1FMCA

7-alpha-hydroxysteroid dehydrogenase complex with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1996-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fmcA00
1K0UA 2ZTMA 4XYEA 5JXWA 3RBXA 1T2AA 4YJHA 1YB4A 4RDIA 4DQVA 3ZWPA 1FDTA 1SBYA 1SZJG 1X0XA 4ALNA 4H3VA 1A7KA 1K6IA 4J16A 1C3VA 1DOHA 1V3UA 2OP0A 2CDAA 4IBOA 4B3HA 4U0JA 1IZ9A 4C4OA 4U6SA 2QYSA 3OSUA 4OO3A 1E3WB 2AEJA 3H4VA 3SXPA 3OHSX 1A71A 3NT5A 1E1KA 4FFLA 2POQX 3S2IA 3WWZA 2Y0EA 1XU7A 4XQEA 2X86A 4B8WA 1XA0A 2JCVA 2OOSA 1UAYA 4DBVO 4RORA 3O8QB 4NBUA 4NG5A 3C1AA 1ADBA 1ZK2A 4FBGA 4IDAA 3O38A 3ASUA 2E4AA 1K6XA 1N5DA 2VYNA 4FCCA 3GNQA 2EV9A 1O9BA 4TRNA 2GRAA 1LRLA 2PZJA 1HSOA 4MVJD 4W9NC 4D43A 5FYDA 3IQDB 3LT2A 5L53A 3OIGA 1BW9B 3V1TC 2FMUA 2VN8A 2C2YA 5CEEA 4WOJA 2O3QA 4JGBA 1EVJA 1KEUA 3JD4A 3EUWA 3UHAA 2X5OA 3ZHYA 3PJGA 1MXHA 3MOGA 1NP3A 4II2A 4YT4A 3DQPA 3SJ7A 1U4SA 2BFOA 1ISIA 2VCYA 2X0NA 4F45A 2BI8A 1TT5B 2JD0A 2YHIA 2PH5A 4W4TA 3SC6A 1XEAA 5LDGA 3C85A 3RUHA 4CM4A 3PLNA 4J4BA 4KDFA 2J5KA 1JLLA 4R69A 2RH8A 1K3TA 1DFHA 4ND1A 4OXNA 5CDSA 1C1DB 1EBUA 4CMHA 4OIMA 2VWHA 3DZFA 2YFHA 4CM5A 2ZB8A 1B2LA 5FI3A 3IAHA 5BSEA 5A9SA 1QXSA 4XGKA 3VPXA 2AW5A 3A14A 4YEDA 5B1YA 4JJIA 1UXIA 4CV2A 4RVGA 5DBFA 1HETA 1ZSYA 3QSGA 1KEVA 5K6AA 1E6UA 1EE2A 1U28A 2B4RO 1D4FA 4E5NA 4NBTA 3G49A 4WCFB 4ZQGA 2BRUA 3K31A 1QV7A 3I52A 6LDHA 4CV3A 2YHUA 4Z3DA 2TMGA 4IPTA 2OZPA 3W8EA 5ENDA 2DTDA 3JTMA 3JYPA 3G0OA 4WASA 4XIYA 2HQ1A 3R1IA 4B3JA 1ZO8A 2DFVA 2QZZA 1Z7BA 2J3KA 1VI2A 4BNYA 3NAQA 4RLHA 3TFOA 3ZWBA 3QIVA 1DIGA 2JFFA 1VM6A 2JFGA 2ZTLA 3FF4A 3GEDA 3RBVA 2UDPA 4FC7A 1VJ0A 4ROSA 1M2WA 2IYPA 3MCVA 2RHCA 2DVMA 4UVEA 3KETA 4NU5A 2EGHA 4AL4A 2Y93A 3TZHA 3LT4A 3HDHA 1HDYA 2Y1EA 3GEGA 2BF7A 2J6IA 3NKLA 2X0IA 2YDXA 4P4GA 3OA2A 4IIVA 1PJTA 2Z95A 4CMIB 3K9QO 2NLOA 3PGJA 1PJ4A 4FFOA 1P77A 2DT5A 2HRZA 3WG9A 3F9IA 5EQDA 2D3TA 3NV9A 4WEQA 2EP7A 2QW8A 3QLJA 5EJ2A 5KKAA 4IY1A 1G6KA 1TI7A 2AXQA 4DC0A 4XDYA 4MIYA 4WNCA 2EGGA 4CM4B 5AQ1A 4PLGA 3MWDB 1EQ2A 1VRWA 2GASA 2Y99A 5KJEA 2X5KO 4BKRA 4BL5A 3NEPX 2QRJA 1YJ8A 2R00C 3GGPA 1ML3A 1EDZA 5MGBA 3D64A 4TVBA 4L9RA 4H16A 1I8TA 3AUUA 3VC7A 2HK9A 3C1OA 4RLSA 1V6AA 1E7YA 2H1SA 5CG1A 1P1HA 4PZCA 4GAEA 2J3IA 3RD5A 5L7YA 4CM9D 3JD3A 3T4EA 2IZ1A 5L95A 3M2TA 4R16A 5I9LA 2HAEA 2ZIZA 5L7WA 3DFZA 4RPJA 1U4OA 2VZ8A 3VZSA 2GN8A 1NM5A 1XELA 2Q1SA 3IP1A 3RQSA 1LSUA 2NUAA 3IUPA 3UXYA 3DZKA 3GK3A 3IJPA 3HFGA 3V2GA 3VZRA 4C7KA 4XR4A 1KVUA 3OICA 3HE3A 4WPGA 1C0LA 1ULSA 3EGOA 2R6JA 3QRWA 3AM4A 5TT1A 5EESA 5TS3A 5L9AA 4XEHA 4YQZA 1YWGO 3INGA 4E21A 4CM6A 1XG5A 4OXKA 4XWYA 4PLCA 4DMMA 2GR9A 1PZFA 1Q7GA 1SC6A 3H8VA 3UH1A 1PZHA 4IMRA 3WQQA 3GFGA 1B14A 3DOJA 4D44A 3ADPA 3C1TA 1UP4A 4DRYA 2CZCA 2CVZA 4JROA 3K2EA 3FNFA 1VSUA 1PIWA 1TA4A 1I2BA 1U2GA 2AHRA 4ZA2A 3DBVO 4E0BA 3DDNA 1FDVA 1N8KA 1ZVMA 4IMPA 4F3YA 4R1SA 2I3GA 1YRLA 3CSDA 5TJ9A 2D4AA 1R0SA 3A28A 4D79A 3GHYA 4J1NA 5A5EA 3O9ZA 2HMVA 1PJSA 1DLJA 4I8XA 3HFSA 3GA0A 5FF9A 1ONNA 4JBGA 3GDOA 1NQOA 5IXYA 3KSDO 3E5MA 4K6FA 3SBOA 3AM5A 1NHWA 1WNTA 4R5MA 4M55A 4BOYA 1R4MB 2P4QA 1QRRA 4RQTA 3C8MA 4EUEA 1E1LA 2FPIA 1P0CA 2BH9A 5AXCA 4TKLA 4RJTA 1F14A 1F8GA 3JQDA 2O4UX 2VT3A 3GGOA 3OIDA 5L4SA 3NTOA 1UJMA 2NU6A 4RF2A 5JNLA 4PG4A 2BFAA 2Q50A 3QVSA 4R1UA 1UH5A 2RIRA 4PFJA 3HWRA 4WGGA 4YT2A 2SCUA 1R66A 4IUYA 3GN1A 4MINA 2PD4A 1CIVA 4CMGA 1PS9A 3DL2A 1R15A 3JQ8A 1PWXA 4JP2A 4BNHA 1IY8A 3MJVA 2YUTA 3MZ0A 4DIOA 2HMWA 1Y6JA 4J4TA 2GUGA 3Q3CA 4AJOA 3W4JA 1DIHA 3KV3O 4NH4A 5JO9A 4NIMA 1GPDG 1HDCA 4CL8A 2DTEA 3UF0A 4QFDA 1ISFA 4A27A 3BMQA 1U3VA 1I3MA 3VKVA 2DLDA 3I9LA 2BGMA 2X23A 5AVOA 3B1KA 2VNAA 4WECA 3FBTA 5FEUA 4BMNA 4BIIA 2OP1A 2BLLA 3ZNPA 3BA1A 1LUAA 1SO8A 4KWIA 1QYXA 4EDFA 2ZCUA 4A2CA 2O3SA 1BSVA 4TZTA 3IJRA 2C2XA 2IXAA 2BKAA 4CQLA 2O2SA 3L4BC 4PZEA 3RVDA 4EYEA 4J4HA 4CMJA 3DMTA 3SVTA 3LT0A 3LYLA 4MP8A 3HDQA 3VZPA 1KBZA 3JYOA 1L7DA 3GGGA 3MJTA 1FF9A 2QX7A 1CQJA 3HQ4O 3QE3A 1JKFA 4D3DA 4UVIA 4OM8A 4CR8A 3PQDA 1VC2A 3TOZA 1R4MA 1GYQA 4J2OA 5U4QA 3W8FA 4B4VA 2EWMA 5I7EA 4KWHA 3CTMA 4EUFA 5ITVA 2CVQA 2Y0CA 1N2SA 2VHXA 1EMDA 3ZNQA 1EUCA 3KYCA 3A4VA 1NX6A 2ZB7A 1ZBQA 2I9PA 1Y81A 3KSZO 4XGIA 3V1YA 4CQMB 1GFSA 4IDDA 5IDQA 4IS2A 2YW9A 4G2NA 4J6FA 4H15A 2EKPA 1CF2O 3CKYA 3WFJA 3COSA 4R4JA 3EW7A 4MJLA 1ZMOA 4QXMA 3BMQB 3TZ6A 1Y9AA 1EUDA 4RPKA 4ZQHA 4BV9A 4LVUA 1XQ6A 3BYZA 4QO7A 3LZ6A 3H9GA 4WK6A 1EDOA 3RCBA 3CZMA 5L40A 2ZTVA 2PKQO 1MX3A 1VPDA 3EK2A 3E82A 2PY6A 1EQUA 5COBA 2JD1A 4LCEA 4CR7A 1I2CA 1H94A 5I8ZA 1U9JA 5A4DA 4FJ0A 1UZMA 3K96A 5JAQA 4XQCA 4BMSA 4II3A 4RVFA 1GR0A 4XYGA 2ZK7A 5KOIA 4J9VA 1Q2XA 3FWZA 4CM8B 4RVDA 1GU7A 5FWNA 4XQGA 1Z82A 4L74A 3JQFA 3PRJA 5IF3A 2NADA 1AUPA 4J0EA 4BNZA 2OBNA 3QVXA 1TT7A 5JMWA 3OF2A 2Q45A 3H9EO 3TZCA 2YFQA 2J3HA 3LC1O 1KEPA 4Q39A 4DBZA 4FR5A 3QWHA 5JSFA 4KZPA 1YH3A 3ITKA 1LBEA 4RPGA 5TSDA 2P68A 4XKJA 3N7UA 3N74A 3JQBA 1W8DA 2ZB4A 4R01A 4I5FA 1LLDA 3JSAA 4MP6A 1YVEI 2E82A 1OZAA 3NJ8A 1D8AA 1M66A 5DP2A 1ZK3A 1V3VA 2Y66A 1HL3A 4RF5A 1B15A 3GN2A 2C7GA 5GY7A 4BS9A 3ZV3A 1NQ5A 