1FMCA

7-alpha-hydroxysteroid dehydrogenase complex with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
b'MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1996-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fmcA00
1AE1A 2LDBA 4LVCA 4S3MA 4BQRA 3CZMA 4CM1A 3WGIA 3FTPA 1X1TA 2VTDA 2D59A 3JQGB 1DOHA 2WD7A 1NWHA 1EQ2A 4M1QA 4BQPA 1ADCA 2P5YA 4OXNA 1FJHA 3HQ4O 2OORA 4XR4A 2PGJA 4IDEA 3AFMA 4MVJM 4WJZA 1QR6A 2WSBA 3FCOA 3PFWO 5COBA 4NNJA 1SCUA 4YT5A 3VH1A 2D2IA 3WX0A 1WDMA 2POQX 4BOYA 1PGPA 4NZ9A 1R12A 4P4NA 2AEFA 4R1TA 5T8KA 1YKFA 3VKUA 1Q0HA 4HV4A 3IQDB 1ZNQO 2NTNA 2HAEA 4U0KA 3AM5A 4DIFA 4LRSB 3K31A 4Y6PA 4RPHA 2WD7B 2VYNA 1JA9A 4JLWA 3WYCA 1T4BA 5EQDA 1U4OA 1JQBA 4CM9D 3ZHYA 1ZMTA 4WK6A 4XR9A 5ES3A 4TVBA 3DTYA 1IZ0A 5DCUA 4G65A 4WCFB 3PP8A 3ZU3A 4HFNA 3ULKA 5KCZA 3L77A 4BV9A 2HQ1A 2NSDA 4L4RA 1N2SA 4PCVA 4EW6A 1H2BA 2EHDA 2D8AA 1DFIA 2QHXA 5CFZA 5AXAA 4YAGA 1PZHA 1U9JA 4NG5A 1V0JA 2BRUA 4NFSA 4A27A 1ML3A 4XYLA 5I7VA 1SB9A 4DVJA 3A4VA 4FCCA 3RI3A 3VZPA 1X0XA 3DZGA 3JQBC 4CQLA 2NVBA 4RVGA 3WJAA 6LDHA 4MVJG 4CV0A 3GVXA 5AXDA 3GZNA 3UAGA 3G49A 3M2PA 4IXTA 3K92A 3BMNB 2P9GA 3TZ6A 3VH2A 1VJ1A 4YAKA 2PK3A 3GEMA 4J7UA 2PR2A 1GY8A 5A9SA 3O4RA 1Y1PA 1IHYA 3ZZNA 1U3TA 5KVCA 2QZ9A 3C3XA 4CV3A 1ZEJA 1GUYA 1B2LA 1HE3A 4OIMA 1HDYA 3U4HA 5MGBA 4Y6RA 1G1AA 2HLPA 4YDRA 1YONA 5DF1A 4BHTA 2DT5A 1L1FA 1WPQA 3ZWCA 5DDIP 4BB5A 3T7EA 1SBYA 1YQGA 1DC6A 4ZQHA 2Y1GA 5JXWA 2ZB8A 3EGOA 3GT0A 3DO5A 4D7AA 4GI2A 4QXMA 2YV2A 5JAMA 4MVJE 3IOYA 5IXSA 5AQ1A 4Q3CA 1NVGA 3OSUA 3RCBA 3DONA 1HYGA 1P9LA 4IY1A 4I8XA 3EHEA 2P68A 3O03A 4PVCA 4EJ0A 3HUDA 3PLNA 2JD0A 5LDGA 4CMBA 5CDYA 1GAEO 4PRKA 5BSHA 2FY8A 3EVNA 3OIGA 3JD4A 2WEKA 1AHHA 5TQVA 3S55A 3AUAA 4CM7A 4RDIA 3RC1A 4I9UA 1JTVA 4B3JA 3GF4A 1F8FA 4E2YA 3QP9A 4E6PA 1YS4A 4CUJA 4IUYA 3RUHA 4JX8A 1C0KA 1PJLA 3M1LA 1W0CA 4BV8A 5ICSA 3HFSA 2JD1A 4DYVA 1NM5A 4LISA 4W7IA 3FNGA 2PGLA 4CMEA 5T8KC 5GZ1A 1I10A 4XYGA 5TRTA 5IJZA 3HNPA 3ZW9A 3ABIA 5TF4A 3OQBA 2NU9A 4H16A 1LLCA 2QYTA 5TLSA 1A72A 4ALIA 1YO6A 4UVIA 4OGWA 1CYDA 1C0IA 1PS0A 2CZCA 3NGLA 5JE8A 2X9NA 3CH6A 4MVJD 2BKAA 1CQIA 1RKXA 4CMAA 1U2GA 5L4NA 3ADPA 5J23A 5BNTA 2VT3A 2V65A 1LDYA 1HLDA 1NP3A 1AN9A 4R16A 5A9RA 1DIBA 3IS3A 3QWBA 1DRUA 2D3TA 4GLLA 4N5NA 1NAIA 1ZJZA 2P2SA 3FNHA 2FR1A 3EK2A 4A7PA 1O94A 2B35A 1ID1A 4KZPA 3PJEA 3GDFA 4MKZA 2IODA 4MJLA 4N5LA 4RQUA 1WLYA 3ZV5A 4DGSA 2CVOA 1ZK0A 4GWKA 1D1SA 1U4SA 3OJ0A 3Q2IA 1E3LA 3M6IA 1IB6A 5FEUA 4Z0TA 3QRWA 3LYLA 1YDWA 1VI2A 5AOVA 5LDHA 2X8LA 2RBEA 3Q0EA 1XSEA 2GGSA 2VCYA 2IYPA 4L75A 3I1JA 1YXMA 3PXXA 1E3IA 3MJ4A 4QO7A 2WE7A 1JN0A 1LA2A 5HWSA 4KMSA 2AQHA 1C0PA 4IJVA 4M89A 3D4NA 3TOXA 4Z0PA 3I5MA 2HMSA 1ORRA 1YE3A 1PJCA 5KJFA 1L7EA 4I5FA 3PZRA 3NDJA 4I9HA 5JO0A 2DBVO 3QWFA 3H9JA 4ALMA 1NX6A 1I30A 1UDBA 3HB4X 1LSUA 4BNIA 1Q0QA 5F1PA 1UH5A 4CMIA 4G81A 2O7SA 4CM4A 3RU7A 3RUIA 1ISFA 4BS9A 5ILOA 3HWRA 2X5OA 4YACA 4YCAA 3R3SA 3OETA 3BAZA 3RJ9A 2F1KA 3D4OA 1PJ3A 2VOJA 3SC6A 1P0FA 1KVTA 2CDAA 4CV1A 1E7RA 4OOFA 3O9ZA 1N1GA 4K6FA 2BD0A 3DMYA 3C24A 4NQZA 3VVBA 3E5RA 4ROSA 1F12A 3LC1O 2HUNA 5CPFA 2VNAA 4KOAA 4UVHA 3STHA 2JFGA 3BMCB 3F6YA 3IMFA 3RBXA 1EEHA 3R3JA 4OMUA 4YEDA 3ZW8A 4DLLA 1GTMA 1MX3A 2W90A 3WYBA 2D1YA 2XPCA 5A04A 4L76A 3ZHZA 3WJ7A 3OICA 4Q39A 2IE0A 3KYBA 4BNMA 2C0CA 3ANLA 2NLOA 1GL3A 4RVSA 3FF4A 4IM7A 5C7IO 5L4SA 4FFMA 1K89A 4UUNA 4ZRMA 1CWUA 1LC3A 1GFSA 1XEAA 4Q3AA 3I52A 3AW9A 4Z0HO 2X9GA 2NVUA 2VRCD 1HDXA 1UXGA 2PLAA 2CD9A 1Z6ZA 4J4BA 2NQ8A 4RDHA 2VYVD 2H5LA 3S1LA 1D7OA 1Y7TA 2QIOA 4DQUA 2W2KA 3K73O 3F46A 3QLJA 1DBVO 1YBMA 4D3SA 3G0OA 3TFQA 4MVJP 3L4BA 2FHSA 4NJMA 1ZK3A 3WQQA 3BMOB 4QSMA 1JAXA 2X5JO 5JPIA 1DLJA 4B4VA 3F1KA 5IF3A 3DOCA 5I7SA 3IP3A 1XWFA 1ISHA 1EE9A 1U7HA 1EVIA 2CSUA 3GDOA 4DBZA 2Q45A 2DTXA 5FYDA 3NT5A 5DT9A 4TRMA 4EZBA 4DUPA 5L45A 4YPOA 1KVSA 4R41A 4DTIA 2OZPA 1I33A 1XR3A 3DBVO 1GQYA 3F9IA 2P91A 1VM6A 5CP8A 4A03A 2I99A 1P1KA 1ZMOA 1VPDA 4IMPA 4UUMA 1PL7A 5THQA 2C5AA 4I5DA 4BO6A 4INAA 4FB5A 2J8ZA 1I3NA 1F8GA 2HRZA 3E9NA 4ZU3A 3W4KA 4RVDA 5F21A 1R0KA 1AUPA 3NKLA 1S6YA 1B3BA 2W8ZA 4CMHA 3DAGA 5FI5A 3OP4A 1SZJG 1OC4A 2QW8A 3CEAA 5FWNA 3AOEA 4XYEA 1ZCJA 4L73A 5L51A 1LQTA 3NV9A 1MB4A 3I4FA 3VPSA 4F6CA 4E30A 3FBGA 3LVFO 3T4XA 1S7CA 4TRJA 3AJRA 1KY5A 2X1HA 3MJTA 2I9PA 4BKRA 2YFQA 2Q2WA 4DMLA 3TFOA 3UCXA 4YTEA 1E6EA 2AXQA 4C7JA 2J3KA 5B4VA 4PG8A 2EWMA 3P7MA 3DWFA 3LF1A 4TZTA 1IL0A 3Q9NA 3BTUA 4K26A 2BFPA 1LX6A 3PPIA 4KTTE 3INTA 1R4MA 3RC9A 4OOEA 1ULUA 3UCEA 5I8ZA 5CG2A 3B70A 3FWNA 2PZKA 3IUPA 3VVCA 3IJRA 3R6DA 1YBVA 3IJPA 4B4WA 4DC0A 5CDTA 1Z73A 4FJ0A 4JIGA 3WTBA 1O6ZA 4DPMA 1NHWA 3D4PA 3GN2A 2XAAA 3P2OA 1T26A 3KYDB 5K0ZA 1A7AA 4ZQGA 1ZUD1 3V1YA 4YT2A 1Z7BA 2BFAA 1Y5RA 3HADA 5L7TA 1P44A 3L4BC 3ZGYA 1ONPA 1TI7A 4BO4A 5KKAA 4D46A 3JQFC 1YGYA 3PYXA 3DBRA 4FD3A 1XHLA 2FPGA 3ZWBA 4BKPA 3GHHA 3H5AA 4RPGA 4BGVA 2VZ9A 4XIJA 2B5WA 3E9QA 3H9UA 2GRAA 4BNHA 4WLEA 3IAHA 4UEJA 2EIHA 1LUAA 5AXCA 2VZ8A 3C7AA 2UDPA 1IOLA 4KDFA 1B26A 3WGHA 2YW9A 4GLOA 1NTOA 1SOVA 1OI7A 3GQVA 2AEJA 