1FMCA

7-alpha-hydroxysteroid dehydrogenase complex with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1996-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fmcA00
1C14A 3OETA 3GNTA 5JSFA 4F45A 1AGNA 3VC7A 3P2OA 3CZRA 3NX4A 1PZGA 4MDHA 2JFHA 2B4RO 5KJ6A 3EZLA 4W7HA 2WYWA 4DGSA 1GDHA 3BMCB 5G4KB 3BMQA 1ZSYA 3H5AA 4DLLA 4GPD1 2CF5A 4IXTA 3M6IA 3GZNB 4GAEA 3KM0A 1E7YA 4TWRA 2VWGA 1PQUA 4BKRA 3HDHA 3WMWA 1SPXA 3BMQB 4HNGA 5K6AA 2YUTA 3JQAA 1Q0QA 3KSZO 3HFGA 4ZQFA 3GRKA 2XF8A 1MFZA 1PJBA 2NNLD 3PZRA 3VPGA 4YAGA 4PIVA 3EK2A 2HKIA 5FI3A 4EDFA 4NJMB 2XXJA 3KEOA 5JC1A 2E49A 2DKNA 1TT5A 4CR8A 1BDBA 4B79A 1SO8A 4LN1A 3WYCA 2BKAA 3K6JA 1YOVB 3OH8A 1TEHA 4GMFA 3ZWCA 4NFHA 3WFJA 3Q2IA 3QWAA 4W9NC 1ARZA 1NM5A 3IUSA 4D43A 3G3EA 2GNAA 3I9JA 2WD7B 5ES3A 3I9MA 5JAZA 2CZCA 1AN9A 2X8LA 4JBIA 1BXGB 2GZ1A 4IQGA 1IPEA 4LMRA 1E3SA 4XX0A 3TF5A 1CRWG 1ZCJA 4E31A 4FR5A 1QMGA 3WMXA 1DHRA 6ADHA 4CMGA 1TVEA 5T8KA 5EERA 5BR7A 4YAIA 1ULSA 4AJHA 1KEUA 5JY6A 2C07A 1VI2A 4AJOA 1LDMA 3EDMA 3D0OA 2H1SA 4FGWA 1PJLA 1UZLA 3ZU5A 1FMCA 4E5YA 4BNYA 4R1UA 4ZHSA 3DEYX 3DHYA 5AXCA 4BNLA 4XA8A 3RCBA 4HKTA 4CMCA 3D4NA 1C0IA 3HDJA 3PIIA 4YACA 1ZK0A 2VHZA 1BW9A 3OMLA 8LDHA 2NU6A 3MJCA 5IZ4A 3RVDA 1F8FA 5C7OO 1H2HA 5G2OA 4L4XA 2Z5LA 3WGZA 3ZWMA 1SBYA 1DRWA 1UZMA 4WCFB 1LEHA 4JROA 4KDFA 2X6TA 3I4CA 3I83A 4KUHA 4DPMA 3ZV5A 2ZYGA 5A02A 1Q0LA 2ZCUA 1ZBQA 2JJYA 1Y8QA 2B36A 2J8ZA 4QQRA 3RUDA 4MVJI 4ZA2A 2NQTA 2A92A 3E6AA 3OJEA 4L4SA 4NZ9A 4YJFB 5CP8A 1ONPA 2C2YA 3L4BA 1TLTA 4J9UE 5CPBA 3DHNA 1LSSA 2BI8A 3VVCA 1ZMOA 1N1GA 1RM4A 3C8MA 5ILGA 4TRMA 2NADA 1MFPA 3C3XA 3D5TA 3GR6A 3RAJA 4A10A 2CVQA 2HMSA 4YQYA 4L8VA 1YRLA 4C7KA 3PYLA 4E33A 5FI5A 3SC6A 2G76A 2WE7A 3DAGA 5JW6A 1Y5MA 4WPGA 3WGHA 1DO8A 4B7UA 2VTEA 1QG6A 2YW9A 5HS6A 1TA4A 4KMSA 5IDYA 4YAKA 4YAEA 4BNWA 4B3JA 3JQ8A 4NU5A 4XIJA 3AY7A 1A71A 4PLWA 3TZQA 3QIVA 1DRUA 1EDOA 4FC6A 1M6WA 3ROKA 3K2BA 5J23A 1V6AA 3GY0A 1AE1A 1E3LA 4CUKA 3U0BA 1E0DA 2HRBA 3EMKA 1K6IA 1YXMA 5A1TA 2J3KA 2BGKA 1NASA 2X9NA 3MWEB 2PY6A 1OBFO 3W4KA 2NVUA 5CAEA 1WZEA 3OIGA 4RGBA 1V35A 4PLGA 3JD1A 3WLEA 1N7GA 2QRJA 2WTBA 4EI2A 4D3DA 1BWSA 4JQCA 3D3WB 4J0FA 4WGGA 4TRRA 1D3AA 1U3UA 3D4PA 1MXHA 4QEDA 3IMFA 1GQQA 4YJGA 5JXWA 4MO2A 4YR9A 4DIFA 4J1NA 5HA5A 3F9IA 5K9ZA 2BD0A 5F1KA 3FBGA 3DONA 4ALIA 3NUGA 3PDJA 3TFQA 2AQ8A 1CDOA 2AXQA 5A9TA 4J49A 4DLAA 3E82A 1NXQA 3I52A 1IYZA 1I2CA 3PJFA 3F3SA 2PKRA 5DBFA 5KVSA 2ZB8A 1MC5A 1NHGA 1ZSVA 4I8XA 3JQ9A 4NK4A 1NHWA 1XLTA 4OQYA 1I3LA 1T26A 1VJ1A 3WX0A 4A7PA 4Q3CA 4MIYA 1ZKMA 1E7QA 1ZK2A 3GVIA 4KQXA 4LVUA 4Z0HO 4PRKA 3DBLA 3BA1A 1YDWA 4II2A 5JMPA 1UH5A 1YBAA 5DDIP 4OM8A 5A9SA 4YT8A 1QSGA 1XQ6A 3EZYA 2FZWA 4WEOA 1UXKA 2EW8A 2HDHA 3Q6IA 4RQUA 4BNKA 1FXSA 4M1QA 4DBZA 4IDAA 4N7RA 3UN1A 1V3UA 1SEPA 1YOVA 3NT2A 1YWGO 2ZCVA 1E7RA 2H9IA 4MPDA 1ADFA 1ML3A 3JD2A 2WE8A 3NRCA 5JLAA 3DMTA 4XQGA 3NAQA 1U2DA 3AWDA 2NACA 4W82A 4YAJA 5H83A 1PSDA 2XOXA 1KOLA 3IL2A 1XU7A 2VHXA 4FGSA 1LUAA 2O4UX 4XB2A 3EY4A 3GPIA 4FFPA 4MIOA 1I3KA 2V6BA 4BIIA 2AEMA 2Y93A 2ZJ1A 4YCAA 4LVCA 2P2SA 3ZU3A 2D5AA 4ALLA 5F5NA 2B5VA 3QVTA 4KZPA 3PQEA 3OJLA 5TS3A 5ICMA 1HLDA 1QLHA 4WECA 2E4AA 1OZAA 1E1KA 2PGDA 1T2EA 3QWBA 1GCOA 3CMCO 2GN4A 2DUWA 3W8DA 4GX5A 3D4OA 1WPQA 4E0BA 2IZ1A 1O95A 3WSWA 4I1IA 3WBBA 1KETA 5G0UA 3MCVA 2W2KB 4NQZA 1I10A 1VJ0A 1LLCA 2UDPA 2XAAA 5CDSA 4TSKA 1XKQA 2QG4A 3ETEA 3NGLA 5I7VA 4XQEA 1LNQA 1XEAA 4HFRA 3SBOA 1KVTA 2NV6A 2NVUB 1Y81A 3LQFA 4RL6A 3CKYA 4CLOA 4RF5A 5H82A 1JWBB 1YJ8A 2VZ9A 3UCEA 1CETA 5COQA 5IN5A 4J43A 3QVSA 5G4LA 3CUKA 3PDUA 2EJVA 3FR8A 1EZ4A 3BYZA 3FWNA 5U9CA 5TJHA 3VDQA 1JTVA 3VTFA 1NAHA 3F4LA 4MP3A 4OQZA 2P4HX 3G17A 4CV0A 4BV8A 3UAGA 1AHIA 5TRTA 3VPSA 2V6GA 4NFSA 2OMEA 3ONDA 4WCFC 3D64A 2GRAA 5T64A 4WJZA 4RVSA 3R1IA 2P91A 4R5HA 2BGMA 4BQPA 3CIFA 2OBYA 2AQHA 2VYVA 3E9MA 3AUTA 3LC2O 4EJ0A 3ICCA 4BKOA 2BFPA 2WSBA 3ETGA 4TROA 4XQCA 3MZ0A 4GVXA 3RI3A 1H93A 3O8QB 1NVGA 3A9WA 4GQAA 1NYTA 3Q2KA 1B8VA 5AXDA 4H7PA 2PFGA 3DBLB 4IMRA 3E48A 2HMVA 1DIHA 2W90A 3CH6A 3KETA 2CY0A 1DJQA 3AFMA 4Q9NA 1QYWA 3WG9A 2G1UA 3GFBA 5DCYA 2NLOA 4WLVA 2X1HA 3KYBA 3I4FA 4IJKA 1A9YA 3GEGA 4NBUA 2X23A 4WLEA 1YJQA 4J0EA 1DDOA 2GPTA 4IS3A 3V5NA 3NGXA 2PD6A 2PLAA 3FWZA 1B3RA 3KBOA 4G65A 4LW8A 4ROSA 3ZH2A 2Q3EA 1K6JA 1J0XO 1I5RA 3ZV3A 4P8RA 1UAGA 4ZGWA 2VQ3A 3ZWOA 3GF4A 3PJGA 2P9CA 2GERA 3PK0A 1AUPA 2AW5A 2FSVA 4JBGA 4D41A 4YT5A 4BOYA 2C20A 1QKIA 3NDJA 4MVJP 5KJCA 4RORA 1BHSA 1E5LA 4QUKA 3N74A 5TNXA 1EK6A 5JS6A 4DIBA 2PH3A 1KVSA 2NTJA 3CMMA 2JHFA 5DCWA 3C7CB 3GQVA 5DOVA 3EC7A 4BO0A 3ZWWA 1DLIA 1K3TA 3E03A 1IPFA 