1HE5A 4CMIA 3L6DA 2Y1EA 1V9LA 3D3EA 2QRJA 1DEHA 4FBGA 4BNIA 3C7AA 1WDKA 3U3XA 1O6ZA 1BVUA 2WYVA 4J2HA 4RV9A 3DAFA 2PNFA 4WE3A 4ALMA 4LVCA 3ZHZA 1IPFA 1MXFA 2OL4A 3GC6A 3JSAA 3L77A 3QW2A 4ROSA 3UGKA 1QV7A 5I7VA 3KYCA 5BSFA 3FD8A 4NK5A 4WJZA 3DFZA 2Q2QA 3BHMA 3WGOA 1T2FA 3QWHA 2RHCA 4BVAA 1WMAA 3VKVA 1UXGA 4CLEA 2CDBA 4F6LA 5THKA 1VPDA 4D0SA 1AXEA 2QYSA 3GVPA 3WG9A 3WDSA 5TS3A 4G2NA 4H3VA 1EVIA 1ULUA 3RUDA 3WJ7A 1XDWA 3PJGA 1EZ4A 2OXIA 3N7UA 5JYEA 2RH8A 3RD5A 1O9BA 3VPXA 3N74A 3C85A 1T2CA 3CINA 3M2TA 1K2WA 3L4BA 4E6PA 1PGQA 5JMWA 3DMYA 4R01A 1NFRA 1KEUA 5JAIA 3RVDA 4B7UA 4RVFA 3WBFA 5IAAA 1DC6A 4CMGA 2ZIZA 4CQMA 3TF5A 5TC4A 5MGBA 1LSUA 5JFOA 1BXZA 1E3WB 1VSUA 2C2XA 3PYLA 4B3JA 1Q2XA 1MV8A 1QYWA 2NVWA 4R4JA 4I5EA 4AJOA 4WLEA 3RC7A 1P1FA 1U1IA 2NTJA 5EERA 1GAEO 2VRCD 4DPLA 4EITA 4XR4A 4BO3A 3ITKA 2G0TA 1WWKA 4CR6A 1NVGA 2ZB4A 5GMOA 4CL3A 4YAKA 3BHIA 2Q1UA 2GN4A 4AJKA 4XRGA 2VTDA 4FD3A 4UVHA 4W4TA 4CMEC 1UXKA 3H3FA 1GZ4A 1LDYA 3WIEA 2I9PA 3W4JA 3VDQA 3HDYA 3VPGA 4KMSA 1E92A 2JCVA 3IL2A 2F00A 2QZZA 1I3NA 2AEMA 4XA8A 4GLOA 2PZLA 1PR9A 4QXMA 4WOJA 1H2HA 3KLPX 3VVCA 2ZB3A 3DMTC 2WMDA 3LLVA 2GZ2A 4D44A 2EV9A 2ZTLA 1L7EA 4JLWA 1GUYA 2H5LA 4GVLA 1NQ5A 1YBMA 2B4RO 3TDKA 1C3VA 1GYRA 1VKNA 4J0FA 4RZIA 1I2BA 4OXKA 3PJFA 2CDAA 1D1SA 2FN7A 1HDYA 1ML3A 2ILTA 4MP8A 4W9NA 4A10A 4GLLA 4KWHA 4FFNA 1VM6A 1JA9A 2OORA 1OZAA 4FC6A 5DULA 3WJAA 1GZ3A 3TQHA 4A7PA 1K89A 3JQAD 2YQ5A 2ET6A 2HRZA 3EVTA 4E5KA 1Y8RB 1L1FA 1R15A 2VT3A 3I9NA 4E2YA 2NVUB 3W6ZA 3GF4A 2X9NA 3FBTA 2HMWA 3OP4A 3Q9NA 4IQ8A 3A9WA 1UR5A 3O26A 1VL8A 4GWGA 3RBXA 1Y9AA 1P45A 1O94A 4JJFA 3E6AA 4Z9YA 4UEJA 4CLXA 1T4DA 2B36A 4XIJA 1DSSG 1CERA 3TZ6A 4A27A 5COAA 3JYPA 2QIOA 1YQGA 1KERA 2GNAA 3EGOA 1ZVMA 2VUUA 3NDRA 2BLLA 3OQ1A 2GDZA 4ZHSA 4M55A 3AY6A 1T2AA 3LT0A 1I3LA 3WB9A 5T64A 2ZYDA 3V2UA 1ZMTA 5HS4A 5DDIP 1GQYA 3BMQB 3MTJA 4YVFA 5FI5A 3NT2A 4PIVA 1QR6A 3VH4A 5IXYA 1X14A 1W4ZA 2FR8A 1NFFA 1UZMA 1U2GA 2O50A 4BNTA 3W8FA 4WLNA 3QWBA 4Q9NA 5HWSA 2HK8A 3DZGA 3LDHA 1BG6A 1A4IA 1B3BA 1E5LA 4DRYA 1LDNA 1E3JA 3K2BA 4UULA 3GNTA 3QLJA 3WGZA 3GVIA 4DTIA 1PIWA 4ZQBA 3WGTA 4F45A 3SC6A 3AM5A 2J5QA 1DFHA 3I6IA 1TEHA 2XXJA 1Q7BA 1XU7A 5K6AC 2PD3A 1IZ0A 2WD7B 3RKRA 1HE4A 4CJXA 3DHEA 4I9HA 4GWKA 2VHZA 1HE2A 4MVJD 3BHJA 1ZK2A 4WGGA 4J43A 1VC2A 3ETDA 3D4PA 4XWYA 3UXYA 3DAPA 1IOLA 3JYNA 1U7TA 4G5HA 2FWMX 1PJSA 2AEFA 3HJAA 5JDCA 3CZRA 3ANMA 3M1LA 1NFQA 1NPTO 1YDWA 3LZ6A 4DIFA 2BGKA 1YBAA 4OQZA 3RUCA 1U3VA 1YVEI 2VWPA 3HADA 4L9RA 2EJWA 3U9LA 2JL1A 3GG9A 1P0CA 2YW9A 3Q0EA 3W1VA 4B3IA 1T1SA 2AQHA 3NJ8A 4IIVA 2VCYA 3H8VA 4J1SA 3G49A 1A7AA 3T7CA 5AYVA 3FNFA 4M86A 1GFSA 5KKAA 3TRIA 2C82A 4XCVA 2QHXA 4DQVA 1DOHA 1EE2A 1F0YA 2GCGA 5TT1A 4YAIA 3K5PA 4JP3A 3GEGA 1Z7EA 4XDYA 2DLDA 1B2LA 4XDZA 2NTVA 1CWUA 5COQA 3LQFA 4NZ9A 5F21A 5CAEA 3Q2KA 8LDHA 3HFSA 2R2GA 3N58A 4DUPA 3V8BA 3DBHB 5FEUA 1SO8A 4KDFA 5BSGA 1PJQA 3W4KA 1GEEA 3S1LA 1UAYA 3OEWA 1UP7A 1QSGA 3E5RA 3WR5A 1H93A 1P0FA 1SOWA 3CH6A 2Y99A 1YS4A 4UAGA 6LDHA 3FF4A 4BQRA 1G1AA 1I01A 3QVTA 4GPD1 4YJFA 1RM5A 3L0DA 2H1SA 1X0XA 2VYNA 1ENZA 3JQFC 3GNSA 2DUWA 1OC2A 5JS6A 1R4MA 2ZB7A 3PDUA 4QO8A 4IGFA 1EBUA 3UUWA 4ZD6A 3DDNA 2PKQP 2WTBA 1HZJA 2E49A 2W2LD 3PRJA 4O1MA 2P9GA 1PGJA 3IUSA 1WAMA 1X15A 1CIVA 1FJHA 2OO5A 1GQQA 4LMPA 3ZNPA 5A03A 1E7WA 1IHYA 4UVIA 3INRA 3RC9A 1HT0A 3GRPA 1ZFNA 2A35A 5IZCA 4LCJA 3SLKA 1BW9B 5A9RA 3AY7A 3KUXA 1H6AA 3EC7A 3KYDA 3K30A 4AJHA 2P5UA 2BGMA 1B14A 2O7QA 3D5QA 5F1KA 5BSEA 3ZNOA 1AGNA 1B15A 3ZI0A 2VZ8A 2W90A 2BMAA 4B7CA 5KJEA 1JN0A 1M67A 1XYGA 3DAGA 1R4NB 4OSPA 4OKNA 4UUOA 1Q7GA 2JD0A 2Q3EA 3HWRA 3OJEA 3ZWPA 1UXHA 5ICSA 2OBYA 3GQVA 1F8FA 2BH9A 4YJHA 4CM3A 3QA9A 3ZNNA 1XQ6A 2O3SA 2X22A 3GPDG 2NU8A 4GX1A 2GN9A 4D43A 4DBZA 1CETA 