3ZV5A 1ZK1A 2NVUB 4D0SA 4NU6A 1PTJA 2C59A 3SC4A 3FR7A 5TC4A 4RZHA 3JQ9C 3S2EA 3SEFA 2VYVD 1DHTA 4KQWA 2E6UX 4FPXA 4A26A 4BGIA 1NPDA 1TB4A 2D5CA 4RF4A 4A73A 1EVYA 3IMFA 3EVTA 1JKJA 5B37A 1E3LA 3JD0A 1KETA 5JCXA 4Q3DA 1T2EA 3PWZA 1PJ2A 3RAJA 3WR5A 1K2WA 1I32A 1T2CA 4J7XA 1BG6A 4AVYA 1XDWA 5T5QA 4YAIA 3DHNA 5AOVA 4E30A 5ER9A 1PWZA 5DULA 5JDCC 4CMBA 4WCFA 4YAKA 4LK3A 3GMDA 4QEDA 3VPGA 3JV7A 1R0LA 1WZIA 1I24A 3HUDA 2ZJ0A 2G82A 1VE9A 1MXFA 2IODA 3I23A 2FPPA 3TJRA 1YS4A 4RPHA 4DGSA 1ZCJA 4LMPA 4E5KA 3JQ7A 4FFNA 1L1FA 1O89A 1N7HA 2ZQZA 5BT9A 1P44A 3DOCA 4OGWA 2BELA 2VYND 4GX5A 4PGFA 1NFQA 1GTMA 3OJOA 3Q2KA 3WLEA 4JCOA 4B4UA 3G1TA 3ZN2A 1NPYA 2WD7B 1KVSA 1JTVA 3HN7A 3HZZA 4IM7A 1PS0A 1Q7BA 9LDTA 3VDRA 1R4NA 3I9OA 1VJ1A 2GZ2A 3ZGYA 1PS8A 3DMTC 5G4LA 1BWSA 4YT5A 1LLUA 4PIVA 4LISA 4Q3BA 3LC2O 4XIJA 2ZYAA 3SJUA 3GQVA 2D59A 1QYWA 1P1KA 4E4YA 4FN4A 3FBGA 1KVRA 4JLWA 4YQYA 4X54A 3ZHBA 4BNNA 1QYVA 2FWMX 3GH3A 3HNPA 3TSCA 2GN4A 1T1SA 1PGNA 5HTOA 3EDMA 3CUKA 3PJDA 3PEFA 4LCJA 3Q2IA 1GQYA 3WGZA 3S2FA 4DLAA 3PQFA 1CYDA 1EEHA 1WLYA 2V7PA 3CMMA 3I9NA 4RVUA 1YONA 5B4VA 3L9WA 4Q9NA 1HTBA 2J8ZA 3U9LA 3TWOA 4O1MA 3WFIA 3DBRA 2JAHA 3JQCA 4IZIA 4PG7A 4MVJE 2QHXA 3HB5X 2OO5A 1V9LA 3GR6A 3H9UA 1ISHA 1JKIA 2RBEA 5A9RA 2DFDA 1DFGA 5FI5A 3V2UA 1FDUA 1P3DA 3IIEA 1HE5A 1H6CA 3ZWYA 3GNSA 4RO0A 3GC6A 3WBFA 1G0NA 3QWIA 1WAMA 4OOFA 3VVBA 3KEQA 2GGSA 1IB6A 4WCFC 5L51A 2VZ0A 4EW6A 5DP1A 2AEMA 1AXEA 3L6DA 4NJMB 3SX2A 3ETEA 4CPDA 4GLLA 1UP6A 3AK4A 4HKTA 1C1XB 3RKRA 1CDOA 1NNUA 1Q7CA 1BXKA 4I5EA 1ZH8A 1H0KA 4S1VA 3PP8A 1J4AA 3OMLA 1MP0A 3E03A 4NBRA 4BKOA 1GCUA 1PZEA 4E5MA 2PH3A 4DXHA 3VKUA 4GSLA 1I01A 1N92A 1KVTA 2X7HA 4ITUA 4KQXA 3A06A 4OJNA 3MWEB 3ANLA 5AXDA 4B79A 2Q1WA 4HX5A 1UR5A 4NR0A 2HK8A 4L4XA 1ZEMA 1J0XO 4WOKA 4DIFA 4WLOA 1MGOA 2H6EA 4YAEA 4MVJP 3PVZA 1PQUA 2VYVA 1I33A 5EIOA 1U3UA 5T67A 5IN4A 3VPFA 3GRPA 2W98A 1I3NA 2NVBA 4FS3A 4IJVA 5KVVA 3BMCA 1M75A 1M76A 4OL9A 5CG2A 4BNVA 1YL7A 3DAFA 1N9GA 1UXHA 2GNAA 3JQGB 4XDZA 5JY1A 3GZ4A 1ARZA 2BFMA 4LN1A 9LDBA 5JC8A 2E37A 4BNUA 2WYUA 1R37A 3JQAD 4BQRA 3BHIA 5GMOA 4GWGA 4YB8A 4EJ0A 5TJHA 4D46A 2BHLA 4YJFA 4N5LA 4MO2A 2GZ3A 4DA9A 4DREA 3KO8A 1R4NB 3TPCA 1HWYA 1ZZEA 5JCJA 3E5RA 2C5AA 2FZWA 4KUEA 5DOZA 3PHHA 1HYEA 1DB3A 4TSKA 4CUZA 3OQ6A 2UV8A 1B8UA 1LQTA 1U7TA 2JKVA 3WTCA 4K1LA 3IUSA 5CFZA 5JC1A 1P9LA 1RWBA 4KUGA 4FD3A 1E5QA 5I9MA 2C5EA 2X9NA 3PWKA 1Y8RB 3L6EA 1HXHA 3MJSA 1SOVA 2DTXA 5G2OA 5G4KA 3JQGA 3RI3A 1TLTA 1IYZA 1GY8A 3WIEA 4GBJA 1N1EA 2A9FA 2CFCA 2Q1TA 2Q4BA 3PJFA 3KM0A 2VWQA 5U1PA 3G1UA 3I6IA 4AG3A 3ZWCA 2B69A 3KYDA 3NGXA 3ZI0A 5EMHA 3WGOA 3B1FA 4O0LA 4CMEC 3ZU5A 4BNTA 4NHEA 1HE4A 3H2ZA 4MVJH 3UW3A 3EY4A 3W8DA 2DU8A 2VHVA 4NBWA 1MC5A 3GY0A 2JCYA 1DPGA 1HDGO 2JAPA 3PHLA 4TROA 3QJ5A 1XIVA 3INTA 5CP8A 2DPGA 1C0IA 2EJWA 2O48X 2HJRA 3KVOA 4WUVA 2CMDA 3D4OA 1HT0A 1Y8QB 2AMFA 2HDHA 2JD2A 1QMGA 3Q9NA 4CODB 1PJBA 5AYVA 4GX2A 3UKOA 4DLLA 1FMCA 1ONOA 2QRLA 3L77A 4PLTA 1QV6A 4BNGA 4E2WA 4PG6A 2AG8A 4TRRA 2F1KA 1OI7A 1XSEA 3M1AA 4OOEA 4ALIA 1Q0HA 2QYTA 1E0DA 3I4CA 1LXCA 3FWNA 4R5HA 4YXFA 3H3FA 1W6UA 1FXSA 1JWAB 3WMXA 1EZ4A 1AN9A 2BFPA 1EBFA 3NTRA 5LCXA 1LNQA 4D42A 2YZ7A 3GVXA 5JO0A 3U4CA 3ZW9A 3LQFA 1VSVA 3M6IA 3O4RA 5JDIC 4R68A 1YO6A 5K9ZA 1DDOA 4GPD1 4DPLA 2Y68A 3D1LA 1JN0A 4M54A 5L3ZA 5LC1A 3RFXA 4CM8A 4HADA 5A02A 5IZCA 3VOSA 2BMAA 1NR1A 3QA9A 2WYWA 4IDCA 2ZATA 3BTUA 4OKIA 1I3KA 4Q3NA 4HV4A 1BGVA 5IDWA 3H9JA 1LDYA 3K8ZA 3LDHA 3H5NA 2EJVA 2CVOA 3FCOA 4XB1A 3GMSA 3VVCA 5COAA 4E5YA 2B83A 4QTZA 2GZ1A 2GYYA 3ZH2A 3BXXA 2WE7A 4QECA 4QT0A 3ZHZA 1PGQA 5KVCA 1NTOA 1YKFA 4IDFA 5CAEA 1VL8A 1C0PA 1PJQA 2A35A 1SB9A 3WGTA 4NK4A 1S7CA 1DC6A 3DTYA 2YV2A 3PDJA 2PV7A 2R00A 2PGJA 1YXMA 3FPCA 4UVHA 3UOGA 4PLWA 3HHPA 1XWFA 2JCXA 1BRMA 1T25A 5F5LA 3RSHA 1K89A 3D0OA 3S8MA 1BDMA 1WVGA 2V6FA 2B35A 3FR8A 4BGEA 2EW2A 4YJHB 4UVGA 3EZLA 3L4SO 4FGSA 1E5LA 1EK5A 1MG0A 2GERA 3ENKA 1LU9A 1ADCA 2AQIA 5LDHA 5F1PA 2P4HX 2R2GA 4BKUA 1U5CA 3FHLA 2ZJ1A 4FQ8A 1E3SA 3KBOA 1SCUA 3CINA 2EKLA 1YQGA 3ONDA 4YT8A 4XJTA 2HUNA 1EVZA 4K9DA 4R1NA 2CUKA 2NTJA 1ZMTA 4RVHA 3VAZA 5L7TA 1ISMA 1T1RA 4WLFA 1GV1A 3ZWMA 2O50A 3D4PA 3JQEA 2P5UA 3JQ7B 1JW9B 3GUYA 1GZ4A 4R3WA 1P1FA 3UAGA 1NASA 3CEAA 1ZSNA 3A9WA 1T24A 3WGIA 2NSDA 2JFHA 1O94A 2O4CA 1ORRA 1PU2A 1R16A 4QO8A 4ALMA 1UDCA 2EF1A 3QP9A 2YV1A 4ONEA 1H6BA 1G0OA 4JIGA 4RF3A 5IZCC 2Q2WA 1QP8A 2PTGA 3K30A 4DTIA 1B8PA 3EHEA 4MP3A 2PZMA 2CSUA 5H82A 4XB2A 5ICSA 3W4IA 3PHIA 3QV1A 3WLFA 3PWSA 3V5NA 1LDBA 3IL2A 4GMFA 3WJ7A 1NQAO 4W6ZA 4HNGA 2HMTA 4ZN6A 3F5QA 1O6ZA 3NTQA 1R6DA 4MVJI 1N7GA 1B8VA 2NU7A 2HJSA 3RUFA 2Q2VA 1LSOA 2IEDA 3PZBA 4Z9XA 3FSRA 5L4NA 2OMEA 4CLHA 4UREA 4IS3A 4P38A 1LI4A 4CMEA 5A1TA 2FHSA 4QFCA 4R1TA 3RBZA 3DC2A 4BNIA 5JYDA 3S1LA 3KOUA 2B5WA 2AE2A 2HLPA 5EINA 4URFA 1BMDA 3NT4A 3JYLA 4Z9FA 1I2ZA 2C7VA 2PNFA 3FNHA 4GGOA 4HP8A 4LVCA 3RASA 5JYEA 3WB9A 2ZTUA 3T4XA 4CLRB 5IXSA 1QORA 1V0JA 3TDKA 4YACA 4BQPA 1ZXLA 4J49A 3ZW8A 1TEHA 1MV8A 3F6YA 5HA5A 4CL3A 3HG7A 2VRCA 1DRUA 5IZ4A 1JVSA 