1O6ZA 1DSSG 3CPSA 5L4NA 5L3ZA 2P5UA 5LDHA 4R41A 2LDBA 3KV3O 1VC2A 2OO5A 3U4CA 2LDXA 4NIMA 2JFGA 3V2HA 3OQ6A 1CF2O 3BHIA 3GAFA 5L45A 1UXJA 3H5RA 3I9KA 3PLRA 4KUGA 4P4NA 4YJHB 1R66A 3Q3CA 1YB1A 1DLJA 4L73A 4Y6PA 4OSOA 1DC6A 4JP2A 3W4JA 3DOCA 4P22A 3ADOA 1EVYA 2AG5A 2E82A 4CM8B 5HRUA 1WWKA 4DA9A 2HMUA 3KXDA 4PZCA 4RVHA 3HSKA 4R51A 4U5QA 3SLGA 1EUDA 1UR5A 4IIUA 2G82A 2O3JA 2CDCA 3JQFC 2VHVA 3V2UA 4I5EA 3GMDA 3PLNA 2PZKA 1CYDA 1LLUA 4OO3A 3VH1A 3BMOB 5U4QA 3JD4A 2NM0A 2Q4BA 3IP3A 4AJEA 4OOEA 2Q99A 3C1TA 4I08A 3OHSX 4DMLA 2W98A 4B4UA 3T7CA 2Q45A 3E1KA 1ISIA 2X0JA 1KYQA 3O4RA 2VNSA 3GVCA 4ZU3A 1WMBA 1ZSNA 1L1FA 5BT9A 2YY7A 3JQCA 3KYDB 1ZK4A 1YL7A 4AICA 1H6AA 1S7CA 4PFJA 1U3WA 5DCUA 3DFUA 1E6WA 4M89A 4FBGA 1QYDA 2Y0CA 3I23A 5C7IO 1W4ZA 4NH4A 2ILTA 3WSVA 1LA2A 2J5KA 2DPHA 2YHIB 5AXBA 4YA6A 4XZ3A 3ULKA 5ADHA 5JDIA 3BXXA 1UXHA 4AJ1A 1DBVO 2EF1A 3H8VA 5L9AA 4ZQBA 2VRCD 3W1VA 1E1MA 4WOKA 1Y6JA 9LDBA 4E21A 3NTOA 1VL0A 3FNFA 2X22A 3RFXA 3P7MA 3T7EA 2NSDA 1GTMA 2NTNA 4XWYA 3SJUA 3ZNNA 4XYBA 2FP4A 1HTBA 3Q0EA 2CMDA 4LSWA 5H81A 4EUEA 2Y68A 4AJ2A 2QZZA 5EINA 1XQ1A 4YEDA 4EITA 5JMWA 4NJOA 1T2CA 1ZXLA 4K6FA 1PZEA 4CMEC 1CWUA 4YPOA 1K6XA 3D1LA 2GZ2A 4CV1A 4RF2A 4PVDA 4QO7A 5JPIA 1MV8A 2EV9A 4AG3A 2QZ9A 2Z95A 4J7XA 1LSUA 2CDBA 4H16A 4CM6A 2RHRA 1AHHA 4LRSB 1ISHA 1R4NA 3ROQA 2VTDA 2VYND 4WE3A 2Q4EA 3OM9A 4OGWA 3BMOA 2OFPA 2ZB4A 3JQ6A 4N54A 1ZW1A 1YKFA 3SX2A 5EQFA 4RZIA 1A72A 1NWHA 1T25A 4ND5A 4DPLA 1HZJA 1HYEA 1NQOA 1U1IA 1YH3A 4KQWA 3GNSA 3ZNQA 3ZWNA 4QT0A 2IDZA 4YJGB 2YQ4A 4QFCA 2QYSA 3AOEC 2YDYA 1YONA 2AEJA 2VWQA 4FDAA 4NBVA 2DFVA 4PLYA 3TSCA 4NI5A 4BO5A 5JAMA 1U9JA 2DVMA 4ITUA 3AOGA 3CSDA 2Q1UA 2I67A 1F06A 3OBBA 5GMOA 3RFVA 1D7OA 4Z0PA 2IEDA 5KVQA 1B8PA 1HWYA 3DOJA 2OHXA 3UUWA 4L76A 5TQVA 3UICA 2GUGA 1PGQA 1VL8A 3E9NA 4M55A 4CUZA 1M6HA 1J5PA 3GMSA 2HK7A 1ISFA 4LCEA 5BNTA 2BELA 3AI1A 4Z3DA 4D7AA 4BO9A 5IDQA 1EFKA 4PG8A 4ONEA 2JD0A 4N5MA 1NX6A 3TOZA 2FN7A 4GX2A 1FDSA 3CEAA 3VPHA 1ZJYA 5IG2A 2V6MA 4WLFA 3PI7A 3PQFA 2JD1A 2FPPA 2GLXA 1Q0HA 1KEWA 4R3WA 1TXGA 3ITKA 3ANLA 5EL0A 4DXHA 1B14A 5JYEA 1NFRA 4ALKA 4OIMA 3UH1A 1HDXA 3W8FA 5A5FA 1BSVA 1KEPA 3DBVO 3BHJA 5LDGA 3CTMA 3JQFA 4FIZA 3VVBA 5BSEA 4ND3A 3ZWVA 1EE9A 3S55A 3KB6A 4K26A 1XYGA 2X86A 1PR9A 2D2IA 1O89A 4ND4A 3ABIA 1GYQA 2EJWA 2WJPA 4H15A 2O7QA 3ZNOA 3PP8A 1HKUA 4NG5A 5GZ6A 1NTOA 3F46A 3HDYA 4CM4A 3NEPX 3WGYA 3OIFA 4AJNA 1YGYA 1RM0A 1I01A 4W9NA 5CPFA 3FF4A 1WNTA 2ZTUA 3F6YA 4NHEA 2X0NA 1FDWA 4MP8A 1N7HA 4CMIB 5JNLA 3C7DB 3GN2A 5B4UA 3IIEA 4W99A 4PLCA 2C7VA 2CDAA 3U09A 4K6CA 3HQ4O 3GGPA 5JC8A 1ISMA 2E37A 4N5NA 3FBTA 4CV3A 7ADHA 2C59A 3CINA 4O5OA 3UCXA 4YXFA 2J3HA 1ENZA 2DBZA 3VKUA 3ETDA 2AQIA 4EW6A 1QR6A 3F4BA 3L6OO 2Q1SA 4I9HA 3AY6A 5TT1A 1SCUA 4IQ8A 1W73A 1DAPA 1P0CA 4IMPA 1R16A 3L6DA 1F8GA 3RD5A 4XJSA 3UKOA 2I3AA 1ZMTA 3TZHA 2VUSA 1XIVA 3RUEA 4P4GA 3DZKA 1SOWA 1LRLA 2PWZA 3U4HA 1CERA 4Q3NA 4FS3A 5ITWA 1SEVA 3HB5X 3L6EA 1W6UA 4L74A 2FPGA 3ZU4A 4BNIA 1B3BA 1X15A 5EQDA 3ASVA 5CDTA 4LCJA 1U3TA 4A0SA 1NQTA 1C0PA 3DDNA 1P31A 2VUTA 4OJNA 5G0VA 3PGXA 4MVJD 2Q2VA 1JLLA 2DTXA 4RCVA 3X2EA 1LLDA 2C5EA 3CE6A 2JKVA 5T5QA 5AVOA 3VZSA 1UP7A 3GPDG 4KOAA 5K0ZA 5HTOA 3DTYA 1HETA 1UXIA 4D45A 3A28A 2I3GA 3I6IA 2GGSA 5DOZA 3GHYA 1OI7A 2D0IA 4WNCA 2C5AA 1ZIDA 4O6VA 1RYEA 3IDSA 4PCVA 3QWHA 3GG9A 1LRJA 2BHLA 5AOVA 2V6FA 1JAYA 3GZNA 4XQ9A 4IIVA 4B4WA 2EWMA 4E32A 3AK4A 5IDWA 1VJTA 3E5MA 1R0KA 4G81A 5T8KC 4A2CA 1HYHA 4BGEA 2AE1A 2O3RA 5DF1A 3FRJA 2PNFA 4MIEA 3WQQA 5KIAA 4R5MA 3D5QA 3GH3A 3HWRA 4PVCA 4AJ4A 4KUEA 4GGOA 5JO9A 4RJTA 3WICA 5THKA 5F21A 2CUKA 3HN7A 1DPGA 4WLUA 4HFJA 3ZV4A 3DAPA 1T4BA 1SB8A 4ALNA 1K89A 1X1EA 2P5YA 2VZ8A 3OA2A 3RBXA 4MKRA 2AQKA 3H9QA 4Q3AA 1VPDA 2Y1FA 4R9SA 4DYDA 1KY5A 1TB4A 4XGIA 1HT0A 1R0SA 1YDEA 4BV9A 1LTHR 3Q9UA 1LQUA 1KBZA 5TJ9A 1H6BA 2EW2A 4FOOA 1DOHA 2G5CA 3GC6A 4UREA 1LDNA 4QXMA 1PS8A 2PGJA 3O03A 3ANNA 1Q7BA 1VE9A 2C2XA 1CQIA 3AU8A 4GL4A 2GN6A 3BTOA 4ZQEA 1ZK3A 4GVLA 1LX6A 4PG5A 2Y1DA 2Y1OA 2GR9A 3QA9A 4RDHA 3ZWBA 4D0SA 1NPDA 5JCJD 4TMFA 3ENKA 4AJLA 5ICSA 3CXRA 4E5NA 3TNLA 1GZ3A 4IGEA 5BSFA 4FFOA 4QTZA 1WDLA 3RUAA 4BNUA 3ON5A 3QVWA 1LLQA 4BKQA 4OAQA 3LU1A 2YHIA 4PZDA 2YYYA 3H9JA 5JO0A 4BL5A 5F1PA 5BSGA 1NVMB 4XJTA 4LGVA 4HFMA 4IZIA 4D0RA 1AXGA 2J3IA 3B70A 4ILKA 5HWSA 4OKNA 1Z7EA 4YT2A 1X13A 3VPFA 2PZLA 4Z3KA 1EMDA 2VOJA 3WGOA 1EUCA 2FOIA 1F0YA 1QV6A 3LLVA 1PJTA 2Y05A 3RSHA 4TZKA 1ISGA 3WB9A 4JIGA 1X14A 5L4LA 4CQMA 4TQGA 2FPIA 2EP7A 3VOSA 4HNHA 1C1XA 2G0TA 3PTZA 4CLEA 1X0VA 3F1LA 2B5WA 3RFTA 1N92A 5ER6A 5JDCC 3LK7A 3I9OA 1JKIA 3L77A 