3F1LA 5DN9A 3F3SA 2GRAA 3K92A 4W99A 4A73A 4CMAA 1B8VA 2FPIA 2WYWA 2D1YA 4F3YA 4J1TA 1QKIA 3OICA 4XD2A 3I23A 1N9GB 2Y1DA 3PQFA 2IEBA 1BVRA 1F06A 5B4VA 5KJCA 5DBIA 4PFJA 5DZSA 2IZ0A 3DHNA 3AOEA 4PG7A 4NI5A 4CM1A 3JV7A 4YAEA 3EY4A 4CMHA 3ZWYA 1I0ZA 1E1LA 3ICPA 3PZRA 3UCEA 3I3OA 3OIFA 3FHLA 1AXGA 3BMNA 2PA3A 2X9VA 3S2FA 4QECA 4R1NA 1ISMA 1MA0A 4N5NA 1PL8A 1QLJA 3U0BA 2QYTA 2P2SA 4I5DA 4BO2A 2J5RA 3TOXA 5CP8A 2AQKA 3C1TA 1XLTA 2PGLA 3G1TA 4RVGA 5LCXA 4DA9A 3TZKA 2XXBA 2UV8A 5A9SB 1O8CA 3LLSA 3WYBA 1OFGA 2LDBA 1FF9A 1ZNQO 3U4CA 4YJDA 1T2DA 4IDEA 2GZ3A 4BMSA 3GZNB 4HUJA 4FGWA 2A92A 4BO9A 1QG6A 2DTXA 2NLOA 2ZCUA 4GVXA 4NFHA 1JAYA 1E1NA 2B5WA 3U4HA 4PLYA 2G1UA 3GDGA 4A5OA 3WOHA 1NVMB 3BTOA 3VC7A 2GR9A 5T57A 4IGEA 4D46A 5COBA 5T8KA 1ENPA 5L95A 1NAIA 2DPHA 4CQMD 2VUSA 1R37A 1V35A 4MDHA 3S2EA 1GV0A 2D2IA 1AN9A 1LQTA 3GHYA 3WLEA 4X54A 3WNQA 1PGPA 1ZBQA 3C7CB 4FW8A 4KTVE 2WSBA 3WQRA 4D41A 4QT0A 3ZU5A 2C29D 3HNPA 1HDZA 4I5GA 1DAOA 4FR5A 1LLDA 3AOGA 3V5NA 1LA2A 2JFGA 4HBGA 5IN5A 4NHEA 3QVSA 3O8QB 4S1VA 3PHIA 4DPMA 3Q3CA 5LC1A 3GGGA 4N54A 4OHUA 2PH5A 3NT4A 4U7WA 5KJ6A 3DZBA 1P1IA 1U3WA 4RQTA 5G4KA 1U3UA 3CMCO 2NVUA 3DZIA 2JHFA 3BZUA 3KEOA 3ZV5A 1NQOA 4LN1A 4K26A 4EUHA 4ND1A 1MC4A 3L9XA 4XQ9A 5L4SA 1D7OA 4H7PA 3HDHA 3Q6IA 5I7SA 1KY5A 3RAJA 3M1AA 4KTTE 4PVDA 1H6DA 3HFGA 2ZCVA 4PZDA 3MCVA 4WECA 1C1XA 4D45A 1LEHA 3H3JA 3RU9A 3TZCA 3BIOA 1N1GA 1ZCJA 4PLCA 3DBRB 1FDUA 3Q11A 4E13A 2VWGA 5FYDA 3ZWBA 4PLFA 4YQZA 4NIMA 4A03A 3ZNQA 4MVJG 4JK3A 2VNSA 4JQCA 2CVOA 5F1PA 5DF1A 2D5AA 2HJRA 3U4IA 1U3TA 2QG4A 1KC1A 2DTDA 5JAQA 2O3RA 2RCYA 4KWIA 1ISIA 1I30A 1PS8A 1GQ2A 3PEFA 4WASA 2JAPA 5DT9A 3RWBA 1NYTA 3B1FA 4OMUA 5ES3A 4J4TA 2DUUA 3H6KA 4DIBA 1I10A 2UDPA 4BKUA 5ITVA 4GX2A 4GQAA 5A1TA 3QWAA 4BL5A 2PK3A 3R3JA 1BGVA 4ESOA 5EPOA 1GEGA 3INTA 3W6UA 1TLTA 2Y93A 1P31A 2YHIB 1NQTA 1Y5MA 4FDAA 3ZWCA 4KOAA 1U9JA 4YJGA 4R3WA 2ZATA 4TKLA 3PTZA 3DXFA 1UXJA 4D0RA 1SMKA 3U5TA 1U8FO 2I67A 4U8GA 2C20A 1DB3A 3VPFA 2NU7A 1IZ9A 2PGJA 2PZMA 4IS3A 3U62A 1DXYA 3DZFA 5L53A 4AVYA 3C8MA 3EAGA 1FMCA 1Y8QB 1ZO8A 2G17A 3PVZA 5JCJA 1YGYA 3OIDA 4FJ1A 5IZCC 2Y67A 2X9GA 3LF1A 4OXYA 4Q3DA 3WFJA 4J6FA 3OJLA 4FOOA 4BHTA 1RKXA 3S8MA 4P22A 3ZWMA 1DJQA 3JYOA 3HG7A 2PZJA 1YL5A 3FR7A 3UW3A 1EEHA 2UVDA 3R0IA 3ZGYA 4PLZA 4DREA 3TNLA 3JQ8A 4QFCA 4HV4A 3IOYA 4RPHA 4CQLB 4OH1A 5L7WA 2J5KA 1RPNA 2EHDA 3WS7A 1W73A 2BFAA 4RGBA 2IDZA 4QTZA 1U28A 3FR8A 1ZXLA 2WE7A 4ALKA 1BXKA 5L45A 3H5AA 2Q99A 5C3MA 4IZHA 2OMEA 3K9QO 3FTNA 4R1UA 1DIGA 3I83A 1Y81A 3OM9A 4BMNA 5GZ1A 3EK2A 4Q3EA 2HU2A 5IFLA 1A5ZA 5EINA 1MUUA 3SJ7A 2C07A 3ADOA 1ZK1A 3C1AA 3ASUA 1Z45A 3OFSA 2I5PO 2NADA 1FDSA 4P4LA 1T2EA 1I2ZA 3H5NA 3MTGA 4BO1A 4AJ2A 2JHGA 3QSGA 1LC3A 4AG3A 2X5JO 4NK4A 2EKQA 5GZ3A 5JDIA 4E2ZA 2XPCA 5EESA 4XKJA 4CMCA 4P8RA 2Y66A 1U5CA 2X0RA 3E03A 4YT2A 1G0NA 5TRTA 3S55A 3KYBA 3WTCA 2CSUA 2I6TA 4H15A 4HFMA 2Q1TA 4RF3A 1B8PA 1I5RA 1T25A 3NDIA 4FFPA 4OXNA 4QX6A 3P7MA 2HMVA 3JYLA 3MJEA 4M87A 4AL4A 5EQFA 1MGOA 1AHHA 3P2YA 1GCOA 2O3TA 2WEKA 3KSUA 4GI2A 4E12A 1JWAB 5U4QA 4PG6A 3UN1A 1R6DA 1I24A 4NBVA 3DONA 5TJHA 2HMTA 3BXXA 1V3UA 1HDXA 3VH1A 3VOSA 3GR6A 1C0IA 1ZSYA 4N7RA 3K2EA 5BR7A 4EEXA 1N5DA 1P44A 1WZEA 1YKFA 1WLYA 3NT5A 2FPPA 2Q1SA 4GX0A 2DPGA 2J6IA 1LXCA 2GGSA 2YDXA 2VOJA 3V1UA 1PQUA 3WWZA 3WLFA 2XOXA 3QY9A 1HYEA 4WCFC 4UUNA 4BV9A 3RI3A 3EHEA 3E1KA 4I9UA 4BNZA 3I9MA 4MVJI 4YRBA 5L4NA 1CEQA 2VYND 2ZJ1A 1YL6A 1ISHA 3GUCA 4HFRA 3V2GA 1PGOA 5A4DA 1P3DA 4RVDA 1QYXA 3GMDA 1KVUA 3JD3A 3KSZO 1HYGA 4W7IA 3B1KA 4U6SA 1IUKA 1FDTA 5BSHA 1SOVA 1XEAA 3QV1A 1R4NA 3ZWNA 2JD2A 5C7LO 1DIAA 3PHLA 3GVCA 4CV1A 1YL7A 3OQBA 1H94A 4W82A 1WNTA 1NVTA 2PD4A 4YXFA 3PFWO 5FFFA 3T4EA 2Y0DA 3L6OO 4FFLA 5A02A 5KOIA 4Y6SA 4O0LA 4QFDA 4YACA 