1FMCA

7-alpha-hydroxysteroid dehydrogenase complex with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1996-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fmcA00
4ZRNA 3QVOA 5JMPA 2RHCA 3CE6A 1U9JA 1EZ4A 2VTDA 4AJ4A 2IXBA 3T7CA 5CP8A 1PJTA 2NU9A 1ISFA 5JBIA 4WECA 1NQ5A 4PRLA 4Z9YA 3U0BA 3P5SA 3RUHA 2CDBA 4CM3A 2AW5A 3AWDA 4IDDA 2ZJ0A 2YQ5A 1T4DA 1N7GA 3ZHYA 1MFZA 3EYWA 2CDCA 3JD3A 1YXMA 3TWOA 4CLDA 5ILOA 1EVZA 2A92A 4DWVA 3WTBA 4QEDA 1ZJYA 1X1TA 3DZFA 3GVXA 2W2KB 5FI3A 3WS7A 2ZIZA 4IDAA 4CM5A 4FPXA 2AQKA 5A9TA 2EIHA 1YB4A 5F1KA 1XHLA 5DN9A 3PWKA 4F45A 3ZNNA 1EE9A 2FRDA 1T4BA 3I52A 2UAGA 5ICMA 5TRTA 4RF3A 4WGGA 1E7YA 5H83A 5KJCA 5I7SA 1O8CA 4HADA 5L4LA 2W2KA 2AE1A 5AXBA 3H2SA 4UAGA 2JCXA 3VDRA 4MINA 3SBOA 1LQUA 1NBOA 2UUOA 4J0EA 4ALJA 3F6YA 2PGDA 3VH3A 2GD1O 3AI2A 4XD2A 4RJTA 3TZKA 1WWKA 1C0IA 1XIVA 3RKUA 2FN7A 1P1HA 4FC7A 4K1LA 4RVUA 4B7CA 5T8KA 3NTRA 4YT8A 5GZ1A 5B4UA 4J1NA 3PHLA 3MWEB 4S1VA 4WOJA 3HUDA 1HF3A 4ALMA 3JQFC 3H8VA 1QYXA 1ZK0A 1SOVA 4RQUA 1KOLA 5JCXA 1WPQA 4IDCA 1HLPA 2QIOA 4WE3A 4LCJA 4P4LA 4TVBA 4A27A 4E5YA 2NTVA 4FFNA 2Y0DA 4FFRA 4J49A 4MIYA 4UVDA 1DDOA 4PZEA 3D4OA 5B37A 4JROA 2CF5A 3GH3A 5A05A 1R0KA 5IDXA 3O4RA 4IZHA 1KEVA 4XQGA 2V6FA 3BIOA 5CPBA 1E1MA 4BB6A 3QWFA 4RPHA 3RFXA 4NBUA 1UDAA 3OJOA 1QYVA 4MOWA 3NDIA 3WOHA 4R9SA 2FZEA 1ARZA 1EK6A 1BG6A 4EBFA 5B1YA 4ITUA 4BNHA 4DUPA 1ZZEA 4RZIA 5EQFA 4CMJA 1YE3A 3NAQA 1YQGA 2AHRA 3INTA 2Z95A 1L7DA 2PKRA 1SZJG 3PQDA 1PL6A 5GZ6A 4KUGA 2YQ4A 1F14A 4OO3A 1RKXA 4XZ3A 3VZRA 2VRCD 3MWDB 2DPGA 3ZWNA 4Q3AA 1BXGA 4JBHA 3QQPA 3BHIA 3HDYA 3OIFA 3E48A 4FGWA 3ZWPA 1GZ4A 1EVJA 4N5LA 1H94A 3OJEA 2WM3A 2B5VA 2CF6A 3JD2A 3AU8A 4D0SA 3DOCA 3RUIA 4ZN6A 3JQ6A 4E4YA 4BO7A 1YONA 4K28A 5F3RA 4FIZA 4R5MA 2CNBA 5L3ZA 4Z0PA 1O0SA 2V65A 2EKLA 5MGBA 3BTUA 4EJMA 4I5FA 3DOJA 5AXAA 3VPFA 2HJRA 1YDWA 3KSUA 3MCVA 1V0JA 4UEKA 2GRAA 3H9GA 1YQXA 4YJFB 1ISGA 1D8AA 5TX7A 4HBGA 4ALNA 4CV3A 4WCDA 1LC0A 3PXXA 1D1TA 4AJEA 3VPSA 3CUKA 3GN2A 4XEHA 4DLBA 3F3SA 4IJWA 3ONEA 4BKOA 1LUAA 3CTMA 5EIOA 1V3VA 4Q9NA 4I8XA 2J5QA 4YJFA 1OI7A 2FHSA 4O0LA 2ZQYA 3UN1A 3BA1A 3DMYA 4I9NA 4A73A 1E77A 3ICCA 3ZNPA 2CZCA 3W4JA 1A72A 4GLOA 4DPLA 4UVEA 1CQJA 1H93A 2VNAA 1KVRA 2E82A 4RF4A 4BNJA 5KJ6A 5ITVA 2X7HA 5L95A 1X7GA 5C7OO 4Y6SA 4Q3CA 1LDNA 1GQYA 3MJSA 4TROA 3JYPA 2ZB3A 9LDBA 1UDBA 3ORFA 1VKNA 3QWHA 3KYDA 2JL1A 3CZRA 2CD9A 2G0TA 2O3QA 5A04A 2NM0A 1ZEMA 4CMIB 3NX4A 4D0RA 1K6IA 3R3SA 4XQEA 3CINA 4RORA 5EESA 3AUAA 4BKRA 4KOAA 4NK5A 1YL7A 1LSJA 3KEOA 4OXNA 2EERA 2Q2QA 2ZTMA 3GHHA 2RH4A 1GCUA 1IHYA 2BI7A 1KVUA 2EKQA 4WJZA 3K96A 2DFDA 5K6AA 5BSFA 3LT4A 3OSUA 5KJ1A 1ZEJA 1VSUA 4QSMA 2IZZA 4NMHA 4W9NC 3B70A 2FZWA 1B26A 4CR6A 3WYCA 1NVGA 1Z82A 1C14A 3JQ9A 2QRKA 3JCZA 1QG6A 4L73A 4I5DA 2DU8A 1N2SA 5LDGA 4E5MA 3P2OA 2FSVA 3U09A 4MKZA 4Y6PA 2NVUA 2O2YA 1HYEA 3HDHA 2GLXA 4BNKA 1M76A 2HMUA 1DAOA 2GGSA 3PIDA 3ZZNA 1LC3A 1E1NA 5A5FA 4YT5A 3HFSA 1IYZA 5JNLA 1NPYA 5IF3A 4PLZA 1SB8A 4KMSA 4D7AA 1P33A 4R9RA 4NBWA 5JDCA 3BTVA 1KY4A 2QG4A 1GUYA 4GX5A 4I08A 3AFNA 4RPJA 5A3JA 1UXJA 1T26A 2RCYA 1IUKA 1Q7CA 2A94A 3F5SA 3BMNA 1NPTO 5TIIA 2RAFA 4GH5A 4CLHA 5B4TA 1DHTA 4CM1A 2X5KO 4WLOA 1PGNA 3ZV5A 5L7TA 4DPKA 3FPLA 3BHJA 2Z1NA 4N7RA 1C0PA 1QSGA 3OMLA 5HRUA 4PCVA 5A06A 1TB4A 2HCTA 2GCGA 3RKRA 5A4DA 3M2TA 2X5JO 1VL0A 1ZNQO 4DREA 2PD6A 1QV6A 2EGGA 1VKOA 4I9HA 1LRLA 4IINA 4L8VA 1IE3A 4FQ8A 3WTCA 4RVGA 1E3IA 3DMTA 1UZLA 1YQDA 4FSHA 4OGWA 3U3XA 4M89A 3VKVA 2JAHA 4K26A 3Q9UA 4XA8A 2E37A 4FFLA 3I9JA 4IGFA 4PFJA 4BMNA 3C7CB 1SMKA 1GYPA 3BMOB 3PWSA 3EDMA 4QX6A 1PJCA 4MVJI 3TDKA 1KEWA 1XELA 3CKYA 2O4CA 3BMQB 5G0TA 1ML3A 4XYLA 2BF7A 1DRUA 1T1RA 5G4KA 2Q1TA 2RHRA 4Z0HO 4R41A 1HDRA 1VJ0A 2UVDA 3AK4A 1YBAA 1VJ1A 3GN1A 4MP3A 1RM3A 4Z9XA 2O3UA 4E5PA 3BMOA 2X9VA 3ZW9A 4KQWA 2NWQA 3BMQA 4LRSB 1ZSNA 3AY3A 1JLLA 3ANLA 4DTIA 1LBEA 1LSSA 1E7MA 3QW2A 4RLSA 4CLRB 4Z0TA 4L74A 2Y05A 2GZ2A 4FJ0A 4BMSA 1ZO8A 1DXYA 2VYVA 2F00A 3QA9A 1PS0A 1HTBA 1C0KA 1AXEA 3B20A 6ADHA 5DF1A 4E5NA 5A9RA 2BH9A 3ON5A 5JW6A 3H9JA 1LA2A 2CDAA 4BO6A 2DBRA 1ZK3A 3RROA 4R68A 4WASA 1PEDA 1OFGA 5J23A 3PJDA 1Y9EA 4BKQA 4CLRA 2JHGA 4OXKA 4M8SA 2X22A 3VH1A 5T64A 2GUGA 1NVTA 3MJ4A 2O3TA 2JFFA 1T25A 3Q2KA 1PGPA 3D4NA 2CY0A 1PL8A 4NG5A 1Z45A 3G17A 3AFMA 3WJ7A 5I7FA 4O1MA 1I01A 2HK9A 4TRRA 2Y67A 3BMCB 2FPPA 3FCOA 2I9PA 3GVIA 4OOFA 4HFMA 4PRKA 4I1IA 3GRPA 5DT9A 1X14A 3GZ4A 4IQ0A 1B8VA 2IZ1A 2WMDA 3DXFA 3ZCXA 1W0CA 3AJRA 5FYDA 4J9UE 2D8AA 4E33A 2NVBA 3D3WB 3PFFA 4FOOA 4YJGA 5JDIC 1N5DA 2J8ZA 3C1TA 1T2EA 4R01A 2WYUA 4R3NA 3VTFA 4E2YA 1KY5A 1NQTA 4W82A 4B4VA 1U7HA 1BDMA 2I5PO 3WGGA 1GUZA 1GDHA 3WGOA 4BO4A 1HDOA 1SC6A 3OBBA 4DGSA 3D3WA 4DIFA 3SXPA 3ZI0A 2JKVA 1A4IA 1NASA 3OA2A 1HWYA 2BFMA 1GZ6A 2Y1FA 1U7TA 2YY7A 2Q46A 1VLLA 3AM3A 4RF5A 1GADO 4U6QA 4L0QA 1TT5B 3TPCA 2IYOA 5CEJA 1KC3A 4TKMA 3JQFA 2VOJA 3S55A 4BO2A 3DAGA 5BNFA 4OKNA 4U8GA 3AM5A 4B3IA 3GZNB 3G79A 3STHA 2Q2VA 2VNSA 4FJ1A 1HDXA 1SEPA 4YWJA 3GUCA 1E3WB 2IZ0A 1OMOA 1EQ2A 2J5KA 2WJPA 3ONFA 3GAFA 4PLCA 1PQPA 