4XRRA 4HUJA 1AGNA 1DC4A 3EVNA 1BW9A 3D7LA 3H2SA 1KVQA 2NWQA 2ZCVA 1YJQA 1B0AA 3ZU2A 3GVIA 1NXQA 2FR8A 1ENZA 5FFFA 4EEXA 4OH1A 4ZVVA 4BNLA 2C29D 3TL2A 1RM3A 2NV6A 3OEYA 3AOEC 4NPCA 3AUSA 1E3IA 4YJFB 3ZV6A 4ZD6A 3KUXA 1XCBA 2DUUA 5JAZA 3JQFC 4DQUA 3AU8A 1JU9A 4U0KA 2NVUA 4XA8A 4HWKA 1DAOA 1JDJA 1U7HA 4K6CA 2FR0A 1U3TA 2VUTA 3PIDA 4INAA 4E32A 4E3ZA 1PQWA 1UP7A 2XXBA 1FDSA 4IGEA 3PTZA 1XR3A 2OXIA 2DQ4A 4IQ8A 4O63O 2G0TA 4AJPA 1ENPA 2A92A 2RAFA 4HFNA 2PFGA 2VOEA 3TZKA 1EUZA 3GVCA 1IE3A 1VL6A 1Y5MA 1C1DA 2QRKA 1LSJA 2Y1CA 4I9HA 2YY7A 3DTTA 5A06A 1BTOA 5IG2A 1N9GB 1SEVA 3RUCA 1O5IA 2IE0A 3GLQA 4ILKA 1QYDA 1KS9A 4BO3A 3VTFA 4E6PA 5JMPA 5G0SA 4NDNE 2X58A 4WKGA 1MFPA 4D7AA 3QVOA 4GX0A 4IGFA 2Y0DA 5EERA 3P5SA 2PA3A 3OETA 3GZNA 4EEZA 5U9CA 3AUTA 3BAZA 4PLZA 1QG6A 4E13A 1NHGA 4IDGA 4F46A 4MKRA 3R0IA 1ZNQO 4W7IA 3WSVA 1MB4A 1Q0QA 5AXBA 4Z3KA 1NAIA 1Y7TA 1VJTA 3LC7O 1ZJYA 4NI5A 4EITA 3IC5A 1KC1A 1EK6A 5CHEA 1KEWA 1O0SA 4JNKA 4AJNA 5BNIA 3OBBA 1E7QA 4QSMA 3OIFA 1A7AA 3ZWOA 3KZVA 2WSBA 3ANNA 1GL3A 2EERA 3WSWA 4Y6PA 3WJAA 2AA3A 4CV0A 4DVJA 1WWKA 1PJLA 2HKIA 1EFLA 5A5FA 4DYDA 4BNMA 3X2FA 3E9QA 4BUCA 3DWFA 5THQA 2JHFA 4NFHA 3R3SA 1LDEA 3U0BA 3EC7A 4R9RA 2A4KA 3GPIA 5JAIA 3AOGA 3AY3A 5CDTA 1JQBA 2FR1A 4S3MA 2WEKA 5TLSA 3IDSA 3KLMX 4MKZA 4AICA 3TZQA 1DLIA 3NRCA 1J49A 1LDGA 2G17A 4GLOA 2IXBA 1OC2A 3CMCO 1X0VA 2FOIA 2RCYA 1KIFA 2UYYA 3KB6A 4QUKA 5JPIA 4ZQBA 4DLBA 1EFKA 2OFPA 3F46A 2IYOA 3QHAA 3QVTA 2O7SA 3OJFA 5TRTA 4HFMA 1CJCA 5I7SA 1HZZA 4CV1A 2EP5A 4PLHA 2YJZA 3AM3A 2QIOA 3INRA 3AI1A 2XPCA 4MPDA 4BO5A 4JBHA 2DAPA 2NACA 4FSHA 1RYEA 1GYPA 3UVEA 4GVLA 4ZRMA 3OEWA 4JX8A 4YJDA 4BNWA 1P0FA 4IZHA 4KOAA 1KERA 4WNIA 2WYVA 3WQRA 5B4UA 2Q4EA 1C1XA 3JQ9A 4DIBA 4ND4A 2YV3A 4BVAA 3IP3A 1B7GO 1IOLA 3RUDA 5BNTA 1WZEA 4JBIA 2BGKA 4NK5A 3WGYA 4IQ0A 2WJPA 3ZWWA 2Y1OA 3MJEA 1P45A 1PQPA 2AQHA 2I76A 2D2IA 5J23A 4GWKA 5JDCA 2J5RA 2W2LA 1S6YA 3U3XA 3ICPA 4UAGA 3WGHA 1L7EA 5TT0A 4FOSA 2P9CA 1ZEJA 4BNFA 1E3EA 3LT1A 4IDBA 4P8RA 4D3SA 5JS6A 3E48A 3PFFA 3H9QA 1SMKA 1UZLA 2B4TO 4WLUA 3W6UA 3WYCA 3DBLA 4YBZA 3JCZA 3ZWAA 1DRWA 2RHRA 2VUSA 1V35A 3GAFA 3GVPA 3UUWA 2H63A 3HADA 3C7DB 3O26A 4UUNA 1ZXBA 3BMOB 5ADHA 1E1NA 3WICA 4JP3A 3GNTA 1Y9EA 4KTVE 4CUJA 3WWYA 2GF2A 4UEOA 4BB6A 1P1IA 4GX1A 1JA9A 2Z5LA 2GN9A 2X1HA 3U09A 4JJFA 5EL0A 1HE3A 4YTEA 3RUAA 3DOOA 1A5ZA 2A94A 2FPGA 2VWPA 1DXYA 5G0VA 3H5AA 3HB4X 3C7AA 4NMHA 1XLTA 1SOWA 4GMGA 3RC9A 1J5PA 2DUWA 1GUZA 2BI7A 3E8XA 4YAJA 3JYNA 4M87A 3CPSA 4D0RA 2I3AA 1Z7EA 2FSSA 3KYDB 2VOJA 5DN9A 4NBVA 1WMBA 2ZB3A 4WLEA 1H93A 4N7RA 1IHYA 2H9IA 1LRJA 3C24A 5KWEA 3CE6A 4UUOA 4DPMA 2ZYDA 3JYQA 4H7PA 3I1JA 4ZQFA 3ICCA 5AXAA 4CJXA 4W99A 3ANMA 4ALLA 1E6WA 1HYHA 3AW9A 3D4NA 4UUPA 5JBIA 2PWZA 3H5RA 1W4ZA 2O3TA 3H6KA 3I4FA 4W9NA 1JAXA 3DBHB 4XRGA 3ROKA 4J0FA 2B36A 1AHIA 4YAGA 3LF1A 4ALKA 2DKNA 4PCVA 3TRIA 4ALJA 1WPQA 2VRCD 3PIIA 3Q9UA 1YBAA 1YBVA 5G4KB 4CLOA 3LLSA 2I65A 2UUOA 4CMIA 5A3JA 4YRAA 2CNBA 2VHWA 2VUUA 1ULUA 3ULKA 4FGWA 2P2SA 2NQTA 4AFNA 4MVJM 5G0WA 5IJZA 4XCVA 5F5NA 3ZNNA 4A0SA 2WTBA 3AWDA 1JVBA 3WXBA 2PR2A 4R54A 1X1EA 1ZK4A 3IKVA 2AEFA 1YL6A 1F12A 4BO8A 2CDBA 1P31A 2WDZA 3V8BA 4CQMD 4ND3A 8LDHA 3IKTA 5C37A 1UAGA 3VH3A 3U4DA 3TOXA 2TMDA 5JFOA 1RYDA 4I5DA 4RZIA 5KJ6A 4N5NA 5DBGA 4J3FA 4Z6KA 2F00A 4PG5A 3UFXA 1H2HA 3ZU4A 4HY3A 4HFJA 1LEHA 1PR9A 4JK3A 4BNJA 4A10A 1Z75A 2ZQYA 4EBFA 3STHA 1YB1A 3RJ5A 2W4QA 4XYBA 3KSUA 3KTDA 4OKNA 3KYCB 4L73A 5JLAA 4J1TA 1V8BA 4Z0TA 3RFTA 2Q1UA 4ZRNA 4OXYA 4GKVA 4MVJA 4WE3A 2DBVO 3H7AA 4CQMA 2P5YA 4L4RA 3PZRA 4YRDA 4ZJUA 4U5QA 4OHUA 3I3OA 1Y8QA 1K6JA 3GHHA 4BO0A 3IOYA 3QW2A 1UDBA 2Z1MA 1WDLA 3I6QA 5T8KA 1LTHR 3WYBA 1ISJA 1R0KA 1HDRA 1YE3A 2B0JA 3I9JA 3U5TA 2I5PO 1VL0A 2BD0A 2Z1NA 3JD2A 2HRBA 2HO5A 3I83A 5BQFA 4CUKA 4PLPA 1HKUA 1IHXA 4HXYA 4JN6B 3GG2A 3M1LA 4RL6A 5JW6A 2GN6A 4Y6RA 3MEQA 1VKNA 2GLXA 3ON5A 2HCTA 1YL5A 2EIHA 3U4IA 3L07A 5IDXA 2G76A 2NTVA 2D1YA 2DM6A 3OQBA 3PPIA 4AJJA 4NJOA 5TF4A 3VH4A 1IULA 4GSKA 4AJIA 3BHJA 4CM1A 2P9GA 1X14A 4Y98A 3G79A 1GUFA 4FC6A 1Q1NA 4AJ2A 2WD8A 5BNFA 4J91A 2CY0A 2NU9A 3T7CA 3U4HA 5JDIA 4BNXA 1RM4A 3DMYA 4LSMA 4Y67A 2WMDA 4YYZA 3EZYA 3PI7A 4P4LA 2Q49A 2EW8A 3L9XA 2O7QA 4OMUA 4E12A 2DBQA 3K2BA 4TWRA 2RH4A 3B20A 1GEEA 1PSDA 3HSKA 4K28A 2XOXA 2B5VA 1QLJA 4IXWA 3LVFO 3UCFA 4UUMA 3NUGA 4N5MA 3KHUA 1YQDA 2IRWA 2VHZA 3JQ8B 1O95A 1E3WA 3K5PA 3RKUA 4PLFA 3DZIA 3OQ1A 3NDIA 2OHXA 3F47A 1U1IA 2X5JO 3I5MA 2VT2A 4NFYA 4YA6A 5DDIP 3ADOA 5G0TA 3TN7A 4BO4A 3LF2A 5HWSA 5TNXA 4TRJA 3ROMA 4ZGWA 2BGLA 2HU2A 4MDHA 3AFNA 5CPBA 4IJWA 4IJUA 1EVIA 2H5LA 1N1GA 3RU7A 3L0DA 3ZV4A 3HDJA 3FD8A 5KJ1A 4PLVA 1A72A 1P33A 1X7HA 1D7OA 3PXXA 1SNYA 3MTJA 1ZW1A 2I6TA 5BSGA 1LX6A 3MOIA 1TVEA 5GZ6A 3X2EA 1DIBA 1B16A 4DPKA 1Z73A 3W6ZA 1DJQA 2W90A 1RM0A 2ZKLA 4CLOB 3CH6A 3TL3A 1T26A 1BDBA 4I9NA 2EG9A 5A3VA 2JL1A 1OC4A 1C0KA 2WD7A 1DEHA 3B6ZA 3FRJA 3D5TA 1PJ3A 2LDXA 1NPTO 3DZGA 4AJ4A 4WEOA 1XQ1A 2W2LD 4J7CA 1ZJZA 2ET6A 4O6VA 2PGLA 4NNJA 4YDRA 2Y05A 2G5CA 2C82A 5H83A 4TRMA 4E2XA 1PGOA 