2VHVA 1SB8A 1KVRA 4MO2A 3DB2A 3C24A 3WXBA 2Y1GA 5JC8A 1YXMA 2FZEA 3GEDA 1ZZEA 3IUPA 3INGA 4E2WA 2P4QA 1OBFO 3I52A 1N1EA 1PS0A 5GY7A 4WNIA 2P4HX 5IG2A 3AW9A 1N9GA 5LDHA 2ZK7A 4CV0A 3NX4A 3IKVA 5EMHA 3CZMA 3ROPA 1HETA 3ETGA 2Z1NA 3VZSA 1EQUA 2FPGA 5CDSA 4I08A 1Y5RA 4RJTA 3OSUA 2I76A 4KP7A 3JQAB 1ADBA 1YQXA 5B12A 4D3FA 4RZHA 4NMHA 3CUKA 2GYYA 2E37A 3BMOA 3OBBA 4M8SA 4PGFA 2BGLA 4D79A 1TB4A 3NKLA 4CM7A 1GYQA 1XCBA 4GMGA 4J1NA 4CUZA 1IB6A 2D59A 5F1OA 3WICA 2AMFA 3R6DA 3V1YA 5A9SA 3F4BA 1GADO 2I99A 1T26A 3I6QA 1UXIA 2W2KA 1PJTA 2YY7A 4ONEA 2ZTMA 1N92A 4CV3A 4E5YA 3WYCA 4XYEA 5TT0A 3B1JA 1DLIA 2C54A 4JGBA 4RF5A 3OEYA 3CSDA 3WYEA 1WDLA 4Y8VA 2DQ4A 1XG5A 2W98A 4XRRA 4CV2A 2X4GA 1HSOA 1K6IA 3FCOA 4CMKA 1YH3A 1SBYA 3B20A 3GMSA 1SB9A 2OGUA 2QW8A 1Z82A 2UUOA 4HX5A 4ZRMA 3RUFA 4IUYA 4BO8A 5IZ4A 2B35A 4IDFA 2AG5A 1RM4A 2IXBA 1LNQA 4YB8A 1XU9A 1B0AA 3JYQA 5BT9A 1I32A 3WMWA 4AJ4A 4GGOA 1H6BA 3VZQA 3V1TC 3AM4A 2J3IA 4RO0A 1GD1O 1WZIA 3H65A 3JQ9A 3M2PA 4IMRA 4KUHA 5GZ6A 1ZJZA 2GN6A 1EK6A 1WXDA 1U5AA 1ZEMA 4A26A 1FK8A 4R41A 3HDJA 4IZIA 4CPDA 3KXDA 1BTOA 4S3MA 2BELA 1PZEA 2GSDA 9LDBA 2H63A 4MVJE 4TMFA 4RCVA 1V3TA 4U0JA 2O4UX 1ONPA 1G0OA 3PGXA 3OMLA 3ZU4A 5TGDA 2FP4A 2DBVO 4PLGA 3NGLA 3V2HA 5AOVA 5I7FA 4RLHA 3LK7A 3QIVA 3LT2A 4PCVA 3F6YA 3GNQA 5EIOA 1M75A 5JAMA 4II3A 2Z5LA 5KKCA 2SCUA 2E82A 2H9IA 4EUEA 2X6TA 4CM6A 3GVXA 3K73O 4L74A 1EQ2A 5FWNA 5H81A 1U7HA 3AWDA 5DCYA 1LSOA 2AW5A 2IZ1A 4KQXA 1VE9A 2HKIA 3BTVA 4JBGA 3PQDA 3RFXA 4XZ3A 4ZRNA 5CDUA 2A94A 4WPGA 3VPHA 1J5PA 4PZCA 3RUHA 1E6EA 1XR3A 1XELA 1LLCA 3O03A 4ND3A 3RJ5A 2B4TO 3GHHA 4DYVA 1RYDA 5JLAA 1GL3A 1M2WA 4Z9FA 4Q39A 2PD6A 4RF2A 1LLQA 3H2SA 5IJZA 1H9BA 4HWKA 2IE0A 4WLOA 4DC0A 4BNMA 2EF1A 3GRKA 4XQCA 3PXXA 2YJZA 1RWBA 2WD8A 4J49A 1BWSA 4GKBA 1DRVA 3JQBC 3E48A 1MC5A 5CHEA 3A28A 5I9LA 1O0SA 1K6JA 2YHIA 3I9LA 4BNLA 1EVJA 4Q3AA 4JJGA 1E7QA 1TXGA 3HN2A 2QX7A 2ZJ0A 4ND5A 1KVSA 3WMXA 5AXBA 1Z7BA 4KDEA 3U09A 2FOIA 3ZCXA 3KEQA 2R00A 5G0SA 5JMPA 4FS3A 4IJVA 4R5HA 5KVSA 2HCTA 2DT5A 2YV2A 3MZ0A 3TWOA 2X8LA 5DOVA 1Y1PA 2HDHA 2WYUA 5B1YA 2VQ3A 3KVOA 1MLDA 1MP0A 2JFFA 3OIGA 1VRWA 4GX5A 2CDCA 4OO3A 2X58A 4TWRA 3UF0A 3OJOA 1KVTA 4B4OA 4BO0A 2GO1A 2ZQYA 5G0VA 3WGHA 2EJVA 1BDBA 3I4CA 4AJ1A 4D3SA 4GSLA 4FOSA 2Q45A 1X7HA 3IDSA 4R3NA 2OUIA 2PH3A 1WDMA 4QEDA 2R6JA 3F47A 3A06A 1EFLA 4CQLA 3P2OA 1B26A 1B16A 3DZHA 4Y6PA 2E6UX 4BOYA 4EUFA 1K3TA 1R0KA 2CZCA 2FY8A 2IYPA 1PL7A 5EQDA 1U4OA 3FRJA 4M1QA 1B8UA 4ILKA 3GZ4A 3DTYA 1QXSA 3KHUA 3HE3A 2DBZA 1ZKMA 2BFMA 1Z74A 1PWXA 3L4BC 3IS3A 2NQ8A 5L9AA 4CM4B 4O63O 1S7CA 1YOVB 1SZJG 4NBTA 3MOGA 7MDHA 1LRLA 3AM3A 4WCDA 1CQJA 2EGHA 3PHGA 4E5PA 5IF3A 2X23A 3D0OA 3HB5X 4P4NA 5HM8A 2GD1O 2O2SA 2Y68A 3DWFA 2C59A 4IDAA 1PX0A 1EVZA 3E18A 4FFMA 3RQSA 1P1KA 1PTJA 3ANLA 4JN6B 4LSMA 2JKVA 4CODB 5U1PA 4PLHA 4JBHA 4DWVA 5KJFA 1HL3A 2YZ7A 1WMBA 4FFOA 5TQVA 1DC4A 1NWCA 3ZZNA 4ZICA 2I3AA 1TA4A 4DLAA 2NNLD 1YO6A 1ADCA 3ENNA 4MKRA 3D64A 3H2ZA 2HAEA 3FSRA 2X0JA 4CMIB 4FSHA 1KYQA 3LC2O 2GZ1A 1X1TA 2VNAA 3TZHA 1PGNA 1Y6JA 5TX7A 1ZMOA 2UUPA 1V0JA 5FI3A 2WE8A 3AI2A 3OA2A 3AFNA 3MJ4A 4W9NC 2NTNA 3QP9A 4J4BA 3RJ9A 1E7SA 4EEZA 5FF9A 2Q2WA 3HHPA 5A5FA 3KYCB 1NR7A 4ZA2A 3WQSB 3TOZA 4AJPA 2EP5A 1EUDA 4EW6A 4B8ZA 2O48X 1E1KA 2AE2A 2V6MA 4RVUA
chains in the Genus database with same CATH superfamily