1LDEA 2VZ9A 4Q3NA 1PS9A 3S2IA 1DFIA 1U3WA 3VZPA 4IIVA 3MEQA 1TT5A 3WGQA 1E5QA 3ZV3A 1HDGO 3CPSA 3GZNA 3UW3A 1EVYA 3WB9A 3OM9A 2CFCA 1N1EA 4K9DA 3VTZA 1E3WA 1RYDA 1OBFO 4MP6A 5GZ3A 1NFFA 2OO5A 5BQFA 2ZYGA 3KXDA 2C5AA 4ZU3A 4R1NA 4XIYA 4U0KA 3C8MA 3GPDG 3K30A 4YRBA 1E1KA 3DHEA 1TT7A 2C2YA 4INAA 2AE2A 1ZW1A 4ND3A 3E6AA 3S8MA 1MC5A 1PZHA 3I23A 4PZCA 4AJHA 4YAKA 2F1KA 4BVAA 3PGXA 5KVQA 1YJQA 3H4VA 1XCBA 2VT3A 1LSUA 1UH5A 3U62A 1H9AA 3G49A 3UHAA 1K6JA 5T5QA 1V3UA 3IIEA 1PZGA 4URFA 2NTNA 2QYSA 5IJZA 1FDUA 1GV0A 3MTGA 2DBZA 1KIFA 4IPTA 4J4BA 1A4UA 1CRWG 2W90A 1AGNA 2R6JA 2WD7B 3PVZA 4Y98A 4CLOB 3NKLA 4HNGA 4CMGA 4GKVA 5BSHA 3GG2A 4FFOA 5B4VA 4J4HA 4KWHA 1S7CA 5IFLA 5K9ZA 1A7AA 1GPDG 4NI5A 3S1LA 5DCYA 1DBVO 3H2ZA 5AYVA 5JAZA 4H15A 1UP6A 3KM0A 4R5HA 2TMDA 2GN6A 3WFJA 4B79A 3CXRA 2C5EA 3WR5A 4NHEA 3WIDA 1XR3A 4LVCA 5ICSA 2EW2A 3WMXA 1DB3A 4DIOA 2FSSA 5KNLA 2WD7A 4BNWA 3W8DA 4CLXA 3E82A 3NV9A 4CQLA 3R6DA 3OH8A 1Z74A 2BMAA 3LT1A 4EUHA 2JD2A 4JJIA 2O7SA 4F3YA 1XU7A 5FF9A 1GEGA 3HADA 2HU2A 2GN4A 1UP4A 3EVNA 4D46A 1ZKMA 1NTOA 3GGOA 4KP7A 5KJFA 2EV9A 2O48X 4BNTA 1DRVA 2BD0A 3HSKA 3H5RA 4R3WA 4ZQGA 5BT9A 1PQUA 5IN4A 2ILTA 4FW8A 2C82A 3I3OA 3RCBA 3GDOA 5H82A 3WGTA 5FWNA 1N7HA 1EFKA 1U1IA 3GNSA 3LK7A 4Z3DA 1KC1A 1DIGA 1PJQA 1E7SA 1Z7EA 3FNHA 4NBTA 4XKJA 5COQA 3ZU2A 4PLYA 3FNEA 5ER9A 1Q7GA 2Q49A 3JQ7B 4BNMA 3A28A 2CSUA 4IMRA 2GASA 4OM8A 1U5CA 2QQ5A 4HFRA 4RVDA 3FTNA 2PKQP 5IG2A 4CR8A 3MOIA 2Q50A 2J3JA 2YZ7A 3ANMA 5L4SA 2WE7A 3LF2A 4DBVO 1HRDA 1YOVA 3GK3A 1X13A 4P4GA 2AMFA 3PK0A 5C7IO 3EGOA 1SOWA 1PQWA 5IDYA 3E03A 4TRNA 2VYVD 4NPCA 4OAQA 3NJ8A 4LGVA 5BR7A 3D5QA 1J5PA 1DSSG 2VOEA 3HE3A 4XYMA 5LC1A 1LSOA 1EQUA 4ZVVA 1UAGA 4GMGA 2HDHA 2PV7A 4L4RA 1QV7A 1UXIA 2D0IA 4RF2A 1R6DA 3VOSA 4BO1A 4W9NA 2Q1SA 1ZIDA 2UYYA 3JTMA 5MDHA 1ZVMA 2Y1GA 3DBRA 1QP8A 2XXBA 1QKIA 1Y7TA 3QHAA 1JKFA 3KYCB 3HFGA 1HLDA 4YB8A 3G0OA 1YJ8A 3PFWO 3OP4A 2OOSA 4HX5A 4UUPA 4Q3EA 4QQRA 3GUYA 2HRBA 2HQ1A 3KSDO 3P7MA 1E7WA 2Y1CA 1XG5A 2Z5LA 4X54A 1U2DA 4BGIA 3IKTA 1Q0LA 3ZN2A 1PSDA 4EEXA 2IYPA 5DBIA 1JDJA 3KYCA 5KVVA 3MJTA 1EEHA 2VHWA 3RUAA 2B4QA 4PLGA 1EUZA 1QLHA 3ZW8A 4KZPA 4ESOA 2DPHA 2O3SA 3U4IA 1WDMA 1P9LA 1K3TA 3WIEA 4CPDA 5DBGA 3QVXA 4EZBA 5CEEA 4BNYA 1M75A 1ISJA 4DRYA 3WG9A 3COSA 1BSVA 3DZBA 2C07A 3EZLA 4M1QA 3ADPA 5EMHA 1R12A 4B7UA 5G0SA 3ZHZA 2BGMA 4G5HA 5TT0A 6LDHA 1I2CA 4LK3A 5DP2A 4Z9FA 4PLTA 1JAXA 4RPKA 5CDSA 2DVMA 2PNFA 4BQPA 3ONDA 1LXCA 3GG9A 3WQRA 4XB2A 3V1YA 3JQAA 2P2SA 2D4AA 5G0UA 1RM4A 2JHFA 4E2XA 1TA4A 1GU7A 3WSVA 2PH5A 4UREA 1YL6A 4YQZA 5C3MA 5DNAA 3AW9A 1CDOA 1HZJA 3G1UA 2DTDA 4CM8A 2P5UA 1D7OA 2Q1UA 2UV8A 1C1DA 2B69A 4TVOA 2IDZA 3JYNA 4BMVA 1MXFA 3PTZA 1ADBA 1EDZA 3H5NA 3RBZA 5IDQA 3LU1A 4EGFA 1YB1A 3KTDA 3EY4A 3MJEA 3RBXA 1I8TA 4ILKA 3S2GA 4C7KA 2H1SA 5JY1A 4BV8A 2DLDA 4RGBA 5K0ZA 1G0NA 1A5ZA 1LLUA 4J2HA 4R54A 2P91A 2VWHA 3HQ4O 3ST7A 4XIJA 2NU7A 5T67A 1EVIA 4ZA2A 3GVHA 4JX8A 4DMMA 5JFOA 3UH1A 1DFGA 1KBZA 2ZK7A 3PDUA 1GTMA 4ND2A 2PA3A 4HNHA 4NJMA 1JAYA 1G0OA 4BNUA 4M86A 1F17A 4AVYA 4WK6A 2NVWA 1C3VA 4L4XA 3VVBA 1XYGA 3TL3A 1H6DA 1VSVA 1F06A 3ROQA 1BXGB 3OIGA 5L9AA 2D59A 1E3SA 4Q3BA 5F5NA 4YAIA 1CQIA 4ALLA 1BWSA 3CSDA 3CEAA 1O95A 2PD3A 3KUXA 1NHGA 2GZ3A 2DBVO 4CL3A 1KERA 5DDIP 4I9UA 3PQEA 3LZ6A 3ZWVA 4A26A 5JMWA 2O4UX 5DCWA 1F8GA 5U4QA 1KVQA 2O50A 3P19A 3H5AA 1ORRA 1Z75A 4OL9A 4F46A 4YAGA 4R1SA 2YHIA 1SEVA 3MZ0A 3GVCA 1HSOA 1U28A 1UDCA 3ENKA 4ZD6A 4HV4A 3KHUA 1P0FA 3ZH2A 3WXBA 3JD4A 4RDHA 1Y8QA 1NQAO 4OHUA 3A4VA 1R0SA 4YT4A 2BKAA 4O59O 4J6FA 1K5HA 2WSBA 1NR1A 2V6BA 1U4SA 1V8BA 4AL4A 4AICA 4RCVA 3D5TA 1J4AA 1IB6A 2VHXA 4ND1A 3ROMA 5IAAA 2X0JA 3I5MA 4IDFA 1HZZA 2HSDA 3HN7A 4L4SA 4CMHA 4GI2A 3PYXA 1EK5A 4PVDA 4RVSA 4MVJM 8LDHA 1IULA 3OFSA 3WGYA 2X5OA 1PGOA 3A06A 4O5OA 2YFQA 4WNCA 1HKUA 2QZ9A 5JDIA 4AJIA 2BGLA 3E5RA 3NT4A 4IQ8A 4YYZA 2ZB4A 3RU7A 5JCJA 3ZWCA 1GCOA 1NWHA 5KWEA 4YVFA 3VPGA 4D45A 3I4CA 1VM6A 5JY6A 1I24A 4YRDA 1J6UA 1LNQA 1U2GA 3PYLA 2I67A 3GNQA 4MVJP 1SCUA 1I36A 2AA3A 4GSKA 2J3HA 3BAZA 4BNVA 3ZGYA 2I3GA 1V3TA 4GGOA 3KYDB 4KUHA 2FOIA 3FBGA 5ES3A 5A9SB 3RASA 2YV1A 1PL7A 1K6XA 5DOVA 1IZ0A 3RC9A 2A9FA 4J7XA 4OOEA 1ZH8A 5A02A 3E8XA 4XRGA 4CM7A 3UCEA 3T4XA 1PZFA 3QY9A 3SLGA 3VC7A 4BS9A 1VC2A 3DDNA 3QRWA 1ENZA 4B4WA 4A10A 1N92A 1Q0QA 3RC2A 2GN8A 2Y1OA 2EJWA 2G76A 1LX6A 3FWNA 5CFZA 2VHZA 1MP0A 1B8UA 5A9SA 5ENVA 1N8KA 1DC3A 4WEOA 1QR6A 1GQQA 4Q39A 3SEFA 3DZIA 1CYDA 4E5KA 3QSGA 4CR7A 2E4AA 1E6EA 1OC2A 3LC7O 1H9BA 3PHHA 3EAGA 4XYBA 5I7VA 1Y9AA 1LDYA 2NVUB 2JJYA 1E7QA 4GX2A 4LVUA 1E6UA 4WLFA 5TT1A 4CM9A 4EUEA 1ZSVA 1CJCA 5F5LA 1B16A 3C3XA 1JWBB 2EP5A 5EQDA 4DXHA 3D7LA 4WOKA 4D43A 5EN4A 4UUMA 4AJJA 2HK8A 3GDGA 3DEYX 1I2ZA 3OQBA 4B4UA 1ISIA 3PHJA 1P1RA 1TI7A 2DUUA 4D3SA 1CERA 2PK3A 2ET6A 2EP7A 3BMNB 3GOHA 4D79A 5C37A 2QW8A 2QX7A 5JPIA 2Y1EA 4DMLA 1ADFA 2OHXA 3ASUA 1NAIA 2NNLD 3AU9A 3PZBA 4RLHA 3RJ9A 2AQIA 1I3LA 5JAMA 3M1LA 4O63O 3U4CA 4RL6A 2X0NA 4W7HA 1PWXA 4KTVE 2PZLA 2OUIA 2X86A 3GAZA 1T24A 3ANNA 4II2A 2YW9A 4MVJF 2X9NA 