4FGWA 4MO2A 4OXYA 2P5UA 4XKJA 3COSA 4CM8A 1K5HA 4BMVA 5A02A 1LLUA 5CEEA 3VH4A 2JCVA 5EERA 1E3JA 4PLHA 1BRMA 3OJLA 4AJNA 1R6DA 4GGPA 3M2TA 2PKQP 4BNYA 3OEYA 3QWHA 1U1IA 2DBRA 1QORA 3JTMA 5KWEA 3NEPX 1NASA 3LF2A 2UUOA 2IEBA 1TLTA 3G1TA 1WDLA 1B7GO 2AQIA 4J6FA 1LSOA 1U5AA 3H9QA 1SNYA 3GZ4A 4J1SA 4PLWA 1XIVA 3INGA 2QQ5A 3FNEA 3KBOA 5JAZA 3TZCA 4E0BA 3AOEC 4JBIA 3KYCA 1E3SA 5K9ZA 1GEGA 2OO5A 3WB9A 1IUKA 1UP7A 1FK8A 4IDBA 2B4TO 3DMTA 3NAQA 2OBNA 4E5KA 1WZIA 1HDCA 1FDSA 3WXBA 2Z95A 5C5IA 1GUFA 2Q46A 1WDKA 3RC2A 3GAZA 3UN1A 3A1NA 3WIEA 4ALKA 4BNFA 3RASA 3ASVA 1JLLA 2C2XA 3G79A 4YRDA 3I9OA 2YJZA 1FDUA 3HZZA 3VPHA 3TF5A 4AICA 4QTZA 3BMQA 4RPJA 2C82A 3RSHA 1CQJA 2BH9A 3HN2A 1CRWG 1RYDA 2X0NA 5BSEA 2X0JA 3KYCB 2HK8A 4W7HA 2C7VA 4BMSA 3TZKA 3KB6A 5ER6A 3TN7A 1HE2A 1X0VA 3KXDA 3ORFA 3A9WA 1PQWA 2RCYA 3JQEA 3GAFA 4XX0A 2O3TA 1FMCA 2OL4A 5EESA 1N8KA 2ZB3A 1LLDA 1EZ4A 1N7HA 1V9LA 5I8WA 3QJ5A 1VC2A 2VYND 1UXKA 2OBYA 5GZ3A 3M1AA 1OBFO 1VE9A 4ALJA 2I3AA 1PQPA 3HDHA 3D1LA 4O59O 2BI7A 4R4JA 1C1DA 1H0KA 1I0ZA 2BHLA 4MIYA 4WEOA 1PZFA 1ZK2A 4Z9YA 1XU7A 3INRA 4JP3A 4FFNA 2JHGA 3JQ9A 2JCXA 4R01A 4IZIA 4BUCA 4Z3KA 1KETA 1XU9A 2ZTLA 4UAGA 2FWMX 5LC1A 3NDIA 2EP7A 1LDMA 2Q2QA 1HF3A 2A4KA 4LCJA 1N9GA 5CDUA 1K0UA 4D42A 3D0OA 3JD3A 1H6CA 4JK3A 4WE3A 1FXSA 1LRKA 2IZ1A 1ZIDA 4ZVVA 2G76A 3VH3A 1JKIA 4KUEA 4J2OA 3ZWYA 1NPYA 4L74A 4Y67A 3NTQA 4BL5A 4KDEA 1C1DB 3LT1A 1VJ0A 2EERA 1N92A 1P33A 5FF9A 1I2ZA 1DC5A 3JYNA 3MOGA 1PR3A 1B16A 5A06A 5DBFA 3T4EA 2BGLA 4WGGA 5C7OO 3JYLA 3LC7O 4EUEA 2GO1A 2YY7A 1I2BA 4ILKA 3I3OA 4O0LA 3LC2O 4MDHA 1NFFA 3QV1A 1SPXA 1QMGA 2EV9A 2IZ0A 3QVTA 5A3JA 1NVMB 4U0JA 1PL8A 1PZGA 1KEPA 4BO2A 3FHLA 1ZH8A 2O3QA 2VUSA 4HWKA 3NDRA 1BDMA 1OOEA 1R0LA 2VRBA 4IS3A 3L6EA 3DMTC 2NQTA 3RU9A 1M66A 3AY6A 3PHHA 2QRJA 4MPDA 3AU9A 2UAGA 3EUWA 5HRUA 4NPCA 4TMFA 3OMLA 1DC4A 1K6IA 3JQAA 5TNXA 4BO7A 1NWCA 3GRPA 4B3IA 4L4SA 2VWQA 2XF8A 1K3TA 1XGKA 3HN7A 1DIRA 5A3VA 4GAEA 1DLIA 4N54A 1QV7A 2ZJ1A 1QV6A 2O23A 3MCVA 5FI3A 3ZH2A 2OP0A 3NX4A 2I66A 2RH8A 3BHJA 4BO1A 1DDOA 5IDWA 2ZQYA 5JS6A 5A1TA 1B8PA 2UUPA 1HL3A 4GMGA 4RVHA 1KEVA 2ET6A 4Q3DA 4M87A 4MIEA 1F06A 2YQ5A 3O8QA 4WASA 4RPKA 3AI1A 3IC5A 2X4GA 4IMRA 5GZ6A 4B7CA 3TJRA 3IL2A 2B4QA 4HADA 1EUDA 3H9GA 2DUUA 3OHSX 4UUPA 4XEHA 3PDUA 3ETDA 3K2BA 4CL3A 4IGEA 3WOHA 4GX1A 3H5NA 3ENKA 1HDGO 1NBOA 4PG6A 3T7CA 4FBGA 3K9QO 3ONEA 3JQ9C 4B4OA 3GG2A 2C2YA 3OQ6A 3CKYA 1ZW1A 1TXGA 3WIDA 2V6BA 1GPJA 2VHZA 4R5MA 1A5ZA 1Z74A 1I01A 1NR1A 3Q11A 1EFLA 4K28A 3H9EO 4AJ2A 4WLVA 2PH5A 3JSAA 1EBUA 1KC3A 1LSSA 5JYEA 1RM5A 5CPBA 4XQGA 4QECA 4OQZA 3RUEA 5IG2A 1P1JA 5DOVA 4J43A 1LRJA 1PS9A 2CFCA 3ZI0A 4XJSA 5EMHA 3ST7A 1T2AA 3VPXA 1U5CA 1BW9A 4DIOA 2PH3A 2ZTVA 3DZFA 3RD5A 1E1LA 1ADGA 5G4KA 3NUGA 4D44A 1OZAA 1T4DA 3PQEA 3E1KA 4CMGA 5L9AA 3VKVA 1R4NA 4KP7A 5EN4A 4OYRA 1T2EA 4HKTA 4F45A 1UZMA 3ZV6A 3AU8A 4E21A 1ZK1A 4LMPA 5IDYA 3DHNA 3F1LA 3W8FA 1LLQA 3P2YA 3WMWA 1KEUA 1NQ5A 1UP4A 2EKQA 2PY6A 2HSDA 3JD0A 4NU5A 4CMCA 4DMMA 5C37A 3JQ6A 1P74A 1ZSVA 4EITA 4W9NA 1E0DA 2BELA 1KIFA 1Q7GA 1SO8A 3MJEA 3QQPA 1OAAA 4YYZA 1MP0A 2CNBA 3AUSA 3PGXA 1KVUA 5A5FA 5EJ2A 4M49A 2Z1NA 3EY4A 3FBTA 1H6AA 3F4BA 1C0LA 4CQLB 6ADHA 3PJDA 5TT0A 2EJVA 1JVBA 1Y8RA 3GZNB 4RLHA 1U3UA 1WW8A 3DFUA 4CJXA 3H4VA 4FR5A 1D1TA 5DBGA 5A9SB 4YJHA 4YJGA 1MG0A 1E1MA 3MEQA 3LT2A 2NV6A 2Q1TA 4I5EA 3VTFA 4R9RA 5F5LA 2O4UX 5BR7A 1RYEA 1NQAO 3QWAA 2I3GA 5JMPA 2Y0EA 5L7YA 5HS4A 3SVTA 3N74A 2BFOA 1MC4A 2X22A 1RWBA 5EPOA 4EJ6A 3FWZA 4FFRA 5F1OA 2G17A 1WNTA 1LDBA 1DPGA 3E82A 1DHRA 3K96A 2D5AA 1QYXA 1Y9EA 3GDGA 1DJNA 2WD8A 4R3WA 4JROA 3RUAA 3BIOA 4J1NA 4YJHB 3GGGA 1GV1A 4IPTA 3DTTA 3L6OO 4OL9A 4YJGB 4IIVA 5T67A 1BXGA 1PGNA 4ONEA 4J91A 4XYBA 2X0IA 2O3JA 2AW5A 4YAIA 3AM3A 4Y8VA 2AG5A 5DCWA 2J5KA 3MZ0A 4D0SA 2RH4A 5I7FA 2Q50A 3FR7A 4JXKA 3VZSA 1AHIA 3UF0A 4BNKA 1KVQA 1WMBA 3GVIA 2I76A 3NGXA 3PJGA 1EFKA 4LW8A 4ZA2A 2NM0A 3DHYA 4HXYA 1HSZA 4U6QA 3AFNA 3ON5A 4CLOA 2ZB7A 1CEQA 2R00A 3RKRA 1LBEA 1J5PA 4FFLA 1BXZA 4XYMA 5IZCA 1J4AA 2VNSA 5KJ6A 1KEWA 2I67A 2V6GA 4XB2A 4B4UA 4DQXA 1UUFA 4EGFA 1R37A 3WBFA 1I2CA 5TC4A 1QLJA 2YHUA 1VKOA 2GCGA 2H6EA 1UJMA 2Z1MA 2VHXA 2Q2VA 3NTRA 3CPSA 4ND4A 4UVDA 1PJ2A 4BNWA 2EXXA 5JMWA 2J3HA 2IXBA 4PLYA 3WFIA 2EGHA 3WS7A 4YRAA 2Y67A 1BDBA 2C07A 5G4LA 1ZVMA 1I3LA 1C1XA 3RWBA 4G5HA 2P4QA 1PJSA 4Q9NA 3WYEA 4IIUA 4CM9A 3DDNA 4KUHA 5BT9A 2NADA 2CDBA 1CETA 4A0SA 1BTOA 4E12A 4W9NC 4J7CA 2RHRA 4BNXA 1I3MA 1RJWA 3E18A 1BHSA 5H83A 4CQMA 4WLOA 4R3NA 3QVOA 3OA2A 1R0SA 4M54A 4OJNA 2WYVA 1GYRA 4GWGA 2C5EA 4Z6KA 1EVJA 2X86A 4BO8A 2C59A 4WCDA 5FFFA 4OO3A 3RVDA 2DU8A 3VPGA 5IN4A 3CIFA 1JWAB 2DUWA 3A28A 4RJTA 5DULA 1U28A 4N5MA 4KQWA 1PJTA 4C7KA 1HKUA 1I8TA 1Q7CA 4J1QA 3X2FA 2DPGA 5ADHA 1YB1A 2VUTA 3HE3A 2FP4A 4RZHA 2GERA 1C1XB 1PJQA 3DOOA 2E37A 1SEPA 4QFDA 1Y8QA 1EUZA 1N5DA 1P1HA 3ROMA 1ZZEA 2V7PA 2CVZA 4CQMB 1HRDA 4AJPA 9LDBA 4J3FA 1WZEA 1YB4A 2PGDA 2PKRA 1L7DA 1ZK4A 1GYPA 1BVUA 3EYWA 3RFXA 4WLFA 2YFHA 4E4YA 4XIYA 4Q3NA 4CMIB 4CM4B 3HSKA 2FPIA 5JCJA 5DP2A 1YQXA 