2SCUA 1IHXA 4Y8VA 3WQRA 1FDTA 4I9NA 4XD2A 3SXPA 3B1JA 1B26A 1ISJA 1ZO8A 4OXNA 1KIFA 3DO5A 4UVIA 1TT7A 4UEJA 3WS7A 4XYLA 1JDJA 3MJ4A 5FFFA 2CSUA 1BGVA 2BH9A 4E2XA 1KC1A 5CG1A 2UVDA 1KEVA 2ZYAA 4XYGA 4YB8A 3ROMA 2HRZA 2RCYA 1PZFA 1HL3A 2YZ7A 3H7AA 5DP1A 3RJ5A 1SMKA 3V1YA 3NDIA 4NR0A 1MB4A 3TWOA 1QORA 2GSDA 2ZTLA 3DBHA 5MGBA 3WJAA 2PZMA 3VH4A 4GWGA 4EZBA 2HUNA 5BNIA 1I36A 1P1RA 5T57A 3JQ8B 1ZXBA 1E92A 4RPLA 4UVHA 1RKXA 4FW8A 4IDCA 1MGOA 3JQ7B 4J6FA 4J9VA 2V7PA 1IZ9A 1ENPA 2VOEA 2PV7A 2VWPA 1NVTA 3ONFA 1U8XX 5DBIA 2EGHA 2VWHA 1PU2A 2EKPA 3RU7A 3B1KA 3OEWA 5KTKA 1FK8A 2PH5A 4BO1A 1GQYA 1HDCA 2Y0EA 3UCFA 4G2NA 4B7CA 4EEXA 2X5JO 3DBRA 3FN4A 2DQ4A 5JCJA 3SLKA 4CLXA 1NPTO 4ZQGA 3LC1O 1Z82A 1OMOA 1EDZA 3C85A 4IJVA 2EKQA 1XHLA 2FR8A 2HMWA 2DPGA 4CM9A 4DL9A 1A7AA 3I1JA 4RVUA 5I9LA 5L7YA 1CEQA 5L51A 4CR7A 5DBGA 2RBEA 4E30A 3OJFA 2QX7A 3O9ZA 2Q1WA 3U3XA 3GDOA 2QRKA 1O94A 4BVAA 3HHPA 2Z1NA 3QY9A 5BNFA 4BNXA 2WEKA 4P38A 1W8DA 4CM7A 3MJSA 4IQ0A 5JAQA 3TL3A 2DTDA 1GADO 1EE2A 1BW9B 4ND1A 3P2YA 4JK3A 5L4SA 1G1AA 2UV8A 1JKFA 3I3OA 4TVOA 1XA0A 4C4OA 3OJ0A 5HM8A 5TIIA 4EUHA 3OP4A 3P19A 2EIHA 2NTVA 2XPCA 2Y1GA 4WASA 1T2FA 4E2YA 2VN8A 5F5LA 4GKBA 4BHTA 2AHRA 4FN4A 2A94A 3W8EA 1J49A 2J3JA 3EAGA 1R4NB 3MJVA 3NDRA 1UP4A 1GPJA 1ZJZA 4G5HA 3RQSA 5JCXA 4ID9A 3WLFA 4QO8A 2IODA 3S2EA 4INAA 2FY8A 3C7AA 3WNQA 3K2EA 1I2ZA 1P1KA 2HMTA 2DBRA 2ZKLA 4BO2A 1N5DA 3U5TA 5B1YA 1DIRA 3MWDB 1RWBA 1GY8A 1Y8RB 4YBZA 1U7HA 1ONNA 2BF7A 3K31A 4PG7A 3KLMX 3PVZA 4CM1A 4ZN6A 4ZJUA 5KJFA 4YVFA 1ADGA 1Y8RA 1EFLA 1NWCA 1T2DA 4CUJA 1B16A 3P5SA 3JQBC 1P77A 1DRVA 1NP3A 1O0SA 3F1KA 3LF2A 5A9SB 2HJSA 2ZQZA 3LSYA 4XCVA 1DFGA 1GV0A 1MA0A 1E3WB 1JW9B 2IEBA 1RM5A 3C1AA 4U6QA 3QSGA 1U3VA 3WWZA 1LDYA 4TZTA 3WIDA 5JAIA 1A9ZA 4FOSA 3H2ZA 4MVJG 2Q50A 2RH8A 4IBOA 4E2ZA 4FJ0A 4E3ZA 3ITDA 5CDGA 5IAAA 2YHUA 1QP8A 2R00A 1YB5A 1T1SA 2VHWA 3PHJA 4WLOA 3DL2A 4CQLA 4C7JA 5G4KA 3GFGA 4FSHA 4BNGA 5FF9A 3OEYA 5KOIA 3H3FA 1C1DA 1KC3A 1UDCA 3LVFO 2ZTVA 4UEKA 1D4FA 4B7XA 1E3IA 3KYDA 3HDQA 3FHLA 3VH3A 1HE5A 1V3VA 3D3WA 4IY1A 1I2BA 1ZUD1 1QXSA 3DQPA 4GWKA 3HFSA 3RC9A 1GV1A 1GUYA 4RV9A 3ONEA 3ZDFA 2A4KA 3BZUA 1BXZA 3JQEA 3L4BC 3JSAA 1P1HA 3G1UA 3ZCXA 4EJMA 1PWZA 4Z0TA 4GLLA 1VRWA 2I99A 2I66A 4W7IA 2YV3A 4CLRA 1PJ4A 1YBVA 5EPOA 5IDXA 4KTTE 1DHTA 3IJRA 1HEUA 5A04A 4WUVA 4WEQA 2WM3A 3GRPA 1LSJA 1UP6A 3A1NA 1F14A 4PLHA 4IJUA 1K5HA 4WLNA 3KEQA 3PYMA 1R4MA 2UYYA 4D79A 2EXXA 4ZRMA 1B15A 4O59O 1IUKA 1I24A 2Y1CA 3KO8A 3DOOA 4M87A 1JVBA 4X54A 2ZATA 3O26A 5ENDA 4GX0A 2BFOA 4RPJA 3E5RA 5A4DA 4CMJA 4R16A 1J4AA 3TZ6A 1ID1A 1SC6A 1SAYA 2JFFA 2IZZA 1K0UA 2YFHA 4CMEA 1HXHA 4D46A 3B1FA 3JD0A 2UAGA 1JQBA 2FWMX 2X58A 1LSOA 4R1TA 1GD1O 1VKNA 2FRDA 4JGBA 3GG2A 2EEZA 4O0LA 5GY7A 1ONOA 4ZRNA 4ZQHA 5KKAA 2FR1A 2WDZA 3K5PA 4QX6A 5I7FA 3R3JA 1D1SA 1EK5A 2DTEA 4MJLA 1L7DA 3GUCA 1BVUA 3RKUA 4EYEA 1HDYA 3GN1A 1MUUA 1M75A 2C7GA 4R1NA 2QHXA 1C1XB 1Y8QB 1YQDA 4O63O 1U5AA 2HAEA 2WYUA 4WOJA 3ENNA 2GDZA 1UAYA 2ZIZA 1X7GA 4BMSA 4EEZA 5B4TA 1X7DA 3JYPA 4HV4A 1NFFA 3PHGA 3RUFA 1DJNA 5BSHA 3JQDA 1WAMA 1E7SA 3OICA 1XR3A 4PG4A 4OOFA 3AI2A 1V0JA 2GN9A 4CM9D 4RF3A 3Q11A 2JCVA 4JN6B 3PXXA 3KUXA 3QV1A 2IXAA 1A27A 4CL3A 4BNMA 4RVGA 4YRBA 3GK3A 3EYWA 1GYRA 3I5MA 4E12A 2PR2A 3W4IA 5I8ZA 3HADA 2EHDA 2HU2A 3N58A 1GUZA 3EVNA 4BNFA 1ZEJA 1G6KA 1JWAB 4DC1A 3A14A 3INGA 3ZNPA 1E1NA 1PS9A 2Y0DA 3HUDA 5EN4A 1HDOA 1PIWA 2O48X 1HDRA 1GPDG 5JFOA 3R0IA 4UUOA 4RLHA 3L9WA 5TF4A 1BXGA 4OH1A 4IDEA 3U49A 3NTQA 3WTBA 4IUYA 5F3RA 2IYPA 3UOGA 4A26A 4BQRA 3GDFA 3ZWXA 3JYLA 3GUYA 4RQTA 2AEFA 3BTSA 4OHUA 4DUPA 4FC7A 4IDGA 2V65A 3L4SO 1UDBA 4A03A 5I7SA 4BB6A 3TJRA 1C1DB 4BNVA 3RUCA 1C0LA 3W6ZA 3WGGA 2EGGA 3SC4A 2RAFA 3UXYA 2AA3A 3FD8A 2NU8A 4Z6KA 2HK8A 3QVXA 2IXBA 3DBHB 4W4TA 2B83A 3AW9A 1BMDA 3JQAB 4RDIA 4FFNA 2JAHA 3H9GA 4Q39A 4BNJA 2I76A 4WCDA 4EGFA 3SEFA 4B3HA 5F1OA 1I32A 4EJ6A 1KVUA 4GSLA 4Z9FA 4GLOA 3FPLA 3UGKA 4CLRB 5AYVA 2W2LA 5A3JA 3WTCA 2EG9A 4CLOB 4BUCA 3BMCA 1SNYA 3DWFA 3PWZA 4PLZA 5JDIC 1PL6A 4TKLA 4IS2A 3E18A 5U1PA 3I9LA 3TZKA 3A4VA 4BNZA 2OZPA 2ZQYA 3K96A 4PZEA 4A73A 1GU7A 2DU8A 4ALJA 3FR7A 1NR7A 1U8FO 5TLSA 1GQ2A 4PLPA 4DRYA 1YS4A 1E7WA 4YWJA 1A5ZA 1Y1PA 2EP5A 2O3TA 3ZHZA 4CMAA 4Y9DA 4IDBA 2X9VA 1R15A 3VPXA 1UZNA 4CQLB 1BG6A 1Q7CA 3LT4A 4PRLA 1DXYA 4GI2A 4WKGA 4CM3A 2OORA 1A4UA 1N8KA 2Q46A 4Q3BA 4UUMA 5CEEA 4AFNA 2F1KA 1M66A 3FCOA 1JKJA 2DT5A 1YVEI 4W6ZA 2CVZA 5A3VA 1OC2A 1LXCA 3OF2A 5EMHA 3WDSA 3WYBA 1R6DA 2F00A 2IE0A 5CG2A 3AFNA 2W8ZA 4BO7A 1HSZA 1NFQA 4UAGA 3H9UA 5KJEA 1E3WA 2O3UA 1Q1NA 3DR3A 3OQBA 3PIDA 1EVIA 5L40A 