3NYQA 4OB6A 3NGXA 1GAWA 4MV4A 3KWJA 1W93A 5LDGA 4MX8A 3AR9A 3IUBA 1LI5A 1SUAA 1W2GA 1CRWG 1F51E 3BQNB 1RQLA 2FF7A 3V4OA 2FSSA 2MIIA 4MIOA 2XB8A 4NECA 4ZV7A 1H5QA 2OXRA 3E81A 3NTUA 3O9MA 1D2MA 4BFUA 3ASVA 4F1WA 5JAUA 3KOYA 3STTA 3ZVRA 3SXUA 1O94C 4MW6A 2P2YA 3IIJA 3B89A 2DJIA 1N8KA 1URPA 1TECE 2C0QA 5B58T 4TX1A 4XIYA 2FK7A 4RVNA 1JU9A 3HUFA 4EBBA 5AKIA 2EYUA 1CUDA 1U4SA 2CYAA 2ODTX 3SIWA 1SQFA 4XYLA 1TZBA 1Z75A 4PVCA 4AIRA 3M6IA 3W3AH 2GJ8A 3NHWA 1CR1A 2XWJI 4OHFA 3QSYA 2BGJA 5G2OA 10MHA 3EFBA 4MINA 5A6SA 2P8JA 3L46A 3QXSA 1FTWA 2I7TA 2O8NA 4Q3NA 2QL7A 3GIDA 2IWHA 1H5NA 3OPMA 2E5FA 1A9YA 3ZXIA 1SQ6A 4LF5B 4MCAA 2EKZA 1DRKA 2Y92A 4MQLA 3ZE7A 2F48A 2FPWA 4IWNA 1U2GC 3L0OA 3P9NA 4D3YA 5LPNA 1LPPA 2C9ZA 3IJRA 5FWAA 1GCUA 4XE5A 3UKJA 2QLBA 1Z33A 3ONDA 4U2CA 3RFFA 3EVBA 1BFUA 2VJMB 3IDAA 3GBSA 4A16A 2E4WA 1XZMA 3A6LA 5CGQB 1FFXA 1C9EA 4FT4A 3GDOA 1X1EA 3E7FA 2BM0A 2RGNA 3EC1A 3A2NA 3DGEC 5J3JA 2GCOA 3UK0A 5TQ2A 4KXLA 1E2NA 1UM8A 3VH2A 3D7MA 1L9XA 4PHCA 4X3CA 1TIKA 5IUKC 1V1MB 3VTAA 5AHWA 5H70A 5C7YA 1MB2A 1VJDA 2J0VA 3LQRA 4HB2A 2VI5A 1O5IA 3CO5A 3ICVA 3K16A 5IABA 5A9TA 1Q57A 1UP6A 2VPYA 4BNJA 3AV0B 1U0TA 4Q4HA 4BP9A 4PHGA 2W2MA 2QU7A 4UD2A 4ZU3A 3VXKA 2B1IA 2MDTA 1NUPA 3MM4A 4TMXA 3SQXA 3IPRA 1Z26A 2R8XA 1Y9DA 2VDNB 3FPEA 3PIDA 3LBIA 4YRGA 3GFBA 3C97A 3EIUA 4KAXA 5JBIA 1BMTA 1E5XA 1TJ4A 1QB7A 5FRDA 1YASA 4E31A 3VR4H 4WLVA 2JFWA 1B7GO 1PJCA 1TYEB 1VXOA 3AUJB 4ND4A 4EZBA 1HG1A 3PKIA 1G2IA 3S68A 1KHTA 4FMDF 2F6RA 1BRMA 5A5VA 1DC3A 1JKFA 1S8NA 4J29A 3QEMA 2C2BA 1F8UA 2AKEA 1GAXA 4Z3KA 2PO7A 3OAAA 1V43A 2WHXA 1KJWA 2H2GA 3PXDA 1H2WA 2NUPA 4LV5B 5DTJA 4FMCB 1PK9A 4Z5XA 1W85A 4WN9B 4WWHA 2QP4A 5LWHA 4JLOA 5C3UA 2OCBA 3EDMA 2GBLA 3RSLA 2EFJA 2FK8A 3HKCB 1WP9A 3EH1A 4YAWA 3OKPA 4GI3A 2BYTA 3I62A 1IC6A 3FCEA 2BBTA 3KQTA 2LPMA 5BNFA 1M7BA 4FOTA 3UICA 1ECGA 1LQ2A 1P73A 1QIJA 5L3ZA 1X2BA 2JAHA 1OLXB 4UPDA 5ALLA 1JS1X 1SU8A 3CZAA 1X74A 2MSLA 3KB6A 2R1VB 2VJBA 4U3JA 5FPQA 5KAMA 4WXMA 5JBQA 2FUKA 4NCKA 1RIFA 4BFTA 1NTRA 2I3GA 2VRBA 3JATA 4NS1A 4M1MA 1D8AA 5T3UA 4IJ5A 4HNHA 1L8XA 3O7WA 3AESA 4N0PA 1DAHA 1ZIDA 4QSMA 4HADA 1FOEB 3O9ZA 3R0QA 3LT5A 3WL3A 5AD1A 1DIHA 4RSMA 2GNPA 4H77A 5JPIA 4FIZA 4UBJA 3DL4A 4IM7A 4R69A 1KI6A 2AEEA 4AI6A 2WA1A 3G8BA 1UZNA 3GH1A 5ICMA 5J1TB 4DLXA 2AKYA 4CEJA 2AC4A 1HLPA 1W49A 3MGGA 4JDPA 4B40A 1WVGA 4YAGA 4KVGA 3EUFA 2QVLA 2G09A 2WUWE 2XTAA 4WBNB 4ZVNA 3W1EA 5B6JA 5K99A 4GMDA 3K71B 1C1DB 1R0ZA 1JLLA 1Y9ZA 2EZ8A 3D3KA 3EUAA 4LGVA 4A8JC 1QIDA 4YMVA 3G2QA 3DOOA 4GKAA 5KVQA 3ZU2A 3DMTA 4K1LA 1DX9A 3U3KA 2PH1A 1J56A 3E53A 2CXRA 2DH6A 2XNHA 4LC1A 4QTTB 2JFQA 1O7JA 2F67A 4UAVA 4O8ZA 2RH5A 3OVMA 4HH0A 4UBNA 3REFA 4Q4AB 1EFUA 3LH5A 1E60A 4EL0A 2ZUDA 5F3RA 1RKQA 3KSAC 2IF2A 3EPLA 4MWBA 1Z2DA 2Q2OA 4ZXPA 3BYZA 4E5DA 3QYFA 2OO5C 3VBCA 1SVOA 3PF9A 4YRDA 5KTNA 2BGIA 2QGZA 1C81A 2PTHA 1LI4A 2XBLA 1W1UA 2H4HA 3S99A 5C9ZA 5LQNA 2C5BA 2VBGA 4UQLA 2IUFA 1KARA 3MLEA 1KK1A 1MOQA 4NICA 1F5SA 3VX4A 3MJTA 1EP3B 1OBVA 4TYQA 5BQFA 1E2FA 1X7ZA 3WKEA 3EISA 2QKYA 1RRPA 2X42A 2ZGVA 3GO4A 1XEXB 1NNUA 4XI9A 3UTCA 4EQZA 1LRKA 4DMLA 1Z63A 4A8TA 2PT9A 2X76A 4TL7A 2A0KA 3DVSX 1TT7A 4BQIA 4LWPA 3V00A 2VHEA 1ZMXA 2WIJA 3FMFA 4KXQA 1LS6A 3EG5A 3KTDA 1N3LA 1PJLA 1UBTS 2OG2A 4LDAA 5E6UB 1TUBB 2E4VA 3VM6A 4F8JA 1Z4QA 4NH4A 4YR9A 5CG2A 3DOJA 4ZCRA 2IXAA 4E7PA 4EARA 2YWHA 1PEYA 2ZG6A 3IJPA 1HDCA 3EE6A 3AEZA 3B1XA 2PVPA 4HVAA 1TVEA 3TUIC 1IRIA 4GMKA 1H0KA 2AHOA 4IILA 3SICE 3R0XA 1OSNA 5CEEA 4AXBA 1R0YA 4Q7KA 4TVBA 3LK6A 4COKA 3TI7A 5BUZA 2NZUG 3A8TA 3NHKA 4Y6QA 4QASA 5K0CA 5CDFA 3GNLA 5LYJF 2QL6A 1RXWA 3R09A 2Q07A 3GT0A 1SEVA 2CW5A 3SX4A 3TSYA 4UVDA 3ZZTA 4CF6A 4J9UE 1RLUA 3PQ8A 2R6FA 2MMGA 2VNKA 3BPSA 1ZH8A 3P4UA 2EFYA 2QB5A 1IY1A 4HZUA 1SKAA 4UXIA 5ENZA 1GZ7A 1FUIA 1QV9A 2ZPUA 2I2FA 3QJGA 3ROMA 2ZSIA 5JI2E 5CDTA 5H02A 2FEWB 2ZRAA 3FPGA 4HN4B 4TS3A 3UPTA 4RD0A 3HB1A 4BNWA 3SSMA 1JT2A 4MQ6A 2RGDA 4TKVA 2HUPA 3AHJA 1SCDA 1W5FA 2WHYA 3F6PA 2KI5A 3KB1A 3MRXA 4KU4A 1FDIA 1Y3HA 4D1YA 3MWDB 3B9BA 4LVUA 4RF4A 2FPUA 4AP6A 1L8LA 5L7YA 1D2CA 2H7XA 1CR2A 4ZVUA 5K6AA 2BFOA 3H9QA 1E32A 3ON5A 3A2MA 4OBBA 4UU0A 5B1DA 1DIBA 1BE8A 1E3IA 1VFPA 