2LDBA 3QWFA 1ZFNA 5ILOA 4PZDA 1LLQA 5JCJD 4M8SA 1YOVA 2XF8A 3DBHA 1SB8A 2OUIA 2X0RA 5EN4A 4CQLB 1TT5A 2YHIB 4FDAA 5EQFA 5K0ZA 3QQPA 3GVHA 2W2KA 3DB2A 2V6MA 3IS3A 4RCVA 3TFQA 3ITDA 4MKXA 1HE2A 4E31A 3JD1A 3DAGA 3RC7A 4ZU3A 3V2HA 4E2ZA 1NVTA 5BR7A 1ADFA 1WDKA 1T4BA 1LDNA 3ONEA 5TQVA 3ZHXA 4WCDA 5DT9A 2EXXA 1I36A 3AJRA 1RPNA 2PD3A 4MVJF 2D8AA 1QKIA 2OGUA 1P1RA 3PHGA 3NJ4A 1LC3A 4OQZA 4LGVA 2EHDA 4YJGB 2HSDA 3RWBA 3WNQA 4YWJA 4YR9A 3LLVA 3GF4A 3O8QA 2O2YA 1NQTA 1XU9A 2PZLA 1MA0A 3F3SA 5KKCA 4MIEA 1UUFA 3ZWXA 3F4BA 1A4UA 3F1KA 3FPLA 3QVWA 3LU1A 3SLKA 4L8VA 1OFGA 1Z6ZA 5DNAA 4TQGA 2X22A 1DBVO 4PRLA 6ADHA 2UAGA 4LSWA 1YGYA 3H65A 3GDGA 5CEFA 1KY4A 4YPOA 4BV8A 4XD2A 3ROQA 3UGKA 3VPHA 3CXRA 4TKMA 4EUHA 4RGBA 4KDEA 1DIAA 4XGNA 4XZ3A 3WGQA 5HM8A 1YDWA 2NQ8A 1CERA 2Y1FA 3F4LA 4JJGA 4FFRA 3RC2A 4A7PA 5KVSA 1E6EA 1VLLA 2JHGA 2YQ5A 4OYRA 1GDHA 1GYRA 5C5IA 1XGKA 4CMAA 1BXGB 2QQ5A 3EMKA 1B26A 3BTOA 4P22A 1D1TA 3ZDFA 2CDCA 1E3JA 3S2GA 1GADO 3PYMA 1GD1O 4Y6SA 5F1OA 1OBFO 3RUEA 2YYYA 4EJ6A 1T2DA 2AQKA 1ENYA 5HRUA 3RUIA 3QY9A 1P74A 4JQCA 4M89A 1NAHA 2QZ9A 3NDRA 3GAZA 2XXJA 4DMLA 4J43A 1X13A 5DCWA 4UVDA 1X15A 3S55A 4C7JA 1KC3A 1E7WA 1BVRA 1Y1PA 1KOLA 4QX6A 2P9EA 3A1NA 4A5OA 2UUPA 3I9MA 3FI9A 2X9GA 1PZGA 3HN2A 1U5AA 3K6JA 4R51A 4CM3A 4FB5A 4YRBA 2E49A 4I5GA 1PJCA 4AJEA 2JJYA 4F6LA 3PLRA 1RJWA 2FN7A 4G81A 4Z9YA 3ZZNA 2OL4A 1IPFA 1GZ3A 3K92A 1LSSA 3E9MA 3ENNA 1LLCA 1UXGA 4CLDA 3VTZA 1UDAA 4XYMA 2O3UA 3CZRA 1NBOA 4R3NA 3VZQA 3BIOA 5JY6A 3NGLA 3EAGA 3WDSA 4RPLA 1W0CA 3F5SA 4A03A 1DC5A 4O5OA 1HRDA 4BO1A 5ITWA 4Z0HO 2V6BA 3ZCXA 2C0CA 1HZJA 1QR6A 4B7XA 5DBIA 5T64A 4GI2A 2O3JA 3E1KA 4Q3AA 4LRSB 2NM0A 4PRKA 3ZU3A 3WOHA 1NVMB 2UVDA 1DO8A 3GUCA 3RIHA 3RJ9A 2Q46A 4KMSA 2WM3A 2GD1O 4L0QA 3VDQA 4N54A 5ES3A 1A27A 4DL9A 5KJFA 3OECA 3DHEA 1ZIDA 4JXKA 4UULA 1OOEA 5DZSA 1H5QA 3GZNB 4XR9A 1ISGA 3WYEA 1RKXA 2Q99A 5CDYA 1QLHA 4IIUA 7MDHA 3OFSA 1YBMA 1WMAA 3WNVA 1GAEO 3R3JA 1GCOA 2I99A 3H3JA 3ETDA 2PKRA 1I0ZA 4CM9A 1PL6A 2GCGA 4BKQA 2OORA 1WXDA 5L45A 4BO7A 4Q3CA 1F0YA 1NWHA 4DWVA 1DJNA 1U2DA 3PYXA 2E48A 4D45A 4N18A 2IZZA 3DEYX 3JQAA 1UXJA 3Q1LA 4ND5A 5HS4A 1YB5A 1XKQA 4D41A 1H9AA 3BTVA 3TF5A 3DR3A 2HMSA 1GV0A 4CMKA 3KYBA 2FZEA 2FY8A 2YQ4A 1Z74A 1K5HA 1PGJA 2X0JA 4MIOA 1SEPA 3D5QA 5L4LA 1DRVA 3G17A 4FIZA 5COQA 4B4WA 1UZNA 3OJLA 1D3AA 3AOEA 1CETA 4R9SA 3NX4A 3AI3A 4GKBA 1LRKA 2HK7A 1WW8A 1PR3A 2Y1GA 3K73O 3AY7A 4ID9A 4AJKA 2DC1A 3WTBA 3CIFA 4RV9A 4KP7A 3Q11A 4ZQEA 5BSHA 4M49A 5C3MA 4BGUA 4E5PA 3DONA 1HSZA 4I1IA 4Z0PA 1A9ZA 3G3EA 3KRTA 3C7CB 4EGFA 1IL0A 3FNEA 2B4QA 5KTKA 1Z45A 1DAPA 1NR7A 2IZ0A 4DQXA 3P7MA 3GPDG 3VH2A 3DBRB 3WQSB 4AJLA 3ZWVA 5T57A 5TGDA 1OAAA 2HMUA 4CLXA 1HF3A 1AXGA 5T6BA 5IDYA 4XX0A 4J9UE 2OBYA 3P2YA 5ER6A 3PYLA 3KEOA 1GQQA 3DHYA 3L6OO 1PGPA 2I67A 4XJSA 3U49A 1AE1A 1I10A 3Q6IA 4IXTA 1V3TA 3M2PA 4TVOA 1ZSVA 4WLNA 4CMCA 1F17A 1ZKMA 2AQ8A 1FJHA 2P91A 4BNKA 5A9SB 4RQUA 1BHSA 1NVGA 3UICA 2X6TA 3BMCB 5IN5A 4DC1A 1A4IA 2DPHA 2FRDA 1BVUA 2DBZA 4AJHA 4LW8A 4MVJG 2IEBA 1XYGA 3ASVA 3DZHA 3W4KA 1CEQA 2PKQP 1ZK0A 1W73A 3L4BA 4FOOA 2VNSA 3VHRA 5G0UA 4I08A 3ZNOA 5GZ3A 4B7CA 3ZWNA 1EE9A 2EEZA 1M6HA 4PVCA 3DZJA 3QWAA 2C20A 2J5QA 1CRWG 1WDMA 1PL8A 2GSDA 3OH8A 3E9NA 4PVDA 2Y67A 1I5RA 2G1UA 4E2YA 1AHHA 4XYLA 5CDUA 5KNLA 1F06A 1E7SA 1LQUA 4GVXA 4IDEA 5THKA 4CM7A 4CR6A 3MTGA 3AU9A 4IQGA 4KTTE 3Q0EA 3BMOA 2VWGA 4RDHA 4U7WA 1JWBB 4J2HA 4J1SA 5B4TA 2D0IA 1F8FA 3P2OA 2CF5A 3LK7A 3ORFA 1QYCA 4M86A 5IFLA 1M67A 2FSVA 5T8KC 4OSPA 3W1VA 4DYVA 4HBGA 2C54A 4FFPA 4BKPA 5C7OO 4W7HA 1HDZA 4TMFA 3C3XA 1O8CA 3WMWA 3DBLB 4DUPA 3OM9A 2PZKA 3BMNB 2VTEA 2NNLD 1H2BA 4AJ1A 2XAAA 1JAYA 4OAQA 1UXKA 3TQHA 1YQXA 2GO1A 5TX7A 5C7LO 4PLYA 3UCXA 1DIRA 2IDZA 4M1QA 5ICMA 2CD9A 2FP4A 4FFMA 5DOVA 3KXDA 1J6UA 4R41A 1I3LA 3UN1A 2VZ9A 3B70A 3MJCA 1NFRA 2PLAA 5I7FA 2C07A 1E1MA 1T4DA 2W8ZA 2VQ3A 4B3IA 3PK0A 3DO5A 1BXZA 4J7UA 1R12A 4WJZA 4BO9A 1RM5A 3SLGA 4NZ9A 3U62A 1OMOA 4IINA 5H81A 2I66A 5HBRA 5CEJA 1HDXA 1PL7A 3JQAB 3NYWA 1IZ0A 1WP4A 4PN3A 4ND2A 1LC0A 1CWUA 4GQAA 3JQBC 2X8LA 4EZBA 4I9UA 3UCEA 1A9YA 2GPTA 4QQRA 1HYGA 1IPEA 1P1JA 2ILTA 1DC3A 3WIDA 4Y8VA 1FK8A 4BMVA 1HDOA 1GZ6A 1QSGA 3PHJA 3DXFA 1E7MA 2AE1A 3RROA 4U8GA 3GRKA 3BMNA 4CLEA 1H6AA 2PGDA 3AFMA 3OJEA 1HLDA 4LRTB 1SAYA 4W82A 2J3JA 3OA0A 4P4NA 1I30A 5HS6A 3TNLA 3NT2A 3HJAA 2D5AA 3D3WA 2O23A 4FJ1A 4J90A 1GEGA 3I9KA 4GH5A 4GL4A 4WLVA 5CPFA 1MUUA 1B3BA 3E18A 1ADGA 1LJ8A 3JQ6A 4MOWA 4O59O 5F21A 5C7IO 3NDJA 3HDYA 1PX0A 1HEUA 5IAAA 5I9NA 1CQIA 1H9BA 3MJ4A 2AG5A 8ADHA 7ADHA 4L76A 1U8XX 4CLRA 4LMRA 4BB5A 3OP4A 5MDHA 1SPXA 3BHMA 2DBRA 5TIIA 4B8ZA 5KJCA 3FTNA 3RFVA 4YCAA 4XQ9A 3AUAA 5F3RA 3GOHA 5ILGA 1LA2A 1XHLA 3PJEA 3RU9A 3V1UA 4OQYA 4Q3EA 3GT0A 5A04A 1VKOA 1HLPA 2VTDA 2V6GA 1MFZA 1MLDA 3BZUA 4K26A 3ROPA 3T7EA 3WS7A 1D1SA 1G1AA 5DCYA 2PK3A 3AI2A 2X9VA 5I7VA 5DF1A 1T2FA 1X7GA 4HNHA 3ST7A 5A03A 2PD6A 1Y8RA 3B1JA 3WBBA 1MG5A 3N58A 5K6AC 2CF6A 3KLPX 4EJMA 2Q2QA 5KIAA 4YJGA 2NVWA 4NFSA 5A05A 2NU8A 2GDZA 1PEDA 4ESOA 4Y9DA 2WE8A 