4YBZA 4QO7A 1PS8A 4E31A 4OQYA 3GQVA 4KUEA 3AY6A 1WVGA 5AXCA 5A3VA 1I30A 1E3EA 3R1IA 1K89A 1FJHA 2NSDA 4R1TA 3ZWAA 1A71A 4PLHA 4TKLA 4GMFA 1U4OA 3D0OA 3BHMA 5KCZA 5IXSA 1TXGA 2FMUA 4E2ZA 3C1OA 2HLPA 1NXQA 3IUSA 1R0LA 3JQAD 3LLVA 4DIBA 3F1LA 4PG6A 3L4BC 4RPLA 1DJQA 5EERA 3KYBA 3FF4A 2C29D 4MIEA 2J3IA 3UCXA 1I32A 1E0DA 4P8RA 5G4KB 5CG2A 3GRKA 3Q3CA 1EE2A 1HYHA 4J16A 1NM5A 3G3EA 2FP4A 3ADOA 3ROPA 3WDSA 2VCYA 1SBYA 2ZATA 3FI9A 3K9QO 3S2EA 1ADGA 4ND4A 2PGJA 4WLVA 1LEHA 3Q11A 1HL3A 3ZWYA 1UR5A 4GWKA 1X0XA 1NNUA 1NHWA 2XAAA 3OF2A 4D3DA 1T2AA 3EVTA 4BGVA 1MGOA 3ENNA 1I10A 3ITKA 4CUJA 1J49A 1BHSA 1ZCJA 4YACA 4IDGA 3I6QA 3UFXA 3KBOA 3OQ1A 1I3KA 2VHVA 4XGIA 5IDWA 2X9GA 4IJKA 3QWBA 3PDJA 4GKBA 1BMDA 2HAEA 3A9WA 3HDJA 4EJ0A 4FGSA 3MTJA 4U7WA 2UUPA 2NU8A 2BI8A 3Q0EA 1OOEA 4J91A 3RC7A 4EJ6A 3WLFA 1UZMA 3QIVA 2VZ0A 2NLOA 3B1FA 1CWUA 2J5RA 3WBBA 3DTTA 1M67A 1IZ9A 1H5QA 2VZ8A 1XLTA 3TF5A 2YV3A 1QRRA 4W6ZA 1H6CA 3A14A 4LN1A 2EWMA 4PG4A 1GQ2A 3O9ZA 1AXGA 3CIFA 4BGEA 1UXKA 4P38A 5TC4A 3PLRA 3ZU4A 3V2GA 2Q1WA 4RZHA 2EGHA 3O38A 4YT2A 1G1AA 4JCOA 3PJFA 2H9IA 1MG5A 2VUTA 4J7CA 2I6TA 2V6MA 4BO9A 1PX0A 1NFQA 4GX0A 3WFIA 2ZB7A 1C1XB 4GBJA 2HMWA 3NRCA 3IOYA 2BRUA 1XWFA 3KZVA 1P45A 3RQSA 4E2WA 1WZIA 4PG5A 2BLLA 3JYOA 3PIIA 1DLIA 1YB5A 2D5AA 2GO1A 4YJGB 3DO5A 3WGZA 1E3JA 3FHLA 3UF0A 3IL2A 1C1XA 4W4TA 3TZHA 3I6IA 4LW8A 4RO0A 2I65A 2HKIA 4DLLA 4TMFA 4BUCA 3O26A 2P68A 2PZJA 3FTPA 1YH3A 1EUCA 3LVFO 4GQAA 3B1KA 1O6ZA 4NU5A 5L53A 2FR1A 4CM4A 5A03A 5JCJD 5JAQA 1B8PA 2HUNA 3LYLA 4FC6A 1O5IA 4HFNA 4E21A 1M6WA 5JYDA 3JQCA 4JXKA 4M55A 4ZICA 2GNAA 1LLCA 2QYTA 4JQCA 4J1QA 2AQHA 3VDQA 4TZTA 2YFHA 4P4NA 1D4FA 4RQTA 5L7YA 1HEUA 1X7DA 3I9NA 4TQGA 3NEPX 4TWRA 4L9RA 2EEZA 2GSDA 4NJOA 5IZCC 1LTHR 3NYWA 3H9QA 4YEDA 3V1UA 2GN9A 5TF4A 1FDTA 2B4TO 1PU2A 3DB2A 2BFOA 2E48A 1F0YA 1P0CA 1GZ3A 1U3VA 2D3TA 4S3MA 2C20A 3UOGA 1J0XO 1QMGA 3FBTA 4BNGA 1EBFA 3AM4A 5CDTA 5DCUA 3QLJA 3L6EA 3DAFA 3V2UA 3ICPA 3ABIA 4AJOA 4AJLA 3HJAA 2PD4A 1AN9A 3QVSA 4L76A 3JQBC 1LDGA 4RPGA 1LDBA 3FR7A 1ULUA 2BFAA 1GAEO 1PJ2A 1EUDA 1L7EA 3BZUA 4ZGWA 1MUUA 3AOEC 1DHRA 4EI2A 3TFOA 4IDBA 1KEUA 1B2LA 4N5MA 5LCXA 2X4GA 4ALIA 2DQ4A 4B4OA 1S6YA 2P9CA 1LDMA 1WDKA 2W4QA 2NADA 2RIRA 1X7HA 4CM9D 3QVTA 3O8QB 1YBVA 4XRRA 9LDTA 4IUYA 5I9NA 4KDFA 4B8WA 1FDSA 4GLLA 3N58A 3AI3A 5TJ9A 3MOGA 1HE5A 1NR7A 1OC4A 1Y1PA 2HK7A 1HDZA 2R2GA 3CMCO 2ZKLA 3DL2A 4IS3A 5HBRA 3KO8A 5COBA 3OJFA 3DOOA 4PZDA 2Y0EA 3VH2A 3NTOA 2VN8A 3C24A 3GMSA 2R00C 4CM6A 3O8QA 3IMFA 3WGHA 2PZKA 1SAYA 3RFTA 1BVUA 3TJRA 4QECA 3OJ0A 4J90A 5TQVA 1DO8A 2XXJA 4FBGA 3M1AA 4JBGA 4MVJA 2HMSA 3F47A 1PIWA 2YDYA 3RJ5A 2DTXA 3UGKA 1B3BA 1Y8RB 3C7AA 7MDHA 4QFCA 3AOGA 1OZAA 1E3LA 3JQGB 4MPDA 3N7UA 1YS4A 3VAZA 2AG5A 4CQLB 3L77A 2VRCA 3WSWA 4BB5A 4WLUA 2Q99A 3DBHB 5T57A 1HDCA 1Y81A 3GDFA 4U5QA 3GMDA 3AUUA 4AJNA 3DZHA 5JO9A 1DC6A 2IXAA 2HMVA 3EHEA 1Y8RA 3V8BA 1XDWA 1I3NA 2DBQA 4YAJA 1IOLA 3JQGA 1H2HA 1GUFA 3QWAA 2G5CA 2WYWA 2ZQZA 2VYNA 3TZCA 3WX0A 3DBHA 3LT2A 2FPGA 3IUPA 3A1NA 3I83A 2ZCVA 4H16A 2PLAA 1I0ZA 1WAMA 4Y67A 5KOIA 2NTJA 1M66A 3T4EA 1QYCA 3NDJA 1PJ3A 4BNIA 3GFGA 3Q9NA 4E6PA 4RV9A 5EJ2A 4II3A 5EINA 1H0KA 3EK2A 3UXYA 1SB9A 2RH8A 4A0SA 2OBYA 1KVTA 4EUFA 3DBVO 1ONPA 1YOVB 3UCFA 4BNFA 4WLEA 4MKRA 2VT2A 2J6IA 1U3TA 4I5GA 4YAEA 5HS4A 4A2CA 1R4MB 2CVQA 3HB4X 3RUFA 3HNPA 4Z6KA 1TEHA 3GR6A 4O6VA 4BO0A 4DVJA 5L40A 1G6KA 1ISHA 2VWPA 4FOSA 2Y1DA 4XR4A 4XJSA 3W6ZA 5THKA 3LF1A 5KKAA 4KWIA 1H6AA 3DBRB 1AUPA 4JP2A 2ZJ1A 4MVJG 4LCEA 3VZQA 3I4FA 1Z73A 3M6IA 4MDHA 1DIHA 1R4MA 4RVFA 1EFLA 3ETGA 2UDPA 1ZK1A 3IJRA 3VH4A 2VUUA 2YUTA 3VPXA 5CHEA 1Y5MA 2OGUA 1BW9B 2P4HX 3EMKA 4D44A 2P5YA 2YYYA 3WMWA 2O3RA 1Q2XA 3GEDA 3OETA 4E12A 4XYGA 4R16A 2C0CA 1HE3A 3AI1A 3GNTA 4GPD1 4DC0A 4FD3A 4PG7A 3VPHA 4E3ZA 1OAAA 2G1UA 4QT0A 3DHNA 4XDYA 1M2WA 3OA0A 1BVRA 3PHGA 2POQX 4BNLA 4J9VA 1BW9A 2EKPA 1MLDA 4BNXA 2DM6A 4U0JA 4I5EA 4UVHA 2H63A 1MV8A 5FEUA 3ZWWA 4AJPA 1MB4A 4OIMA 2ZTVA 3GEMA 2GF2A 1ZSYA 4BNNA 2OXIA 5HTOA 5F1PA 1R4NA 1SPXA 4CQMB 5EPOA 4XDZA 1QORA 2CMDA 2PFGA 3DFUA 4MKXA 4EYEA 3ULKA 1LRKA 5HM8A 1BXKA 5ILGA 4UUNA 3BXXA 3KEQA 4XYEA 3JQAB 1FDVA 3RU9A 4DL9A 4IJUA 3FWZA 4XB1A 1U8FO 2AEJA 4CV2A 1UJMA 1RPNA 4XX0A 3IS3A 3ZV6A 4LISA 3ZWMA 2XPCA 5A1TA 4CQMA 1R16A 4WPGA 4CM8B 5COAA 1ZMOA 2Y0CA 3LT0A 1C1DB 2WEKA 2B36A 5TS3A 2EHDA 1PGQA 3L4BA 3TOXA 4E30A 2YV2A 2Q4BA 3WYEA 2PR2A 1U3UA 3PHIA 4KDEA 2HJSA 4IQGA 1DC4A 1JW9B 2B0JA 3OICA 1NP3A 2X6TA 4CMCA 5JSFA 1PR9A 2PH3A 2NU6A 4G81A 4J0FA 4MVJE 4YDRA 5I8ZA 1TLTA 2ZTLA 1IPFA 4R51A 4ZHSA 3RUCA 3HWRA 1CIVA 1XU9A 3WYBA 3E18A 5I9MA 1W73A 4ZJUA 4TSKA 2O7QA 4NJMB 3UVEA 4YJDA 3SX2A 1YL5A 3CZMA 2QRJA 3QWIA 2LDXA 4OYRA 5IN5A 1Y6JA 3IKVA 4NH4A 1ONNA 3F1KA 5IXYA 5IZ4A 2EJVA 4Y9DA 1ENOA 1P44A 3OIDA 4LRTB 1JWAB 3LSYA 5GY7A 2PZMA 1UP7A 3M2PA 3D3EA 1PWZA 4FCCA 2AXQA 3Q6IA 4MO2A 1IPEA 1JN0A 2WTBA 4HKTA 3U49A 4XJTA 2X1HA 4OSOA 3H7AA 4XR9A 2PKQO 1HYGA 5L51A 1KVSA 4IDEA 2Q4EA 3W4IA 2YHIB 4QFDA 3ETEA 4BGUA 4CMKA 4CMEC 3BTSA 3K2BA 4CV1A 3B1JA 3Q2IA 