2C8VA 4PLWA 3C3AA 4D6PA 9ABPA 1ST2A 2GM3A 3H9CA 4H4CA 1YR9A 3AEUB 2A78A 2XTNA 2H1LA 1UBGA 3G7UA 5F5NA 5KTKA 1AT1A 2P6MA 3FRIA 3WQBA 2B4QA 1WXWA 3FPSA 4U7PB 4IFBA 5EFZA 3TJRA 1XLTC 3RUEA 5CT5A 1QYDA 1ZGAA 4JROA 1GTL1 1I8TA 1G7RA 3BJIC 4LYDA 1C3EA 1VJGA 4P0QB 1AS2A 2ZBQA 5UKDA 5HRAA 2HJWA 1HKUA 4A4DA 3UK6A 4IH1A 4V39A 2C97A 1BW9A 4OCZA 4BUCA 4YRFA 1Z3IX 3NDBB 3K0SA 5JY1A 3RV3A 3WTBA 3GEMA 4WI1A 1QFSA 1AKRA 4V2IA 3KALA 3T4XA 2J7PD 3TPCA 4ZHQF 1K7EB 4HDRB 3IA7A 5GV7A 3T9CA 2WAMA 3TTVA 1NWHA 1O9HA 1KFJB 1Q5PA 2NSHA 1J0BA 2D1SA 2GPSA 3OWOA 4KUGA 4MARA 4RCYA 2Q5JA 3AF6A 3A9VA 2JFPA 1JYSA 2VWHA 5TF4A 2FFRA 3ZE0B 2O8BA 2FWIA 4GBGA 5T8KC 5GVRA 1MF7A 2L82A 3VSAA 1QVWA 3EBOA 2RD2A 4JSRA 3E9QA 2D4AA 4R2IA 4PG4A 2ODNA 3RC2A 3SS9X 3LHFA 1RBZA 1TKCA 4DIDA 3COSA 4YCAA 2I6SA 1YZQA 4GXQA 5DNEA 3SJBA 2H54A 2H7YA 4HDMB 4IHKA 1Q2UA 1PHRA 3AI1A 2PBRA 3FWPA 4H17A 4P7JA 3JD1A 1II8B 2P9BA 3KPUA 5T6MA 4BBJA 1CY1A 3SY8A 5D3MA 3GA0A 3ULKA 3NXKA 3N2YA 1BWQA 1KMHB 1CCWA 1SU6A 3FYTA 2WM8A 5JS7A 1QGOA 4QXAA 2Q5FA 1U8XX 2JFYA 2TMGA 3K8YA 1Q16A 3R9KA 4AYTA 1T9CA 1Z0JA 1M6HA 2HU7A 3CNHA 4K9DA 2O5CA 1B42A 1LCIA 1TYAE 1QH8B 3G0OA 3C1OA 1H2ZA 4ZIRA 1C8LA 3OI7A 2R8ZA 4ZYVA 4FI3F 1KO7A 1D6JA 3L6BA 2RGGA 3A4NA 4JLSA 2O8EA 1NUUA 1SHTX 1USIA 2RBKA 3Q7TA 1V6SA 4JD5A 5C7IO 4JT9A 4IOLA 3SX2A 3T9AA 5KOYA 2C5HA 2G8NA 1K6XA 2QX8A 3KQVA 3N2GB 3V8RA 2H16A 3MINA 2W8BA 1A7KA 4BFXA 4EO9A 4XWAA 1KS9A 3IUYA 1ANKA 1TM4E 4I55F 1XQ1A 3MWKA 2V7TA 3ENZA 1DTSA 2XVAA 1UF9A 4QLOA 3L4EA 3FWZA 3A32A 4YCSA 3G1UA 4J0HA 4B8WA 5LQUA 3DHYA 2VSFA 2B2NA 4GKVA 4OJNA 3QVUA 1C4XA 4LBVA 4Y7CA 2C2HA 2YWXA 4BTVA 3WIDA 4E15A 3TLGA 4UBMA 4CG0A 2ATCA 2BRUA 3IIKA 5CYOA 2BZ1A 3GAFA 4PR3A 2ORED 5BYKA 5AVXA 1SC6A 2B61A 1BJTA 4ZO4A 4KQMA 2OQVA 2J85A 2P4UA 3U80A 4EBFA 3ZZ1A 1LDBA 2QLNA 4XYBA 3GT7A 2HV8A 3MSXA 4L78A 5CMLA 5LYJA 5JRZA 2OAEA 3PIIA 1OAKA 2DPLA 4PANA 4TVKA 5LA6B 3DQPA 3G2HA 2ZT6A 4U5QA 1KETA 3DEFA 3L8DA 5EIAA 3UQYS 2IS1A 3BDVA 1RJ9B 3IYLW 4FKBA 2H08A 1NBIA 4ALLA 4NBKA 1Q44A 5U4XA 3WE7A 4CM9A 1P6UA 3RNLA 1WTCA 1X9GA 3KIPA 1Y5NA 2VUTA 4N39A 3UOGA 4CM5A 4DA4A 2I29A 1OLUA 2EBUA 1TCBA 1MPXA 2IL1A 1E4EB 1UDAA 3EGWA 4G1UC 3AEQB 5CM9C 4ESVA 3NNSA 3OEED 1AA6A 1FMFA 4QDZA 4R54A 1D8TA 4ZDJA 4FYVA 4EZEA 3LOUA 2WJIA 5JQWA 4C01A 3M33A 2G76A 4WIAA 3VI3B 2JIMA 4ZAZA 1JFSA 3DOUA 4B8YA 2DX7A 2XF8A 3BGDA 3DP7A 3O82A 4I3GA 4BATA 4LFAB 1Z4PX 4ZT7A 4RD2A 5JJIA 4DMMA 1P9LA 4MW5A 3CBGA 3RLFA 3EJWA 1BXRB 1DJNA 3WJ1A 1FP4B 2IPXA 2I6GA 2R79A 2AFHE 3HVHA 3NHBA 5AM4A 1NN3A 4B0PA 3VPAA 2H4WA 5B1HA 4ZMSA 2BMJA 1BCSA 4MRVA 5C1BA 1F8XA 3LIIA 2V9ZA 5H4GA 4QTUB 2PXCA 4N0QA 1JPNA 4YRNA 2Q3LA 1UK9A 2ZYGA 4KDCA 3GRAA 4HVCA 5B55A 4V1CA 4X66B 4RTRA 2O5VA 4ZPXA 4MUNA 1W0JD 1KEPA 3UWPA 2PZAA 4A92A 4CNQA 1X7YA 4HH3C 4LJ7A 1JDSA 2C5AA 3GK3A 3ZZMA 5JR3A 3KQOA 3IP9A 1WB9A 4B4WA 3VNAA 3SDZA 3EA0A 2IELA 1OE0A 4AS3A 4ZHQA 3KZVA 4RMHA 1WXGA 3NDPA 3ORFA 3CLUD 4IVPA 4D25A 3GXOA 4QLBA 2G72A 2IYRA 2YJ6A 4X24A 4LJLA 4KE8A 3VH3A 3I9OA 4M98A 4NDNE 1P2SA 4LZAA 4UREA 3RC1A 1U28C 1G17A 2CVQA 3IP7A 4RIIA 3BAZA 3BIJA 1UJCA 1DCMA 2FPXA 3DBRA 4PAMA 4AN0A 1AC5A 4EFMA 1O97D 2VOEA 4R1OA 5H83A 4BU0A 4UVGA 3URKA 3I8XA 3HB9A 1TT5B 3GRUA 3E9NA 3Q7EA 2ZVQX 4QC2A 4RLSA 4TV9A 1A9XA 4YRJA 2PGOA 3AIMA 4Q7MB 2XIJA 4JP2A 4Q9HA 4HXGA 1CTQA 4FZ3A 4P82A 4LX8A 4AZWA 1VJ0A 2IFTA 2QM8A 4N3AA 4DM4A 4Z1OA 4ZZIA 5A5DA 2EG9A 4P81A 2AQIA 2BI8A 2VDKB 1Y42X 2YXBA 3FNGA 3PQ3A 4P1ZA 5DYNA 3STHA 3H11B 5KUTA 4Q6BA 2CYCA 4PCAA 4I1SA 3ZKAA 2WI8A 1AH2A 3MGAA 2OR3A 4K0RA 2EQ5A 2D1RA 3HZRA 4E4TA 2J6CA 1I6WA 3AF0A 5HPYB 5K0JA 4EPRA 2BTEA 3O38A 2B4YA 1KPHA 1DFGA 1CUEA 3LFHA 1TAUA 1LRJA 2UZ1B 4K6HA 3D6NB 3NHPA 4J2TA 3IT1A 1K7SN 2QD2A 4LHWA 4YJGB 3ZVNA 2OHVA 3GJTA 4M76B 1V37A 