4UEKA 4B7UA 3ABIA 5GZ1A 3OJ0A 2NTNA 5A9TA 1LDMA 4TZKA 4BO2A 2WWRA 3PQEA 1X7DA 5F1KA 3O03A 5JE8A 3GG9A 3P19A 3PGXA 1Q0LA 3F1LA 1NYTA 1C14A 2Y1DA 1TXGA 2X4GA 5KVQA 4NJMA 4B4OA 3RC1A 3D3WB 4ZICA 3EYWA 2V65A 4IJKA 3WGGA 1E92A 4FJ2A 1KYQA 4G5HA 3VH1A 4D3FA 4FW8A 1MC4A 1NWCA 3DFUA 3QWBA 1Y5RA 3VPSA 1GPJA 3FN4A 1ID1A 1YOVB 4RVSA 1FDWA 5BSFA 2YDYA 1ZUD1 1IUKA 4EI2A 3E6AA 1X1TA 2Q3EA 3PFWO 4BGVA 2VRBA 3PDUA 3DAPA 4L4SA 4ZHSA 4F6CA 3GEMA 3LSYA 1GUYA 2EKQA 2VHYA 4E33A 4G65A 4PG8A 5KCZA 3WX0A 1GQ2A 3ETGA 1M6WA 3BTSA 1ENOA 3D3EA 1DFIA 3GDFA 2O3RA 1H6DA 5EPOA 5B12A 5JAMA 3R6DA 4UEJA 3GFBA 4GGPA 1E7RA 2B37A 4YVFA 1E77A 5I8WA 4BHTA 4HFRA 4OSOA 1KY5A 5ENVA 1NFFA 4U6QA 1U8FO 1DSSG 1B3RA 1YDEA 4J1QA 4L75A 5DCUA 1U3WA 3ONFA 1DHRA 2ZYGA 5CDGA 1ONPA 2QG4A 4NQZA 2W2KB 3AY6A 3FNGA 3FTPA 4KUHA 3DZBA 4BO6A 1BXGA
chains in the Genus database with same CATH superfamily
4BRUA 4XSGA 3MUOA 2Z8ZA 4IH4A 1M34B 1NATA 1U7XA 2DP4E 5JXWA 3EJWA 4RYDA 3NHBA 5KAMA 2XUPA 3AF5A 4YJHA 1PR2A 3ZZTA 1JIQA 1SBYA 3HP1A 1SZJG 1Z8DA 2EFGA 1AZLA 3H1GA 3O4JA 3FPAA 1JEAA 3N2YA 4J16A 1DOHA 2OP0A 3C87A 2BFFA 3L8GA 1S8OA 1UPCA 3R5TA 3VYWA 4F71A 1JG3A 2AZXA 3FMIA 3L92A 3TSYA 4DS3A 1MO5A 3K6KA 3Q98A 2M6RA 1XLTC 2CXQA 1GLGA 2QYSA 2WT4A 3OSUA 4C0HA 1SURA 1E3WB 4HQFA 1QG0A 3OHSX 1MW9X 3OQJA 3PX3A 2BMFA 4DLRA 1RABA 1DWOA 7ABPA 3WQHA 3BE8A 3CS3A 2POQX 2CJWA 3M1YA 5FA6A 1V37A 3WWZA 4AMUA 2P9HA 2GXQA 3RAPR 3RVBA 2X86A 1XA0A 2FWAA 2QVZX 4G5SA 1WMFA 4WK2B 2OOSA 3RS5A 1ZM9A 1UAYA 4TKUB 2HF9A 1D0IA 1SBTA 2POCA 4FZVA 4NG5A 4OUDB 2IEAA 4UU8A 4G67A 2PX4A 4ACBA 1LPNA 4FBGA 2NTYC 2V0GA 4KLCA 4IDAA 1MA3A 3ILVA 1J2JA 2H06A 3N39C 4O8ZA 5C18A 4JKOA 3L7CA 2EV9A 4TRNA 4C04A 5IVDA 4R71A 1SQFA 4G4JA 4N8EA 3C39A 4EHIA 4B6GA 1TIBA 3UK6A 1T8UA 4R8VA 3IQFA 5FYDA 3LT2A 1C9EA 4G26A 5SYAA 5KDDA 1N6KA 4CIBA 4FW9A 3K20A 3MGAA 1Y0BA 2OECA 3TNLA 5JSKA 3ZY5A 1W36D 2FEXA 3LLCA 2C2YA 2O3QA 1R6BX 2F6RA 4XSHA 3VAAA 1KEUA 2ST1A 1XZJA 3M4JA 2VDMB 3LWBA 3WLIA 5FTKA 3GFQA 3PJGA 4OJQA 5BSUA 3R0VA 4BASA 4EHFA 1A8QA 3ZXIA 1IAVA 1DXOA 1GG9A 1GR1A 3WV5A 1NXPA 2HWUA 5J43A 1U4SA 4TM7A 4X92A 1M6YA 4G89A 1XZCA 2X0NA 1J2TA 4LYJA 2BI8A 2FW6A 3LGAA 2IHZA 4IOKA 4L3VA 3SC6A 4FZRA 5LDGA 1F2UB 1RRKA 3EEBA 1Y1QA 3T54A 3Q0IA 4MHSA 1VE3A 1JB1A 3D6NB 2J5KA 3ABSB 1MH1A 1RPTA 4R69A 3ZGNA 3STYA 3SD7A 4J0KA 1N5JA 2RH8A 2Q27A 4XGRA 1DFHA 2QPAA 3UIEA 4CMHA 3PUJA 4FYVA 2QTVB 2QD4A 1S1CA 1L7PA 2WPDA 2KPOA 3L7OA 5FI3A 1B2LA 2FWBA 3GLFB 1JU3A 5BSEA 1MAAA 2Q9AA 3ZYZA 5A9SA 1QYRA 1LX7A 2AW5A 3I76A 3KQLA 2XRYA 4CV2A 3UJ3X 5LBTA 4N12A 1U8UA 4FLMA 4QJ3A 2OK8A 1ZSYA 4OTZA 1T6BY 3ECSA 1EE2A 3KJEA 5LOVF 1IPHA 5DBEX 4Z8XA 4YRQA 4MQMA 5K51A 4WCFB 3GFFA 4B40A 4DSOA 4DGQA 2J9ZB 2BYTA 3I52A 4U8HA 2NO4A 3TD6A 3NANA 4OHYA 4CV3A 4DE5A 4EKDA 3NBXX 5CMLA 5FI1B 5KHOC 1QG4A 3H19A 4HEJA 5FBVB 2TMGA 3B53X 3MERA 2ZUBA 3W8EA 5JZVA 1FFGA 5KS2A 5EZSA 5KTTA 3VYTB 3CNOA 5IUKC 1POWA 1Q16A 2XUIA 4B3JA 5DH9A 4YIKA 1N2IA 2QZZA 2A6PA 2CB9A 4QYMA 1DQSA 2QAJA 2C5LA 4P83A 2FRXA 3OCJA 1OA1A 3NAQA 3Q1KA 1ZOIA 3PLAE 1VRCA 5BVGB 1X74A 1DIGA 2JFGA 1GITA 3GEDA 3L1KA 3RBVA 4D4IA 3PVCA 1U9IA 4FDVA 1Y8AA 3TECE 5AVZA 3RE1A 1DQZA 3RWMB 3T06B 5DRYA 1M2WA 1G8HA 2IYPA 3T3MB 3NUZA 4UU0A 2DVMA 4EPYA 1UAAA 1YZUA 4UVEA 1JQLB 2C4MA 2X7XA 2YFYA 1WTAA 4CTMA 4IIEA 1S3IA 4JLKA 4LUCA 1PZXA 4I6EA 3U80A 2OHOA 4M0UA 2ZSBA 2J6IA 3B3JA 2C4WA 3M3HA 1NUUA 2X40A 2ZVPX 4HHEA 3FOZA 1OH5A 1E8NA 1PJTA 4MQEB 2Z95A 4PAGA 1VHTA 3VXKA 3AW8A 4X95A 2XMSA 3QUQA 2J4FA 2Z5VA 4FFOA 3L0IB 2HRZA 4EZEA 3FWKA 3F9IA 1RWKA 2VPQA 3BUSA 4FYHA 5EQDA 1F8YA 2DQKA 1N75A 4CIYA 4XM1A 4M1OA 5EJ6A 3LUGA 1GRNA 2P6RA 1TI7A 3FMPB 3MCTA 4W6QA 4R1OA 4DC0A 5DM4A 4NCKA 3U3JA 1XWIA 1BQ3A 4E09A 3EMBA 1EDDA 4CM4B 8ATCA 5AQ1A 1MD9A 4HB0A 1VECA 2PG3A 6PFKA 1MX5A 1QVRA 2RKWA 3G7UA 1UBLS 1A2OA 5IJ9B 2Y99A 3FYUB 5KJEA 5JEEA 4ZVLA 1RHKA 2ZSEA 1LFAA 5AIAA 4J3JA 3KG2A 1EDZA 3PIRA 2YASA 3D64A 2PS0A 1ZMRA 2H2AA 3A1TA 2VIIA 1TKBA 2X3UA 4L9RA 3MUFA 4DR7B 3VC7A 3AR9A 3C1OA 4RLSA 4UNNA 1U0FA 4Y2SA 2PSSA 3AQ4A 3SJAA 4DLVA 3AVUA 1KEEA 3WWCA 5IVPA 2MSNA 1I6MA 4Z4CA 2VDWB 2J3IA 4JYMA 1X7WB 4TUYA 5D3MA 4W9MC 2CLMB 1E5XA 4J0GA 3CNNA 2IZ1A 4BVLA 3M2TA 4R16A 3ZVLA 5KSYA 1ZESA 1PKEA 2CYBA 4XASA 3I92A 4D56A 2YS6A 1XV5A 3O8RA 1JJFA 4RPJA 1Z08A 2WSIA 2H7XA 1TOAA 2VZ8A 3VZSA 1KMQA 3KD2A 2Q1SA 3KJHA 2NUAA 3IUPA 3LBNA 4QRDA 3UXYA 3IJPA 4XWTA 1ZW6A 3HFGA 2DGDA 2HJWA 3QOFA 3OPQA 4IV5A 4OMDA 4XR4A 3ZQKA 3M82A 4MWZA 1KDRA 5HPYB 3OICA 4Q3LA 4B4DA 3HE3A 2C8JA 2P5SA 3ETJA 3STTA 3OPNA 1OIVA 2G83A 2A9PA 2R6JA 1NYQA 3M0EA 3AEUB 4CZ2A 3AM4A 1XA3A 3GJ6A 4DADA 2P79A 4YQZA 2P40A 4YAFA 1TVKA 5TS2A 4US1R 4K9RA 4KFTA 4OXKA 4PLCA 4HYYA 4XWYA 5EAIA 3GP8A 1ADYA 1OGYA 1PZFA 3VDXA 5EVJA 1NTRA 5I4BA 1N36B 3UH1A 4Q4JB 4D9FA 3WQQA 1B14A 1ZD3A 3DOJA 2PHZA 1Y33E 4QPZA 4YJKA 3C1TA 3ZXUB 4G0NA 2R0QC 2C7PA 1KZ6A 2CVZA 2QG9A 3K2EA 2MINA 4I3FA 5G40A 2QVCA 4BVBA 2WJVA 1G55A 3JWIA 3LDAA 3LGXA 4HJRA 5E3IA 2FNAA 3DBVO 1FFAA 2QMEA 3GXBA 1WD5A 7MDHA 3DDNA 1FDVA 4KAJA 5TARA 5HRCA 2O54A 