3ETDA 3F9IA 1Y8QB 1BDBA 1Z7BA 3LC1O 1O89A 1YWGO 1GR0A 5KVCA 3GY0A 1B15A 5L7WA 4CJXA 3UUWA 1DAPA 3DZGA 3NTQA 1L1FA 3I9KA 4MVJD 4Y6RA 4BL5A 3I9MA 4XGKA 4ZQFA 3EZYA 4JNKA 3AUTA 1PGJA 4H7PA 3K92A 5DULA 4PLVA 3ZU3A 1ZUD1 4FFPA 2AEFA 4BQRA 2VHYA 1UUFA 2JD0A 3RUDA 4UULA 2JFHA 3KRTA 5DOZA 3UKOA 3ZHBA 4A5OA 4FJ2A 3TZQA 5AQ1A 4FDAA 1YBMA 2YJZA 3DHYA 5JYEA 1RJWA 2FWMX 2H6EA 1VRWA 2GYYA 1BXZA 4J1SA 2CVOA 1KEPA 2CVZA 2ZCUA 1ZXBA 1VE9A 3WICA 2BGKA 2WYVA 3DR3A 3IP1A 3UICA 1DJNA 3LQFA 2VYND 4EEZA 1D3AA 4NFYA 3PJEA 4JP3A 2VRBA 4IS2A 2Q3EA 3GEGA 3WQQA 3AUSA 2WE8A 2X23A 1ZBQA 3L9WA 1ZK4A 1ZMTA 4OMUA 5KTKA 1HSZA 1UAYA 4FB5A 5IZCA 3G1TA 3U4HA 3B6ZA 1NQOA 5JC8A 4HXYA 4J2OA 3IAHA 2Q2WA 1FK8A 4F6CA 3MJVA 3V1TC 4R4JA 1B3RA 1JTVA 1RYEA 2GERA 1WLYA 3V5NA 4LSWA 4Q3DA 3NJ4A 3RWBA 4AJ2A 1P77A 2C7VA 4XCVA 3NGXA 3LDHA 4FR5A 3D1LA 3L4SO 4JJFA 5TNXA 2PGLA 3JQBA 2Y99A 4BKUA 3L07A 5CDGA 4IBOA 2EW8A 3BYZA 5BNTA 5AOVA 2IODA 3HDQA 1TVEA 1GEEA 3IJPA 1YKFA 4PLPA 3HHPA 1DLJA 5KKCA 3PLNA 1JKIA 3AOEA 4YTEA 3DTYA 4WKGA 5DBFA 4IXTA 3VZSA 3KSZO 4RVHA 7ADHA 3R0IA 4DLAA 1H6BA 2XOXA 3C7DB 3Q1LA 1YDEA 2PWZA 3EUWA 4WEQA 1KETA 3GT0A 4YQYA 1E92A 1LI4A 4MP8A 1T2CA 4J43A 2W2LA 4U6SA 4N5NA 3PRJA 1UXHA 2EF1A 2B35A 2OORA 5CDUA 4KTTE 5U1PA 5BSEA 4A03A 4PIVA 3FR8A 4DQXA 5JAIA 2X0RA 3TFQA 3JQDA 2E6UX 2JCYA 4UEJA 3FN4A 2IRWA 4OXYA 5I7EA 5I8WA 1DIRA 2JFGA 3DAPA 1GFSA 2VWQA 1ADCA 1GY8A 2NQTA 2R00A 5BSGA 1GV1A 4JIGA 4CMIA 2OL4A 3PZRA 1A9YA 2VUSA 2YDXA 1ZJZA 3K5PA 4A7PA 1RWBA 4WCFC 3GA0A 3K73O 3ZWOA 1MXHA 4BO8A 1NVMB 2G17A 4MIOA 2O3JA 2DTEA 4WNIA 5KJEA 4NFSA 1E5LA 1YRLA 2GZ1A 5FFFA 5TSDA 4C4OA 4B3HA 5A5EA 2QHXA 3WNQA 1NWCA 3DQPA 1JVSA 3IDSA 3PQFA 4ROSA 2NACA 2P4QA 3WQSB 1R37A 3EC7A 5AXDA 5F21A 5H81A 4CQMD 4IIUA 3PI7A 4HP8A 3FD8A 3JSAA 4ID9A 1O9BA 2TMGA 2ZTUA 4NDNE 5TJHA 2ZYDA 2C59A 1WW8A 2D1YA 3W1VA 4L75A 4D42A 1P1KA 3H9UA 3D64A 1DFHA 1AHHA 1N1GA 1X15A 3MJCA 5G4LA 5B12A 3C1AA 1AHIA 4KQXA 1PTJA 3OECA 1FMCA 3ZHXA 4AFNA 3TQHA 2ZYAA 3NUGA 1BRMA 3WWYA 1LQTA 4DQUA 2DAPA 5HWSA 3VKUA 3PJGA 3OHSX 2GPTA 1WP4A 4E13A 4IM7A 3U4DA 3AY7A 2DC1A 3DC2A 4LMPA 2HMTA 4YR9A 5EL0A 4PN3A 4YJHB 1XEAA 3H9EO 2Y66A 1DEHA 4B3JA 3JD1A 1D1SA 4GWGA 1JA9A 1FXSA 1HE4A 1HXHA 3H6KA 1XSEA 4NBVA 5T8KC 4CV0A 3HG7A 2QZZA 3O03A 5HA5A 4MJLA 2W98A 1EDOA 3DFZA 4LMRA 5JC1A 1HE2A 3SC6A 3SVTA 1QLJA 4J4TA 3ZDFA 1XKQA 4PLFA 2VQ3A 1XA0A 3VHRA 3SJUA 4YJHA 4IY1A 3SJ7A 5KVSA 3DZKA 3KOUA 2E49A 1DIBA 1P74A 3QP9A 1O94A 3X2FA 4IMPA 2OBNA 4R69A 5HS6A 3ZWXA 1H2BA 2O23A 3LC2O 3F4LA 2X58A 1VJTA 4CODB 3RVDA 3QV1A 3L9XA 4NQZA 1I5RA 1SO8A 2WD8A 5LDHA 3U9LA 5I9LA 1LRJA 1CF2O 4M54A 1GPJA 4CUZA 4RDIA 4AJKA 2FPIA 4ZQEA 4DYVA 2HRZA 2IEBA 4XQCA 5JLAA 3ZV4A 3KLMX 5L4NA 1HT0A 1V6AA 1SNYA 2C7GA 4FN4A 4HY3A 2B37A 2I3AA 2WDZA 3E9NA 4XGNA 4GSLA 1Z6ZA 3FRJA 2CUKA 5DP1A 2AG8A 1V35A 4TZKA 4BIIA 3ITDA 1HETA 1YO6A 1K0UA 3GPIA 4JBIA 4CL8A 4R1UA 4BO3A 3EW7A 3RFVA 4BO5A 1ONOA 4CM4B 4W99A 3PGJA 3RIHA 4HFJA 4BHTA 3ASVA 5C5IA 1ZXLA 3H3FA 4ND5A 3TN7A 1YGYA 3R3JA 1P31A 4GL4A 3ZWBA 3FPCA 4YA6A 4YRAA 1BGVA 2Y68A 4HWKA 3WWZA 3PPIA 1Q0HA 4NIMA 1ISMA 5CG1A 3I1JA 1NX6A 4DA9A 3PYMA 2DT5A 3RD5A 2DKNA 1NYTA 1F8FA 4K6CA 3GC6A 4DC1A 1LLDA 1V9LA 3QVWA 3RAJA 4Y8VA 4NZ9A 1IL0A 4CMAA 4GVXA 2V6GA 1Q1NA 4N54A 4IGEA 1AE1A 3N74A 1FF9A 1MG0A 4XWYA 2OFPA 2GR9A 2VTEA 4J1TA 4FS3A 1YVEI 4B8ZA 1JVBA 4C7JA 4N18A 3GFBA 4CLEA 3OQ6A 3V2HA 1I2BA 2V7PA 1FDWA 1RM5A 1VL6A 3PEFA 4ZQHA 1MFPA 2RBEA 4G2NA 3WJAA 3BTOA 3K8ZA 3NDRA 2LDBA 1EMDA 1B0AA 3BMCA 4H3VA 1LJ8A 3IQDB 1JQBA 3JQ8B 1JKJA 1PJ4A 4IXWA 5CAEA 1MA0A 3CH6A 4J3FA 1ID1A 4EDFA 2SCUA 5L45A 3JV7A 1ZFNA 3DWFA 3JQEA 2B4RO 2BELA 5JO0A 1HDYA 1WNTA 1E6WA 2AEMA 4YPOA 3TSCA 4BOYA 1DRWA 3I9LA 3HB5X 1B14A 3E1KA 3JQ8A 3RI3A 1N9GB 1JU9A 3GF4A 3INRA 3DZJA 3WLEA 4LSMA 1C0LA 4B7XA 4GAEA 2IEDA 4NR0A 5AVOA 3IP3A 4PGFA 3X2EA 2EG9A 1ENYA 5ITWA 3W8FA 1WDLA 2QRLA 3JD0A 4NBRA 2BFPA 4NFHA 3OEWA 2I99A 2NV6A 3S2FA 2BHLA 2W2LD 3ROKA 1QXSA 5CDYA 1LLQA 1RM0A 4PVCA 1T2FA 2AQ8A 4HUJA 4OH1A 1MC4A 1N9GA 4JGBA 4CMEA 5JXWA 1XQ1A 2WWRA 3JYLA 3OJLA 3KB6A 1Q7BA 4AJ1A 1DPGA 3WNVA 4YCAA 2H5LA 4BNZA 3H65A 1CEQA 3TRIA 1WMAA 4GGPA 1UXGA 5K6AC 4UVIA 4OJNA 2JD1A 2B83A 3W4KA 5U9CA 2YHUA 4ALKA 2C54A 3T7EA 1EBUA 2HO5A 4NNJA 1PJBA 4PLWA 3WGIA 1X1EA 3UAGA 3KLPX 1XGKA 3JQ9C 1GD1O 4NK4A 4CUKA 4ONEA 4W7IA 3GLQA 3QE3A 4UVGA 1DIAA 3E5MA 2VWGA 1NAHA 4IJVA 3GGGA 5THQA 4BKPA 4DQVA 4PG8A 1P1IA 1R66A 1X0VA 3IC5A 4GX1A 3ZNOA 4F6LA 1XQ6A 4YXFA 4M87A 5CPFA 4E0BA 2C2XA 5ADHA 2I66A 1P1JA 2PY6A 1R15A 5G0WA 3WBFA 3FNGA 1PR3A 3F5QA 4QTZA 3ZNQA 1T1SA 2JAPA 4E32A 3PP8A 3TL2A 1CETA 2JCVA 1T2DA 5BNIA 3CMMA 1NFRA 3QJ5A 4D41A 5JDCC 5CEFA 2Z1MA 2OP1A 4EW6A 3NGLA 5G2OA 2DFVA 3TNLA 1DC5A 1B7GO 3RSHA 3L0DA 1I3MA 4WUVA 3W8EA 2P9GA 3TZ6A 2EXXA 1WXDA 3DONA 4TRMA 3NT2A 3SC4A 1ULSA 2I76A 2PTGA 1I33A 2OMEA 4UEOA 1UZNA 2ZB8A 1W4ZA 5GMOA 3C85A 4QXMA 3HN2A 1A9ZA 1K2WA 3H3JA 4FFMA 4JLWA 3E9MA 4UUOA 4CLOA 3TOZA 1W6UA 1ZK2A 5JE8A 3F4BA 3LLSA 1W8DA 5F1OA 1KYQA 3K2EA 4OKIA 1BTOA 1IHXA 2XF8A 4P22A 3K31A 