3RBVA 1VL6A 4XKJA 1IZ0A 3ORFA 5BQFA 3PJEA 4AJKA 2JAPA 1FDVA 5IN4A 1IOLA 1H5QA 3S2IA 3DZHA 4CPDA 3WQSB 5G0TA 2B4QA 4BO4A 3HZZA 4Q3EA 1IHYA 6LDHA 4D44A 3KOUA 2JCYA 4XEHA 2GD1O 5JYDA 1Q7GA 1EEHA 3WXBA 1B7GO 3ZHBA 5L95A 4ESOA 1JN0A 1PJ2A 3DTTA 3AOEA 4K28A 3B6ZA 4ZICA 2PKQP 1IY8A 2DBVO 4J1SA 3ZHYA 3V8BA 1EBFA 4CM4B 4E5PA 4FPXA 4MP6A 3LYLA 4XRRA 3VH2A 5IJZA 1XSEA 2X0IA 1N9GA 5TGDA 1Z73A 3KLPX 1XDWA 3DZFA 5C7LO 4Z9YA 1I3NA 4AJIA 5CDUA 1LQTA 4M8SA 4IPTA 1G0OA 4XDYA 3MTGA 4E2WA 2I9PA 1PL8A 4YJDA 3PEFA 1BDMA 1LRKA 2RIRA 5G0SA 3NT5A 1PJQA 4KDEA 5TT0A 2OP0A 3BTUA 4J91A 1RPNA 2YV1A 1YO6A 1U7TA 2J5QA 2QIOA 3PHHA 4DREA 3G79A 3WBFA 1XCBA 3KSDO 1HE2A 3LZ6A 4M54A 1GCUA 2PKQO 5THQA 4CMHA 1P74A 1KVRA 4J2OA 2C0CA 5L7TA 1H0KA 1ULUA 3DHEA 4QECA 4J2HA 1GZ4A 4JCOA 2HLPA 5EIOA 1EQ2A 1T2AA 2UUPA 3IOYA 4YJHA 1HYGA 4E6PA 3PQDA 1E3EA 3JQAD 1P33A 2B37A 5L53A 2VT2A 1Y9EA 3G1TA 1U4OA 3ZW9A 2W4QA 1WXDA 4BKPA 1CJCA 2VYNA 4CM5A 3WFIA 1ZH8A 2OOSA 2Q2QA 3FPCA 5KWEA 1IULA 1H6CA 4TKMA 1P45A 4HXYA 2H5LA 2O7SA 4EBFA 3SVTA 3BMNA 4LMPA 3ZWPA 2PGLA 1WW8A 4R68A 3GZ4A 2O4CA 1KY4A 3DZGA 3K30A 2C82A 2X0RA 4JJFA 5DN9A 2ZB3A 3WJ7A 2WWRA 3AM4A 4NBWA 3U62A 2D59A 5DNAA 3PHLA 4OL9A 4Z9XA 5LC1A 1M76A 4NBRA 4BGIA 4DMMA 4BO6A 1VM6A 5DZSA 3EGOA 1QV7A 3LT2A 1Z45A 2IYOA 1E3JA 3QVOA 3WIEA 1HE3A 4E13A 1DIAA 4GGPA 3FNGA 2Q1TA 2ZYDA 2IRWA 5AXAA 2QRLA 1H6DA 3K92A 2VUUA 1M2WA 4ALMA 2PD3A 1R37A 1N9GB 1I8TA 4J7CA 3OIDA 3WOHA 3UF0A 3GAZA 3L9XA 3VDRA 4XDZA 1GAEO 1HLPA 3Q9NA 3HB4X 1UXGA 3FNEA 4MVJE 4KWIA 4BMVA 3AM3A 3UW3A 9LDTA 2CFCA 4BMNA 1ZZEA 3L0DA 1PL7A 1S6YA 2B35A 2CNBA 2D1YA 3FI9A 1KVQA 1OFGA 2DBQA 3MTJA 4F46A 2PD4A 3ASUA 4U0KA 4J4BA 2DFDA 3RIHA 3G49A 4BS9A 1A7KA 4CQMB 1RYDA 1H2BA 2O2YA 2PTGA 3EVTA 3JD3A 4KWHA 4AJJA 4N18A 4I5FA 5T6BA 3WYEA 1PX0A 3PRJA 3BHMA 2NVWA 1DC3A 2QW8A 1XELA 1ENYA 1B2LA 2CD9A 1HDGO 1HDZA 3NV9A 4Q3DA 4YRAA 1DC5A 4A27A 1DAOA 3LT0A 1P9LA 4B4VA 1JU9A 2DLDA 2R6JA 4RF4A 1U2GA 2AMFA 1R12A 4R9RA 4FFLA 3GVXA 4AJPA 1F17A 1D8AA 1PEDA 5IXYA 4BNHA 1Z7BA 3BIOA 1N2SA 1KERA 4DBVO 2OGUA 3M2TA 3C1OA 3GT0A 3RUHA 5COAA 4PLFA 1MLDA 2RH4A 3M1LA 4B8ZA 5A05A 3RASA 1X7HA 4CL8A 1ZNQO 2P4QA 2Q2WA 2NWQA 4OKIA 3GHHA 3H3JA 2O23A 3TZCA 1P1FA 1VKOA 5A5EA 3G0OA 4GSKA 4DWVA 1MG5A 1O8CA 4U0JA 2P9EA 4Y6RA 2B4TO 3JCZA 2UUOA 4NMHA 1ADBA 4KP7A 4WNIA 4MVJH 3VTZA 1IB6A 5FYDA 1H94A 3RC2A 5HBRA 1TT5B 3PYXA 2TMDA 1C3VA 4IDDA 5EESA 4R69A 2NUAA 4Y6SA 2B0JA 2J5RA 4PN3A 1UUFA 3IQDB 3QP9A 4FCCA 3ZN2A 3V2GA 4XYEA 3B20A 1OOEA 4R54A 1WDKA 1PJCA 1GEGA 4NDNE 2WMDA 3JV7A 3R3SA 4E5MA 5T67A 1V8BA 4JXKA 3VZPA 3U9LA 3ZV6A 4BNNA 1E1LA 2HSDA 2B69A 3K73O 3KZVA 4IJWA 1L7EA 3HJAA 3QRWA 4D42A 4PGFA 3NYWA 4LRTB 4GBJA 1BVRA 1FDUA 5GZ3A 3COSA 1XGKA 1BXKA 1PGNA 1CIVA 3JQ7A 4JP3A 3RROA 1YL6A 1NPYA 4HWKA 1UJMA 1H9AA 3H4VA 4PLTA 3GVHA 2O50A 1UDAA 3D7LA 3RUIA 4DQUA 2HCTA 4L9RA 3K9QO 1EVZA 5IFLA 3HNPA 1RM3A 1WP4A 4J7UA 4F6CA 3RJ9A 4FJ1A 1LI4A 2Y1EA 5KVVA 3DB2A 4HX5A 5MDHA 3DZBA 1E6UA 5L7WA 4H3VA 1VSVA 2PA3A 5TSDA 3ADPA 4M49A 3KVOA 3ANMA 3A06A 1U4SA 4YJFA 4MINA 3ST7A 4BO3A 4R1SA 4BGVA 5A03A 3OQ1A 3UHAA 4JBHA 4F6LA 5FWNA 5I9NA 4XYMA 4PLVA 4BB5A 1KS9A 1PGJA 3DAFA 3WGIA 3QLJA 4XIYA 3T4EA 2ET6A 1ORRA 4CV2A 3AY3A 1R0LA 4WCFA 1Z74A 3MOGA 1P1JA 1T24A 4J4TA 4QFDA 4NNJA 2G17A 1U28A 4GKVA 2JCXA 4UULA 3H9EO 3TDKA 4AVYA 1YB4A 4FB5A 1ZEMA 4JJGA 3AJRA 2WD8A 1WDMA 1H9BA 2AG8A 2VHYA 3QW2A 1PJSA 4MVJA 4P4LA 3TRIA 3UVEA 1HE4A 1QYCA 3T4XA 3I6QA 4IINA 2RHCA 4RPHA 2QQ5A 3IS3A 4LISA 4ZD6A 4K1LA 3MJTA 4CLDA 4FD3A 5IXSA 3WGTA 8ADHA 2BGLA 4DLBA 4IM7A 1CQJA 2A35A 2BRUA 2J6IA 3QWIA 5A9RA 1P0FA 1YE3A 3PPIA 2GZ3A 3BAZA 1GL3A 2DAPA 1E77A 3NT4A 3GEMA 4L75A 5ILOA 3SJ7A 5I9MA 1XG5A 2YV2A 2CF6A 1EVJA 5AQ1A 3PFFA 3ICPA 3WNVA 3U4IA 4Y98A 4LSMA 4NFYA 2OL4A 2VYVD 2W2LD 1OAAA 3FTPA 4J90A 1IL0A 5TC4A 1HRDA 1SOVA 1NR1A 3H5NA 3OECA 2D4AA 1PQWA 3EHEA 4U7WA 4II3A 4RVDA 3E9QA 3O38A 2DUUA 3V1UA 4RPKA 1SZJG 3S8MA 1Z75A 1J6UA 3LDHA 2O3QA 1IE3A 2HJRA 3GGOA 3GOHA 3TL2A 3DZIA 3GLQA 3INRA 3VKVA 4HP8A 5IZCA 4AL4A 1DC4A 4HY3A 4HFNA 2X4GA 4F3YA 4YQZA 4CQMD 4YTEA 2BMAA 1XWFA 1ZK1A 1YL5A 1R4MB 4S1VA 2HK9A 5CEJA 3VHRA 3BTVA 3RWBA 1O5IA 3F5SA 1ZFNA 2OBNA 1PR3A 1PTJA 4XR4A 2Y66A 3LLSA 1K2WA 2CVOA 1LDGA 4BO8A 1MP0A 4CJXA 3DXFA 4KTVE 3RC1A 4U6SA 1GZ6A 2VCYA 4XR9A 1U5CA 3HE3A 5IF3A 4JNKA 4IXWA 2HQ1A 1NBOA 3H6KA 3QE3A 4S3MA 1AXEA 2NU7A 2P68A 4R01A 3NTRA 4GMGA 4CR6A 3MOIA 1B0AA 1PWXA 2W2KA 2FMUA 1NQ5A 2NQ8A 3Q1LA 4GH5A 4HADA 3VZRA 2R2GA 1OC4A 3FTNA 4DYVA 1I33A 3IKTA 1NQAO 3MEQA 3DMYA 3NJ4A 3IAHA 2GYYA 3M1AA 3INTA 3JYQA 2I65A 2NU9A 3S2FA 3V1TC 1NNUA 