1HXHA 2NU8A 1DRWA 2VHYA 1ZFNA 2GR9A 3KZVA 4R54A 2EW8A 3RBZA 5T6BA 4CMEC 2X9VA 4R1UA 1B0AA 1LDNA 1YWGO 1HWYA 1DAPA 5U9CA 3IP1A 1J6UA 2GLXA 3KEQA 4YQYA 1QYCA 3GGPA 1E92A 1BVRA 1RM0A 1V6AA 3BXXA 1Y8QB 2WTBA 2OXIA 5ICMA 1PWZA 4J9VA 5IAAA 3GK3A 4UUOA 3SEFA 1CJCA 2R2GA 4MKXA 4NBRA 1HDZA 2E49A 3MJCA 4CLHA 3I83A 2OP1A 2NACA 1ENOA 1UAYA 4PZEA 3MJVA 1B8UA 5ENVA 3JD2A 3U49A 2WWRA 4I08A 1A27A 3U3XA 1EQUA 1DFHA 3SJUA 4W82A 1I24A 1E7WA 3H6KA 2R00C 2NVUB 1U8FO 2X23A 1QP8A 4Y6SA 4JCOA 4LRTB 5IZCC 1EDZA 5CAEA 3DZHA 3H2SA 4P22A 4ZQEA 5AYVA 3L4SO 4WNCA 2Y68A 2CMDA 3D64A 3WNQA 2W2KB 1Y81A 2C7GA 3UICA 4J2HA 4NBUA 4I1IA 1U3WA 4LGVA 4FJ1A 2VHWA 4IGFA 4NJMB 3RJ5A 4AJJA 4YT4A 3LLSA 1GEEA 4H7PA 3G1UA 4L8VA 3KLPX 1MXFA 4MVJA 5T5QA 1T2CA 3VHRA 1LJ8A 4TVOA 3D7LA 2YV1A 3JV7A 1Z45A 1OC2A 5T57A 3ENNA 1KERA 4PZCA 1Y9AA 1YVEI 3SXPA 4BNVA 3IIEA 3GFBA 3JYPA 1CIVA 5G0WA 4JQCA 3D3WA 4YA6A 4E2XA 2I6TA 5THKA 1ENPA 1JKJA 4XRGA 3ZNPA 4D43A 3LDHA 2H63A 4IQ8A 4NK5A 1U2DA 1K6JA 3GVHA 3BTSA 4M55A 4IDFA 4KTVE 3DEYX 4R51A 4J90A 4C4OA 1PU2A 3B1JA 3F5QA 4RORA 4QUKA 1EBFA 4TQGA 4CM6A 4D3FA 3VZQA 1QKIA 1KVRA 4QX6A 4OAQA 1MC5A 2WM3A 3ICPA 3EW7A 4YAJA 5JLAA 4DREA 4DA9A 3QSGA 1A71A 2JCYA 4YWJA 2ZYAA 4MIOA 4AG3A 3GMSA 3L07A 1P77A 4P4GA 1I32A 2QYSA 4DIBA 4GSKA 5G0TA 1YJ8A 3BZUA 4UVGA 3B6ZA 1UZLA 4U8GA 3V2HA 4F46A 2G1UA 3E6AA 4ND3A 1SOWA 1UXHA 4P38A 4DPKA 5BQFA 1KC1A 3WG9A 4LVUA 4NH4A 5EL0A 2BLLA 1DAOA 3TDKA 5TJ9A 3FPCA 1ZJYA 3HDJA 4XGKA 2CF6A 4AJHA 4ZGWA 1AGNA 1T1SA 2CF5A 4RQTA 1T2DA 1XKQA 4ZICA 1J49A 2YYYA 3GEGA 4DYDA 2PV7A 3DZBA 1FDVA 3DBHA 3CZRA 2G5CA 1EVZA 1YL5A 1GUZA 1WP4A 2WE8A 4D45A 3DL2A 2WJPA 4OKIA 4PLVA 4BNJA 1MFZA 3UOGA 4B8WA 3WICA 4U5QA 1O89A 2DM6A 5JFOA 3WGZA 4DBVO 4MVJF 4D3DA 4ZQBA 3RBVA 5DN9A 4RL6A 1JVSA 4RCVA 1R4MB 3PI7A 4GBJA 1F14A 1HT0A 1M6WA 5ITWA 4A73A 3MTJA 3GVCA 5JDCA 1I36A 3IDSA 3CMMA 4J49A 1FDWA 3LU1A 4GH5A 5IDXA 4YQZA 1GD1O 1LQUA 2C54A 3CSDA 4HNGA 4RF4A 3JQDA 3ZWVA 2Y93A 3E48A 2QX7A 3UUWA 3D3EA 3K2EA 4CLDA 4FN4A 3KLMX 5DZSA 3ZWWA 3LK7A 4H15A 3VC7A 1PX0A 3OBBA 3B1KA 3QHAA 2VYVA 4GKVA 1E5QA 3NT4A 3GPIA 4NK4A 1DRVA 2H1SA 4PLCA 3DBRB 4XWYA 1NPTO 3AY7A 5KIAA 3CTMA 1JWBB 3H8VA 5ITVA 3G3EA 2RIRA 4S1VA 2X7HA 1JKFA 1PWXA 2HCTA 3FN4A 5T64A 1BXKA 4FIZA 2A92A 3FNFA 3GRKA 2Y1CA 4AJKA 5I7EA 1Q0LA 3FRJA 1LDEA 5AVOA 1GQ2A 1GPDG 3DAPA 5DP1A 3JQAD 3UHAA 2DBZA 4CR6A 2E6UX 1PTJA 2W2LA 4CM8B 2FRDA 4BGUA 1PS8A 4GVLA 5I9MA 2ZTUA 5B4TA 3WR5A 4URFA 4OXKA 2O4CA 1IY8A 1HDOA 1YL7A 2GN4A 1E1KA 1H6BA 4K6CA 4F6LA 4EI2A 3WQRA 3KETA 3AUTA 1V3TA 4YJDA 5L3ZA 5AXBA 1HSOA 1TA4A 4CODB 4P4LA 5B4UA 2W98A 2ZB4A 4GQAA 4P8RA 4XDYA 3RFTA 1YH3A 2Y0CA 3AUUA 3NYWA 4D0RA 2ZJ0A 4WLNA 3C7DB 3DAFA 1QXSA 4QT0A 4LK3A 1UXIA 2WYWA 4YAEA 4XQCA 3ZU5A 2V6MA 3GN1A 4HP8A 1M76A 1VJTA 4JP2A 4OM8A 4J4HA 3C1OA 3ZWAA 4N18A 4FFOA 2Y05A 3QIVA 5CDSA 2GNAA 1Z82A 4E13A 5KJCA 1NR7A 3DB2A 3QVSA 4GX5A 2DAPA 2DPHA 1CDOA 3HFGA 3FSRA 3WBBA 1DJQA 3WTCA 2DFVA 2GSDA 5TGDA 5KNLA 3NT2A 1NHGA 1DEHA 3K6JA 3I9MA 1XDWA 3VAZA 2ILTA 5HS6A 3JQCA 5TT1A 1WXDA 1E3EA 3W4JA 1EUCA 1DSSG 3C7CB 4HFMA 4IDAA 3RIHA 4L9RA 4BNLA 2NVWA 3BMQB 3OQ1A 2TMGA 3GH3A 3JD1A 5HM8A 1BSVA 4B7XA 3WGOA 4G2NA 1MUUA 2OHXA 5JDCC 5L53A 4UEOA 1P1IA 3N7UA 1YDEA 1NFRA 5JW6A 1HYEA 2HJSA 3AI3A 1GYQA 2X5KO 2PWZA 3GVPA 3DZKA 3WLFA 1ENZA 2O3UA 5A05A 4EDFA 1EDOA 2JFHA 4NMHA 5JBIA 5MDHA 4GL4A 2OOSA 2PD6A 2VZ0A 1ISIA 1IZ9A 1YJQA 2CVQA 3EDMA 5ILGA 2Q4BA 3ZNQA 1PIWA 5HTOA 3E5MA 2R6JA 1VSUA 1O8CA 4BKQA 4NI5A 2IEDA 2Y1EA 3ZN2A 2A94A 4IDGA 3RUDA 4ITUA 3OIFA 4AJOA 4GKBA 4D41A 3PWKA 4TKMA 4ND1A 4FW8A 1UP6A 1SAYA 1ZSYA 4M8SA 3SLKA 4OHUA 2HK7A 5EQFA 4E3ZA 3PLRA 2I5PO 2Y66A 4KUGA 4Z9XA 1N9GB 1U3VA 1ZXLA 2B83A 1HTBA 1BWSA 2CDCA 1K2WA 1IPFA 4W4TA 1B3RA 1Q2XA 3PIDA 2W4QA 4IJWA 3U4DA 3GOHA 4IDDA 3BTOA 1XLTA 4WOKA 4RF3A 4E33A 3GNSA 4ZHSA 1VL0A 1PQUA 3LT0A 2IRWA 2FR0A 3GGOA 5IN5A 4AJIA 1E3WA 3W4IA 3JQ8A 3WGGA 3RQSA 3ETEA 3FTNA 5A03A 3KO8A 4CL8A 1MG5A 3U62A 1QRRA 4XDZA 1HETA 4IJKA 3I4CA 2D4AA 2FSVA 3PDJA 3DZIA 4ZRNA 5TS3A 4OSOA 3BHMA 2DLDA 4NBVA 2IZZA 3V8BA 1P45A 3ONDA 4U6SA 4XGNA 1VLLA 3OA0A 2OFPA 3OECA 1HDRA 2QRKA 1H6DA 5B12A 5F3RA 1KOLA 2PD4A 3RUFA 3ZNOA 1T1RA 2EG9A 4FFPA 3MTGA 3ASUA 4RLSA 4IINA 4FPXA 3K8ZA 3KSUA 3JQAB 3ZWOA 4BNUA 4IQGA 1M75A 3AM4A 4B7UA 4TROA 3ZDFA 5H82A 1TT5A 1W8DA 2D0IA 4U7WA 2WMDA 2HDHA 4NU6A 3U09A 4E5NA 2EEZA 1HZZA 4UEKA 3C1AA 2GYYA 4BNNA 1YOVA 3JYOA 3MOIA 4L4XA 1QYDA 3F5SA 4O1MA 5BNFA 1LXCA 2Y1OA 1LSJA 3LSYA 1VL8A 1TB4A 3V2UA 5JSFA 1OFGA 3ETGA 3GUYA 3DZJA 4LSWA 4Z9FA 2E4AA 1DC3A 4WCFA 5JAIA 3ITKA 4WNIA 3WQSB 4ALLA 4R1NA 3H7AA 4E32A 5IXYA 2HRBA 3O8QB 3VDRA 5L40A 4IBOA 3C1TA 2RAFA 2NU6A 2ZTMA 2CY0A 2D5CA 1UDCA 3DR3A 3L9XA 4FJ2A 4J0EA 2Y0DA 2AMFA 3DXFA 4AJLA 1E6UA 4XD2A 5EIOA 2BFMA 4AJEA 1TT5B 3WFJA 2G0TA 1VRWA 3OF2A 1R15A 4GX2A 1ISMA 1YOVB 4J0FA 3BTVA 2HU2A 2X0RA 8ADHA 1HYHA 4KQXA 3P5SA 3BMNA 3GG9A 4A5OA 3ROKA 4PN3A 1XCBA 1A7KA 1PL6A 2AHRA 2IXAA 3CXRA 2JKVA 3PVZA 3R0IA 4BB6A 3PQDA 2O50A 4CQMD 5C7LO 4ID9A 4PFJA 2Y99A 2AE1A 3KTDA 3H2ZA 4HFJA 