3H9CA 1EDEA 1I2DA 4R1SA 2I3GA 2IVZA 5AQEA 2QUKA 1E2KA 3KPYA 5FTJA 3SHWA 3VTAA 4HEA1 1DUIA 4DV5B 4BFLA 2XKAA 3L3BA 5CH3A 1M73E 4D79A 2P0EA 4RVOA 4MPJA 4F8EA 5A5EA 3O9ZA 5IP5A 3T6KA 3V4ZA 3AUKA 1U7ZA 1SZDA 3BSWA 2BGRA 1SKBA 2OAEA 5FF9A 4BQIA 1JJ7A 1FP4B 1ONNA 1CNFA 4L3WA 1OTHA 4FHGA 2WJGA 2ZE8A 2AJCA 3NETA 5E6RA 4DXDA 1KRHA 4PX3A 1KK1A 4ZOLA 2W6IA 3ADBA 2CHQA 2VDOB 4Q1FA 4M55A 1R4MB 3QJGA 4RESA 2W2MA 4RQTA 2CHFA 1KSGA 1TQ2A 3EW9A 4TTQA 5AXCA 3BRQA 1JZQA 4N41A 4NMLA 5JMOA 3ESRA 4IKOA 2DHQA 2VT3A 4P0PB 4AI6A 3L0PA 4RFSA 2B21A 2V9ZA 3NTOA 4OXXA 4AM8A 1JAIA 2NU6A 2PCJA 4FGZA 1IN6A 1TUBB 1RFLA 4X66B 2X76A 1JAHA 4X20A 3ZHSA 4J8PA 4R1UA 1H05A 3L18A 1UH5A 5E3HA 3HWRA 1UBEA 4UBJA 1ZH2A 3UAYA 1E4EA 4XD7D 2SCUA 3RK4A 4UHEA 3OQNA 1LNSA 3OOHA 4HAXA 5F4BA 3GN1A 3WLRA 1F2DA 1WPXA 2GD6A 2WIGA 5IPFA 3VM6A 1VL1A 4KO8A 3L7IA 1CIVA 3SN6A 3THYA 4RZ3A 4CMGA 4DF3A 1QWOA 1PS9A 1USKA 1GN9A 3JQ8A 2WG1A 1WKBA 3QENA 2FZLA 2QZ4A 1H69A 4ICIA 2KYRA 2YUTA 3TOSA 3UV6A 4DIOA 1GVNB 3ZCVA 4P9NA 3E22B 3GEEA 1QKKA 3ME5A 1EUQA 4NH4A 3NEAA 3NTUA 4LGYA 2J67A 2O2XA 5A7GA 2D2VA 2DTEA 3UF0A 3GB9A 1BCRB 2QR3A 5JNTA 1ISFA 5CT8A 2F8SA 4QA9A 2HO4A 4GNKA 2GD0A 1KP3A 3AVXA 3JVUA 1EFVA 2QD3A 3QMWA 4L57A 4BMPB 3PENA 3I9LA 2GAFA 3T3OA 2HNKA 2VK8A 1G8MA 2B8TA 3B1KA 3DE7X 3RWOA 1UKEA 4JGGA 5EJEA 3AHIA 3P9KA 4MRRA 3LUCA 1PEKE 2JHAA 3FB4A 4QBIA 4QUBA 3ZHOA 4BIIA 2BLLA 3BA1A 1SO8A 1YK0A 3G2MA 4OH7A 4EDFA 2YWJA 1WY5A 4Y1RA 2O3SA 4A2CA 3UMYA 4G5YA 3OOSA 3NQ41 1ZGHA 2BKAA 1KYYA 4CQLA 3L4BC 3FKSD 4L72A 1SFRA 1X3SA 1N57A 1FFYA 4EYEA 4ZYTA 2NTEA 3ZCRA 3L6BA 1P0PA 3IEKA 4IQ4A 2AN1A 3A9RA 4OQFA 3UHJA 3HDQA 2XODA 2CD7A 4BQEA 5KWJA 3ANXA 4FP9A 4RJLA 4MHTA 4QASA 2UZIR 2VJNA 1FF9A 1V16B 1JKFA 4JT4A 4OM8A 2W2VA 4DCGA 2IXEA 4OGFA 4NSNA 5LB4A 1UEXC 3EQ8A 4J2OA 1UKYA 2PX6A 2VNJA 3WYDA 1MOZA 3TRIA 3W8FA 4FYXA 4DMHA 3AJ8A 2Q0XA 4W8GA 2NZYA 4QU0A 4B4VA 4F8JA 5I7EA 4KWHA 3CTMA 2BMJA 2CVQA 4MQ4A 1PTJC 3MCAA 3CLRC 2ZS8A 4BVEA 2IC5A 1THGA 3ZNQA 3HRHA 4D74A 4N9WA 1EUCA 2RHGB 4WKCA 4RH0A 4WI1A 3A4VA 1NX6A 1Q5PA 2XMCA 2HL6A 5DASA 3VGPA 1G8AA 1X7XA 3NNSA 3CURA 4UKDA 1H42A 2H11A 3V1YA 4RTKA 1GFSA 1IEXA 2BM9A 3MINA 3IBSA 4FILA 3TK1A 4G2NA 2Q3CA 4F9TA 5IDQA 1O6FA 4H15A 2B8WA 2D4HA 3EW7A 4MJLA 1GZ7A 2LXNA 4INZA 5KU1A 3TIXB 2OWDA 4NCAA 3R0QA 5C51B 3K9FC 1PFYA 3FUCA 1UFKA 3KWFA 3O3OB 1KP9A 4FEEA 4FE7A 1P61B 3BYZA 4JENA 1HI9A 4QO7A 1PF7E 4DV7B 1Z34A 3I2FA 4LMAA 521PA 1ZS9A 2RK3A 4Y1EA 4CCAA 4NCJA 4LYAA 2ZTVA 3DVSX 3OQOA 4UW9A 4Z3OA 2W2PA 3GWZA 4HAWA 3WGLA 1XZFA 4ENRA 1HORA 2JJ1A 3FE2A 3WLPA 1EJ6A 4LCEA 4C6HA 1NOKA 1SG0A 4I1PA 1I2CA 3G7NA 1VGVA 3ZJUA 2Z56A 4FJ0A 2JW5A 3H17A 3A1CA 3CPHA 5JAQA 3PDIB 2GFIA 1T91A 4KHPB 2RAUA 1KP2A 2GOYA 4II3A 1ZJ6A 4XYGA 3U4QB 1JT2A 2R8OA 3R3HA 2ZUVA 4Q5IA 5IK2A 3TEFA 3PGVA 3V3KA 5JVDF 4MRAA 2WTAA 1QZUA 1PJZA 1Z82A 2L0XA 2AX4A 3P71T 2N47A 2V6IA 4XQGA 5CM8B 4GF5A 4ZMRA 3W2IA 1W1UA 3DG9A 3BWMA 4DHWA 3BC1A 4EK9A 3J80A 821PA 3RGWS 4IICA 1TZ2A 2FN4A 1OR8A 3H9EO 2J3HA 3DM5A 3SQWA 1MORA 3AP1A 2O2IA 3P8ZA 3LWNA 1RU3A 2B98A 2Q7DA 1NQUA 1LBEA 3ITKA 5H3HA 2WTUA 3DDSA 1ZC4A 4I55A 4BMXA 4LFBB 4IFTA 3S70A 3ZKAA 3N74A 4JP1A 2AN4A 3MK31 4MQEA 3SDZA 4O4JF 3QXHA 4MP6A 4EW2A 1I1QB 4YLEA 4ZDJA 1OZAA 2E9SA 2EF0A 1BMFD 2EX1A 3JWEA 1D8AA 3WHLA 1IRIA 2W6QA 2Y66A 2HNBA 2G28A 3F6PA 3NC1C 2RE8A 3QITA 4RF5A 2OBBA 1W48A 3RVJA 1S8FA 1TGYA 1G9XA 3D6MA 3B9BA 13PKA 3KQSA 4YRGA 5B2EA 1X2EA 3OWXA 3ZV3A 1LTQA 1R6XA 7MHTA 3RSOA 1FUIA 4S1TA 2C59A 2BAGA 4RZXA 4KJXA 1J1ZA 2Q5OA 1XYYA 4L95C 1ZH0A 2E6UX 3VHLB 3FDZB 1MH9A 2PAFA 4RF4A 1XZGA 1I2MA 4IZOA 1D2GA 4GLFA 4NDZA 1REQA 2LKDA 4ZOAA 1E3LA 3JD0A 1DTSA 4BTEA 4D9NA 4MV8A 4WXPA 3D31A 3M8KA 5JCXA 1JIUA 2HV9A 1ZD9A 4O8CA 1B76A 4RKYA 2A59A 4JQYA 2BFDA 1SCDA 3HY4A 1SC4A 3KQPA 4GPTA 1AMNA 3OZEA 5K20A 4L3OA 1U7DA 1D2NA 5ER9A 3P2MA 2FLKA 3W5DA 4WCFA 3MTQA 2CNNA 4DUYB 1WBBA 1S1MA 3UWDA 1IZZA 5KQGA 2X1LA 4QEDA 1W5SA 4OLAA 1Z7YA 3CH4B 4M0LA 1R0LA 1F7VA 3IBTA 2W11A 3HUDA 1LH0A 2ZJ0A 2G82A 2N75A 1CX9B 4ZPXA 2WG0A 4MSUA 5AHWA 2M9MA 2AMVA 3HBMA 2FPPA 4R0NA 4IDQA 3UGTA 4E5KA 2B9EA 4FFNA 2W7TA 3G6WA 2C7OA 4XE5A 1N7HA 1YRWA 2JGEA 2YVLA 3G2PA 2CWWA 3QTBA 4G37A 2VUHB 3U48A 2Y4NA 3DT9A 2H1RA 4KQKA 4AWBA 4DOMA 4I7EA 3K71B 1O6CA 3M1IA 2GCPA 1MB9A 1GLVA 2B4YA 5K6TA 1WXQA 3L1JA 1NDQA 2RJNA 2XB8A 1J23A 2WD7B 1KVSA 3HN7A 1JJVA 1GNRA 2NO5A 4C5AA 2OCAA 1V4BA 4YLYA 1M2GA 3C3MA 5CW1A 3VDRA 3HUFA 5CA0F 3OF3A 1VIMA 1S2OA 2GZ2A 1N6RA 5G4LA 2JARA 5CLIA 5BN4A 3DTVA 1LLUA 2W00A 3IE2A 1MB0A 4LISA 4FM9A 1KJ8A 1JQKA 3A4IA 1YQQA 1WKCA 4PNHA 3U16A 2GWRA 2OD2A 2GAIA 3WMRA 3K16A 3RODA 3DE2X 2XLBA 1IATA 2DWPA 4X54A 4KPYA 3O4FA 3OQIA 1KYVA 1Y1TA 3TSCA 1DEAA 3KJZA 1A50B 4HAVA 1U2ZA 2VDLB 3Q2IA 3MFYA 1XRSB 1MENA 3S2FA 2QTCA 3I8SA 5JCOC 1T0UA 1CYDA 3N7TA 1JR6A 2ZJOA 3I9NA 5B1EA 1UC8A 2C5HA 3D4BA 3JXEA 2O14A 4PTZA 3QPCA 3RB8A 3OZBA 2O8EA 4BP1A 2QTAA 5B4VA 2J8ZA 5J2UB 3S2YA 3U9LA 2WR8A 1XEWY 3WFIA 3DBRA 4RTLA 4J2TA 3WGVA 3U19A 1SUWA 1WPGA 4IZIA 2OZKA 2EZUA 3MVEA 1UC9A 4CKCB 5DLEA 2NZUG 