1QYDA 2X0IA 1KS9A 3P2YA 5FI5A 1GYQA 3DMTC 3INGA 1A27A 1DOHA 1E7RA 4JJGA 4OSPA 3JYQA 2Y93A 1Y5RA 3RUEA 4TRJA 3FSRA 3K6JA 3L6DA 4AG3A 1VL8A 3ZU5A 5ENDA 1MX3A 1PJLA 2OZPA 2OP0A 3PWZA 1F12A 5G0VA 4K6FA 1NPDA 8ADHA 1PJSA 4MVJH 5TLSA 3KVOA 4GVLA 5T6BA 3OEYA 3VVCA 4ZRMA 4IZIA 1P3DA 3SLKA 1IY8A 2B5WA 3GVPA 1A7KA 2FR8A 1E1LA 2J3KA 3GGPA 1U8XX 3U5TA 1ENPA 5KIAA 4DBZA 3NT5A 5DZSA 2GDZA 2DUWA 2P9EA 1M6HA 4NU6A 5ER6A 1PZEA 4CMBA 4DYDA 3DBLB 2X8LA 4WCFB 4Z3KA 1VPDA 3F46A 2D5CA 3L6OO 2G82A 1R4NB 1VI2A 3JQ7A 1U5AA 3HZZA 4ZQBA 3RBVA 4D3FA 3KETA 3D4PA 1WMBA 3E9QA 2NUAA 2FY8A 3KV3O 5TGDA 4DPMA 2A35A 3I9OA 4J7UA 1QYWA 3RC1A 1GL3A 2D2IA 4M49A 4QUKA 4QO8A 4JK3A 2O2SA 2IE0A 1P1FA 5JS6A 4EITA 5C7LO 1LU9A 1WZEA 3FNFA 4XQ9A 4JN6B 3DBLA 4G65A 4BV9A 4WCFA 2Q45A 4OQZA 2A4KA 3W6UA 4WLNA 2NQ8A 1GYRA 2W8ZA 3GHYA 2FR0A
chains in the Genus database with same CATH superfamily
2L2QA 3B5EA 2PX4A 1N3LA 1XEXB 1X38A 2ETVA 3HBJA 3QEKA 2RHCA 3CE6A 1U9JA 2I3BA 1FQJA 2VTDA 1F2VA 3CJRA 4X3OA 3T7CA 4C0QC 5LQDA 7ABPA 1P4AA 2HV9A 2NU9A 4OEHA 5MHTA 3KYIB 3JWJA 4Q9IA 4N41A 3U0BA 1WX1A 1L9XA 2JDIA 4D26A 2A9RA 3M7IA 1WRBA 1UMBA 5J3JA 1BH6A 4PO9A 4RTMA 1DG1G 4Z9BA 3GJYA 3I39X 3PSAA 2X40A 4AZVA 3PX7A 1C9DB 5M2QA 4HXEB 1JR4A 3QEMA 1NXPA 2CDCA 5CLIA 1B76A 3TWOA 2OENG 4CLDA 1Z56C 4IILA 4DR2B 2E7ZA 2PO7A 4KLRA 4D4GA 1V7QA 4QEDA 2JGKA 3ZDRA 4OI0A 5HF8A 4YHBA 4ZYLA 3V4RA 5IVKA 3DZFA 2LWIA 3KBBA 4MQFB 4OI2A 3WJ2A 3GVXA 1IVSA 5BV8A 3QXSA 4BCDA 3ZUPA 4QULA 5B1SA 3IP6A 3WS7A 4IDAA 2L19A 1H3FA 3AHHA 5A9TA 2AQKA 3SPXA 1YZYA 1C41A 2EBWA 3ANTA 4Q3LA 4AQDA 1H9CA 3EGEA 1YB4A 1AGXA 3W2HA 5GONA 3PPYA 5TXGA 4B3MB 2GCOA 1MMFB 5ICMA 2VF2A 4FMCB 1OSNA 3VC3A 5H83A 3QEJA 5I7SA 3DLHA 5L4LA 4EB0A 3BERA 2JCXA 2JEZA 2W2QA 1L5NA 1Z4IA 3TNDA 3BXZA 3VDRA 2UUOA 3TGPA 3W7VA 1ZD4A 2OVFA 1GAXA 1KFBB 2QI9C 2BMWA 2Y76A 3WL8A 4XD2A 5TMDA 2QVYX 3MS2A 1WWKA 1YB2A 2QV7A 2ZR0A 4RGQA 2CKMA 4A0QA 1PFKA 2FN7A 4R2IA 3WKCA 4QE3A 3GROA 3MUEA 3O9VA 4JB8A 1IOVA 4IHAA 5T8KA 1GJRA 2AX4A 4JH0A 3ROTA 1F20A 2QV0A 4MMZB 3BGWA 4H4CA 5CDFE 2WZBA 4KLZA 3NHLA 2OYCA 1HF3A 4ALMA 5HQTA 2VA8A 3VOBA 1KJIA 4XQ0A 2HPZA 4BJ6A 2C4HA 3LQKA 1KOLA 5FCDA 3TSZA 3UWPA 3F5MA 1WPQA 4IHJA 2QIOA 4EMTA 4WE3A 1DGQA 3V46A 4P4LA 1ESZA 2QUHA 3FG9A 1MTOA 4E5YA 2QLBA 1V16A 3QW4B 2PPLA 2Y0DA 3IBSA 4FFRA 4UVDA 5HCNA 3SQDA 3OQMA 2CXRA 2PX0A 2OV8A 3HM9A 2WDPA 5BW8A 4CU2A 2BL4A 1R0KA 4XWWA 4FYHA 3K15A 2HWWA 1GNLA 2HWUA 3UT5B 3W79A 3AWIA 4IZHA 4LNUA 2WWGA 3PQ7A 2V6FA 2UVQA 4XQGA 2VDMB 3ZDQA 4BPRA 2CUNA 4HHEA 2IP2A 4BTEA 1DWUA 3TEJA 1QIFA 4POAA 2YVKA 1KI6A 1TD1A 4F3NA 3QWFA 3OTHA 3IFSA 3CYFA 2E1PA 2FLWA 1AQIA 5IABA 2CMKA 1QYVA 2JFQA 3N6RA 4MOWA 4WT7A 4JBXA 3WOHA 3P9XA 1ARZA 2W4IA 4I81A 4IMIB 2BGWA 1FTSA 1ZZEA 4RZIA 3UJNA 2VDKB 1J8MF 1YE3A 1YQGA 5C8YB 3INTA 2W0MA 2REQA 2Z95A 3KQWA 1SZJG 3K2QA 4PC2A 5KAPA 4C3VA 1K63A 3BRCA 4I7EA 4L85A 1PL6A 2VTBA 2WJZB 3ACDA 3AHIA 1S2OA 4OQEA 1TJYA 4U2KA 1KYZA 1F14A 2CYCA 3RSQA 1G66A 4BE9A 3DJFA 3VZRA 4AB1A 5AVSA 2VRCD 3LLUA 4YYEA 2ZWPA 3HO1A 1PHPA 3GYBA 3H83A 5C8ZA 4ZT4A 1ORWA 3DDCA 4Q3AA 4AZSA 3IV6A 3H4IA 5E4FA 1JFVA 2C9MA 3CRVA 3BDVA 3HR7A 3K09A 3MYRA 3OIFA 3E48A 2QT9A 2VDLB 1XZFA 1QB7A 1UK8A 1EVJA 1TU0A 2WR8A 5E6RB 5FWDA 3OJEA 4JBNA 3AUYA 1QOZA 4DUGA 4ER6A 5K8JB 4RW0A 4LDQA 3PRKE 5KHOC 4UBJA 4DZRA 2OGTA 4KQ1A 3VO2A 4ZN6A 4RD3A 3M34A 4PN7A 4QU5A 2MSDB 4UHKA 3UGTA 1B73A 5JFTA 4BO7A 2WIJA 1YONA 2ZTHA 4X90A 4K28A 1U9IC 5FPKA 5F3RA 4JJ8A 3ZVRA 2ZAMA 4FIZA 1KH2A 4U2BA 5EHNA 5L3ZA 1OH7A 3K5WA 1VE1A 5B30A 1FU7A 2GILA 3CWCA 2HV8A 4XX1A 4L8GA 2ECOA 4KIUA 2GCIA 2FZ4A 2ZE6A 2HGZA 2OBFA 2HJRA 3WLTA 2WYIA 3UMSA 1V0JA 2CXTA 4H6XA 2P2GA 1IAQA 1YQXA 3I0ZA 2NGRA 2YBEA 2UZIR 4ZVLA 2YJ3A 3LJKA 2GA8A 1ISGA 4AROA 1D8AA 2XD4A 2QMQA 3CB2A 3D7MA 4ALNA 2XCQA 4PHHA 5AW9A 2ERXA 3L1VA 3OFJA 3H11A 2I1QA 1Z5UA 2GEKA 4OP2A 3UV3A 3A3PA 3VPSA 3LNTA 5DW0A 3GN2A 3JAKA 3FRHA 4DNXA 4EI8A 5GJVC 3RG8A 3NVAA 1A5AB 4PPQA 3T5AA 3NALA 3I34X 1LUAA 3OFNA 5EIOA 5EWJA 1V3VA 3HKDA 3CVJA 1M6NA 1G5TA 2BCEA 4PNZA 4Q9NA 3EPJA 4YJFA 2A0KA 3N0TA 4Z2YA 1TRHA 5TQJA 3UN1A 4B5KA 1QHNA 1A04A 3DMYA 1GTJ1 1WQ4A 3EIFA 4A73A 4DM4A 3EXIB 3M70A 4M3NA 1YVPA 3ICCA 1IJEA 2CZCA 1AKTA 3JASA 3ZNPA 4NXMB 4GLOA 4DPLA 2W43A 2ZUTA 2EDAA 2PJUA 2E82A 4RF4A 2RGGA 4LRYA 5HEKA 1XO1A 5L95A 1FEZA 2GEFA 3GRZA 4GMHA 4M9XA 5C7OO 5FV4A 4Y6SA 1SVNA 4HI0E 4C9BA 4F1WA 1GQYA 1Z6XA 3G8DA 3HJUA 1E2IA 3OZBA 3JYPA 4I3GA 2ZB3A 3P0HA 1UDBA 3ORFA 2G4VA 2I29A 1XZQA 1TUBB 1W35A 4QGGA 2VBGA 3R5TA 4DCUA 4PTLA 1MT3A 3NXKA 4JI0B 1Y3FE 2O3QA 5A04A 2NM0A 8ABPA 4OA8A 1YR7A 2PUEA 3RSFA 4PGGA 1SVMA 5EESA 5H68A 2IQ5A 2WHEA 2O8BA 1L5MA 3M5WA 1P2SA 3PX2A 2FZLA 1S3IA 3CUSA 5AVKA 2P41A 3TEMA 4YUWA 4RA9B 1LSJA 1CB7A 1DBPA 1C50A 4M98A 1KGDA 3BXPA 1Y1RA 1GCUA 2BI7A 3ZE0B 1FP2A 4RABA 2EKQA 1NBIA 2R6AA 1THMA 1V1MA 3K96A 4LRUA 3RSOA 4CZ2A 3QKSA 1GM5A 3OM0A 5BVHB 4UPVA 2XNHA 4MV0A 4BFSA 1VSUA 3NC1C 3KOWA 2YUIA 2I4IA 3D6MA 4NMHA 4W9NC 5JVDF 4IJMA 5JSQA 3P45A 4O1HA 1Z25A 2ZIGA 1WOYA 2JFYA 3LBNA 4X1KB 4U6NA 