3V1UA 1T24A 1DB3A 5H81A 5F5NA 1XELA 4TRRA 2O2SA 4HX5A 1ZKMA 4JJIA 2O3SA 2BI8A 2WDZA 3TNLA 3PQFA 2Q4EA 3W6ZA 3ZV4A 5CEJA 2EP5A 4GGOA 1DHTA 1UAGA 3S2GA 2XOXA 4RF5A 1D8AA 4R69A 1BW9B 4PLGA 2I65A 4TWRA 5KJ1A 1DXYA 2SCUA 4IS2A 1X7HA 2P9CA 1K6XA 5K6AA 5G4KB 3WLEA 4CR7A 3OFSA 1MGOA 3PJFA 4DLBA 2VOEA 2P9EA 1R4NB 4AL4A 2WYUA 1G6KA 4RGBA 5I9LA 3PWSA 2AQ8A 1A9YA 1O5IA 3TZQA 4NR0A 3H5RA 4UREA 5JCJD 1TT7A 3SBOA 1SB8A 5GY7A 3TQHA 5L95A 1DFGA 3BHIA 4JJGA 4GX0A 1BMDA 4F3YA 3ZV3A 4PLFA 7MDHA 1Q7BA 5DOZA 3JQ7A 1Z75A 2GASA 4NFYA 2GUGA 3KV3O 4CLRA 3FR8A 1LRLA 2A35A 5KVQA 4ZN6A 3HDQA 4R68A 2BMAA 4BO3A 4HFRA 1Y8RB 4FC6A 4TRNA 4A26A 3UVEA 4LCEA 1XYGA 3ZU2A 3FI9A 3U0BA 2AQKA 4CPDA 1ZEMA 4DLAA 3RKUA 4R9SA 3CE6A 3GLQA 3JCZA 4PLZA 3ZCXA 4PRLA 1YQDA 4II3A 1UXJA 1DIGA 2DKNA 3PYLA 2AEMA 4JGBA 4ND2A 4QQRA 1NNUA 4WCFC 1ADBA 3GY0A 3KOUA 3UFXA 3EMKA 3I9LA 3PFFA 3JQ7B 2UYYA 2C29D 1WMAA 4NHEA 3SX2A 4OSPA 4CLRB 2VHVA 2P4HX 5JC8A 2NTVA 3QW2A 3TSCA 2FPPA 3MWEB 2HKIA 5BSGA 2B5VA 3I6IA 4DXHA 5CDGA 2ZIZA 4W6ZA 4JBGA 3TWOA 1H9AA 3HB5X 1NXQA 3ZWMA 1C3VA 5JO9A 3HHPA 3OM9A 1EK5A 2JJYA 3E9MA 2EF1A 3G17A 1GU7A 2UVDA 4Y98A 4WKGA 1BXGB 3NRCA 2EKLA 1CERA 1P1FA 3KM0A 1TEHA 2YUTA 4NJOA 3U5TA 4GPD1 2J6IA 4OKNA 1MFPA 3K30A 3TRIA 1W6UA 3V5NA 4MVJH 3K5PA 2JHFA 3ZWXA 4HNHA 4CMJA 1H93A 5G2OA 2Q1WA 1NPDA 2PZMA 1P31A 3VTZA 1MXHA 4CLOB 7ADHA 5CG1A 1NQOA 3PYMA 1MLDA 4O5OA 3KVOA 1PJ4A 4EUFA 5K6AC 1R66A 3KSZO 1ARZA 1UZNA 4II2A 4ESOA 1A4UA 1YBAA 3FD8A 4A2CA 4DPLA 2NTJA 4WPGA 2ZYGA 1B14A 3EVTA 3MWDB 2O2YA 4FS3A 2OGUA 3BMCA 1I5RA 1E6WA 1JDJA 4R1SA 3TL3A 4XZ3A 3ADOA 4GMFA 3ZNNA 1DIAA 4BKUA 1ONNA 3VZRA 2C20A 4DC1A 3GNQA 3PHLA 4O63O 3RC7A 4BO5A 4RPLA 1M2WA 2PZJA 4BGEA 5JYDA 3AK4A 2PKQO 4FGSA 1GZ6A 3S2IA 2PD3A 2PNFA 4CM3A 4CLXA 4J7XA 4YJFA 1UDAA 4I5GA 1VL6A 3PK0A 1M67A 4PLTA 4EEXA 4NIMA 2AA3A 1PGOA 4GVXA 3ROPA 1X7GA 5G0UA 4E2WA 3I23A 4QEDA 3NTOA 2VQ3A 2IYOA 3GHYA 3OH8A 1E7QA 2EJWA 3B1FA 1KY4A 4YT8A 2ZYDA 3BMOA 2DBQA 3LLVA 3WWZA 3LQFA 5JNLA 3LZ6A 4E5PA 1QLHA 3AOGA 5JY1A 3WSVA 2ZKLA 2FR8A 3WGQA 1RPNA 3HDYA 4YJFB 3OJEA 1PR9A 2JD2A 3WSWA 3PHGA 4FOOA 1PEDA 4UULA 3VPFA 2YDXA 3ZWNA 4PGFA 1H9BA 1G0NA 3SJ7A 1J0XO 4BO0A 1ZXBA 3I6QA 1NQTA 3QY9A 1MA0A 1ULSA 3KSDO 5A5EA 4ZQFA 4CUKA 4HY3A 3W8EA 3ZU4A 2YQ4A 3W6UA 1UR5A 5B1YA 2Q1UA 1PJBA 4MOWA 3WGTA 5KVVA 2X6TA 4OH1A 3E03A 3WWYA 1V8BA 1TVEA 3JQFA 3GNTA 5A9TA 4W99A 3U4CA 4BNTA 1AXGA 3PTZA 4XA8A 4BGIA 1DIHA 1LU9A 4XQ9A 4BNZA 3TOZA 2FSSA 3UKOA 5BSFA 3OIDA 3UGKA 2ZK7A 2VWPA 2NUAA 2VN8A 4ALNA 3DBLA 5CEFA 1WAMA 1N7GA 2W2LD 4ND5A 1QYWA 2XXJA 5TJHA 4BIIA 4Q3EA 4MP6A 4FSHA 5KKCA 3L0DA 5TX7A 3PZBA 3QA9A 4AVYA 5IDQA 3AWDA 3UW3A 2EW2A 3WNVA 5CHEA 1WWKA 3O26A 2FOIA 4AJ4A 2HJRA 2GZ1A 5G0SA 3D5TA 1C14A 5F1KA 2AE2A 1PSDA 5HA5A 4Y9DA 1ADFA 2DTDA 3WMXA 1X7DA 1GZ4A 5KOIA 3PIIA 4I9NA 3H3JA 1CF2O 1H5QA 3GR6A 1FF9A 5TIIA 1ZO8A 1BG6A 3DBLB 4RF2A 3VOSA 1RM3A 2J3JA 3EZYA 3I9KA 3QWIA 1HLPA 1NVTA 3S8MA 3W8DA 1Y5MA 2DC1A 2BF7A 3ZHBA 1KBZA 2NWQA 3D3WB 1E77A 4HBGA 2VWHA 3ANMA 1QYVA 1JU9A 1LNQA 3ZHXA 2QRLA 2AG8A 1XA0A 2BGMA 4R5HA 1SEVA 3H3FA 3EZLA 3KUXA 5TSDA 4L0QA 3C8MA 4A10A 3MJSA 4YVFA 4Z3DA 1GCOA 1QG6A 2DTEA 2EGGA 3SC4A 2B69A 3TZHA 1LTHR 3KYDA 5C3MA 1I3KA 5G0VA 2ZCVA 4IJUA 1IULA 1GQQA 4RVUA 1V35A 2CUKA 4E31A 3KEOA 1LC0A 2Y1FA 1AXEA 4CUZA 3RFVA 3IKTA 1D3AA 4PZDA 3AY3A 4NBTA 4J16A 1V3VA 3RROA 4XCVA 1VKNA 1GDHA 4TKLA 2ZQZA 3WGYA 1IHXA 2J5QA 5U4QA 2GN9A 2E48A 2Q49A 3CUKA 5JDIA 2OUIA 8LDHA 4XRRA 1P3DA 1X1EA 1ENYA 1PGJA 1WVGA 4NDNE 5DBIA 1SMKA 3AI2A 4JBHA 5DCYA 1O9BA 2O3RA 4O6VA 1KYQA 1GV0A 3QVWA 4YR9A 1B8VA 2GN6A 3ROQA 4YB8A 1KS9A 4NFHA 4PG4A 3PGJA 5COAA 4PG7A 5L7WA 2VRCA 3L9WA 1YRLA 3B20A 2JAHA 3DBHB 1EMDA 3PEFA 3DFZA 3HG7A 3I9JA 4Q3BA 4LSMA 3NJ4A 3R1IA 3ITDA 1T25A 2J5RA 4WUVA 1GCUA 3GMDA 2HMWA 4IXWA 3RAJA 3VDQA 2NNLD 3S2FA 2TMDA 4UVEA 1NFQA 4B8ZA 4YBZA 2G82A 2ZCUA 2Q99A 5IFLA 2E82A 4WOJA 3SLGA 1IYZA 5ER9A 3FPLA 3RUCA 3F3SA 4WECA 4OQYA 4QO8A 2FZWA 1MV8A 3DHEA 2O7QA 4EEZA 4D79A 3D5QA 5COQA 1HE5A 1HZJA 2F00A 3O38A 1ISGA 3IUSA 3PRJA 3Q9UA 1YB5A 4E2ZA 4HUJA 4E5MA 2YV3A 3EC7A 1E5LA 2PZLA 4XB1A 1E7YA 4CM5A 1HEUA 2VWGA 1B15A 4BMNA 3QE3A 2Z5LA 3OJOA 4K1LA 2DQ4A 3BYZA 1A4IA 4MP8A 5GMOA 4H3VA 5KVSA 1O0SA 2XXBA 4YRBA 1GR0A 3UCFA 1F17A 1EVYA 2VTEA 3A06A 4DWVA 2GF2A 5IZ4A 2QZZA 1W73A 3UH1A 5A4DA 3L6DA 3V1TC 3GUCA 1IPEA 3Q6IA 4NBWA 2GD1O 2BGKA 3WDSA 1W4ZA 1XQ6A 2IDZA 2VT2A 2JAPA 1Q1NA 4EYEA 3KHUA 1H2HA 3ICCA 4ZJUA 2LDXA 3H65A 5JCXA 4YXFA 1DO8A 1P0CA 1X14A 4RZIA 4RV9A 2PFGA 4AFNA 4ZD6A 1D4FA 1P1RA 4MINA 3U4IA 1PGQA 3HJAA 1GADO 4JNKA 2Q1SA 3A14A 3OEWA 4TSKA 1JAYA 2FZEA 2YHIA 2Q3EA 4J1TA 2HMUA 3Q2KA 1SC6A 3GFGA 1PZEA 4DRYA 1FDTA 4FOSA 4MKRA 1E1NA 2A9FA 2JFFA 4GSLA 3U9LA 4X54A 2Y1DA 5U1PA 1IE3A 1A9ZA 5JDIC 1N1EA 2FN7A 3LT4A 5DNAA 1LEHA 4TZKA 2GZ2A 1RM4A 3NJ8A 3DOJA 3PHIA 4B79A 5I9NA 2GZ3A 1U8XX 4J4TA 4J9UE 2GPTA 3ANNA 4KWHA 4XQEA 3GPDG 4PIVA 5EINA 2UV8A 5BNIA 1YL6A 3GEDA 1GZ3A 2ZATA 1NAHA 2YHIB 4M86A 1ONOA 4IZHA 5B37A 1X13A 2EKPA 3TL2A 1Y6JA 1M6HA 1T2FA 2J3IA 3S2EA 4EBFA 