3ZWYA 5CFZA 1FF9A 3PJDA 3OFSA 2X5KO 1DFIA 2FHSA 4LK3A 3VAZA 2YJZA 2Q49A 1HF3A 5B4VA 1XU9A 4BKUA 2O3SA 3QQPA 4YDRA 3KSUA 4RO0A 2EERA 1EUZA 3AU9A 1C0KA 5COBA 4NPCA 2YFQA 4L4RA 1BRMA 1GEEA 3NKLA 1X1TA 4UUPA 3RC7A 1YQGA 5I7EA 1Z6ZA 5B37A 4E5KA 3LC7O 1G0NA 4R3NA 3PHIA 4RLSA 4OMUA 4WK6A 4UVDA 1E7MA 1P3DA 3JTMA 2D3TA 1GFSA 2TMGA 3JQGA 3S1LA 2GASA 3IC5A 3IKVA 3MJEA 1A4IA 1LJ8A 1PGPA 1GR0A 3RBZA 3U4DA 2JL1A 3JQGB 4B4OA 3TQHA 3HN2A 3TOXA 1HSOA 3OA0A 4NBTA 2GCGA 4UUNA 1F12A 2C29D 3DC2A 4RVFA 1PJ3A 3H2SA 4TVBA 3IJPA 3QWFA 3ZWAA 2ZJ0A 5A06A 1DEHA 4OXYA 3JQ9C 2BLLA 1M67A 2FR0A 3PWSA 4U8GA 4J16A 4BNTA 3AUAA 1VSUA 3GDGA 3PWKA 3PGJA 4NK5A 1Y9AA 1O9BA 4FFRA 1ADCA 2BI7A 4YRDA 3WR5A 2A9FA 5KVCA 4NJMA 4OSPA 3KYCB 1DB3A 1GUFA 4B3IA 1W0CA 3AUSA 5ITVA 4J3FA 1PS0A 2PK3A 1LC0A 1RJWA 4Y67A 1QRRA 4BGUA 3CZMA 4XGNA 2YQ5A 2IZ0A 3ZU2A 3DZJA 2Y67A 3EUWA 4YYZA 2EKLA 3JYOA 2Y99A 4UVGA 3KHUA 3OJOA 4DTIA 1NAIA 3KRTA 3QJ5A 4ZVVA 3TPCA 3DMTC 3PFWO 1QYVA 2JHGA 1LDBA 1DIGA 3R6DA 3UFXA 3VZQA 5C37A 4YT4A 2WYVA 5JY1A 2X5OA 1BTOA 3EW7A 1MXFA 3GEDA 5ER9A 4CODB 1JA9A 4D3SA 4PG6A 4XGKA 3FSRA 1I0ZA 1V9LA 1PZHA 1YBMA 2ZB7A 1LC3A 3S2GA 3OSUA 2C54A 3TN7A 4HBGA 4J1TA 1WZIA 5LCXA 2NVBA 4E4YA 1V3TA 2BFMA 1T1RA 2D8AA 3F5QA 3W6UA 5I8WA 4CMBA 1JVSA 4OXKA 3IUPA 3QHAA 1DIBA 4QSMA 4EUFA 4NU6A 2E6UX 3JYNA 1QYXA 4K9DA 1I3MA 1ENOA 4CMKA 4CM8A 2GF2A 1FJHA 4A5OA 4XRGA 5HS4A 3RU9A 1TI7A 5KKCA 3D3EA 3NJ8A 1X0XA 4DC0A 1VLLA 4JLWA 4DQXA 4HUJA 4MVJM 1EQUA 3GVPA 1LDEA 2XXBA 2X9GA 1E6EA 1Y7TA 1WMAA 2DC1A 4FJ2A 1Y5RA 3E8XA 4CLHA 4DIOA 3HG7A 3KTDA 5JE8A 2OXIA 2D5CA 4CMIA 1MC4A 5EJ2A 4RPGA 4IZHA 2FZEA 2ZK7A 3FNHA 5DULA 4DQVA 5KNLA 1WVGA 3WWYA 2VNAA 5C5IA 5K6AC 2BFAA 3I9NA 2QYTA 3KYCA 2GN8A 2I5PO 3JQBA 4J1QA 4UVEA 1N1EA 4ND2A 3ZHXA 4R4JA 4MKXA 2PZJA 4N5LA 3ZZNA 1PQPA 2Z1MA 2OP1A 2AE2A 4J4HA 5JBIA 3H65A 2GO1A 5G0WA 4I9UA 4D3FA 4B8WA 3L07A 4M86A 2VZ0A 3RKRA 5KJ1A 5TX7A 7MDHA 1HZZA 4DVJA 3GA0A 2ZTMA 4DPKA 1MG0A 4TRJA 2VRCA 4RZHA 1LBEA 4MOWA 4GX1A 1E5QA 3AUUA 5CHEA 3IP1A 2VT3A 3WGQA 5C3MA 2FSSA 1SB9A 2R00C 4MKZA 5GZ1A 1I30A 1PGOA 3ZGYA 4MVJF 4XB1A 2HO5A 5IZCC 5KCZA 1EBUA 3STHA 2DM6A 4FQ8A 5DP2A 5FEUA 3PZBA 4UEOA 1QLJA 2POQX 1ZVMA 5ENVA 1P44A 4I5DA 4TRNA 4IDFA 2E48A 1P1IA 2YDXA 4O1MA 3C24A 2VRBA 1YQXA 3BMNB 2OUIA 1Q2XA 1MX3A 3DFZA 2I6TA 2O2SA 2JD2A 5CEFA 5CDYA 4JJIA 1WLYA 1GYPA 3K8ZA 1B8UA 3LT1A 1T4DA 3AI3A 4URFA 3AM5A 3F47A 4I5GA 1D1TA 3ROPA 3ZI0A 3ZW8A 3M2PA 3GGGA 4JX8A 2P9GA 4FFMA 2WD7A 1JAXA 5B12A 1DFHA 3X2FA 3O8QA 4IGFA 2X7HA 3TFOA 4OYRA 3DBRB 3N7UA 5DT9A 2H6EA 2H63A 3LF1A 1LU9A 3GNQA 4L0QA 5JDCA
chains in the Genus database with same CATH superfamily
1BH6A 2CFSA 3OETA 5JSFA 1P2UA 1TE2A 3R6GA 1KJ9A 1TCCA 1IXZA 4MDHA 2P2DA 1APBA 2ERYA 1M1YA 3K70D 3KJZA 5CB4B 3B52X 1TM5E 3PDWA 3T9DA 4XPIB 1F8UA 2QAGA 4QQ8A 3TZBA 1RI4A 2C5LA 3BMQA 1ZSYA 4RELA 2R65A 4XWGA 4P2GA 3V4LA 2CF5A 1TEXA 2GPYA 3M6IA 3DEAA 3PCRB 3KM0A 4IXTA 1FS6A 1SFRA 3OY7A 3LX4A 4UTNA 3HXQA 4DR2B 3HDHA 1SPXA 3BMQB 4CF3A 2H1IA 2ROQA 4H27A 2YUTA 3JQAA 1B6RA 1Q0QA 1DVRA 3ZGXA 1RHUA 3BFVA 4B80A 3HFGA 2GEBA 3AKDA 5ADVA 2XF8A 2ZI5A 1NVFA 5I01A 1PJBA 2PQ0A 2WYOA 5LQRA 2BH2A 4X85A 5E7QA 4PIVA 5C46F 4IHJB 4NESA 3CR3C 4GM0A 1L7XA 5SICE 2GHIA 3TX6A 4G0VA 5J4KA 3P0RA 1IQRA 1W5BA 2JEZA 4TTSA 3WL8A 2I7TA 4WKCA 3U3OA 1LBIA 1SZCA 2E49A 2XTNA 3ED1A 1TT5A 4CR8A 5JI2E 1TJ3A 4PX9A 4BECA 4QGAA 2BKAA 1YOVB 4JT8A 1LTKA 5EGNA 1TEHA 1AIPA 3ZWCA 3GYGA 4AKIA 3WWEA 2QF7A 4AO6A 5CBKA 1RJGA 2JJ1A 2VSFA 3B9BA 2J3QA 4HYEA 4AF6A 4KXVA 3ZGOA 2YYZA 1BCSA 5ES3A 2BTQB 2WD7B 3I9JA 1ZMBA 4JBXA 3HUTA 2CZCA 1AUQA 3U1TA 3N07A 4ITVA 5ICCA 1BXGB 2IF2A 3GEBA 3N2NA 4CKCA 4ENUA 4ZOQI 2O8DB 4FMCB 1KU0A 2ZRIA 3MWDA 5ARDA 3WO0A 4H7DA 3IXQA 3RVJA 4I50F 4C6HA 1MVOA 3IRVA 1UAAA 4QAQA 3JZIA 1QMGA 3WMXA 4DCPA 2MT9A 1OJLA 1CBUA 1FXWF 4OBEA 3GWZA 1OWOA 1P3Y1 1ULSA 3OMWA 4GSYA 4RFSA 4DDUA 1IQ0A 4DR7B 1KGDA 4P92A 4XLTA 3LJKA 5SY6A 1KDVA 1YIAA 3V48A 1JA1A 2HA0A 3V7WA 3D0OA 2CD7A 1N2CB 5JTTA 4BXOB 1DKLA 3EVBA 5TV2A 1FMCA 3C16C 2WTXA 4JDPA 4E5YA 1LF5A 3KYIB 3N1UA 4R1UA 1RVDA 4YX9A 4ZHSA 3VR2A 1MQ8B 3RJZA 4XA8A 1D2CA 1IY1A 2OENG 4JEUA 4GRDA 2JLUA 4CEIB 3I0NA 1L7QA 1YZKA 3HDJA 3WDLA 4YACA 2VHZA 4Z8YA 1HNXB 1JYSA 4OFBA 2E3JA 4B7AA 1UADA 2Z9CA 1TQ2A 2GEFA 1YR6A 2RHDA 4YONB 1G41A 1R9JA 2Z5LA 3UWKA 4EI9A 1AU9A 1UZMA 3TW4A 3TSWA 4JROA 4KDFA 4KFCA 5H0IA 1SCKA 1SVSA 4PNPA 2HJWA 1KH3A 2YX1A 2R2AA 1JG4A 3H2GA 4MI9A 5A02A 1ZBQA 5K2MA 1Y8QA 1G7SA 4QQRA 5GIPE 1XHFA 2A5JA 3IUQA 4FMDB 4L72A 5FFMA 4GUAA 3C8HA 3AF1A 5HE8A 5B30A 3E6AA 3OJEA 4G97A 4L4SA 3M3PA 1ZM4A 3KELA 