2NYUA 4C05A 4MWCA 4E5MA 2EX4A 2FSVA 3U09A 4U00A 1ZN8A 4QBKA 4D3ZA 3FA2A 2O2YA 1HYEA 2BGJA 2ODEA 3AHDA 3HDHA 2WM8A 4MRRA 1IBRA 2HMUA 5LZ7A 4P36A 5JANA 1SUPA 2JDID 4ESEA 4FYXA 3NUQA 3RO7A 1P29A 2XRZA 1M2KA 4Y6PA 3SE7A 1IEWA 5A5FA 4YT5A 4UXJA 1IYZA 1JHPA 4KMSA 3HB7A 2CEKA 4PO1A 1G63A 2XCSB 3FRIA 4MUAA 3EXEB 3MT7A 4UM9D 4PZ0A 4RYLA 2V5UA 3ZBUA 4EQZA 1PVOA 2Z57A 2VRNA 1BDJA 3T5PA 1YVUA 1N8NA 1P2VA 3T5MA 1QOPB 1UXJA 2XDYA 2D3WA 4WFIA 4NJEB 3TQRA 1Q7CA 1GGHA 5E4YA 3BMNA 1LBHA 1QANA 3KDPA 4Q7JB 3AT1A 4EHLA 2HADA 4FXOA 2PZEA 4IEIA 1N0HA 1NXOA 1UKVY 2BGTA 2RAFA 3VR3D 3G8BA 3UWOA 2CNWA 2RHDA 4CM1A 1C3OA 5AJUA 1QQ6A 6Q21A 3ZV5A 1RQ2A 3AEYA 1KOGA 1OAOA 4HX2A 4HVTA 4K6HA 3RS3A 2H7YA 4OBBA 4D57A 3FHTA 3RYTC 4MXDA 4X00A 1WXFA 2BHNA 1QSGA 3MTAA 1Z6AA 2IELA 4PYRA 5NULA 2IU0A 4EHHA 5JMTA 1U0JA 5EUBA 2P2CA 4O0MA 5A06A 2HCTA 1FY2A 2GCGA 3KJQA 3NTVA 3M0EA 3M2TA 1NUSA 4YWHA 4DREA 4JXXA 2O8DA 4BTLA 4A0FA 1NVKA 2PD6A 1WHTB 3BWMA 1TFUA 5AVYA 5F23A 4ZT2A 1XB2A 3K1TA 2IOFK 3LECA 4AIIA 1E3IA 2QSJA 1UFKA 1SZPA 1NONA 4FSHA 4KEAA 3V8VA 1QH1A 3VKVA 4PZPA 5IEJA 2R1TA 5IKEA 1DTSA 3KD2A 3L7YA 4HAXA 1OYYA 2ONYA 1WQ1R 3PNPA 4L5IA 3PXGA 3I9JA 4RFLA 1H69A 4DV0B 5EE3A 5CB0A 3F6PA 3NBQA 4BMNA 3C7CB 1RWVA 4D9KA 2X9QA 1GYPA 1CUDA 3L8GA 3EZNA 3EDMA 4IV8A 4X45A 3CKYA 3KUDA 1RBMA 1O6GA 4UAJA 5E1BA 5G0TA 4B0OA 1P81A 2BF7A 2DUNA 5G4KA 3NG1A 4WTOA 5CK5A 1XN4A 2RHRA 3B2EA 2QXTA 1I4LD 3W2EA 3HMQA 1UC4B 1HDRA 1NBAA 2LIPA 3TZBA 3H4MA 3HJTA 4TQUS 3AK4A 1VCHA 3CKLA 4P32A 3GN1A 1N5KA 4NDZA 5KYUB 1ODIA 3MPUA 4Z9XA 5DGTA 4KPGA 4X85A 2NNWB 6PFKA 1MAUA 1RCFA 1AGRA 2X9VA 5KYKA 1Y34E 1VXRA 4LRSB 1ZSNA 2MSKA 4EKEA 4JFAA 2PMEA 4JFRA 1KGSA 4BQFA 1WOMA 2ZAYA 2D5IA 3C87A 1UPXA 2WAOA 4FYMA 1Z83A 1KO5A 3QW2A 2CXSA 4Q48A 3W9BA 4B3FX 4WXPA 3DCYA 1CRQA 1H8HA 3MQFA 5FA8A 4BMSA 2NXCA 4LF7B 1HY3A 4MLPA 2NSHA 2YWEA 2IXEA 3QY0A 1AC5A 3TSWA 3O90A 1JEJA 5D1NA 1ZM4A 2LP4Y 4KV9A 1QX3A 2IW1A 1MT0A 3H2BA 1AXEA 4HB2A 3SS8A 5FOWA 2WD9A 4PR3A 1PNOA 4E5NA 2BH9A 5F33A 3TKLA 3H9JA 5BN5A 2CDAA 5JW6A 2HIMA 4BO6A 3A0UA 2DBRA 3F4KA 2QGZA 2RH5A 2R8OA 5CTAA 4WASA 1PEDA 1OFGA 3Q7EA 3PJDA 4GGMX 3GLIA 1Y9EA 1N3YA 4CLRA 5GAJA 3GJXC 4IDOA 1YGPA 4GI3A 3X1DA 3T1NA 4RTOA 3KQNA 5FXMA 2GUGA 5CVJA 2FV8A 2GM3A 2ZSUA 3FPSA 3MBIA 5ESRA 3ZZUA 3WXMA 4IIFA 4DUGD 1M1YB 5F78A 1T25A 5JEEA 1BEZA 2QRPA 1T9GR 1QPBA 3BSFA 4FT2A 3D4NA 4R9VA 5CLLA 3PEVA 3WOVA 3WRXA 3LZCA 2C4NA 4HDMB 1TTHA 2D74A 3SC2B 4DV5B 3G17A 4FUTA 3AFMA 3FGPA 3WJ7A 5IYZF 2OGSA 3K0FA 1P6QA 4IUCS 5CNMA 4CCAA 3D4BA 3OU2A 1T9GS 3CF6R 1REQA 5PNTA 2CXPA 3FCOA 2I9PA 2VSNA 3GVIA 1QP0A 1KMNA 4HFMA 2QPLA 2EFYA 2GXSA 2R5NA 4ZP1A 4OUDA 3I5UA 2VR1A 4I1IA 4Q4AB 5IP5A 3GZ4A 3SQWA 13PKA 1GAQA 4KV7A 4LGYA 3ZZTA 4BVKA 5A4KA 3B7PA 1CY0A 4E33A 4GI5A 5DWVA 4FOOA 2VF8A 1IY1A 2ZRJA 1E9AA 1T2EA 3C1TA 3W77A 4CIWA 5JPDA 4R3NA 2D1FA 1QWSA 4N6NA 1NOIA 1RP7A 1KY5A 2BUBA 3T7AA 5C80A 3UAXA 2YOHA 4BFTA 3OFND 4E5UA 3BORA 3WGGA 1M8KA 2ZAGA 3KWLA 2D8MA 2JFBA 2VXBA 5BMVF 4DLWA 2I0FA 3UOWA 2JB9A 4C01A 1K5GA 5F5XA 5K8IA 3CLRC 1EUQA 1TM4E 2O8NA 1IMJA 3ZI0A 1QVRA 1A4IA 1RAAA 1MQSA 3KAJA 5LYYA 2YY7A 1J8YF 2ZT7A 3AM3A 1GADO 3TSCA 4BB9A 4NOLA 1G7TA 3E4CA 2IYOA 5DX0A 4Q4JB 1KC3A 4HGZA 1W85B 3S55A 1LBQA 1AZTA 3DAGA 4D9JA 5B1EA 1P9OA 2K7ZA 3EOAI 3AM5A 3U13A 4MR8B 3FLAA 5T3YA 3STHA 4CT0A 4DZTA 2AJ8A 3FGZA 4BXOA 4DEYA 3K0HA 2BFEB 1T2VA 1TUEA 4HAOA 2WJPA 1OREA 2AUNA 2P6OA 1SHTX 3OE1A 4V3CA 4BFUA 1XZ8A 1VDZA 1PQPA 5CFRA 2JIOA 3W78A 1P4JA 1KZGB 3HUUA 3AETA 1U3WA 5AVWA 3GJ0A 2R8BA 4Q0MA 1TT5A 3UIEA 1UBFA 4X3PA 4N39A 5FPYA 4TT8A 5BWLA 3HI4A 4HO1X 2Q9CA 3DVAA 4RV4A 3ENQA 2FEXA 5B1DA 3OM9A 2PUCA 1R10A 3K32A 1CV2A 3VTZA 1IXKA 1DRJA 1E3WA 1T5SA 3BGVA 5EEHA 4B3CA 1NN5A 5GZ3A 4PGHA 1NFFA 5IX8A 3QPDA 2OO5A 4G56A 2ZYGA 2C3YA 3F8WA 3KXDA 4KE8A 3THXA 4R1NA 2AUTA 4Q6WA 1ECFA 3ACCA 4D4MA 4ZTUB 2IOHA 1IEQA 3GPDG 4O2AA 5CA1A 4YRBA 1E1KA 1TGVA 5LQAA 2C2YA 1A7UA 2AE2A 2ZP1A 1ZW1A 3RS9A 5KTRA 1T8PA 3IVCA 4XSHA 4ND3A 2OBBA 3RVBA 5FIUA 2EFDB 2IVZA 2WM2A 2JFUA 1W44A 4PZCA 1U4NA 1W8IA 3LQRA 5TMPA 2X6QA 3LFTA 3WNCA 1PF7E 5LA6B 5LBIA 5ALEA 4F9TA 5KVQA 1IMOA 3OZCA 5I5EA 3M4JA 3U62A 1H9AA 4N7JA 2UZ1A 3OZFA 4CCSA 3OU7A 7AT1A 4DIEA 5FOXA 2PUGA 3C6MA 1RXYA 1A82A 1JZQA 2H54A 2QYSA 1KK3A 4MW9A 1K7YA 2AMVA 1GV0A 3E84A 4I1OA 5I7RA 3JXEA 1P2GA 4IPTA 5BY2A 1TAHA 2OAEA 1A4UA 2W90A 2JANA 2P27A 1T9CA 2R6JA 1E1DA 4HNGA 4CMGA 3OZWA 4GKVA 5BSHA 1WUJS 2GETA 4EBBA 4IJ6A 5IFLA 2H8GA 1GPDG 3VYUB 2CNWD 1RTTA 2EU8A 3PCXA 2K2QB 1DBVO 1SVUA 3L1JA 4I2VA 4EKIA 3Q8LA 2HY7A 4MGKR 4R5HA 3UB2A 2QAIA 4QJ4A 2GN6A 3NAZA 2ZREA 3CXRA 4OXRA 1OIXA 3WIDA 3F90A 1XMQB 2ECFA 3LX6A 2DGDA 1VLMA 3CJQA 4DIOA 3K9WA 2FSSA 1MRNA 4AZTA 4OMFG 4BNWA 3WKEA 2WUEA 1R00A 1JR3E 2DQYA 3NOXA 3OF5A 4P98A 4F9GA 1N7IA 1ZGJA 5DNCA 4HN2A 2AH5A 2B8JA 1Q5PA 3L8FA 2FEOA 3NV9A 2ZSDA 3O83A 4EUHA 1UANA 3W3ZB 2JARA 4C6RA 2XA2A 4P53A 4RHXA 5BW5A 2DHQA 1H65A 2O7SA 2P0EA 1NMEA 3LXXA 1XU7A 1V6CA 2OK8A 4ABYA 1IN4A 1UP4A 2GN4A 3EVNA 3W5SA 1ZKMA 4D46A 1NTOA 3IBYA 1C4OA 3VKHA 4L5YA 