2YZ7A 3OJFA 4FDAA 4CV2A 2B0JA 1ISJA 2QG4A 2YDYA 3N58A 3GA0A 1ZSNA 4MP3A 4IDCA 2HO5A 4FC7A 4IQ0A 4EUHA 1R16A 4CLEA 3EAGA 3GC6A 3Q1LA 3PWZA 4MVJI 4DL9A 4RVFA 1ZBQA 4K9DA 3KRTA 5JAQA 1H94A 1QSGA 2V6FA 2X58A 5KJEA 2PTGA 2HMVA 4XJTA 1X15A 1XQ1A 2PA3A 3X2EA 4AJ1A 4WLUA 4XGIA 2B36A 3ONFA 4BKOA 1BGVA 2O48X 4CR8A 2H9IA 1NYTA 3CMCO 3DQPA 4N7RA 5ENDA 1OMOA 4B3HA 2NU7A 2HMTA 3F4LA 4LMRA 9LDTA 4EJMA 3QVXA 1JW9B 1EK6A 5KTKA 3JQBA 3Q3CA 5HBRA 1Z7EA 2VUUA 2GDZA 2B37A 1LDGA 4FQ8A 5JY6A 1EE2A 1O95A 1U7TA 4CMKA 1XG5A 2DFDA 3DC2A 3W1VA 3V2GA 4KWIA 3I9NA 4LN1A 4E5YA 4PVDA 3TPCA 4QFCA 2B4RO 3JYQA 2DVMA 4DQVA 1VSVA 2RHCA 2GN8A 4JJFA 1E7MA 3F47A 3P19A 3JQGA 3E8XA 4PLPA 2HK9A 1G0OA 1E7SA 1V3UA 3BA1A 3ZWPA 2JL1A 3CINA 5L4LA 4BVAA 4BO9A 3C85A 5JC1A 4PG5A 3UXYA 1F0YA 4WEQA 2FMUA 3IKVA 3PHJA 2OMEA 4RO0A 1HE4A 5LCXA 1LI4A 4BNGA 1E3WB 3JQ8B 4JN6B
chains in the Genus database with same CATH superfamily
1AE1A 5KNBH 3SX0A 4JBNA 4ACBA 4S3MA 4NULA 3NTVA 1OYYA 2OHVA 4IKOA 1E2KA 2ZRAA 5LZ7A 4GBED 2CXXA 2WU0A 4NMLA 1CNEA 4CM1A 4X64B 2GMWA 3WGIA 2QX6A 4YRIA 4ZZIA 1UKBA 4PYLA 4D5EA 1VRCA 5HOQA 1M0EA 2Q5LA 2WD7A 1GZHB 3LPCA 2EG5A 4YP7A 1KYYA 4M1QA 4US0R 2IBSA 1MO2A 3QUTA 4UQLA 3RE1A 5BMVF 4FGZA 2JLBA 1RLTA 1WOMA 4PGHA 4IDEA 1EHIA 1QR6A 2RHGB 2WSBA 3DUFB 1JIJA 3PFWO 4OQFA 3U81A 4RK5A 3ZQJA 4UJ3A 1SCUA 3VH1A 4I55A 4WFQA 3CGWA 1LB1B 2G88A 4H35A 2X19A 4BOYA 1XUOA 4NZ9A 5T8KA 4H1TA 2BJWA 4R1TA 4LGYA 2AN9A 3K8YA 1YR1A 3N6VA 3E2PA 4UMFA 4EG1A 3GZTB 4JI5B 3U2QA 4U0KA 3AM5A 3ZIUA 1INLA 1R00A 3ZCTA 1Y7IA 2HLNA 3SIWA 2WDPA 3IBCA 1U0RA 3GQBB 4JLWA 4Q05A 4EYKA 4CM9D 3ZZMA 4EG7A 1VGVA 3L18A 3B6MA 4MWDA 4P0PB 3PP8A 1OI3A 2N9UA 2MHCA 1QR2A 1A97A 2R6GA 5KQRA 4F2DA 3RW9A 1E96A 3N8IA 1IHDA 4MV4A 1T3SA 4N0DA 4BWFB 5D51S 4DVGA 5AXAA 2F8MA 5FOTA 1A8PA 2P9FA 4KW7A 2QN9A 4YAGA 1U9JA 1V0JA 2BRUA 4A27A 4L8FA 3EHDA 2PANA 1UODA 2B78A 1UPUA 3U7RA 1NJ6A 4DVJA 4JUAA 4EWLA 1JEQA 1HBJA 1PZXA 3INYA 1VJCA 3B3AA 1N2ZA 3MPUA 4F8EA 3IIJA 1S9DA 4RVGA 2C9BA 1PUXA 4CV0A 2JH9A 1PQYA 1EDEA 2P2DA 2XT0A 4NOMA 1IHUA 3B6EA 3T5GA 3G49A 3UAGA 3UM9A 4MWBA 1RKVA 2Q6LA 4YAKA 5E3IA 4J7UA 5FRDA 1KEKA 1GY8A 3H1TA 1YCGA 1YAHA 3BB1A 4YYEA 1B42A 3LHKA 5G02A 2VJPA 1IHYA 4JT9A 2PM8A 2RHLA 4YECA 3GFQA 4AWAA 4F9FA 3BD7A 5KVCA 4FQ5A 3OF3A 2ZOSA 1ZEJA 3WKBA 2ZSUA 1VZ2A 5C34B 4FM9A 1VCIA 4EL5A 4KYTA 1DBWA 1GNQA 2QTHA 3IVRA 3ZWCA 5DDIP 1QBGA 1OH5A 3EW9A 2Z4RA 4L4YA 3HCPA 4ZQHA 5DFAA 4B2PA 3EGOA 3PXCX 2JLQA 4DUGD 4M6WB 2CL6X 3T9CA 4RE6A 2ZSFA 4XB6B 3B48A 4ZZ2A 5JAMA 2XX3A 2SCUB 1U9IA 1NNLA 2AJCA 3IOYA 4M8NE 1YR9A 4ZAGA 3ES9A 821PA 3NHPA 1DP4A 2P67A 5K0EA 2A6PA 3P2EA 1EHYA 3RCBA 3DONA 1ZN8A 2YWFA 1KDRA 3UGJA 1Y7LA 2VA9A 3EHEA 3RFCA 3AEUA 4H31A 5FOXA 3TX2A 3PLNA 1KMNA 2JD0A 3F3MA 5LDGA 4EJ0A 4X20B 1Y6QA 5CDYA 1E2BA 1PV1A 3WQBA 4PRKA 4RIIA 1QPGA 5BSHA 3EVNA 3WLHA 1YT5A 4S2EA 3EJWA 2EJTA 2WEKA 1AHHA 3GPCA 3LQYA 1IN8A 1KJZA 2ATXA 3AUAA 4FE7A 4GLFA 5ITSA 2BYTA 4I9UA 2XEDA 4B3JA 1CZHA 4E2YA 2QM3A 5DTJA 4W1SA 5FFNA 3SXJA 5AUNB 5E7IA 4EHNA 4YROA 4B3TB 4XVQA 1C0KA 1MT3A 2QQGA 4RHFA 3IUNA 4OFXA 3VR2D 1M8KA 1BCRA 1XMVA 2APJA 2JD1A 3WLMA 4LISA 1NOIA 1PLJA 2ESRA 3L40A 1FXWF 4DYVA 1FRFS 4LE0A 4MRVA 5D5QA 2G4VA 2I4MA 5JS2A 4F3NA 3BZWA 5TF4A 4NQRA 3FCEA 2O0JA 1DQNA 4OAOA 1MVOA 1PEKE 2NU9A 1C5KA 2COKA 2JKZA 2QYTA 3G9XA 3KSMA 3DLIA 3GGSA 4LC1A 4ALIA 2XCSB 4BUJA 5HKBA 1CR4A 1V48A 1JKMA 3JTEA 2CSXA 3MRSA 3R24A 1Z0ZA 2BKAA 2ZVQX 4O1IA 3TW6A 5B55A 3VR4H 1I2AA 1UC5B 4Q37A 2FRXA 1OXUA 5BNTA 3MJFA 4EAQA 2V65A 3M49A 4R16A 1AN9A 3FWHA 5LP6C 3WK4A 3SS7X 1DIBA 4QDKA 2RHTA 1TFRA 1DRUA 1VKRA 2CYAA 3PNYA 1NAIA 3IO3A 3UFXB 3TQCA 4FHZA 4N49A 3WLRA 3OIVA 4WERA 5ADWA 5ERXA 1U0NA 1EG2A 4YP1A 2BHSA 4PX5A 4N5LA 1EP1B 1XAHA 1MQSA 1WLYA 5EWMA 3ZV5A 1ZOSA 2CVOA 1CJVC 3BSSA 2GHIA 5EZSA 4DGSA 2FPPB 1M1YE 4RPIA 4QUGA 1E3LA 3M6IA 4UDOA 3JY6A 3ROXA 3WK8A 1XZPA 3UJPA 4ZOLF 4U02A 9ATCA 2XV1A 5DHSA 5AOVA 3VZRA 4TV9A 4RW0A 2H2IA 2TYSB 1VBFA 2X8LA 3OY2A 2IYPA 4KR3A 5EJFA 3I1JA 1RAEA 4LF5B 2GF0A 4NZMA 2BEUA 3MJ4A 1M1NA 5PGMA 2GBLC 5AM1A 3ENVA 1K7EB 2JI9A 4QNNA 2KJQA 5J63A 1SN7A 3N8KA 1CPYA 1EVLA 5EMNA 1AGXA 1SD1A 2PJRA 2ZPAA 4M89A 3PPVA 5NLLA 1MBZA 3LBNA 3TOXA 3VYTB 2HMSA 3MINB 2LIVA 1Q1ZA 1ANKA 5E9JA 4MSUA 3N8DA 4UFOA 3T0FA 3VU3A 4FBLA 1U1FA 3RBAA 4CWAA 1RHRA 3IMGA 1UAAA 1FMJA 4PQRA 2BOVA 4I5FA 1T6NA 2G5PA 4OGGA 4EVIA 3NDJA 1J2YA 3DZCA 3MPOA 1DQSA 5JO0A 3A1WA 3HB4X 1WKBA 1LSUA 1REQB 4NMXB 1F9EA 2QQEA 5F1PA 3T99A 1KYIA 4GOOD 4GUDA 1QGUA 3RUIA 2IS6A 4BS9A 5CGQB 2D0DA 4LXYA 3R3SA 3AJAA 3GEEA 2F1KA 4KQHA 1UWLA 3LG2A 3TM5A 1I6MA 1KEEA 1H4VB 3J7TA 2VAVA 3Q7TA 1KVTA 4HDOB 1V37A 2DT8A 4CV1A 2X15A 4JUCA 1USVA 3EGIA 1RJEA 3VHLB 3NANA 4K6FA 4PAGA 5ADUS 1SBQA 1O97D 3O8BA 3C8ZA 3DMYA 3QU9A 4NQZA 4R2LA 3DZ8A 1UEJA 2D5LA 5ICCA 1XRNA 1RP1A 3WZLA 1F12A 3LC1O 1KYZA 1E2MA 2P8SA 4KOAA 3ER6A 1LNSA 3BWXA 3FNRA 4UVHA 4LF8B 4ZI7B 2JFGA 3BMCB 1S9HA 4FX5A 3RSOA 1RMTA 3CE9A 4YEDA 1GTMA 3V97A 2O07A 2J3LA 2H85A 2W90A 2B4YA 1DE0A 2F2TA 1KAOA 3TINA 3PGA1 1F0KA 1DEXA 3WJ7A 1AMUA 