4MROA 2JZNA 4ND2A 4L8LA 2D62A 3LV8A 1PI3A 3OPXA 3I0MA 1BDHA 4GT1A 5DMXA 3W7BA 3NRJA 1JWBB 1ESMA 4OFBA 1H4TA 3QLVA 3L2OB 1M8PA 4GUDA 4C89A 3BXZA 4KYIB 3H04A 1F14A 5DB4A 4D0LB 3CLTC 2IZ5A 5AO9A 4RTLA 1NHGA 4HGQA 2ACEA 2VL7A 2CWWA 3KJIA 3RSOA 3GFOA 2NSJA 3L7BA 4I81A 4R31A 1YCDA 2YQ4A 5LBTA 2O2YA 3NUGA 5AJTA 3UA3A 3QX3A 2XDQA 3NC4A 1LV7A 3MB5A 3OQNA 4ITUA 3DZKA 1V6CA 4O5OA 1TUEA 3TMYA 4B0OA 3D0QA 4AJNA 1OJ7A 1YGPA 2P8SA 3CKYA 4I4LA 3F7MA 2J30A 4K6CA 3VR3D 1DI0A 2O2DA 3UWSA 4C07A 1BQEA 2QMOA 1IY8A 3FPCA 3ITNA 3SEZA 2R751 2YVAA 2Q50A 4A1FA 2HPAA 1LBQA 3LL4A 1B41A 2YZMA 4OL9A 4TXNA 5B2ZA 3QX7A 4ZOBA 1JKJA 1YU6A 4YEDA 3S8EA 4X95A 3A3KA 3BH7A 1KRXA 1Z7YA 4ZK2A 3R0ZA 1H8ED 4B74A 2V1XA 4G8JA 2H8KA 2Z95A 5L4LA 1M6YA 1AV7A 3KKQA 3H8WA 1NQWA 1Z4OA 2WF7A 4XSVA 4E5SA 3DLAA 3AP1A 1V16A 4M99A 3H9EO 1JFTA 2WJHA 3PP8A 1VPTA 1J8DA 4IOMA 4NMMA 4GDFA 3KE8A 2XRZA 4GL2A 1UC9A 4BVLA 1GLNA 1JE0A 3Q8XB 2YWDA 1MH1A 2CJWA 3O0TA 3C5VA 2QN1A 5KVVA 4YUVA 1Y6FA 2OT3B 3T38A 3BERA 3TTSA 4E5UA 1WL8A 3PR1A 4LEIA 1H3FA 2G1JA 5JCJD 4AKGA 3E9DA 3KD3A 1A72A 1GUAA 4P5EA 5AKZA 1EFRA 1BHQ1 4ZZ0A 4S1WA 4IHAA 3LVRE 3IMGA 1NJSA 3KG2A 2AJ8A 3M4JA 3GPIA 4LF8B 1BXGB 3MA0A 2DQZA 1LBEA 3G1WA 1C9NA 3WHPA 4EUNA 3I37X 4RA9B 4BKOA 4NQZA 1ETUA 3LQ1A 3AXSA 1L7XA 3IQDB 1GT6A 5IVKA 4RE6A 4QGBA 3LY7A 4P34A 2I03A 2YICA 3NRBA 2P65A 2I7DA 3CEJA 1BYIA 1BMFD 3JXEA 4EGQA 4E3WA 4RS3A 4DEVA 1JHQA 3UJCA 3ND6A 4BXOB 1XKQA 3ETEA 4ICIA 3RCBA 5E9WA 2B7CA 2Q4DA 2PSEA 2OFPA 1QRTA 1OQAA 3B5JA 4CFYA 2H3EA 3IHWA 3LY9A 3KDSE 4AS1A 2BFCA 3PFHA 2HQRA 5DRYA 2FF5A 5A4KA 2G0NA 4JLNA 4A82A 3LZCA 4DAOA 3DV9A 4RLQA 4UUAA 3I04M 3LLMA 4D3DA 4XPIA 621PA 2RK6A 4E4YA 1EUZA 1LJ8A 1U8ZA 3ZD9A 5F2KA 5J23A 3PPIA 3KUUA 3SYTA 4MITA 3JQEA 4P38A 4J91A 5FPPA 1IQRA 3VNUA 5KVCA 1KZ6A 3G9XA 3IAEA 2HR1A 2OHIA 3M3DA 1N1MA 3P20A 3VC2A 1W44A 1JXOA 4BB6A 1NVUQ 4KVAA 3QWIA 1I5EA 4B7XA 5LBUA 3ZDDA 2Y1LA 2Q29A 2WUDA 1UAGA 4CTKA 4IKEA 2DPMA 1QCCA 1ZK0A 3HDGA 1E98A 2HRQA 3AT1A 3NPMA 1BKYA 2I7VA 3D02A 2FJ0A 4NCXA 1YK0A 5AUQA 3HSKA 4RNCA 2O2GA 4QQRA 1R5NA 3BZBA 1YQDA 3CF2A 4LY6A 5IKMA 2A9FA 3QUSA 4HX9A 3E9CA 5AW1A 1EVYA 2P9CA 2WSSD 3DDHA 4QJBA 4RL4A 2LDXA 4WCVA 5K3CA 5LZ7A 4B6OA 1KH2A 4F4HA 1F0NA 5EFOA 3TUZC 1DWUA 2GK4A 1WY7A 2DERA 1HX7A 2ZZNA 1COZA 2J32A 2Q7OE 5I9MA 1PYOA 3BXGA 4Z99A 3FJOA 5H3CA 1QC5A 1ZSNA 3DC7A 1Y4DE 1AM4D 2QX9A 1S1MA 3T7RA 1WSDA 4XVRA 4RYDA 3K1ZA 3GFRA 2VDWB 2IDKA 4MUGA 4HWTA 3JY6A 4XJSA 4IG9A 1OH6A 4KNYA 1VHDA 1OFHA 1W5TA 1P0MA 3PC8A 2ATVA 4CXMA 2ZRDA 4R2JA 1PD0A 3PUZA 1G19A 4LYJA 4WKNA 3FPAA 1ID1A 1YNOA 4LXGA 1QJ4A 3IOCA 4WVLA 3E8SA 3GG2A 3I6ZA 1HTBA 2GF0A 3JQPA 3SC4A 1XLVA 1W0KA 5DBFA 3VR1A 2CNKA 2PSDA 2ZIVB 3O0DA 2QORA 3GMIA 4WDQA 3FI9A 3G6WA 4RMNA 4ZVVA 3T7AA 4UJ3A 4Y2SA 4EL5A 2UZ3A 2JIOA 4HC4A 1OBCA 4KQHA 3D6MA 1F8GA 3K0FB 3KV3O 5CYFA 3GDFA 3IELA 4A6EA 3CZ4A 3WLIA 1EHIA 1B6SA 1HGXA 5E6SA 2VC2B 4G5OA 4DA7A 3FWNA 1V3QE 2IHZA 4KMRA 3TQOA 1N3BA 5EJ6A 2ZBGA 2GETA 1N5JA 4FW9A 1NVWQ 3AF4A 3PTLA 1SM4A 1Q1NA 2G67A 2PZFA 2P6RA 4K1XA 3IUQA 3LSYA 4IH9A 1JR3A 4UTOA 3GQBA 2VKTA 5DYYA 1R9JA 5F5LA 2FEPA 4NR0A 4RORA 1FNSA 1Z35A 4G26A 2XDWA 1S89A 4X6YA 1POXA 1R0BA 4CR8A 1DIRA 4JHLA 4PC2A 2IS6A 4M1KA 2EW8A 3GBPA 3IJEB 2IYLD 3OIYA 5E4YA 4Q3BA 3SBXA 1MGPA 2QE6A 1BX3A 3CJTA 4F21A 2ZAMA 2QN3A 1RAFA 2OP1A 3N0VA 4WCFA 5DO9A 2PV0A 1O6GA 3EEFA 1SXJC 4CUJA 1QHSA 1ECBA 3G2IA 4XGRA 3ORQA 4I1YA 2O3JA 1CJBA 1LK7A 2PUBA 5A04A 2XVYA 2F2TA 2GTHA 2IZ6A 1P8AA 1QYIA 4OSOA 5P21A 3IKTA 5IC6A 1R27A 5BRNA 1XVIA 2GM9A 4HDNB 4HPXB 4TZKA 5JYDA 1WPXA 4CUKA 1UBRS 3X2SA 1GSAA 4I9GA 1LC0A 3EDYA 1LJLA 5JSYA 4Q66C 4PU0A 4R8RA 3PD7A 3UMYA 3LUHA 4DDKA 3OC6A 3KQHA 4HQ6A 1OAOA 2B9EA 5EIXA 2XY4A 4TLBA 1R1DA 1ELOA 4H3SA 3D3WA 4LQLA 4QXRA 1ENYA 2GUGA 