4QPZA 4KP7A 1UJ6A 2CL5A 2E18A 4J16C 5JS1A 4DB4A 2V7TA 4KACA 2BD0A 5IN4A 5JD4A 2O07A 1RWKA 2BDEA 2ILTA 4F56A 4YO7A 1TO6A 2C82A 3G9ZA 2J5BA 5FWNA 5H82A 1FFAA 3JTEA 1EFKA 1RCTE 2AC2A 2PIDA 2P3OA 1VPVA 5JXHA 1DIGA 3O75A 3ZU2A 4UBIA 2B9EA 1FYEA 4ZYXA 1BC5A 2X5XA 1EK1A 3ZCSA 4Z1OA 2AIRA 2ZT8A 1Q7GA 3CNLA 4W5HA 3G7UA 4U5XA 4TVSA 2CSUA 2GASA 1M1YE 2AL7A 3GRYA 4EZIA 1PSWA 3U6KA 4OQLA 2QQ5A 1E2PA 4BU0A 5LZ8A 4GPAA 3GLVA 3E22A 4URUR 5L4SA 1A95A 1YS2X 1BROA 1UDRA 3R4CA 1F48A 1YOVA 4DJJA 1X13A 1BWQA 2AMFA 2IDKA 4JR0A 4ADSG 1SOWA 3HSSA 2F9FA 5IDYA 3E03A 2Q3FA 3RYFA 4M9ZA 4ZOLA 2ID9A 3HE3A 3OQPA 3TLXA 1AQJA 1C7JA 2GJSA 1YJCA 1EXWA 2VK1A 1C3EA 3HCNA 2BCJQ 1Q7EA 1QV7A 3IRVA 3QXGA 4K6KA 4L4RA 4OK5A 2HDNB 1JSXA 3VOSA 4A6PA 3H2HA 5EYPA 1Q3TA 4PSDA 1KWKA 5DX8A 3CVYA 4MV7A 1ZVMA 4LE2A 4Z9AA 2Q8QA 1Y7TA 2OYSA 2VHCA 3H84A 2ZSEA 1CF9A 2QY6A 4DEXA 1G3UA 3C2QA 3VO9A 1RSZA 2W11A 4UUPA 4ZAWA 2QBYA 1WBJB 1ETHA 1Y8AA 2WMNB 4UATA 3BBLA 3GUYA 3U1BA 3P7MA 1NG1A 3WLPA 1E7WA 1H4VB 1IM2A 5IAOA 4C22A 4UE2A 3S40A 4C4TA 1GPBA 3BXEA 1U2DA 4BGIA 2H1FA 5JOQA 1K4MA 1VG0B 3EZFA 1KAQA 3QFRA 1BKSB 2J41A 5HGXA 1WY5A 2HF9A 5K0SA 1IN1A 5KYWA 5GONB 4LZJA 3MJTA 2VHWA 3F3MA 4PAWA 5JNWA 1ZUIA 2XB6A 4DMRA 4M53A 1FVXA 3K5IA 1EUZA 4MI1A 1U7XA 1ZG3A 3WAGA 3E0XA 3ZW8A 1RKUA 4LIPD 4TQAA 2G6TA 1MEOA 2W00A 4CPDA 4EO4A 4UQPA 5DBGA 4WKBA 4EZBA 1Y3CE 4DDKA 4ASUA 3WG9A 3COSA 3EZLA 3ME5A 2C07A 1M7BA 2HLDA 2Q5JA 4ECAA 2FF5A 3O8RA 2QIPA 6NULA 3ADPA 3B1VA 4B7UA 2XZLA 3FUXA 1C2TA 2BGMA 2H65A 3QK7A 4P54A 4WN3A 2O9JA 4RE6A 2DPYA 3O95A 3IYLW 2C2ZA 2Q27A 5FI1B 5AVZA 4JYPA 1ID8A 1IHDA 3D6JA 3ZW7A 4EX6A 3M4ZA 3UUFA 4U7TB 1W7AA 1PSZA 4XB2A 4WY2A 4EVRA 2X8JB 4ZIRA 4Z3OA 3OFVA 1HMYA 3RJZA 4E2XA 2GPNA 1GU7A 4BDTA 4DNOA 2Z2YA 1EJ2A 3FVVA 4UREA 3V8PA 5C3MA 5HKAA 2IEYA 2ZE5A 4XUEA 2YKGA 2I4OA 3H5VA 1V16B 4GEKA 4X20A 3K1ZA 2LE0A 4CM8A 5JALA 1D7OA 2YVUA 4NABA 1G8HA 4D0GA 4WBNF 1OZGA 1QHIA 3VU1A 1D03A 3WGVA 3G02A 1IG0A 5GM1A 1TGYA 1ADBA 1EDZA 1G60A 1RQGA 2FWPA 3E7DA 3TMYA 2PGXA 4HGOA 4EY8A 3EH2A 4R84A 2MIIA 3TS1A 4C7KA 4FYPA 4LHXA 5EC8A 4L07A 4LJSA 4BV8A 4D25A 4RGBA 1CD5A 5K05A 1G0NA 5K0ZA 1LLUA 1KNXA 2CLIB 4J2HA 3CPHA 4IVQA 4WX2B 2PQ6A 4AULA 5HX7A 5ALRA 3FLBA 2DB3A 3EMDA 1IFXA 1LV8A 2FVYA 5CJ2A 3UH1A 4YCSA 4INJA 3WLMA 5ALWA 4CKWB 3U61B 5I7WA 5KOJA 2REQB 5F4ZA 1RD4A 3BQ9A 3MA0A 1E66A 1VG1A 4LJRA 4M86A 1F17A 1LTQA 1ZW6A 3PFKA 4WK6A 2JLAA 4AVYA 3U60B 1LS6A 2NVWA 3FLMA 4TYYA 2C2OA 4L4XA 1FP4B 4C0WA 1YT5A 1S96A 3TL3A 3HFJA 5FUYA 4HQKA 2D1RA 2EQBA 4TYWA 4F06A 1JE1A 2B6NA 3OIGA 2Z5GA 2D59A 3DV0A 1T0PA 4FDUA 3QYAA 2H85A 3INYA 1CQZA 1T5HX 3NW9A 1YE8A 3QX9A 2FXVA 4DADA 3N0RA 1DBIA 2ZRCA 4J0CA 4X3CA 1YUBA 4LOHA 1KY3A 3ZZ0A 2GZ3A 2DBVO 1ACLA 3ETJA 4RMIA 3C8DA 2XYGA 5DHPA 5FHRA 4QHSA 5JAPA 3LUGA 4A26A 5JMWA 3U44B 3D4LA 3FTCA 3S28A 2GM4A 2NZUG 2JFZA 3LC0A 1JT2A 4QOGA 5AUPB 3M6UA 5I3ZA 1KBQA 1SEVA 1TM7E 2PZFA 3QOYA 2P67A 3GVCA 1G6HA 1HSOA 1UDCA 2Z56A 3K6KA 4K3VA 5DFAA 5HF5A 4HV4A 2RE8A 2PRJA 1FJGB 1ATIA 2VP2A 3COWA 1HPLA 3KHUA 3ZH2A 3WXBA 3LCCA 3EZXA 3GFTA 2IYFA 1KKLA 3EJ6A 1USUA 4OL0A 3S1SA 3MAGA 3UT6A 2WU0A 1NQAO 4L9AA 3M89A 3FNBA 5EZSA 2B1JA 3A4VA 4OYLA 3PR1A 1IEXA 2B92A 2BKAA 4PM4A 5FOQA 1X70A 2WSBA 4ITVA 4B2LA 1NR1A 2V6BA 2WC1A 3H11B 5EZYA 1IH8A 4HRVA 3P4UA 4DM3A 4QLAA 4RCVA 4JC8A 4ND1A 5BQ5A 3PQ4A 3ECSA 3C1UA 3I5MA 4LBZA 1K7SN 1HZZA 5LNK6 4I4TA 1JP7A 4JELA 4ZU1X 3VOAA 4K9LA 1IXRC 5EWJB 4CMHA 3IHKA 2W93A 3NRJA 4YFVA 4RVSA 2I1VB 1XCPA 1EKXA 2B2NA 3WGYA 1R5OA 3UBMA 1UF9A 4H7DA 4UMEA 5SYAA 3X1XA 2EWWA 2I6UA 2LUOA 4US1R 3N0XA 1G16A 3VSBA 4KO3S 2VYCA 1N2CB 3OCCA 5IPFA 4QICA 4YYZA 4O3MA 2GA9A 2B0CA 2H2DA 4WINA 2LR0A 3BWDD 5TEVA 5IJWA 3D6NB 1YQ9A 3DEKA 3EWSA 4LF8B 2KPOA 3ZWDA 1P8JA 2ZJ6A 4GDFA 3V3TA 4YRIA 5A62A 3RSGA 4BNVA 3PNSA 4G23A 3A3OA 3WLIA 4OBWA 2I3GA 4QTUB 1V3TA 2E87A 4LPKA 4KUHA 1DRKA 4NSNA 4M8KA 4JVSB 1MIOB 1F2DA 2HMYB 1YMQA 4M37A 1CR4A 2GN0A 3N8NA 1GHTA 3DKRA 3EDCA 3PU6A 3Q6MA 4R8LA 1ZH8A 4FWTA 3E8XA 2CC2A 4LDRA 4XRGA 1F5NA 1WVIA 3UCEA 1IWOA 1QVWA 3OE5A 3Q3JB 4QGHA 4A2QA 1M33A 3V4OA 3KVVA 5BORA 4TKZA 1Q0QA 3RC2A 1SCBA 1GRVA 4YGXB 1DTWA 1NL3A 2WY2D 1VGQA 1RLOA 1ODTC 2E4UA 3WNDA 2HB6A 1N8KA 3NTXA 1DC3A 1UEIA 3KKMA 3FFWA 3SEFA 5DTIA 1KI7A 1GGFA 2IXGA 3N2ZB 4QDUA 4QQKA 1P9WA 2EC5A 2H31A 1OC2A 2Q3BA 4OBEA 4OHOA 1H9BA 1N6OA 4Q12A 3PHHA 2GJ9A 2QLJA 4CTOA 3AB7A 2R7LA 1AK2A 3BSSA 2F55A 2ZUEA 1TK9A 4JUCA 5KC9A 2JJYA 2C4UA 3SEAA 3JWGA 4QVKA 1HDIA 5TT1A 4E4TA 1QHHA 1A8HA 3KR1A 2QN3A 4YUVA 1UBUS 1VJRA 4WJLA 2W6CX 5FLKA 1L5RA 2C7PA 3RNLA 1AM4D 2EP5A 3BJZA 5HMLA 4D4LA 3S5JA 4DXHA 3D7LA 3STYA 3H19A 5EN4A 2GCNA 1JI3A 2H5EA 2J9YB 3G6KA 3DEYX 1C81A 1GG2A 2XUIA 3OQBA 5EAIA 4B4UA 1ZVJA 2GXAA 1E2BA 2DUUA 2IUYA 1EWVA 5JSZA 1VPLA 3B9QA 3BMNB 3F9CA 3L1UA 1WXQA 1CUJA 4M0PA 3FPBA 2IOQA 1GXSA 1JFRA 3GMIA 1MABA 3UTDA 4DMLA 4YFYA 1KYWA 3MWJA 3M6AA 3AU9A 1NKTA 4RLHA 1C3OB 4NYIQ 1XRLA 4ZC8A 3RJ9A 3RVMA 1QBKC 3A1TA 3RC8A 3IRUA 3M1LA 2O0JA 4AW9A 3ZU6A 4RL6A 5D5QA 2OPBA 3UMGA 1KARA 4EGSA 1OTHA 5LYJF 3STTA 