3M5DA 2ST1A 2IE0A 3EWIA 1H0HA 3ANLA 3KYBA 3LYHA 1GL3A 1EXNA 2V54A 5IVIA 1IM5A 4ZOQI 1GTSA 5C7IO 1J7JA 4JBXA 3OU2A 1M3SA 3F6CA 3FPGA 2QU7A 4Z0HO 2BV3A 4KE6A 4L0MA 4AYWA 5DM70 2GPNA 3KZ1E 2NVUA 1F2UA 3ER9A 1HDXA 2JARA 3A9TA 3ASYA 2P6NA 1X7YA 2O5RA 3U3ZA 3ZCQA 4ZGGA 3C3YA 1SCDA 3RVNA 3ESQA 4RDHA 3WRVA 1BMFD 1TD9A 4ZV9A 3S1LA 1D7OA 4D56A 4F21A 2ZSHA 3K0AB 3TLXA 1Y1RA 4EH1A 1NXVA 3G0OA 2ZUWA 4MVJP 5HF8A 4NJMA 1U2GC 3KWMA 2CNDA 3N2LA 4QSMA 5JPIA 1XP8A 2X5JO 4NH0A 2VK2A 2FPXA 3WV4A 2P4UA 3E9DA 1A9PA 4KIWA 4AS1A 2FMIA 1Y4DE 3L6RA 1A0OA 4JHXA 4MTCA 1V4BA 3GDOA 3WJ2A 1VJGA 5TVKA 1VL1A 1Y3AA 2NO4A 2Q45A 1A82A 5DBHX 3SHFA 2EATA 1V2HE 3NT5A 4LQLA 2GK7A 4HF7A 4BY9E 1SRRA 1KVSA 4DMRA 4YPOA 1JQAA 2C4HA 2RHHA 2OZPA 1XR3A 3CB4A 4A8JC 2QTFA 3ZD7A 3CONA 1GQYA 4X7BA 4BU0A 1QZUA 5B6JA 4JT8A 3RYHB 1AO0A 3GJ7A 4M1OA 5K3FB 2GJSA 1LJUA 2XNCA 3KIPA 2HHAA 4MUEA 4PS0A 3JVIA 4ITRC 5CP8A 1SUAA 4A03A 1ZMOA 4UMDA 4UUMA 3SEAA 4DDWA 1E8NA 4JGGA 3ELBA 3HB9A 3QUQA 4KO3S 3BD9A 3FKSD 1OPXA 3TIFA 2EW1A 3MYRA 5B2ZA 4LY9A 4DEYA 1LQ2A 5JH7F 3DV2A 4ITVA 5IT0A 4XM0A 3SYRA 4ENQA 3JVUA 3A27A 1PG0A 5F21A 4KVZA 2QRVA 5FR2A 3L1IA 1AUPA 3T9AA 1QGZA 3EEQA 3OCVA 4Y1EA 4D4GA 1S6YA 1LBQA 2ZRLA 1B3BA 5IM5A 3BQNB 3DAGA 3OG9A 4Q66C 5K4AA 1SZJG 2QB5A 4HQLA 1VLHA 2ZJ7A 4TN5A 4W9MC 4WFJA 1GSOA 2MYTA 1SA0A 4XYEA 1Z5NA 4CDMA 3NP7A 1OLUA 3TXYA 1HOTA 3SVLA 2CDRA 2H92A 2H1LA 4L73A 5L51A 3ZHQA 1DWQA 3EPPA 3ZX4A 4X8HA 4HMQA 4DUYB 1TEXA 1ODKA 1KORA 2YRWA 3NIGB 5EVCA 4JI6B 2HLHA 3BXEA 3LVFO 1Z4OA 1V95A 3ROFA 1S7CA 4MI3A 5AW0A 1AF7A 2X1HA 1M7HA 3DE6X 3ET4A 2JRLA 3IQZA 4G5RA 3T7IA 2VTBB 1WCV1 5CDFA 3BGWA 3BH7A 4NARA 3OT5A 4S1PA 1OXMA 1H23A 2Q2WA 4UHFA 3TFOA 3FYCA 3OT1B 4YTEA 4EX7A 1JFSA 1CRPA 4XE5A 3EZ6A 2FAXA 2GJ4A 3NHYA 4MMXB 2J9FB 1GTRA 2NZVG 1IL0A 1VGRA 2YMQA 3ILSA 1N5KA 1DAKA 1LX6A 3J81k 2R8BA 1Z2DA 3TGLA 4KTTE 4MYTA 2XW6A 4GM1A 4NAHA 4OOEA 2Y77A 1ULUA 1JEOA 1DXQA 4IIYA 3NNNA 2Q2NA 3KEMA 1HTTA 1L4HA 3FWNA 1YBVA 1TF7A 4IEEA 5FBLB 1Z73A 4JIGA 4AYXA 3LUPA 4WACA 2CHQA 3LSTA 4OUDA 2A5GA 4DPMA 1H4QA 2VRWA 1EI9A 4PBTA 5GTDA 4E4RA 3CG0A 1TM2A 5AM3A 3V1YA 3R6WA 4QULA 3WADA 4NYIQ 1PLKA 4XLLA 1E4VA 3ZGYA 4C4ZA 2N42A 5KKAA 1KZ7B 2B6NA 1KK0A 3I6YA 1XP5A 1YGYA 5KNDA 1W29A 1ZHHA 2NOAA 4DV5B 1POXA 4RTSA 5F7ZA 3ZWBA 3G02A 4J0GA 4DW8A 4IZOA 4MR8A 4E5VA 2IZ7A 1U1EA 1JU4A 1D4OA 3F73A 4QOEA 4WLEA 3IAHA 4UEJA 2EIHA 2M32A 5LQRA 4FCVA 4HAOA 1EIWA 2FEMA 3KLBA 2VP5A 2ZBRA 1IONA 4X44A 1IY0A 1C8LA 721PA 4LZWA 4Q4JA 4AY4A 1BN6A 1J2RA 2DQKA 1G8FA 2VF8A 3GQVA 3ILXA 4JYPA 2GCNA 3CR3C 4XKJA 3R8FA 4RY0A 2C94A 3M9LA 1LLUA 1QFSA 3IAUA 5EERA 4PLHA 1MVLA 3O74A 3OJLA 3U4GA 4EKEA 5KO2A 2BSQA 1O95D 4AO7A 1PV4A 2H3HA 1W25A 3HPRA 3QKSB 3EFBA 3PD1A 4U4AA 4D9FA 5E9QA 4GGPA 1KDOA 5HK9A 3NC1C 3QWHA 1QORA 4TWZA 2V7GA 3H42B 2ZSIA 3QLVA 4BAUA 1KI6B 2Z04A 3JTMA 5KWEA 1APBA 2ATCA 3FWPA 4G25A 4G89A 3NEPX 5C52B 3O93A 3OU6A 4IQ4A 3AB7A 5ECYA 2VKTA 1OIXA 2IEBA 1WDLA 4KR2A 3LPNA 2AFHE 4KV7A 3VTAA 5BXQC 2XIQA 5DV9A 3LD9A 1LPMA 4WDRA 2QQ5A 2QN2A 2AI1A 4REQA 3FNEA 5CIYA 3KBOA 2WU1A 5JAZA 4E0BA 2XE7A 4D0GA 2CXQA 2ZW9A 3A6EA 1RMYA 2DGDA 4JBIA 4UZSA 1DUVG 2HNBA 3ZQUA 2ZT8A 1N6OA 1GEGA 3C3CA 2ZP1A 5KNCD 3HVIA 1PR1A 1X87A 4PZLA 3ICEA 1DRKA 4DCSA 3OPYA 2QM0A 4BFTA 1RLOA 1Y1SA 2PFKA 4MUYA 3RTGA 5H4HA 1W7AA 1Z35A 3R3XA 4L78A 4ENVA 1GUFA 3FLBA 1ORHA 1RYMA 2A4MA 3K5IA 3TFWA 5FX2A 5BN4A 3GAZA 4KXUA 3EIHA 3HABA 2V3WA 4GOMD 5IMSA 2BBOA 5HKOA 3SQNA 3QYFA 5SZKB 2PV0A 2HPVA 2O20A 3N87A 4ALKA 3RASA 5JAUA 3ASVA 1JLLA 3IDFA 4DV0B 1XQYA 5E4FA 4X97A 4BB0A 4BDTA 2OYSA 4L3WA 2PMEA 3HZZA 2ZRGA 3VPHA 5ALXA 4F3TA 4AICA 1P29A 2H1OA 2A3NA 1E1DA 5HE8A 4OHOA 1TF5A 3CISA 5AK5A 5IHXA 1DKQA 2HJVA 3HH8A 3HN2A 1ZD5A 2IEYA 2X0JA 3KYCB 2WJ6A 4CTOA 3A1UA 421PA 2C7VA 3H9CA 2Z43A 1SOUA 3TZKA 3KB6A 3TN7A 3R7SA 1B1AA 4KPEC 3AIOA 3IQHX 2OQRA 1X0VA 5DM1A 1W94A 1ZY2A 3FIJA 3A9WA 3GRVA 3H0EA 1PQWA 1TCUA 4P9NA 5FL7A 5LYJF 4XX0A 4RY9A 5FTLA 3NH6A 1I4DD 1ICIA 2XSZA 3E9RA 1N8KA 1C9NA 3IQGX 4X63A 3VR5H 1N7HA 2WFLB 3I58A 1VYTA 2WAYA 5CVUA 1EP9A 3ROEA 1V9LA 2O7RA 4HD8A 3QJ5A 5BOSA 3FZNA 4WRRA 1A8IA 2UZ4A 1PR4A 2NP6A 4PQFA 4MI6A 2XWBF 4XSVA 1YMQA 3DNPA 4TMKA 4V03A 3GIDA 5J1TB 4R4JA 5TGTA 3TTVA 2NT4A 4TSRA 4WEOA 3UBMA 1K97A 2YQZA 4KU4A 4JP3A 5C32A 3N3BC 5E1DA 2JHGA 1E1CB 3JQ9A 4NOKA 4R01A 4URHA 5EMLA 3E3LA 5B3JA 4JI1B 1G20B 1QJCA 4YN3A 4QJIA 4TM7A 4UAGA 2CJYA 3M3DA 2EP7A 3HKEA 4Q0MA 4W9RA 4GYYA 3VX4A 1OJLA 1JDSA 5CDUA 1G9XA 2D1FA 1K0UA 1H6CA 3HCBA 3QVJA 3BAFA 2W9XA 1G3IA 3N8NA 2PCLA 4WE3A 4OM7A 3WKCA 4ECAA 4XVUA 5IBCA 5JROA 1WSAA 5K8UA 3FWYA 5FAXA 1SXGA 1KKUA 1URPA 3L04A 3PE4A 4MUHA 2O8EA 2Y71A 3WMFA 1FLNA 5DPMA 3ZWYA 1NPYA 3L8EA 4AI6A 3T5MA 3UT0A 3EOZA 1ACLA 5E0KB 1KFKB 4HDSB 5CLLA 1E89A 4KO2S 5DSTA 2EERA 4BCCA 5G1OA 4U3JB 2FSHA 3JYNA 5ISMA 1PR3A 4OJQA 5DLQC 4CEIB 1WKVA 5C7OO 3JYLA 2EQBA 1WX1A 2FMKA 1P61B 3NAMA 1ECBA 3IQEA 3SP1A 3VTKA 4X62B 2QYHA 3W1EA 4MDHA 1BE8A 2ECOA 1UC4B 3CVXA 3IP9A 1GZ7A 2FMHA 2Q3JA 3I42A 3LVRE 4MGZR 2JCSA 2EV9A 5A3JA 5CDHA 1P3Y1 4DUZB 3GLFB 