1QNLA 2Z4TA 4KC0A 4LZZA 1E20A 1S8NA 4EG1A 3HWSA 4FTWA 1TZKA 2WFMA 5A9RA 1T0HB 4WK4B 3SNHA 1FDUA 2J0UA 1H6CA 4KQCA 2JATA 3IHTA 2G4CA 1C7IA 2ZPAA 4PC1A 2PZ8A 1U65A 1J0CA 1K9VF 2VXCA 2X3FA 1NI4A 4Z7JA 1CV2A 1CUVA 4OOFA 4CKCA 4KQMA 2GGSA 1POXA 2FX2A 3FVWA 3QE4A 4EW6A 1ECJA 3AG6A 2PUEA 2AEMA 1YBHA 5FJIA 5JRJA 3CVOA 3ETEA 2GBCA 1UP6A 3AK4A 2FQYA 2MSCB 2P77A 1H3EA 1WXXA 2DWCA 4EAQA 3NOVA 4AKIA 3LBHA 4I5EA 4PSAA 2GF0A 3TE7A 1H0KA 1SQ0A 2B1GA 2DPLA 2C84A 4Q9JA 1OREA 1J4AA 2WT9A 4S05A 5IARA 1K86A 1MP0A 2ZR8A 2QP4A 3G88A 3K9NA 4MVYA 2C83A 1PZEA 4XCXA 1RYNA 4LBYA 1BH2A 2HX1A 3UUGA 4AS1A 2PMDA 4BJ1A 2XWPA 2D7JA 3A06A 3LVQE 5F77A 4EKNB 1DJOA 1V7PC 3ANLA 1M1YE 3NBQA 4RIFA 4NR0A 5BSTA 4GPIB 4L4XA 4PBSA 1D1QA 4NCBA 1KARA 3I64A 4WOKA 3W5HA 4FMCB 2IZOA 2OCIA 1P9OA 2QMOA 2VF2A 3PVZA 3KVVA 4MVJP 1FZQA 3RTDA 3WJ1A 2VYVA 5KPJA 3D6AA 1D4AA 1Z4QA 3COYA 1U3UA 2GZSA 3M5WA 4R98A 5K4AA 4HZUA 3VPFA 4Z7NB 5IN4A 2G4LA 2G71A 4FS3A 1P81A 4IJVA 4OREX 2FPSA 5CHYA 4BEVA 4CDMA 1M76A 4TV8B 4PPQA 2BEWA 3AT1A 3FZGA 2JLYA 3VFDA 2XQIA 1O58A 4N0MA 1JB9A 1NG1A 2XWQA 5EMLA 2P4SA 3JQGB 4P84A 4UD2A 3WWPA 2H1CA 1RCFA 2FB9A 4Z8YA 2XNDA 4AK9A 2JNWA 3H99A 1ARZA 3JQQA 1WUIS 2BFMA 4PFKA 3X0DA 1ZHFA 5JI3E 3IDQA 4ENVA 1F38A 1P7VA 4RC9A 4XWGA 3BHIA 1Z5GA 3O90A 5K8TA 5TJHA 5G53C 4XB6B 3BF7A 4EB0A 1KSHA 4EG4A 3T1HB 2M2IA 4RMHA 1W94A 5FJJA 1AJEA 3WLMA 4MO2A 1T1IA 1KQ3A 3HLKA 4RHUA 4DA9A 5ALVA 2GXUA 1NMQA 4NAHA 1R5OA 2Q0QA 3NTLA 1Y4AE 1HWYA 2XMRA 5JCJA 2WK1A 3PXCX 3E5RA 1XNGA 2ZWPA 2J48A 1EFUA 4RK0A 1KU0A 5FPSA 2Q1YA 4DSZA 1L3BA 3AHDA 1F6WA 2OV6A 1HK7A 1XMJA 2UV8A 1LQTA 2FV8A 2QY9A 2YX1A 4LXUA 5LQUA 2I4LA 1J90A 4KBFA 5CTJA 1WOMA 1NU6A 1KEZA 4KUGA 3F5DA 4FD3A 2CC2A 5K8CA 4WZBE 5ITSA 2X9NA 3PWKA 5EXTA 3QFFA 3I37X 4OHPA 1HXHA 1RKVA 3MJSA 4GVPA 2F59A 4KX5A 2IV7A 4QRIA 5FTWA 2IF2A 4IUCS 2V5AA 3PL5A 2FPUA 4QHTA 5I4KA 2WOJA 1IJKA 2I8LA 2G67A 2YJ3A 3B3GA 1IYZA 3DPSA 1YDMA 2QVYX 4XVQA 1XYVA 1SOUA 3U7EB 1FP6A 1RWPA 2R4TA 1GG5A 2Q3BA 3BK7A 1E60A 2O2DA 3F97A 3GA5A 3DD1A 1C3OA 5U1PA 4GYYA 4JXXA 5JSQA 1FTWA 3I6IA 5TF0A 3RS2A 3IA2A 5E0OA 1QGZA 4AG3A 2WFLA 3D6FA 3ELWA 4ODIA 1M2FA 5EMHA 3B1FA 2D1RA 2BKLA 2OHHA 3LECA 3IEUA 3LCJA 4TLCA 4MVJH 2NU9B 3VSAA 4LBVA 3Q3JB 1MC5A 1PE0A 2AUMA 1NVEA 4PHCA 4CG3A 1AGRA 5CP8A 5KNCA 2R11A 2YZGA 2HJRA 2ROQA 2WBLC 2AOTB 5LOVA 3D4OA 4DV2B 2XMPA 1Y1LA 3LRPA 1RVDA 4B74A 4MUYA 1TCBA 4KR2A 2HW8A 4I1YA 4GX2A 1SXJE 2GPSA 2QSZA 3L77A 4PLTA 1XU4A 3UT5A 3L6UA 3WYFA 3RYFA 4CFYA 3LVRE 4PG6A 4FKBA 3S28A 3M1AA 1EE1A 3AEKA 4XXHA 3PJRA 3PXAA 3QUAA 3G2HA 1E0DA 4JUIA 4OEHA 4M8LA 4IIGA 4YXFA 1YR2A 5K01A 2O7NA 1FXSA 2W8BA 2QSUA 1JWAB 3V8EA 5M7EA 1ITZA 3MIIA 4YJ3B 4MRMA 3V00A 2ONKA 5SZJA 3RRNA 2V7QA 2E4XA 2ODWA 3I2HA 4TWJA 3GVXA 4P0TA 5JO0A 3U4CA 3N2KB 3E70C 1TCUA 3M6IA 5EWMA 1HH4A 4K9QA 1ELOA 1GAJA 2ZBVA 2CEAA 3MS4A 1ULHA 1DDOA 1AO3A 3D59A 1ZN8A 3OE7A 3PF9A 4ZWNA 4GPD1 4DPLA 4ZZ3A 5B7PA 2C4KA 3PQ8A 2Y68A 3D1LA 4ZREA 2XNKA 3WZLA 2DKOA 1RI2A 3RFXA 5A0TA 1UOOA 2HV8A 1JHUA 1TJNA 5A02A 2FLVA 1Q0UA 3EFOB 1G2IA 1T6NA 5IF9A 2ERCA 3BTUA 1IEQA 2INGX 3NVMB 1UMCA 2R44A 1DX6A 3OLWA 1LDYA 1U2GC 5CFRA 3LDHA 1T0BA 3H5NA 3RSQA 3V6LA 2W6MA 2CVOA 2XJ4A 4U7DA 3K70B 1KFEB 2WTMA 3DMPA 3KL2A 4XB1A 1TU0A 2X14A 3AJAA 4CFSA 2EBHX 1G3QA 3A9VA 2GZ1A 3ES9A 5E4TA 1YRQA 3WLKX 1TTQB 3DLPX 4DLPA 4I4TF 3K9LA 4KRYA 1EX1A 5CIYA 3FTCA 4BZWA 2G3YA 1V5IA 4LE0A 4K7JA 1PGQA 5JH7A 1AF4A 2R1UA 2ZQ5A 5GADl 2GEVA 1VL8A 1N0IA 4BE4A 1PR5A 4TXNA 3BQMB 1YS2X 2JLSA 1P0IA 1ZGBA 1S7CA 3DTYA 4I19A 3V7UA 2F3RA 4QYTA 4UVHA 2LVBA 5GJWC 1HFJA 1P75A 1QZ3A 2JF0A 3DS8A 1E98A 2ZUCA 5AVRA 3CNLA 3I6BA 3EWAA 1OD6A 3FKJA 1RLIA 5HE9A 1FFEA 3LKBA 1U90A 2WD9A 1BDMA 3OTGA 5IEJA 4BGEA 1KZYC 3IMGA 5D86A 2R7MA 4UVGA 2XZPA 4ZQCB 1M2VB 1EK5A 4LS3A 5JS8A 3UWSA 1OWNA 1L5MA 3IX7A 1L5FA 1P60A 3ENKA 3JWPA 1LU9A 4KE6A 1UQRA 3TE6A 5LNK6 5J40A 4E7PA 3UB2A 3RAFC 5LDHA 1NBME 4P33A 2R2GA 1FVFA 1QP7A 2P6MA 5FLKA 2ZJ1A 5L3RA 1GPLA 3KBOA 4G9BA 4O2RA 5CIQA 1T3GA 2ETXA 3TLGB 1Q3HA 4AN1A 1TGVA 3LW8A 3T7TA 1BMFA 1D0SA 1GKUB 5EMMA 1R0RE 4JUFA 5FAXA 5DSTA 1E3QA 1YQGA 1Z5OA 4P3OA 1I14A 2LBPA 4NEGA 1AY0A 3QM1A 4DA7A 5AT1A 3TGWA 2NTJA 4RVHA 5K3SA 2ZUUA 5L7TA 4H3SA 2YBDA 1RDFA 1GGKA 1M8GA 2I3ZA 3UT0A 4JA0A 4NMWA 1GV1A 3IP5A 2WY2D 3LX4A 2VJOA 3GEIA 1TZBA 5DGIA 3V4RA 2X0FA 4UARA 5CNMA 4QG3A 4LQLA 2Z4RA 5CCEA 1FXWF 1IVNA 1KFKB 3J81A 5KMGB 4ALMA 1QGOA 4QO8A 4PN7A 4EFMA 1BD3A 4AMBA 3DLAA 3AMVA 2OYSA 1G0OA 3E53A 3OT5A 4ES6A 4Z9AA 1TUGA 4MV1A 4XEUA 1VBFA 4ZALA 3ODPA 5LU8A 3Q3EA 3QKSB 1V2GA 4MKFA 4Y2JA 5EQJB 4I0WB 5JAPA 1PT7A 2IDMA 5H82A 3M6VA 4US0R 2Z3VA 1O8BA 2AT1A 3WLFA 4N49A 2CUTA 2CCKA 3IL2A 1GPNA 4GMFA 1KHHA 4FFBA 5LXTA 4IG9A 1NQAO 2W4MA 1A5AB 4LK2A 3WI7A 2C4UA 2O1XA 3O3NB 5KNDA 5T7BA 3PX7A 4ZN6A 2F9MA 2GKGA 3P9SA 1L4EA 4G5XA 2COUA 3CNEA 3OOJA 3IT1A 1R6DA 1I1HA 5IWCA 5LJIA 3GDWA 3KUKA 1FEZA 2OYCA 3VOBA 5JQWA 3KQHA 3OFKA 2IEDA 2R66A 3PZBA 4DUGD 1H0RA 4MA4A 4O2AF 5L4NA 2OMEA 4Z4HA 2GTIA 3VNBA 4YX9A 1V8FA 5LFAA 1ISPA 3KVRA 3BK2A 2EBFX 4QGAA 3RBZA 