3IO5A 1PWXA 5FTMA 4PTZA 5KU7A 2I6SA 1D2AA 4BX3A 5BMOA 5DHSA 4ZJYA 1H2EA 1JLMA 3ER6A 4MVJF 3B3AA 1PT5A 2EW1A 4ASUD 2LD4A 1T6XA 2O2GA 1D9XA 1GILA 2APJA 1M7GA 1ZA2A 4WGFA 4AG5A 3TBHA 3NBMA 4P7JA 4NCAA 4DKJA 5A1JA 1XJ5A 3QOFA 3PNVA 5D3ZA 3EEQA 5BPHA 1E3EA 5A0FA 2HBYA 4LBYA 2DHDA 3SF8A 4LDZA 4TUYA 1A71A 4NOJA 1VSBA 3M9LA 1QH1B 4GMFA 1JQAA 1Q92A 2R1TB 3CZAA 2V7EA 5I7AA 4LHVA 3WRWA 1PFGA 5IXSA 5A5VA 3K9BA 1PFYA 1D0VA 4PC3A 5CJJA 3QE2A 1XQVA 2WM9B 5EE0A 5IBPA 2HLPA 3B6IA 2IBSA 5LP6F 4WQMA 4Y9SA 1VJCA 3KQKA 2OD9A 5I4IA 1HL7A 4D0RA 3K35A 4Q93A 1DJQA 5C4MA 4CDNA 3UHFA 2FEMA 4GQBA 2BFFA 4G84A 3IH5A 4I55A 4MKFA 4MIEA 4R81A 4YAFA 2B34A 2RKBA 3RS2A 1MR3F 1E2KA 4YMSA 3D6HA 2HSWA 3QXXA 2HD4A 3LP8A 5G4KB 2WB2A 3VJRA 4I1YA 3Q3CA 1XNHA 1HYHA 2DFNA 5AW5A 2CXUA 5CHYA 4BZWA 4MV3A 3ROPA 1WXEA 3IPXA 1Q2UA 1SBYA 2CHEA 2PFSA 2HWKA 2AXPA 2ZATA 3LBYA 4H7KA 4Q1CA 3S2EA 3U7EB 3VR0A 1ZVQA 4XGQA 2IS2A 3GOQA 5FNZA 3B9BA 1HL3A 1EFUA 5FTJA 2J9XB 4JAVC 1ONSA 1UR5A 2ZJAA 1NNUA 1NHWA 2XAAA 3FKQA 5FNVA 1MBZA 3EVTA 2O0KA 3ITKA 2NU8B 4CUJA 4KBYA 4WL0A 5AK4A 3B38A 1CZRA 3DULA 5LN1A 3OVMA 1BHSA 4YACA 4PZAA 2WQ6A 3NOVA 3IQEA 3UFXA 3OQ1A 1TIBA 4OPMA 3KQOA 5DI9A 4CIYA 5IDWA 1YZGA 5LP1A 4TYPA 4BBZA 4OHMA 3EIUA 3GA7A 5AK5A 6YASA 1RYHA 3DOEA 4WBNB 2OILA 4KRYA 2HAEA 1V8OA 2Y3IA 4FGSA 1CR6A 4HOYA 5IKPA 2XQJA 3T12A 2UUPA 3BIJA 4IIHA 3GLIB 5LNK1 4J91A 3WLFA 2SKEA 3QIVA 2NLOA 4FZ3A 4DG5A 2CN1A 4N6GA 4J94A 1GAWA 4O4IB 2VTKA 2OQVA 1PFVA 4JJAA 3G2LA 4P9NA 4PAOA 3TF5A 3IA2A 5F9HA 4QUHA 4PG4A 4DGQA 2G5PA 3SZMA 3D7SA 3SZGA 4XWOA 1AXGA 1QGYA 4P38A 3CF4A 3ZJUA 3PLRA 4AP6A 1IBKB 2UZAA 3C6YA 3CO5A 3V2GA 5DM2A 2IH5A 4RZHA 2D00A 1N2CE 3EPLA 4AI6A 1IIRA 3O38A 4RTLA 2FOXA 2H0RA 4EDHA 2I4RA 4XAQA 4HS9A 4G8JA 1TKCA 1ZOPA 4J7CA 2F67A 3A1SA 4HWOA 4TMXA 1REQB 3KQHA 1UWCA 3CX4A 3QUBA 1NFQA 2D1TA 3G2PA 1TK2A 1X9HA 3BK2A 3AYZB 2VPZA 4HDRA 2ECKA 2Q6VA 4BBPA 4FMPA 4P3OA 4BO0A 2HMWA 4BLQA 1ZWLA 1N25A 4HJXA 4OUDB 1DCTA 3QOXA 1XP5A 4HQLA 1OI4A 1XWFA 2P9HA 1P45A 2RGYA 3OCWA 3K8OE 3R3YA 4E2WA 4EG0A 3OCXA 3JYOA 4B80A 2YJTD 4B5LA 4ZO9A 4CTMA 1MV5A 1YB5A 2D5BA 4KXVA 2GO1A 3L6CA 3U1VA 4AT1A 3NNNA 3EGVA 3UBTA 3FHLA 4UZSA 1EDBA 2W58A 4CG0A 3OX2A 2IYUA 1PR5A 1T1EA 3DV2A 4QELA 4X92A 4QUBA 3FMIA 5HFAA 1M2JA 4RY2A 4OX9Y 1S8AA 3TZHA 4RO0A 2UUAB 3KDAA 4DLLA 2PL5A 4C4RA 1NW9B 4ETWA 2FGJA 1W75A 3VJMA 2P68A 3IUJA 1E6KA 1NVBA 3FTPA 3FYCA 1C9KA 4GQAA 2Z5FA 3B1KA 5DM70 3ESXA 3EF1A 4Q01A 4NU5A 2FH5B 2FPKA 2GSWA 2HUNA 3LYLA 2Z8ZA 3MGCA 1Z17A 2JLRA 4HFNA 4JOBA 2VQEB 3A1DA 1LLCA 1U0NA 2NYRA 2QYTA 3VRHA 3IAS6 3KD3A 1MPXA 3GZJA 3MHPA 4J1QA 4MVJA 1XLVA 4OK3A 1BD3A 4C04A 3I9NA 1GGJA 4BXOB 2WSSA 2P78A 2ZYSA 4L9RA 1E20A 4FMBB 4PCLA 4DY4A 3IILA 2DBYA 1CY4A 4C4ZA 3IP9A 3NYWA 1CR2A 4TYNA 1WHSB 4KPUB 4WA7A 2Q41A 4C3OB 3IQGX 1YDHA 2BZSA 2B4TO 1PU2A 3R5FA 3A37A 3JALB 1SUBA 1P0CA 1U3VA 4KO2S 2BFDA 2C20A 1P0MA 1Y4DE 2QKYA 4OLJA 1J0XO 1T36A 4HQRA 1QMGA 4ICIA 4BNGA 3GCDA 3N2LA 1VI6A 2BEUA 3QLJA 4BRWA 4HK4A 4CW7A 3DAFA 5DSTA 4DJEC 1JKMA 3VDMA 2QRGA 3ICPA 2F3TA 3ABIA 3EIWA 4MYSA 4AJLA 1OT3A 1KXZA 2H3EA 3HJAA 1NUQA 4AJOA 2PD4A 1VHDA 4AWAA 3PD0A 4NECA 4NHOA 5EQTA 3HUEA 4JLUA 1UC5B 5JWOA 1A96A 2NZXA 1S2LA 5CA1B 1L7EA 1TQ6A 1UKBA 4COOA 2HWXA 1WVMA 2A1TR 2BFWA 2YMLA 1JF8A 2QM7A 4L8FA 3U7QA 1DHRA 2Q62A 4EI2A 1HT2E 1PKEA 4IDBA 1QG2A 1PV1A 1N1MA 2F64A 4N5MA 1YE5A 2QTVA 5IWCA 3EZ9A 3T1HB 1JIQA 4ALIA 4B4OA 4ZFNA 2QLLA 2BI4A 1QPGA 1TU3A 1WDKA 3G9QA 2ZRAA 4UE3S 3U7IA 2A1TS 2PZAA 2R8PA 4OFXA 1SIUA 3CR3C 3O8QB 1ACJA 4GOXA 4J75A 2XIJA 4C7VA 5JJ5A 1U6JA 4KH1A 3EUAA 1P7WA 1U1FA 2UZ1B 3FDJA 4JU9A 4GLLA 4G26A 5JZSA 2KMLA 1SVSA 1FE8A 1OC4A 1NR7A 2NZYA 1CT9A 1TU4A 2OORC 2QAJA 3EDYA 3FB4A 4IS3A 3WGMA 3KO8A 2IZOA 3EA0A 4TTVA 3DOOA 1HFKA 1Z2AA 3QFCA 4EY4A 2PPVA 3FTQA 1BEUB 4BLRA 1E6CA 2DCUA 3R0JA 3WGHA 3EZGA 1ZQ9A 2Z30A 1SAYA 3M82A 3RFTA 2C2HA 3E58A 2MSWA 2IV2X 3OJ0A 4CIVA 4EYSA 4QM7A 4MAFA 3ILYA 3HCDA 1CUZA 1GT6A 2GT1A 2ZJ4A 3HYTA 3M1AA 4MQ5A 3F47A 4IV0A 2PAAA 3FIUA 3FXAA 3KOZA 5LXTB 1PIWA 3HBFA 2XCIA 5ALGA 1M8PA 3ZZ1A 3M81A 1RVV1 3IDZA 3C7AA 3KJGA 5ITZA 4F93B 3I0NA 4AF6A 4KNYA 4QFCA 3AOGA 1J25A 1E3LA 1MENA 2GJKA 4YALA 1J22A 1FLAA 3WDKA 3H1PA 3IVGA 4QDKA 3T3MB 3VVMA 4FLEA 1ULAA 2XDWA 1RMYA 2WA2A 3GDFA 2X15A 3AUUA 1EWQA 1AURA 2OTCA 3TNJA 3TR5A 1USVA 4QREA 4NU0A 4D6XA 5A6VA 1H3EA 1XTJA 1CPYA 1XPUA 3EHEA 4L4ZA 2NO5A 4URHA 4KJXA 4AK9A 4GXTA 1WXHA 3ESYA 3JQGA 3TRHA 4RIHA 3R5SA 3EOZA 5EGNA 3CE9A 5CD1A 4B44A 1WSAA 3KJNA 2C7QA 3DE4X 2FVXA 1LD3A 2ZQZA 3GLIE 5IW8A 3TZCA 4XWKA 4ABTA 3L1HA 4N65A 4X8MA 3DBHA 5CX1A 1P17A 1BGXT 3QXJA 4IFBA 4WKCA 2FPGA 2ZJ5A 1GNVA 3MTBA 2G4LA 2PLAA 1I0ZA 2FN9A 5JCOA 5KTTA 1M66A 3T4EA 1QYCA 1PJ3A 1FNCA 1QG0A 1U7PA 2YS6A 3RG2A 1GTSA 1S3FA 2WUDA 3Q9NA 4TWZA 1D6JA 3HCBA 4LV6A 2R68A 1GIAA 2FE4A 4MH0R 4GI1A 4RH3A 3DL4A 4D9FA 4OCZA 2NXJA 3QTTA 2XDQB 1UBCA 4MR9A 4TKUB 2X0EA 3ZHOA 4EUFA 3AVUA 4RHUA 1OFIA 2ADFA 1YOVB 3OHMA 4L8YA 4OHCA 3UCFA 2OHHA 4ZEOA 1YQQA 2V0GA 1FP6A 1IQUA 1VLJA 1U3TA 2M6RA 3DPUA 4MUYA 3R7SA 3EF0A