4MW1A 1FRNA 3C48A 2C92A 3DAHA 2OO5C 4QL3A 3E0QA 2Q41A 2WILA 3NDRA 4EA8A 1JG3A 4IS3A 3DMTC 2NQTA 2XVZA 2Y1XA 4GRDA 3AY6A 2QAIA 3DR5A 3PHHA 5EHNA 2XHZA 3WLSA 2QRJA 4MPDA 3AU9A 5HRUA 1TJ3A 1V1MB 1K86A 2O59A 4TMFA 4C21A 2I91A 2O5EA 1T5SA 3C5CA 1OQAA 1DC4A 1K6IA 1N8NA 3QUAA 4B3IA 4L4SA 3U61B 4Z8XA 4GNKA 2A5LA 5A7HA 2B9EA 3FPBA 1K3TA 3FGNA 1FS5A 3EC2A 5AIAA 3AHIA 2NPOA 2Y27A 4JR0A 3IIMA 4OQQA 4OHMA 1DIRA 2ENUA 4MGKR 3TNFA 4KITB 3D6HA 3MAGA 2MWMA 1E5XA 5G41A 3N2KA 1BVYF 1DLIA 4ABYA 4N54A 1QV7A 1JSCA 3A6HA 1UK8A 5T6MA 1DELA 4WKPA 1LWNA 3ZH2A 4EMUA 1FMTA 2JGRA 4XW2A 3L7MA 1SURA 1DDOA 3NG1A 1GJRA 1ZH4A 4NMMA 1AXRA 2B1IA 2ZQYA 3K0BA 3K09C 3WRWA 5A1TA 5JS6A 5CVDA 1N6NA 1CB7A 4AUMA 4BTEA 4KYIB 4YXWA 4D9CA 1N9ZA 3N28A 2YFKA 2A67A 4M87A 2HF8A 2W37A 3W2FA 4GOLD 1QTRA 5DEOA 3HB0A 3IC5A 4RJKA 2V7XA 1D2MA 1ES9A 2X4GA 3EOAI 1DAMA 3CX3A 2JBAB 2FGKA 3K9CA 1C9MA 3QPAA 1WW3A 2B4QA 4RNCA 5FNVA 4HADA 1B1CA 3H9GA 4X24A 1VE1A 3OHSX 1AQYA 2BFEA 3UPUA 1AVTA 2IVZA 4RVOA 4ENRA 1NLMA 1Z4IA 3PDUA 4LYHA 3GJ5A 2I2XB 5JFTA 3WZMA 4R9NA 1BGXT 4LDNA 2JW5A 4F2HA 1Z8FA 2FE1A 3K2BA 3R0ZA 4WXRA 1Y3CE 5E9AA 4CL3A 2BGJA 4BRZA 3BICA 3ITNA 1AGRA 3L92A 4YRCA 3H5NA 1ZG3A 2AHOA 1JI0A 1AQUA 1HDGO 1NBOA 1SKUA 2DPMA 4WZAE 1STOA 3WQHA 3CEJA 4Y3UA 2X1MA 5DYWA 5CM8B 4D9MA 4CYMA 4DAOA 3EA0A 1TXGA 1GPJA 2VHZA 4R5MA 3OLCX 1NR1A 2WWHA 3KWJA 1HR0B 4L8YA 3B8HA 3PFNA 1PHPA 3A04A 3H9EO 1AKUA 3IAAA 4ZOBA 3D8BA 4ZVUA 5LQNA 4C2BA 1LSSA 3SZGA 2CJWA 5JYEA 2CUTA 2FEAA 3FUCA 4BLSA 2J07A 4C0SA 4RK7A 3RUEA 3GLHE 4P33A 4J43A 5CBPA 1PS9A 3VSAA 5FBVB 4RTRA 5EMHA 4CIDA 2HCRA 1UBHS 1W35A 3IV9A 5FWDA 1OAOA 2WV7A 1YMUA 2PH3A 2XNKA 3HV0A 4MEJA 5JNTA 5JJIA 1TQ6A 4MI9A 3KKQA 3DZFA 4QASA 3RYTC 5LU9A 2EKZA 5G4KA 2WK1A 1WBJB 1T4DA 3K3PA 4LYAA 4CKWB 3F5MA 1FFYA 3QV2A 2FH5B 4CMGA 3K6SB 1NBIA 2WVAA 5KUTA 3PR1A 4KP7A 2REQB 5EN4A 4OYRA 3HBLA 4F45A 4OY3A 5FQOA 2INGX 1UZMA 2JAOA 1AGPA 2ZETA 3OMXA 5LP6B 1ECCA 2B3TA 3OTGA 3W8FA 4X84A 1U31A 4ARBA 2FFQA 3U7EB 3WMWA 2QJOA 4KPYA 2PY6A 5DXFA 4Z51A 5F23A 2HSDA 2P2GA 3IPYA 3VSBA 4DMMA 5C37A 4CF5A 3FTFA 4EITA 1R0YA 3AETA 4HEQA 1RXIA 2WM9B 1SKAA 2VEOA 2R8XA 3L7AA 3QQPA 2V3CC 4M2LA 4OVKA 1CR6A 1MP0A 1RIIA 1IIRA 3Q87B 2A7QA 2YC4C 3QIAA 1CUAA 5DM2A 5EJ2A 2ZRHA 1KQNA 5A5FA 4JSYA 3RHTA 3GXOA 3TQIA 3FBTA 3BORA 1DMSA 1QGED 3I2KA 1H6AA 4NPHA 1C0LA 1XD9A 4JOBA 4CQLB 5JIBA 1KMMA 5IEJA 1BWPA 1WZCA 2PSSA 3F5DA 4BVBA 4FOTA 1JVBA 1YUBA 3QEJA 3T1HB 5KTSA 1ODLA 3GZNB 5AKJA 5ALSA 5GADl 5A3QA 1U3UA 1JDNA 1WW8A 3H4VA 3MCWA 1D1TA 1PFUA 5A9SB 2VF7A 4GR9A 1D2AA 3SHOA 3KSAC 1MG0A 3L8GA 2NV6A 2GVDC 2Q1TA 4I5EA 1XNHA 1IAVA 4OA8A 4U2DA 3M82A 4CDRA 1NQAO 1PVVA 1ODSA 2I3GA 5JMPA 2Z4SA 2B1JA 1KAEA 2KPOA 2Y0EA 3FYSA 3ZDZB 4MVCA 4C07A 1RWBA 3INNA 4W1QA 4RGQA 4WZBE 3ELWA 4Z5XA 1N2BA 1WM1A 2NYAA 3FWZA 4I9GA 4O4HF 5F1OA 4IH9A 2VJMB 3NHJA 2K87A 1W0KD 3EDOA 3KQYA 4IAOA 4Y0NA 2WNHA 5I4IA 2ZVJA 1JQJC 1LI5A 1QYXA 1WO8A 2D5AA 4FDTA 4GEKA 4NRDA 1EGMB 1JP7A 3A3PA 1Y9EA 5DX0A 3U13A 1QIEA 3PLAE 3AEKB 3H5LA 4KWTA 2AUMA 4RM2A 5FV7A 4JLUA 1KFCB 2H00A 2YWBA 5JD3A 1R7RA 3BIOA 3SZRA 4IPTA 4TT3A 4YJGB 2ZJ5A 5F7JA 3TLJA 1BXGA 4YCCA 5I51A 2RDMA 1V7ZA 1ZH0A 2ORVA 4PYMA 4D25A 1YJAA 3EE6A 3RM3A 4YAIA 1E9VA 1Q17A 3LFTA 2J5KA 2Q5JA 1K27A 1DG3A 4K9RA 2CLMB 3WGJA 4UHEA 3PB3A 1F4VA 4BNKA 1II0A 1KVQA 5HSGA 1UBOS 2WTXA 2EFGA 3LCUA 3PJGA 5IBQA 1FC0A 4G9GA 3RVMA 1Z08A 2EOAA 2JIOA 3CXUA 3PDHA 1L8XA 2AG6A 2GZDA 4YCDA 1Z6QA 1O57A 1HSZA 2QLFA 2UVPB 4U6QA 4U7TB 1KU6A 3FCUB 2WT9A 4RA9A 3EX7C 2VBFA 1K0FA 1G6OA 1NXWA 5DGTA 2K2QB 2ONJA 2FN4A 2ZB7A 2WSLA 3SHVA 2R00A 1BN7A 1DKMA 5KCMA 1BXZA 2XITA 4XYMA 4IX1A 4U7HA 2VNSA 4MEAA 2QN6A 2I67A 5GOZA 3O73A 1JR4A 1WHTA 1UUFA 1GG5A 5FA5A 1MIOA 3QPWA 2IUYA 5DK6A 5TC4A 4EGFA 5HGJA 1IMOA 2H6EA 2Q5IA 1T2NA 3NTRA 3CPSA 1M2FA 2HXGA 4ND4A 1PJ2A 1II9A 3FI0A 4OKSA 4Q4DA 3EFEA 4UVDA 4EMSA 5JWHA 1UJ6A 4EECA 2V3VA 3MWDA 1O6BA 4TVKA 3UK6A 2Y67A 3P0RA 2C07A 4RETA 3WS7A 1ZVMA 2A1UB 4OQEA 1XFDA 1Z2PX 3RWBA 3V6LA 5AP9A 4ND7A 2RHMA 1UOPA 1XPOA 1PJSA 4NEHB 3WYEA 3KYJB 3NVMB 3OCCA 2II6A 1E20A 2NADA 3WNCA 1BTOA 4E3WA 4UNNA 2G1PA 5IAEA 2XUHA 4N8EA 1I3MA 2JFYA 3E18A 7MHTA 5H83A 4WLOA 1QHNA 1XTRA 5IBRA 2Q6VA 2VUIB 1OZGA 2ZQ5A 3IERA 1CNFA 3D9QX 4A6PA 2HDOA 1WLSA 2FZ4A 1EVJA 2X86A 2HY7A 4WCDA 1RKQA 5FFFA 2IX3A 4OO3A 3H2HA 4S1NA 4QTYA 4JBLA 5DULA 1U28A 4RQAA 1NVKA 1ISPA 2C7PA 4IZ6A 3ABQB 1HKUA 4MPRA 4FYXA 1I8TA 1SBCA 3DM9B 5HF6A 3HS3A 4C4YA 3OO0A 4NSNA 4OI1A 2VUTA 4FEYA 4GMDA 2PLFA 2XZOA 3UFBA 4IV0A 1PJQA 3U7JA 4ACAA 4LXQA 1R5BA 1EZ1A 2JLYA 1CQZA 4UUQA 1WV1A 4POAA 3IEVA 4CF3A 5MN4A 4PWYA 1EUZA 1FNDA 3FCXA 4DNPA 3MMZA 3AUXA 4CNBA 4J03A 1CRQA 1P5ZB 1H4TA 4J3FA 4OU4A 1YB4A 2G9VA 1T8PA 2PGDA 3G7SA 4PQYA 4WXMA 5LMNB 1GYPA 1BVUA 2MSKA 4V39A 3DVSX 5J2UF 3VNQA 4E4YA 2J08A 3W2GA 2MYPA 2VHTA 3QEBZ 4CMIB 2VNIA 1Z4KA 2FPIA 1T8TA 1VIYA 2PSJA 1ZCAA 1U0BB 4G09A 2WSMA 5EXPA 3GCZA 1AU9A 3AUJB 4QXRA 1L1EA 3CF4A 4URZR 1ZFNA 3LY9A 1L5KA 3REQA 3TRFA 4R54A 3IPXA 1XZBA 3RBZA 5IJ0B 1HT3A 1OROA 3DDZX 4NZOA 2VT7A 1HWYA 2FP4B 