2DFNA 5JYDA 5C1DA 2VSFA 4CIXA 1WPRA 1E8DA 4I99A 1P7PA 3N0RA 1P9NA 1EWQA 4D1YA 2HF7A 1NUAA 4N5IX 4URFA 1BMDA 3NT4A 1SXIA 2IIVA 2N1BA 1IM2A 2PRJA 4GSYA 4FYJA 4IVPA 4JFAA 1P1CA 4BQQA 2VQ6A 3UJBA 5EOVA 3IEXA 4BFCA 1W25A 4CG0A 4KLRA 2BF4A 4LVCA 4UOQA 3L04A 2RD2A 1ZWKA 3REQA 5IXSA 1G2QA 5F2EA 1ODSA 2Z08A 2GBIA 2JKYA 1X70A 4YACA 5E9WA 1OY1A 1CHDA 2ZR9A 2VQEB 3TNDA 3HLYA 3ZW8A 2GPNA 4IF4A 1E9FA 4C0WA 3B1VA 4D92A 1MV8A 2FHPA 1R27A 2CVHA 1ZRHA 3GLSA 3P9PA 4PV7A 5CX4A 5HA5A 4KOEC 2A84A 3HG7A 5DO9A 3KYJB 1IBMB 1IRXA 3H1FA 5CUQA 1SBZA 2AK3A 4CVNA 1I4OA 2ZT6A 2WZCA 4P4UA 2PA0A 1BW9A 1J5XA 4M7OA 1M34E 4U9IS 3RIEA 4PYJA 1LF5A 3IV6A 2BMEA 4MPRA 4MCJA 1JALA 5IJWA 2R62A 5E1OA 4LV8B 3IDOA 3CRMA 4L8LA 2HT1A 3ANTA 4OH1A 4GOKA 1E18A 3G23A 4MCHA 4ZOCA 3VO1A 3DBIA 1Y3HA 2XGOA 4ME6A 3JR7A 1OH6A 1YIAA 5ALNA 3QOYA 1T9HA 4LDAA 3AUSA 2EDAA 3QEKA 3T9DA 2ZRNA 2DUUA 4B5KA 1Z29A 4DQUA 3AU8A 4PXYA 1X1AA 1JU9A 1UBNA 4XA8A 2A9OA 2BMDA 2L42A 2EWWA 1H4VB 3TUIC 1U3TA 2VUTA 4INAA 5DPMA 2YIMA 1HMPA 3FI0A 3EIOA 1IN4A 1PQWA 4IGEA 4ND6A 3LBYA 3PTZA 5FWAA 4BU1A 4H6PA 3WQBA 4YRZA 2AJTA 2G0TA 1SD5A 1V5EA 1ENPA 2A92A 2GWHA 2I4OA 1FUUA 2CN1A 4NL4H 4RA6B 5CRIA 5IU6A 3IDAA 2CUZA 2I2CA 1QPGA 3ONVA 1KOJA 2WJ3A 3GVCA 4GP9A 1ORTA 1Y5MA 1YT5A 2NYUA 2ZRQA 3N86A 5JCOA 4EY6A 2NAPA 3M5PA 1XNRB 1SIUA 4MYCA 2Y1CA 3FKQA 4H6WA 4R1MA 1PR0A 1FFXB 5B7GA 4IGKA 2WKWA 3RUCA 2IE0A 4OL0A 3GPCA 4IF6A 3U3RA 3GLQA 1QYDA 4DCVA 4E6PA 2GM5A 3I2GA 3TKAA 1Z6YA 4N7BA 1DBQA 4QUDA 4N8DA 1RQPA 1P2GA 3PHCA 2NZXA 4GEKA 1O0CA 2WJ6A 4RGVA 4DNOA 4NBNA 3X44A 3E3LA 3QVOA 4D7AA 4GX0A 3SJCA 2RBGA 1Q7RA 1NX9A 4HWOA 5BQPA 5ADWA 4DUZB 3ETHA 3AP2A 4P5EA 2HYDA 1JNYA 3HCDA 3AUTA 4LSGA 3E5HA 3O1LA 3QKSA 1OFVA 1ODFA 1FFBA 5HXAA 2CE2X 1QG6A 1L7VC 4ZCRA 4QUGA 4MKRA 4FZJA 1Q0QA 4Z3KA 1NAIA 1CZLA 3FG9A 5K6RA 3R8XA 5JNSA 1V9CA 1RAEA 3NFRA 4YPFA 3THRA 1O0SA 4F4JA 1VIDA 1DV1A 1WIWA 2OKCA 3BA6A 2VZEA 4NFLA 1P6UA 1PBNA 4JKIA 5LNK1 2YRXA 4P36A 2WUFA 3OIFA 5AKZA 1GL3A 2EKZA 2X41A 2OGTA 2YY6A 3WJAA 2OFFA 4OGLA 1ONBA 4MYSA 3OUTA 3QVUA 1DDIA 5EKDA 3D5EA 3NC4A 1W35A 3OESA 1M9NA 4P7GA 4DYDA 5THQA 1A7UA 3PBKA 4QTXA 2KS6A 2ZXUA 4RTPA 3OT4A 4H7IA 4BIMA 4PNZA 3BULA 4HN9A 4PZ0A 3GPIA 3BCHA 5JAIA 3AOGA 3AY3A 3WADA 3FLAA 4FYPA 5DHRA 5TLSA 3HTXA 1V7CA 4V2IA 4TXJA 1XXHE 4NBKA 2C97A 2J6HA 2ODQA 1OLUB 2X8JB 4GZMA 4P31A 5AJXA 5LYJB 1DLIA 1NVAA 4GGMX 3U4AA 5E1BA 2BMWA 4HTFB 3HBLA 2BEWB 4QWMA 4WDQA 3L7AA 3GT3A 3PV0A 2FK7A 1KIFA 4CIVA 3U3MA 1QDLB 3AWIA 4IG4A 2ODBA 2GZMA 4ZQBA 3RK0A 3F8TA 1ZISA 1G4AE 2MYUA 3U60B 2IYOA 2O8DA 1K0FA 4UFNA 1AKVA 4F3TA 4GS5A 3A9UA 2O7SA 1DAFA 4UCFA 4OCZA 2HJ9A 3BXEA 2VUIB 5AJWA 2QTVA 4AP5A 5FBZA 5I7SA 1FSPA 5JJ5A 3M9WA 3LFTA 1QBGA 2FYTA 4OQMA 2QORA 5F76A 4YUYA 5BV1A 4JBHA 4AG6A 1A9TA 3WB0A 2DAPA 2QP3A 4FSHA 4P0QB 8OHMA 5ALJA 3GMTA 4CKEB 4ZRMA 4P3PA 2ZIGA 4D98A 3KNZA 1UK7A 1SVIA 4QQNA 4YJDA 1EXMA 1P0FA 1TIPA 1JEYB 4Z7OB 2O57A 4WNIA 5B4UA 2Q4EA 5FFNA 2YICA 4IHJF 1E94E 3OM8A 1JYEA 1XT6A 2OO3A 2FUG1 2PPVA 1G8GA 1FXUA 1Q3TA 3PCXA 4G0UA 3K32A 4L5YA 4XSVA 3HWX1 1I4TD 4WHMA 3U7QB 1YS6A 2PL1A 1NXWA 1QDUA 1TQHA 2WJPA 1TD1A 5EIHA 3U26A 1A1VA 3MJEA 4ZZ1A 2B7CA 4DC9A 1XL1A 1ESZA 5BUSA 1KEKA 1WULS 1TRKA 1U81A 4M8IA 3O94A 2QUJA 2AQHA 3LXUX 5J23A 4GWKA 1FYXA 5HW0A 3C5EA 1QF6A 2W2LA 2ORIA 1S6YA 4RK5A 5BQOA 3CVYA 1E2JA 1OJLA 2P9CA 1E3EA 3LT1A 4IDBA 4J76A 3T41A 1OJ7A 5LXTF 3PFFA 2I2WA 1N3YA 2B4TO 3AEQA 4OUDA 5LUBA 2ENUA 3OAAA 1IWPB 2CL0X 2OUKA 4MW6A 3LX8A 2O2CA 4EHDA 3SOPA 1DRWA 4JJ6A 2IS6A 4CWAA 3AEKB 3DF7A 3N2GA 2XHZA 3FGPA 4JASB 3UUWA 3ZWKA 5HX7A 2H63A 3BAFA 3HADA 3O26A 1G21A 4UUNA 1BQEA 3JYHA 5KO2A 1SVOA 5IUNC 4JP3A 2J5XA 3GNTA 1Y9EA 4IRUB 1X87A 3ISJA 3FPKA 3WWYA 2IP4A 2FW7A 3MRSA 3ZDAA 3LYHA 3TIGA 5FQOA 2AOTA 5JCZA 4MRVA 5EL0A 1HE3A 3V8MA 3DOOA 2A94A 4DLXA 2LCIA 2BFDB 3ZJ4A 5KOHA 3IULA 2VNIA 1DC7A 3HB4X 3DOEA 5CW2A 2PMWB 1XLTA 2CNDA 3A2MA 5AVWA 1EWYA 1YJ5A 1NT2A 1PK9A 1GCGA 2VSNA 4YV2A 3E8XA 4LJ8A 2ORWA 2PBFA 1Q0SA 1XCGB 3BGWA 3BHNA 3DOIA 3A36A 1UBHS 4YAJA 2GAOA 5CA0A 1TA0A 4I5IA 1Z7EA 3V46A 5JZSA 1CY2A 3TZBA 2G63A 1K27A 2VOJA 4I1SA 4DA6A 2RMKA 2DWUA 4NBVA 4UMVA 1WMBA 4JSRA 4WXEA 1OI3A 1KR2A 3F49S 3IODA 2XA1A 3TX2A 2XQVA 2WFLB 1LV8A 4AX4A 5SZHB 1BOOA 4GICA 4NARA 3I1JA 4BFXA 1SG6A 4I4LA 3TX6A 3CUUA 4X97A 3T9FA 4K9PA 5HCNA 1HYHA 3AW9A 3O93A 4F4UA 3S81A 1T5DX 2IP2A 4UUPA 2A9JA 1WV1A 2EBUA 3JASB 3ER6A 4M38A 1W47A 1HKHA 1JT9A 4OI0A 3DBHB 4YRFA 5AI9A 3ROKA 1J39A 3UGQA 2FFQA 2YOGA 4GECA 4J0FA 4XD7A 1ZOSA 3VJRA 2O5CA 2QD2A 3KSAC 4UM9D 1CTQA 1FNDA 3QF7A 1N2CE 4R9VA 5I9IA 1WU7A 4QQ8A 1WPQA 1B73A 2VRCD 4YY3B 1YBVA 3FAKA 2ZRDA 3LLSA 4NZOA 2UUOA 3WWEA 1CW2B 4CMIA 4ZYWA 1X9HA 3PUIA 2CNBA 5EY5B 2OV1A 2YQZA 3RIMA 2VHWA 3HCCA 5BMOA 4L6IA 5IJ0B 4RXTA 1WB4A 1Z12A 2V7QD 2B4KA 3NIFB 4AFNA 4HH1A 5G0WA 1EB8A 5IJZA 1DV2A 2CLIB 2Q5LA 2PYDA 3AHGA 3LQ4A 4BFSA 4W1PA 3KKMA 5L3VA 2FSGA 4CE6A 1Y3DE 4R54A 1ZK4A 5DXAA 3QOWA 1F12A 2C03A 4LXTA 4XLTA 5FLEX 1BX0A 2ZZNA 3TOXA 5TXGA 3PUVA 2QD5A 4RK6A 3TRJA 3ZHRA 2JLQA 1K4YA 2R7KA 1DTE<