1R2QA 3GRUA 3QXJA 4YJFB 4U4AA 5E9QA 3WGUA 2C2YA 1M34E 2EZ4A 5KQGA 3V2IA 1TQ6A 5HBGA 3LFUA 3UT0A 3BE4A 3RAPR 5NLLA 4BFTA 1O0BA 2RGYA 5DWQA 2PUCA 4MDFA 4R2LA 2NADA 3C3XA 3PC3A 3QTTA 4FLFA 1K5PA 3TZEA 1QM5A 3TTXA 1V4BA 2V5VA 5CYGA 5CLJA 3GT7A 1ZD2P 4YQYA 2FSVC 1RRMA 1E1QA 1JHOA 1YRLA 4YHBA 2EFJA 5DHPA 2QL9A 1PBNA 5LD2C 4E15A 1QHNA 1XQXA 3IUNA 5SV2A 5BUCA 1T36B 4NQRA 2G76A 3G9XA 4N8SA 5JW6A 2L18A 3OLZA 4UU0A 3LXUX 4L07A 4B34A 3LYAA 1MTZA 2VVTA 1QG6A 2BOVA 2IYTA 3G7UA 1T0UA 4IDOA 4KMSA 2BFDB 2BUCA 4Y1GA 3JQ8A 4YAEA 4KR3A 2ZJ7A 1BD3A 3Q72A 4MW0A 4R8RA 3X1DA 3LRXA 2WA2A 2HXSA 1E6MA 3TD9A 1EDOA 4FC6A 3SS8A 1BN6A 2C84A 3HCDA 2G70A 4LWZA 5I51A 5J23A 3D7MA 2I0FA 2JBAA 2YC2C 4PR0A 4CUKA 3BSWA 4WBNF 1E0DA 1S2DA 1CXZA 2WWVD 5AW0A 3TSOA 3QMPA 5M5BA 4G0MA 1SRRA 2ZU6A 1H23A 3PC4A 1YXMA 2HX1A 1V8ZA 5A1TA 2J3KA 2N47A 4REQB 5DM2A 4IVNA 2BGKA 3P9QA 5FBLB 5AVKA 1NASA 2X9NA 3MWEB 1NYQA 4KO8A 4DMFA 3VJKA 1XEWY 3W4KA 4GQIA 3VNRA 3DZDA 2OHJA 4I3GA 4RGYA 1S3IA 2XYVA 3QLVA 1Y4AE 1ZN9A 3OIGA 4RGBA 1Q3KA 3G89A 4DN6A 3JD1A 4YAWA 1GT91 1JHRA 3GXOA 3K8OE 4ENRA 1BWSA 1U9IA 4ZYZA 1VMDA 1T4GA 1KYTA 1GKIA 2ZAGA 3AHDA 3QOFA 4K3UA 4KYVA 1TVKB 1SVUA 2BFBA 4FHEA 5LZ8A 4DDMA 3UIEA 1U3UA 1JR3E 3D4PA 4KK4A 2JLWA 3IMFA 4KQHA 4YJGA 1CUEA 4NHOA 1VE6A 5AI6A 3WXMA 1AV6A 3HKBA 3Q2OA 4YR9A 1NMEA 1DXHA 5NULA 5D7BA 2QN6A 1RJ9B 9ATCA 5GVSA 2PRKA 3IE1A 3IURA 3U61B 2HA5A 2L17A 4D3XA 4QOGA 5K9ZA 5IT0A 2Q8PA 4NV1A 1YFKA 3FBGA 3PUHA 1NUUA 3GUVA 4Q34A 1FLVA 3NUGA 3UQYS 1J5EB 3O75A 3TSYA 2M2IA 3C3AA 2H59A 2AQ8A 4HAIA 2ZDGA 5ALSA 5DWDA 3MWKA 5A9TA 3AUFA 1U2DC 3E2MA 1RAFA 3GRAA 4DY4A 4GNRA 3ZW7A 3W0LB 1FFBA 3WDKA 3F3SA 2LPMA 4JB3A 5DBFA 5ICSA 5KVSA 2ADOA 1NHGA 1ZSVA 1C4KA 1GN8A 4MJ3A 4NK4A 1TJNA 2YXLA 5HEKA 3T9BA 4BASA 1QC5B 5KI6A 1T26A 4YFYA 4CEJA 1RKQA 4M0EA 4Q3CA 3T61A 4A7PA 1E7QA 1NUPA 5DI3B 4DZZA 3U13A 3DBLA 4KFTA 5JJ5A 3WLLA 4RTNA 4JVNA 1UH5A 3S29A 4EKEA 1NONA 5H8WA 5IM5A 1NVVR 1DP4A 2QT9A 1XQ6A 2FZWA 4ZAFA 1JQDA 1WL8A 1MR3F 1UXKA 1O96A 2ZAMA 3Q6IA 2FPXA 3FMVA 3QF4A 1FXSA 4D81A 2R7MA 4EYQA 1F3OA 2YN2A 4DTCA 4N7RA 5AW6A 4A0HA 3CURA 1N8NA 1YK0A 4MPDA 5EMKA 3W5DA 1T6NA 2WJGA 1J09A 3IEIA 4HH0A 2VDKB 1ML3A 2RKBA 4FOLA 3NANA 3WHIA 3AGQA 1VLHA 3DV0A 3AWDA 5F2EA 5K8JB 4W82A 1JLRA 2BEVB 4OHZA 1SVNA 1OFUX 1T1EA 3OQIA 1KOLA 3Q40A 1U0RA 1XU7A 2VHXA 2NZ2A 1KEEA 2Q3BA 3HKEA 2O4UX 4DNPA 1USIA 2UZAA 2OAQ1 4XB2A 2DWQA 2GYWA 3EY4A 3O8LA 4QE3A 2OFWA 4YC7A 5EFZA 4HAUA 5CJPA 1I3KA 5F7XA 1X1AA 2VNJA 2VHQA 1JIIA 2AEMA 2Y93A 2ZJ1A 3IX7A 3X2SA 4DR6B 1TAQA 4TKUA 3ZU3A 2D5AA 2B5VA 3BDIA 3QVTA 4B87A 3EZ7A 3OJLA 3PQEA 5TS3A 5JZBA 3LWBA 1QLHA 1O08A 2GWHA 2E4AA 4GZMA 4QA9A 4WECA 4HQKA 3CB2A 3OEHD 2QJWA 2DUWA 3MJDA 2XV1A 3NKFA 3PD7A 1CJKC 4N12A 1VG9B 1ZH4A 2IZ1A 3K0KA 4M7OA 2CJWA 3EBOA 1Y3HA 1AA9A 1UZUA 3B82A 3VYRB 1G6Q1 3LD9A 3SYRA 1V2HE 3ETEA 3IKMB 3IP8A 4H3KB 3CLUC 2ZSEA 3IYLW 4WXMA 2ZZKA 5JYCA 3ZCPA 1V2GA 5DHTA 4XQEA 3SP1A 4CKBA 2Q6IA 2D6FA 5I9BA 2XKBA 1I13A 3K32A 3SBOA 3FFXA 3L6RA 4RL6A 1IH8A 1JWBB 2VZ9A 3WL3A 3TVYA 4C7OA 5IN5A 2PAAA 3C3PA 3OF3A 4NOJA 1D6NA 2OQRA 3QVSA 1VL1A 2OPBA 3A6JA 2EJVA 3FR8A 3BYZA 2CE2X 2P9TA 2G9RA 2VPQA 5JS2A 3VDQA 3VTFA 3VYTB 5AM3A 2P4HX 1E4VA 3PEYA 4GMDA 3UAGA 1YDHA 3TNYA 4B76A 1NBWB 1JSRA 5BSMA 4LYEA 5LQAA 2WP8J 3HKEB 3BMXA 5TRTA 1X7XB 2O1WA 2VDRB 4P3PA 4TSRA 2OMEA 4WCFC 3DKKA 4OBXA 5DTRA 3GJ0A 1H2XA 2PT6A 2QP9X 5T64A 3CZAA 4PW0A 4YLEA 5D5PA 1PYGA 3I01A 3R9IA 2QR3A 4Z7QB 1NW3A 4OJQA 1NRIA 4I4TA 2YVQA 3WIBA 2OBYA 2REXB 5MGNA 4KX5A 3FYSA 3UW1A 4QYXA 2AQHA 4ZCQA 1HFKA 3AUTA 2QYHA 3E9MA 4KIFA 4EJ0A 3ICCA 5ESRA 4B73A 2WSBA 4JLAA 3RFFA 4TROA 2AOUB 3TD6A 3CZCA 3O8QB 1M2VA 1CTQA 1DZIA 1WKBA 3DB1A 1E2NA 4GQAA 4J3JA 1VYVA 3ZS9A 3NOXA 3NVDA 4S1WA 1W59A 3E48A 1EFPB 1QGZA 2VT6A 3JY6A 4KIWA 1E4OA 2PZ8A 1KE2A 5CA1B 4MUXA 4HN4B 3KETA 2BGWA 1UOEA 5EZ6B 4TMVA 4DCJA 4DHEA 3AFMA 5F3RA 3TM5A 2O7NA 3MMNA 1WMEA 2H11A 4N82A 3WG9A 2BI4A 1MIOB 4CTNA 5KAMA 3V1KA 3OZTA 2Q6KA 2NLOA 1NRXA 3SQLA 2YIMA 3KYBA 2X5XA 1A9YA 3GEGA 2JVIA 1GTL1 4O3MA 3EG5A 5CNMA 4EECA 5HOQA 2HF9A 2C9ZA 4KN5A 3NGXA 3V5NA 3U44A 2J30A 2PLAA 3F6PA 3DO8A 1IEWA 3G9UA 3PWTA 4ROSA 4M1KA 1K6JA 3NCHA 2CFRA 3S7ZA 2IXDA 3ZV3A 2PH7A 1Q44A 2QK4A 4ZGWA 5EJ8A 1RC1A 3ZWOA 1T2NA 1N0IA 2J0EA 3GF4A 3PJGA 1AUPA 4EYSA 2C20A 1HDEA 2XYPA 3SC2B 2HYDA 1NXOA 1RXSA 1YI0A 3DFFA 4KYUA 4MR9A 5KJCA 1GU1A 4MW1A 1YJCA 4RORA 1BHSA 4HWGA 4K1XA 3LQ1A 2XE4A 1M33A 3ZXUB 3N74A 5EIFA 3RHSA 3BILA 2Q8NA 3GLTA 1D5CA 4ZQCB 2V3VA 4MW7A 1Y98A 4XIIA 2DETA 4HV4A 4WA8A 3TAHA 3V8RA 3TGLA 5KBYA 4X97A 3BGWA 5DOVA 1K7CA 1QH8B 4D9GA 4WXHA 