3M33A 1ZOLA 4CN8A 4ARUA 3IP1A 1J6UA 2FN9A 2FFRA 1VBMA 3KEQA 2R68A 5KBYA 2IS1A 1DPFA 4ZHQF 1V6AA 1BVRA 3L1VA 2IKQA 2H08A 2OXIA 1KQ3A 4KR0A 2ZYIA 3HKBA 3O0TA 2Y0PA 5E6SB 3FROA 4NAUA 1PWZA 1G5FA 5IAAA 4DB4A 1RI3A 2QAGA 3A2NA 4XSGA 3QSYA 1Z13A 1P5RA 3MJCA 1K9SA 3RU3A 4C6RA 4JC5A 2ZU0C 1VHDA 1JEDA 2NACA 2O57A 1UAYA 4TYQA 4C6HA 3CYFA 4NCJA 3RJTA 4GMHA 1N2CE 1UFVA 5ENVA 5TPZA 1WL8A 2EBWA 2C2OA 5B1DA 5LMZA 4X6YA 3AV0B 2WWRA 2Z4TA 5HCNA 4I4NA 2DCUA 3G0CA 1J0EA 1FRVA 1E7WA 2IYVA 2HPZA 2JHPA 3C6YA 4BX0A 1CY6A 3MTDA 2A9QA 1IM2A 2PZFA 3R3YA 1X7XA 2AOTA 4JCOA 4LRTB 3UJ9A 4EDHA 5CAEA 5IZCC 3WAJA 4AKHA 1QNFA 2C4UA 3ZG6A 3V1NA 5IT9A 4KR6A 1XEFA 5EIAA 1WPGA 2Y68A 3LXRA 4MWZA 5EMKA 5KX5A 1G5QA 2W2KB 4QHTA 3UICA 3EDYA 4J2HA 4N03A 1MA3A 2GZRA 1NF2A 2BFBA 3FZGA 1WZUA 4I1IA 1E0KA 1U3WA 3PKZA 2JH8A 4X1KB 3OHPA 4IGFA 3RJ5A 3V8MA 1POWA 4AJJA 4DRXB 5KYWB 1GEEA 2A0FA 3HLTA 1FBTA 4HDKA 1FEZA 5F51A 4DQKA 4MVJA 5T5QA 3ND9A 2O8BB 4E1VA 1FYDA 3QYAA 2ZXFA 1Z45A 3GP8A 2CBXA 1J1ZA 1OC2A 1RCUA 1NW8A 4PZCA 1Y9AA 4BNVA 4CG3A 3IIEA 1W44A 3BMXA 5ALKA 1CIVA 5G0WA 5LUAA 1SG6A 1XNJA 3TMKA 5A5DA 4AC9A 2PWBA 1H8EA 5HDBB 3QMVA 4IQ8A 4O02B 1VHLA 4NK5A 1GZSA 4H7JA 5KDDA 3NPMA 2OXRA 4OCZA 5TMDA 2DH5A 2O0MA 3SF0A 3KD3A 1RDFA 4X45A 3SEZA 5JV5A 4ZAXA 1DAEA 4E15A 3GUVA 2WIGA 3L82B 3LBYA 3PFKA 3BC1A 2ZUUA 1P9OA 2PGAA 5CFOA 5CVTA 4QUKA 5JXGA 1EBFA 3LJKA 4TQGA 2RHBA 1BJKA 1TVKA 2OO3A 4OQXA 3DE0X 2BJHA 3D7RA 4BATA 1OLXA 5EZYF 3RRZA 1U0FA 4HB0A 4XUDA 1GXSA 3EVGA 3K9BA 4GZMA 1E64A 1A71A 3QSGA 2GN2A 2IW3A 4V0ME 4ZEXA 1JKJB 3KOXA 1MB9A 3R8XA 3OQNA 1FQKA 1QH9A 1H42A 2WQZA 4TZ0A 4P4GA 4HOYA 2QYSA 2YN0A 3AQ4A 1DXOA 1KK2A 5G0TA 1JHOA 1Q0ZA 3ENQA 3EF3A 4YJ2B 5KSZA 3E6AA 1UFQA 4E09A 4ND3A 4DPKA 2EFCB 1OFVA 1WRBA 3N86A 2G63A 5K0GA 5EL0A 1SQ0A 4IHQA 2RB5A 3VISA 1GITA 1L7NA 2WP0A 3Q15C 4R81A 4BBZA 4ZKEA 2CF6A 4O4JB 4AJHA 4ZGWA 2A0UA 1LPBB 4RQTA 5LQDA 5F77A 2YYYA 4Z4EA 4DYDA 2PV7A 1E6LA 3B13B 4FZ3A 4QVKA 1KMIY 3FPEA 2R66A 3REOA 1U80A 1UMCA 1ZYUA 4YRKA 3K4PA 4FINA 4KGXA 3V3TA 4WGFA 3WWEA 1EWKA 1CT9A 4BNJA 1IY9A 1SOAA 1JEEA 3V8VA 2WWTA 1O89A 5KQGA 1RWPA 2WHPA 5JFOA 1A2KC 2JC3A 4PZUA 5H5JA 4D3DA 3FOZA 2R8OA 4ZQBA 3F3YA 2XUPA 3RBVA 2OFWA 3HBNA 3QXCA 4RL6A 2I03A 2GPYA 4GI3A 4MKIA 3QXXA 1HT0A 3IUMA 4QHSA 1ORVA 3C41J 1I5EA 1I4WA 3D6UA 1Q1GA 4U7PB 4RACA 3GVCA 3V9PA 1UBTS 4C7VA 2VK8A 1WB5A 3EFHA 2NT3A 1FDWA 5DX8A 4RQBA 2QI9F 4YQZA 4DA7A 1OLSA 1CNMA 1YACA 3CSDA 4HNGA 4MTLA 2A3RA 3JQDA 1Y7PA 3KOWA 4AY5A 1I7NA 3NYRA 3QJGA 3LRTA 2QX7A 2R84A 3MG9A 4YC7A 1CU1A 5IKMA 1N25A 2ZS7A 5DCLA 5H0IA 4D6YA 2VSFA 3U0VA 4CW7A 1YA6A 1W5BA 2BUAA 4H15A 1N5RA 1TM5E 2VPQA 3OBBA 2VYVA 3QYJA 4Z8YA 3NEAA 3UZUA 7REQB 1OXSC 2PBRA 3GPIA 3NT4A 3WLOA 1DRVA 1YC5A 3VHQA 3DBRB 3A3NA 2Z8YM 3AY7A 3LPMA 5AJVB 4GU5A 1JWBB 1YQEA 3GP5A 3G3EA 2RIRA 1J24A 1RT9A 4LHZA 3HNOA 4Q1VA 1ZOIA 1L4NA 1DCTA 2HCTA 1OV4A 4FHDA 3EARA 4YR7A 1M9NA 3E22B 4ZCIA 5T64A 1NUTA 2QUHA 3VVMA 1BHO1 2DUJA 5LYJB 2V5UA 1CY0A 1KA9H 3DAPA 2XKBA 2Z6AA 2HM7A 4YX9A 1QAMA 1HX7A 3FYDA 4IGAA 3UHAA 1LH0A 2DBZA 4CR6A 1SVLA 2ZCJA 2E6UX 4IG4A 4D4KA 5BP7A 1T5BA 1PS8A 1XTTA 2ZTUA 3SU8A 4TYNA 1P7ZA 4FZRA 1RLJA 3RFUA 2X2EA 1Q0PA 1IY8A 3HA3A 4UC0A 4ZAFA 4DR7B 1YL7A 5IT4A 1G2OA 1E1KA 1GG2A 2J3EA 3B3QA 4RHCA 4Z2YA 3W5VA 4B2LA 4KFCA 1CIPA 3Q3EA 3IAS1 3JWIA 1SH7A 3PD7A 1P2SA 1JDPA 3HLYA 5CBKA 1QQ7A 1HSOA 1WXGA 2M6KA 4CODB 4GNRA 4P8RA 1YZTA 3OE7A 4QELA 4YXWD 2H4JA 3AUUA 5IAGA 3T5DA 1WUTA 1H1LB 2RGUA 4JHLA 3ZBTA 4D0RA 3OOEA 2GBGA 3C7DB 4LK3A 1KYWA 3AR7A 1K98A 1ODJA 1RCTE 4ZHQB 5I9SA 1FJXA 2G8LA 4ESVA 1BMTA 1G7TA 3FAZA 1MT0A 1F6WA 1OBHA 1E1QA 2BFWA 2MSWA 2RGEA 2ZB2A 4NONA 4W8HA 2VJOA 3SQOA 5LA6A 1ADYA 1QCCA 1COWD 1F2TA 1HQYE 1YVDA 2O7NA 2DY1A 2WUFA 4GKAA 3U4QA 4FFOA 2NTYC 2F90A 2WHEA 3QIVA 2D2VA 2KHZA 2XB4A 4Q1CA 5BPHA 4ISCA 5CDSA 3I09A 3DBOB 4NG4A 3WLNA 4EEKA 2I33A 3L7CA 5D6NA 5K99A 2HCFA 4G1UC 3FSRA 4DJFC 1N6LA 1EK0A 4M22A 2UUCB 1PFGA 3WB1A 1G5PA 4IYJA 4NYJQ 4B09A 2J0UA 2OBFA 2Q2OA 1H65A 5KNLA 4MWGA 2FV8A 1DEHA 4MW6A 1E79A 3ZHUA 4XFJA 3THOA 3N2GB 4O2BB 5LL6P 1QQ6A 3STWA 1E2NA 2HBQA 1I4TD 3PQCA 4WVLA 3BMQB 4P3PA 3I8XA 2DSNA 3MBKA 1JNYA 4FEEA 4LGCA 1YNSA 2QR3A 4R8LA 2TMGA 3C5EA 1JZSA 2CNNA 1Z5OA 2IYZA 1QFMA 3JD1A 4HATA 3P27A 5T4FA 4B84A 3PVCA 1T5DX 1QCDA 4G5FA 4L9WA 4OBXA 4XJXA 5K0JA 5L53A 4UEOA 3HXKA 5J58A 3QFTA 2P5SA 3SR3A 2JATA 2PUHA 1PX2A 2PBFA 1V45E 3A9UA 1NFRA 2IXDA 1HYEA 4HTAA 4XIGS 4CFSA 2UXBB 3LLCA 2HL6A 1YULA 3GRUA 3WLFA 1K5GA 1M73E 2V98A 1K7YA 3O4IA 5EXDA 3PFHA 1RPZA 1JFVA 3A9SA 4H9GA 4NCBA 3D4IA 3FJYA 1NOKA 4X1OA 1TU4A 3CR7A 3ZDRA 2OGTA 1SCAA 2PG3A 1PIWA 2X7XA 4OK6A 2CWDA 3G5TA 3E5MA 4PSCA 5HUQA 3CF0A 3ZN2A 5H8WA 2N1BA 13PKA 1Z0DA 4P5EA 4NCKA 3OIFA 3NIFB 4IMJB 5H16A 3PD0A 3DDSA 1IEVA 3TAXA 5A4MS 1KMCA 1MH1A 5LOVF 1UP6A 1SAYA 1NXXA 5BQ5A 4RELA 5EQFA 3DXZA 4NJEA 2PZBA 4KUGA 5KI6A 2OB1A 2Y66A 4Z9XA 1GA4A 4JLNA 1K7CA 4NPAA 1ZXLA 2B83A 3BF7A 1N8TA 2CDCA 2ENWA 2PKEA 2KM1A 5EE1A 5HDQA 5HQJA 2PLRA 1IBMB 1IPFA 4EG8A 1B3RA 1Q2XA 3D3QA 3DMRA 3D1JA 1Y3IA 3P9XA <