3DXYA 1C14A 1QU3A 2AJBA 3ZQKA 3GYBA 4C04A 5IBQA 1ZVKA 2PV7A 1C2YA 4B47A 3CEHA 4HPWA 3RIHA 4PRKA 4KC0A 2GMWA 3K32A 4Y1RB 3E2MA 4TVOA 4Q01A 1HDGO 3T3OA 3BB3A 2FN8A 1JQBA 2JFOA 1K8YB 1OXVA 2YV4A 3KQYA 4FCCA 5AP9A 3K6JA 2AYYA 3B6KA 1UJ6A 1XXHE 4QJ5A 5FH9A 3BS4A 4O25A 1KAOA 1AE1A 3BSYA 4WV3A 4MR8A 3U5ZB 1J21A 3V4VB 5HK9A 1SXGA 3OZGA 4XQ0A 7ADHA 1G3RA 2IODA 2Q3DA 3ZQUA 1OW3B 3SPXA 2BMWA 2GBGA 4Y2RA 2X2OA 1DJLA 1RYHA 2DPYA 2SHKA 1NBEA 3BXOA 3EDRA 2BDUA 3O3MB 4LOHA 4N49A 3UJ3X 5TQ0B 3EYWA 4HNTA 2GPTA 3AUUA 1R12A 3P9KA 2ZYAA 1B6RA 3R6LA 3D0RA 3RNOA 4PG8A 2QDXA 1I7QB 1VTKA 3DOCA 5CIQA 4BMDA 3LWBA 2IVZA 4AYWA 1YRHA 4K05A 3FFBA 4F91B 4F92B 4BB5A 1JYFA 1NI5A 2WU3A 5ENVA 4NCHA 4FNAA 2R97A 4Z1MA 1G66A 1QIMA 1SXJE 4TRNA 1H8HD 4GYYA 4DARA 5CB4B 3LHKA 3TOCA 1KVQA 3L43A 4B81A 1G55A 4C3OB 4D7AA 2OCDA 4O2BB 4Z4EA 1S3SA 2AOVA 3VOTA 3AJDA 5LJLA 3QVWA 1RP7A 2A9KA 3D1LA 5A3VA 2G5PA 1C7JA 5BYJA 3EMVA 5CFZA 2AOUB 4BNDB 5JADA 3KOOA 1Y1KE 1PG2A 1T5BA 1NN1A 1QTIA 3WFIA 2G82A 3F5SA 3NTRA 1G8FA 1T1RA 2GXQA 3MPOA 3SEQA 3PICA 5ADWA 3OY7A 2W6QA 3VA7A 1EXMA 3JALB 2M6RA 4W5OA 3PDHA 4ON9A 3FXAA 3VU3A 1G2PA 3UMVA 5K8VA 3Q1KA 4OLJA 3F6RA 3EOZA 2Z6AA 1V5IA 3W5DA 2GPJA 4G5RA 2ANBA 1QAMA 4DQ0A 1Z0UA 1C8VB 1CJTC 1M0WA 1OVMA 1YMVA 4MS4B 4P3YA 5E1BA 2QN7A 1JP7A 3AR7A 4AQDA 4R0MA 1LW7A 2IYVA 3D4OA 2G4LA 4G8CA 2DBRA 2ZPAA 3AL2A 4PF1A 4S2UA 5DOZA 4AQ7A 1SZCA 3AJRA 3AI7A 1KEEB 1J6UA 2D74A 3UT6A 4EHLA 2QOEA 1GHTA 5IVHA 1PEDA 2VSXA 4JI4B 2O3UA 4YRQA 2R7LA 4PYQA 1SBTA 2F8MA 1H6CA 4TRRA 2HF9A 5JSFA 5F9FA 2H1WA 2CLKB 2OY0A 2PR2A 2PUWA 4DIMA 4OB7A 4YJKA 3GCZA 4PO3X 4HDQB 4GQIA 4QATA 3E82A 4DQXA 1TW3A 4YS6A 4OYHA 4ERXA 4EKGA 1K4YA 3DE4X 2PFGA 5J5AA 3WYDA 4UKDA 3MGBA 3NOXA 3VV3A 5AVWA 5D5QA 2EZTA 1G60A 2R1TA 3ID6C 2GM4A 4LHSA 1M5RA 1XRPA 1KU6A 4UW9A 3COPA 3JU3A 1GSOA 2AIRA 4PTYA 2B7BA 1RKBA 1E3EA 1O89A 1P74A 1WX1A 2CD9A 3COWA 3EGDB 4JBLA 4XOIA 1CQIA 4OM8A 2KB0A 4A8PA 5BMVB 3OE7D 3IUJA 4O2AA 5DLYA 2FMUA 1TO1E 3EMDA 1KI2A 3EASA 3KQPA 3MUFA 3U60B 3N1UA 2Z5GA 1OPRA 3A1SA 3DOEA 2AFIA 2JVIA 3TH5A 4P9NA 1M1YA 3Q2IA 2CLDX 5C7OO 2LR0A 4CM8A 1SIUA 4E09A 2J0UB 5TQJA 1GN9A 3L05A 3VC3A 3V33A 1PEKE 3REQB 2AX3A 4NFYA 1G2OA 2Z5FA 1Q0HA 3PNMA 1J0CA 1MB3A 2W42A 4F5EA 1Q50A 2G40A 2BCJQ 3EBLA 5GM2A 2BGUA 3Q87B 3KJHA 4A8JB 4A2CA 5FDFA 821PA 1Q3TA 1BNCA 1WXEA 2ZYRA 3C0KA 4O33A 3OQPA 2AI1A 2CDNA 3W04A 1UT8A 3AFMA 3JVUA 2OBLA 4FBMA 5CM8B 3NDJA 1VP3A 4PAGA 1HEUA 2OFFA 1U7OA 1Q20A 3RT9A 1NXTA 3CLRD 2XCIA 1XA0A 3KKZA 4UMVA 1F12A 3CVYA 2WJ4A 3RFVA 1LY1A 4NATA 4URFA 1E1RD 2XYQA 4ZOEA 2J3EA 5EJ2A 1ZD8A 4EW3A 3E1SA 1EB9A 4NL4H 3U9TA 1FNCA 4XB1A 4DVGA 3BJEA 3EMKA 4OJMX 5IUNC 4YYZA 3QWFA 4L5YA 3SSOA 2XWSA 2C61A 3Q3VA 1Z08A 1Z68A 1LDMA 2ZEJA 3K1TA 4AUKA 2A5YB 4Z0TA 3EGCA 3RSHA 3QEOA 2GK3A 2H1IA 2VR1A 2WG2A 4Y2TA 1Y6GA 2XBUA 2XWBF 3I45A 3ABQB 2W7TA 1V5GA 3LCRA 3WRXA 1PR1A 5A3SA 1FXSA 2VT6A 3SXJA 3RBZA 4QYIA 2X7HA 1G6Q1 1NRWA 1WSWA 3FTCA 3QKIA 4JIGA 5BV2P 1OWPA 1KFBB 4M0UA 1JSRA 1M66A 5FFNA 4I9NA 3CXRA 2FEMA 3MWEA 5AJHA 3ANXA 5GONB 1GGVA 4NABA 1Q3KA 2RGNC 1ZL0A 1ORTA 1HE5A 3HA2A 3L1UA 3NHSA 3Q6MA 3LA6A 3S44A 2Y1EA 1V9LA 4OX9Y 2V0CA 4RY2A 4WL0A 4FBGA 3SLRA 2ODQA 3SHWA 2ZIGA 3U3XA 3IT0A 1AMUA 2WYVA 3DAFA 2QPLA 4S35A 2XZLA 1M1NA 3E05A 1TL7C 4WE3A 4X20A 3MNFA 3A6DA 4MJ7A 1YFJA 3KYIB 4HQOA 1GQFA 3CY6A 5J5CA 5FWYA 1MXFA 2HCRA 2OL4A 3QW2A 1GXSA 5BV7A 2OBMA 4FWIB 5A4FS 1U1DA 3KYCA 3I1IA 3KVRA 5BSFA 5KQLA 1TTQB 2FPIB 5J2UF 3BHMA 2IGBA 5AI8A 5KYYA 2B0CA 2RHCA 2ON6A 3ICOA 4KO2S 1C0EA 2IV2X 2IF0A 4OMFG 4V0LA 1VPDA 4LRXA 4M38A 4Q19A 1I2AA 3WG9A 1G9SA 1P7CA 4EG8A 4V24A 1YRWA 2LKCA 1FYVA 3RUDA 3DCIA 2DHQA 3BB1A 4M1OA 1XDWA 2LCIA 1U31A 2NXJA 3O5AA 3PJGA 4KO8A 5EWJB 2OXIA 3WWDA 5JANA 3NR2A 3S3TA 1QFJA 2C9OA 