2DPYA 3EOZA 2FW9A 5BMVA 2XUOA 2YWHA 1DLIA 2HREA 3H42B 4EPTA 1X7ZB 1IPFA 1Y7IA 4CWAA 4HPXB 4WKNA 3KQPA 3LT5A 1DBIA 3EGVA 3NHWA 4KDCA 3RVMA 1ZD3A 5LDHA 4LJ4A 3NXSA 4R41A 5TDHA 4KXFB 2XZPA 1TLFA 2LDBA 3CO0S 3HR8A 3KV3O 4JJEA 3U1BA 4WT7A 2HHJA 3U4CA 2CEKA 2XIQA 3I04A 3OOSA 4HDQB 3ZKWA 5CK5A 1SUIA 2PGAA 1TK9A 3FNBA 3THWA 1Z5VA 1F60A 3QVJA 4BB9A 4CNBA 2JFGA 2GD2A 2PLWA 3V2HA 1J0AA 3OQ6A 5EJMA 2GVDC 4RTMA 3BHIA 2YOFA 1UXJA 4XM0A 4H6XA 1R66A 1XZLA 1E9VA 2GS9A 3H1BA 4FN5A 3ABRB 1V47A 4QM6A 4OSOA 5AOBA 1Y1QA 1PNOA 1WMDA 1HFWA 2UXBB 1QVWA 2E82A 2ZVPX 5L3QA 2ONJA 2R4QA 4TTRA 1FDRA 4MQ4A 5AK0A 1GTVA 5EJ9A 3IE2A 2OYRA 4D4MA 1MRSA 1SQFA 4R2XA 3M33A 4RVHA 3QUQA 4R51A 3USES 2C00A 3FIJA 4JJKA 5ALQA 1JEDA 3DJYA 3GFOA 4FE4A 4IIUA 4L57A 2O3JA 4ZU6X 2BKVA 2CDCA 2DECA 5IASA 2XMSA 3S4YA 1NULA 1QZZA 3ZBQA 5KNDA 1LLUA 2JW5A 3VH1A 1GPMA 3U26A 5D2CA 4UHBA 5FI0B 5U4QA 3LPLA 4AS3A 3MLAA 4LXTA 4NZOA 3VKWA 2IHVA 2YKGA 1LPPA 4AJEA 4OOEA 2Q99A 3I42A 4UHFA 4DMLA 2FX2A 3URMA 2M9MA 4M7PA 3T7CA 3TLMA 2Q45A 5F23A 1BA2A 1GGMA 2VNSA 1GPH1 4E5DA 1LI7A 2E85A 5KSOA 2O2EA 5EJFA 5G3YA 1XZKA 5BT9A 4M46A 2OXEA 1XZBA 4V02A 3H8SA 4P5PA 5T41A 4MCJA 5BVHA 4L15A 4D2IA 3KQOA 4YRLA 1U3WA 2GK3A 3DFUA 4V0LA 3TUIC 1WUYA 3CLSD 4M89A 3CG4A 3H5TA 4XOIA 1NW4A 2JGKA 4B9AA 4FBGA 4OU4A 2PXCA 4EGCB 2HHAA 2FCRA 1PFKA 4G5XA 1W4ZA 3RR2A 4F3KA 2OTCA 1KXZA 1V7CA 2J5KA 3P0EA 1TU4A 2X1LA 2G1AA 3KG2A 2XCSB 1IN1A 1X9GA 1XZHA 4YA6A 4BQNA 2IUEA 1IOZA 2P1RA 4JEHA 2QUHA 3IE0A 3BCRA 3LTNC 5J1SB 5F3WB 1JEAA 1S8FA 1FVOA 1UXHA 2BDTA 2JARA 4JMLA 4HSEA 1USGA 3QVGB 4A9AA 1DBVO 1ZONA 821PA 2AUMA 5DKFA 2I33A 1OFUA 1UBMS 3AIMA 2QU7A 1KI8A 4ZQBA 1G16A 1H4TA 1Z35A 2VRCD 3PUWA 4W6QA 3W1VA 4Z51A 4MGEA 1YHZA 2WVHA 4HEQA 4KIGA 1QP4A 1SC3A 3NTOA 2HV9A 5FB3A 3FNFA 3LBFA 4DVGA 1EWKA 3FH0A 3RYIB 3IV6A 3CRZA 5D3MB 2FUG1 2YYAA 2P9FA 5IMBA 1CQPA 2W22A 1FNBA 2CW5A 2AG0A 3QPVA 3V8NA 5IYZB 1KYZA 3PF9A 2V7TA 1J0EA 2CMDA 5DH9A 5TE9A 1XQ1A 3BQMB 2B21A 3KOWA 1T2CA 1WSWA 1FFWA 1CWUA 4AKTA 1RYFA 4ND8A 2VJNA 1XWWA 3UMGA 3N2YA 1W0JD 3O47A 4QO7A 5SZHB 1MQ9A 3AONB 2OZLA 2VUHB 3BH7A 2AOUA 2EV9A 3GZJA 5DLEA 3Q3VA 4MYHA 2F1HA 1FQOA 1NV9A 2QZ9A 1K8QA 1KH1A 2ZUCA 3DCIA 3GEHA 3JX9A 4W7SA 2I2DA 4J7XA 1H4QA 1JEQA 1XZ8A 2EFCB 2CDBA 4P53A 2P3SA 4CM6A 1SOAA 3NBZC 1WLSA 2Y0PA 2XGSA 4JB8A 1BVHA 1CNMA 3ROQA 2CLSA 2VYND 4ND6A 3SF8B 1CY1A 3LW7A 2P79A 1PDVA 2XWBF 4OGWA 4DYHA 3V4RA 4C4TA 3HJBA 2J3EA 4KI7A 4B6OA 2FZKA 1SBNE 2ZB4A 1LBHA 1HI9A 1UKZA 3JQ6A 5FL3A 3U56A 2V58A 4HJXA 4O29A 3SG0A 5KOJA 4PV7A 4ZI5A 1LPBB 1KI7A 1EWQA 1XDZA 3ZEIA 2BGGA 1RQXA 2EYUA 3CWZA 3HU3A 3M5DA 4NP6A 1HZJA 3IPRA 3EMDA 3L0PA 4P3KA 4RBNA 3UY4A 1XK7A 1YTUA 4EZIA 4TXHA 3C5HA 3SQOA 1MENA 5CB4A 4NFLA 2QYSA 4C0JA 2YDYA 3UTCA 4Y0NA 1AXRA 3TECE 1A3CA 1S2MA 1VIYA 1X7YB 2ADMA 3L1UA 4K9QA 4NBVA 5SZIA 4D8YA 3F7OA 4Z7JA 1Q7RA 2DCMA 1ICIA 2VQFB 4C43A 1ZHHA 4DRXB 5JU6A 2WU8A 5DHRA 2CVPA 2IU6A 2Q1UA 4PC7A 2I67A 2UZIR 3OBBA 1XEFA 4HH1A 1U0SY 3RRXA 3V8VA 2VZLA 3AETB 3NUQA 4UDOA 3PXAA 1D7OA 1KMQA 4Z0PA 1B8PA 1PQYA 1MPTA 2W83A 2OHXA 4URUR 4M0KA 4I2VA 2C7OA 3UJCA 2JASA 3IEVA 4YRRA 1JHYA 1PGQA 1NATA 3DBOB 2BR5A 1PDOA 3GLHA 1AM4D 1R9MA 4BUJA 3TFWA 4LCEA 1DWQA 5KYYB 2QRGA 3JWIA 4WKPA 1N57A 1EFKA 2XT9A 4BO9A 4PG8A 5IDQA 3UT6A 2C8LA 3H83A 1Q0TA 1OB5A 4S1TA 3EQ2A 1X7ZA 4TN5A 4EG3A 3GV0A 4AP6A 4B0OA 1NI4A 3VPHA 3LQYA 1H65A 3OE1A 1K5GA 1XTQA 5KTMA 1MAUA 4O2RA 4TYNA 4M1YA 3DLBA 1SPBS 4GXRA 2G3YA 4Q9AA 3E0QA 1ZD8A 4R3WA 2RAPA 3T3HA 1PNQA 3ANLA 5EL0A 3I62A 3PS9A 3SICE 1B14A 2KPOA 2D62A 3OT5A 5JXHA 1JLHA 4OI0A 4RWEA 1QU2A 4HQ6A 2C88A 3MUFA 4J1TC 4OIMA 5E4TA 3W8FA 1P61B 2QVBA 1V1MA 2VJMA 4DMUB 3E4CA 3U17A 3S99A 4MCIA 1G5TA 5IM4A 2HIMA 1A5AB 1Q5PA 1JFFA 3ZWVA 4EY3A 1Y0BA 3UB3A 1H2ZA 1UFRA 4U3JA 1NSFA 1XYGA 2HGSA 2NZWA 3A2NA 2E1RA 1YASA 2QNIA 2X86A 3OZCA 2F1IA 2XDAA 4KPUB 4JU9A 5G1PA 4ND4A 5CW1A 1FU4A 1TO6A 3ABIA 3AINA 4UD2A 2WJPA 1ZZGA 4QT4A 2J09A 3Q0TA 1USVA 3CUTA 4KR2A 4NG5A 1QH1B 3AHCA 4C4AA 3F46A 2FEXA 3F7MA 4ZO4A 4TYWA 4RZXA 2PBLA 2F48A 2FXVA 4AJNA 3DE1X 1I01A 3IHLA 3HP4A 4W9NA 2PRJA 4CKXA 1YIOA 4F4JA 4QLBA 2ZTUA 1QP7A 4G4SP 4ICIA 4CMIB 1EUCB 2I7CA 3C7DB 4HUQA 1XBTA 4FBMA 3IIEA 4W99A 3HSYA 4DAOA 1NUQA 2AFHA 3ZDAA 5ADWA 2CDAA 5G3ZA 2JGNA 2VP5A 2E37A 4MV4A 1XA3A 4N5NA 2FCAA 3T3GA 4CV3A 5IH3A 3NVKI 1LVUA 5LXTF 1XCLA 2VAPA 3DPIA 5HZHA 3HCWA 3DZ8A 4AMGA 2FJPA 2IVFA 2J3HA 4YXFA 1ENZA 2DBZA 1UF9A 4TWIA 1N77A 1YRQA 1YKGA 2AQIA 2Q1SA 4R1OA 5JD3A 5HFAA 1GOTA 2XNCA 1IDN1 4Q4AB 1W73A 2VHUA 3JALA 2ZRAA 1P4RA 3OP1A 1DAPA 1DX9A 1P0CA 4IMPA 4WESA 1R16A 3K3PA 3RD5A 3FYUB 4XJSA 