4TMZA 3S40A 4ZCSA 3VPCA 2Z98A 2ZS8A 3LXMA 4U2FA 1T2CA 3M2TA 4E6PA 5G3YA 1GRRA 2GBLC 1NFRA 1YA4A 2D13A 2GKOA 1FBNA 1WG8A 4IUDS 3CX8A 2VCEA 2CWDA 4F4JA 1QX4A 2GILA 3IB3A 1SY7A 4JGIA 2GB4A 4FD2A 4TSFD 1N2EA 2GZAA 2QL9A 1QBKC 1VE1A 3HUEA 3TI9A 5TC4A 5MGBA 1GQRA 1LSUA 3H2HA 1UKZA 4Z8XA 4B3JA 3L7DA 3KAPA 4D8WA 1NVVR 2FDRA 4FNOA 3RVJA 1XZCA 2D7CA 3GFSA 3W6OA 5EERA 3S81A 3V9AA 1P62B 2CCKA 3EJ6A 4YDHB 4EITA 2BGGA 3MWYW 5TY0A 3ITKA 1GA4A 2WKPA 5F9HA 3B52X 3MAGA 4X91A 1NVGA 2ZB4A 4PBRA 3KFLA 3Q6NA 1W4LA 4KCGA 4AJKA 1S2IA 3G8AA 6AT1A 2VTDA 4W4TA 3IX7A 3GMTA 5SY4A 4K9OA 3H3FA 1LFAA 1LDYA 1RXSA 2BP7B 2I9PA 2PRZA 5DGDA 3HDYA 3V32A 3VPGA 1V4VA 1NR5A 3BDIA 1PSWA 4I6JA 1KP9A 3V4RA 5IWCA 1U7XA 3IL2A 3PUWA 4RVOA 3QYJA 4F6RA 4IIDA 3TE6A 4DR7B 3L7JA 2VAPA 1U0RA 3DA8A 4J75A 1YZTA 5ALUA 4WOJA 1O08A 1HORA 1MAVA 1THZA 2HF2A 4OHXA 3DMTC 5IKPA 3I2HA 2GZ2A 4HNQA 3QVGB 5FBVB 1O9GA 2ZTLA 1F3OA 1C7FA 4TL6A 4XWKA 2H5LA 4B3BA 5LM3A 3MILA 4IF6A 2FFQA 1E79A 5AM0A 4PZUA 5HJ7A 2HTEA 1KXZA 4KQEA 4AF7A 2IYNA 2REQA 3CZCA 2CDAA 1D1SA 2FN7A 1V7PC 2ILTA 2JGDA 2XT0A 5JH7B 2PAAA 1ZA2A 1YHNA 4FFNA 4B09A 1TAQA 5DULA 4ZGBA 1UIMA 2QRVB 3TGPA 4MK4A 1JL3A 3HEAA 3QU2A 1K89A 1CX9B 2NSYA 3IBGA 2YQ5A 1XRJA 3GZJA 2YVLA 3EVTA 1K4KA 2G28A 4K86A 3V4SA 2Z58A 2C2ZA 2QUAA 4JLJA 4MRMB 1L1FA 3SGLA 3TB4A 5JD5A 2OLKA 5THXA 4F9FA 2JIZD 2BY4A 4X1IA 1GGJA 1KIMA 3ESZA 3UAVA 2FZKA 1GLGA 3O26A 1CD5A 1VL8A 4DR3B 4JITA 1Y9AA 4KIUA 1AQNA 1P45A 2V3VA 4EY7A 1GPBA 2B99A 4MQEA 2BEVA 2C9CA 1UMDB 1TF5A 1P2BA 1I7NA 4WKPA 5T4EA 5FBRB 3GDHA 2B36A 4XIJA 4H6XA 2EHJA 1GU0A 2QY9A 2IXDA 5COAA 1PV1A 4QBTA 8GPBA 5KNCD 1UKVY 2CVHA 2QIOA 2XMPA 5KNDD 5EE1A 2JVJA 2JRCA 1TAHA 3OQ1A 3ZY2A 4KACA 2GDZA 4D02A 4K6GA 1FLNA 3RRFA 4H59A 1HT1E 2H11A 3L41A 3LT0A 3O8OB 1J23A 2Z3ZA 4IL5A 1ICEA 3MBOA 2RHWA 1QH9A 5FHQA 2Q3MA 3DH0A 1W34A 3EXG2 5HS4A 2DEUA 1M7HA 2OSBA 4YVFA 3U26A 3KXLA 5GM1A 3CRRA 3AGPA 1X14A 1W4ZA 3E70C 2DWPA 3DV0B 5IXYA 1UZMA 3CIOA 4IAOA 1ZOOA 4JT8A 1SVIA 1XI2A 3CWCA 3U4QB 4A2PA 1CDDA 5KSOA 3D5EA 3JASB 1REQB 3ACDA 3THWB 4LTDA 4Q9NA 4XWOA 5HWSA 1A4IA 1B3BA 3DYVA 4MW4A 3OQVA 3QYPA 4RHCA 2D0DA 1VKHA 1GKIA 2G83A 4ZVOA 3AEXA 2LTAA 4X93A 2HN9A 2WZDA 2YOGA 3A70A 1GKLA 3C6KA 4F45A 5JXGA 2WFLA 1O95D 2JIPA 2IUSA 1FFBA 1PT5A 2J5QA 1P7YA 1YK1A 2ZE7A 1DAEA 1J90A 2ZFUA 3E8MA 3LYHA 1TEHA 2XXJA 4I14A 4P5DA 1ML4A 3LO5A 2PD3A 4JC4A 2GA9A 1YULA 3ZIAD 5K6AC 4YC7A 1K86A 4DE5A 4KR6A 1QVVA 4OY3A 2WD7B 1H3NA 2VAMA 3E9YA 1IN6A 1HE4A 3KB8A 3DHEA 2WOJA 3DP9A 3P0HA 4I9HA 4CJXA 5J40A 2VHZA 2D2EA 2JJ1A 3JAKB 1NXXA 3BHJA 2W48A 1XTSA 4MVJD 1HUQA 3AB3A 4WGGA 1NNLA 4Z2YA 4J43A 3TW4A 7GPBA 4GZ3A 2HFKA 3M4XA 2A9QA 2VBIA 4OP1A 1IOLA 4Q3KA 5DSXA 1FRNA 3D0KA 4HDKB 4PPGA 1ISPA 4OIFA 3ZEAA 5IARA 5AK0A 5ICFA 3CPJB 3TZEA 3PWTA 4FOPA 4HMQA 4BKMA 3T1TA 2BGKA 4OP3A 5G3ZA 3KE9A 2W4IA 1OPXA 1YVEI 3R20A 3KR1A 4AF6A 1UFVA 2RI6A 3EZ7A 1XEWX 1Q21A 3MUEA 4M9ZA 4OHCA 2EX4A 1EWTA 1TYZA 1DADA 3Q7QA 1XZNA 3GG9A 4FFBA 3L5KA 5GJCA 2Z56A 3ORRA 1LBTA 1VBFA 1JG6A 1ZGGA 3DT8A 1PDVA 4QYTA 1T1SA 3W1VA 1QIEA 4WBXC 4I2VA 3KTOA 2XGMA 2VCYA 3ESRA 1HTTA 2HSZA 3MERA 3C3KA 2FMHA 2A5JA 3RTEA 4KB5A 1DBQA 4KSYA 2X0EA 4B80A 4Z4FA 4BX3A 1IBKB 3LW8A 1XJCA 1AG9A 5AYVA 2ZWMA 1JG1A 4YX9A 1NUSA 3FNFA 4BBZA 5CDFE 1H66A 4XCVA 2ZI4A 3HVRA 1L4GA 4B3FX 2Q6OA 1F0YA 4N7MA 3D2LA 2WAYA 3RVRA 1VI6A 3PD1A 3K5PA 4HT3B 2OCYC 3AF1A 3PGLA 4Z7JA 3H2KA 1P5FA 3B6EA 1IHPA 2DLDA 3G8CA 2XECA 2HB6A 4P58A 3ZY4A 3RYFB 4V02A 4NDZA 4KBGA 5CAEA 1GGMA 2G77B 5KKNB 5C8XA 2R2GA 4IIHA 4BRZA 3OJCA 5BSGA 3CLHA 1U1GA 2GLUA 3RFCA 5JROA 2QUKA 4FKZA 3S1LA 3B3JA 3H1EA 5B6IA 1UAYA 2QRQA 3BJZA 3FB1A 5B1EA 2J9FA 3A9SA 2IPOA 1TKBA 2BJHA 1N0UA 1SUIA 2VF4X 4MKIA 3LWNA 2RGXA 2ZSHA 3FGZA 3GLIE 4QUJA 3WY9A 4YP9A 1GPKA