3U0VA 4D9KA 3DWEX 5FTJA 3Q8LA 5DYYA 3UNXA 2HSEA 1ODTC 5ESDA 1USKA 1SOWA 2WSIA 1JI0A 4M9CA 4N5IX 1KL7A 3LQKA 1W5FA 3D81A 3VAAA 1QE0A 4O4LF 2OSBA 1W4CA 3ZU4A 4D8XA 3L1HA 1B3BA 1SD2A 4ZVSA 4RK4A 3RC9A 4RFVA 1L1EA 2CXUA 3KUDA 3QFSA 5JANA 4A0SA 1TD9A 1NQTA 3T1QA 3DDNA 3S70A 2YXPX 2VUTA 4XLZA 1EIZA 3CPHA 3FFBA 2DTXA 3ETCA 4X1YB 1N9ZA 1JQ5A 2J7PA 1I2DA 1QQ6A 2PIDA 1QHHA 3U40A 2O8FB 2C5EA 3BWVA 5T5QA 4D1YA 3H1AA 4ZYXA 3T4PA 1ACLA 3OZSA 1UP7A 2OHVA 3HEBA 4PXAA 2AOVA 2WUDA 3VR4A 3TR6A 3GLHE 3DTYA 1HETA 1UXIA 2KMLA 4JKIA 4M9SA 4NMLA 1XNJA 3I6IA 3GHYA 4OFXA 1J8FA 2ZB2A 1OI7A 3CPEA 4G41A 4WNCA 1QHFA 3QYJA 3L0SA 1RYEA 1XTVA 3ASZA 4LQ4A 1I9GA 3AGPA 2M6KA 1M6VA 5IJ9B 3C41J 3TLBA 2QTGA 2IC5A 1DOAA 2RI0A 2BHLA 2Z98A 3QWHA 2V6FA 4LY0A 3OLYA 1JAYA 5AOVA 4AULA 4E1VA 4KFUA 4B4WA 3CS3A 4CF5A 3R9XB 5CCBA 3I92A 4FE7A 5IDWA 4Q47A 5KTTA 1QBGA 3INNA 2QBYB 5T8KC 4KQ2A 1HYHA 1WS6A 3TAXA 1OT3A 3EQ9A 3L84A 3FRJA 1USWA 4U2DA 4WW0A 4BFLA 4QBGB 4TGLA 1X8JA 2PR7A 1KEEB 4C04A 4QZVA 3N7AA 4F4UA 1DJPA 4MA5A 5E1BA 5THKA 3WICA 3WK5A 2JG3A 3ZY5A 2CUKA 2OCKA 3HN7A 4WLUA 4E03A 4KE6A 3C48A 3MILA 2AOWA 2IGTA 3DFMA 3DG9A 2P5YA 1PFVA 4ZOAA 1GSOA 3ND9A 2X0KA 3GQBA 1VPDA 3DUFA 5EHQA 1ABFA 1TQHA 5H7XA 3X3HA 3I0MA 4D8VA 4J07A 1U11A 2GJ4A 3NR2A 1JE1A 5BWOA 3V1TC 2FPGB 3UWPA 1YDEA 4JT4A 2VAMA 3HZOA 5TJ9A 3AFIA 1H6BA 4MYRA 2AFVA 2E9SA 1KNQA 3PHBE 5P8WA 1DOHA 3R7WA 3GC6A 4IHAA 3UAVA 2QZSA 4NTZA 1PEAA 2GPWA 2FR8C 4E5UA 4WBSA 3QHPA 1XDUA 4TWZA 5JBNA 4U7DA 1ZK3A 1Z6GA 2RARA 1QHIA 3FPAA 2FFBA 3AIKA 1LX6A 4ZOLF 3LC0A 2Y1OA 3D4BA 3EUEA 1XVTA 1FVHA 3ZWBA 4D0SA 1RXUA 1QH0A 2ZJZA 2ONZA 2VPZA 3UK7A 3KQUA 4C6TA 3IPXA 1TMGE 1K6MA 3FSGA 4URZR 4E7PA 3QMWA 5BSFA 1XFAA 2OGWA 2LBPA 3O31A 3RUAA 5C81A 2C2BA 1LVHA 3SQXA 1LLQA 5HUHA 4BKQA 4WN9B 2YHIA 4MPRA 4PZDA 4JB0A 3ICWA 2WNSA 3F96A 2I4RA 4HAZA 4YMHA 1R10A 4ILKA 5BOVA 4V3BA 2C57A 3A7DA 2FQWA 1EZ1A 1LVGA 3IVGA 1X13A 4HEJA 4PYMA 4Z3KA 3PXCX 2DR2A 2GNPA 3NFRA 3RHZA 1PJTA 3RSHA 4TZKA 1JT9A 2H3HA 2MOKA 3I2JA 1I6WA 4KE7A 1MF7A 3RU2A 4MZXA 5L4LA 3U6KA 2J87A 1HNZB 2EP7A 4HNHA 4CLEA 3PTZA 4H7HA 2HUPA 3RUPA 1N92A 3NETA 3UMSA 5JDCC 2ENUA 1CVRA 3LK7A 1N6OA 3EVDA 2VJLA 3VR3A 4JUAA 1QHGA 1KOFA 3L77A 1IBSA 3SNHA 2BTEA 2OLJA 1QRTA 1ZVQA 1IHXA 5A4FS 2LTAA 4Y8VA 1OZHA 5DM0A 3WQRA 1FDTA 4WHMA 4XD2A 1WXWA 3SXPA 4UVIA 2WIGA 3K6RA 4KPUA 3AI7A 4XYLA 5EZSA 5E2IA 2FZ5A 2PZEA 4QU5A 5A5DA 4LJLA 1WBDA 3R24A 3HP7A 1RYHA 2BH9A 4J0KA 1WB9A 1ZH2A 3L7IA 4Z3OA 2F3RA 2X4IA 3EDOA 7ABPA 3LPCA 4YB8A 3ROMA 2YZ7A 1PZFA 3U7EB 1W25A 1JSLA 1LWNA 2Q9CA 3B9PA 1UM9B 2ERCA 2EDAA 2FWNA 2I4MA 1MB4A 2RGNA 3NDIA 1QORA 2GSDA 3DBHA 4LIPD 3I12A 1IN8A 4QLAA 4QOEA 3TQRA 2CT8A 2K7ZA 2X77A 4GE0A 3U60B 4EZBA 4BU0A 1ZR2A 5BNIA 4EG1A 4GMHA 2RHHA 4ZVNA 3A6LA 3JQ8B 4UOZA 5BSWA 4UVHA 3OTQA 5EKUA 1RKXA 5C5EA 3BJRA 1J2RA 3GFFA 4F5ZA 5A6SA 4RYDA 4MW4A 2CXPA 1MGOA 3JQ7B 4J6FA 2VWPA 1IZ9A 2VOEA 4DHWA 2PV7A 1NP6A 2JDIA 3LA6A 3IAM6 1U8XX 3ONFA 4UBNA 4BX9A 1PU2A 1E3MA 5JNUA 4G0XA 2J3MA 2QVLA 1FK8A 4UNQA 5JJLA 1UWCA 3ME5A 2WAOA 3FVRA 3UCFA 2NV2B 4EEXA 1UK9A 3OLCX 3O1LA 4NCNA 1K7EB 5IULC 4AAYA 4NARA 3Q15C 1KMHB 3RTEA 3RVLA 1Z82A 5KYYA 1EDZA 2JI8A 4L8YA 4RSHA 2J67A 4HMPA 1Q1ZA 3A3OA 1XHLA 4G1MB 4KAFA 4RHTA 1M7BA 3HLYA 4X3PA 3DKVA 5EP2A 4B83A 1WE2A 4BFYA 4DL9A 2COEA 1A7AA 1NMQA 1QJ4A 1W46A 1J07A 1YB7A 4LQLA 1CEQA 3BDAA 1EG7A 4YAFA 5L51A 5DBGA 2RBEA 1ZPDA 1DT5A 3G0BA 2NZXA 1XLTC 3WK4A 1Z4QA 4XFDA 5I7FA 1E1QD 2DYKA 2Q1WA 3CN7A 5KKNB 2VF8A 4WXPA 4BVAA 2CN1A 1RKUA 4BLOA 2WEKA 1C7JA 3EVAA 4P38A 2DB3A 1QX3A 2NT4A 1WSAA 1XAJA 2Z3VA 5JEEA 4ZEMA 5I7HA 4PYIA 4B44A 3KKMA 4FS8A 4RL4A 4U9UA 4K9LA 4NS4A 1G5HA 1NGSA 3IA7A 3TL3A 2HO4A 2C2OA 2C3MA 1CRLA 1EFVB 5AW3A 1NT2A 1BW9B 1N75A 1T5IA 2A14A 2QUBA 3KFXA 4ND1A 3TE7A 2YVUA 3I3OA 4TVOA 1UQUA 1TUBB 4HT3B 2XA9A 4CQJA 5J47A 3A4IA 4EUHA 2EVWX 4Z7NB 3EEQA 4QDXA 3EULA 2QM7A 1IOWA 1BJKA 1EFHA 1T2FA 2GAOA 2VN8A 3HJGA 3W5SA 1I1QB 2Z2YA 3CUUA 4BLQA 4MUGA 1E94E 2PHZA 3QI2A 3Q7SA 3QVMA 4IRUB 1J49A 4KQEA 3CVWA 3GJYA 2QTHA 1UP4A 2MSNA 1ZJZA 2WTEA 3BIFA 3OUUA 3X1ZA 1D7AA 2I7XA 2OD9A 3GA5A 4CCSA 1WMFA 5GM1A 4RTPA 4M8NE 4DBLC 1DO2A 3ZV7A 1M1UA 1Z28A 1VRVA 1Y8ZA 1I51A 3OJCA 4GD3Q 3RLIA 3WNQA 1CKEA 1K5DA 3ML1A 5FUWA 4MLPA 1I2ZA 3WYGA 2H08A 4KREA 2F3UA 2ZAYA 2ZKLA 5KDOA 1N5DA 2YNMD 3GJZA 2NXJA 2QD3A 3MWDB 3ELUA 4R1PA 5B1YA 4PC2A 3AVXA 1VB3A 2YXDA 2IZOA 1TZKA 1GIAA 4LV6A 2BF7A 3MS7A 1RLOA 3K31A 4YBZA 5FORA 5GV7A 2LKDA 3IEUA 3UGJA 4ZN6A 5C8YF 1KO8A 2FKNA 2IDMA 2O6HA 1Y8RA 3W3AH 1EFLA 4CUJA 3P5SA 5LOVA 3A6DA 3NZEA 4CIXA 3RFUA 5KTPA 1ZC3A 3I8OA 3KQYA 4DM3A 2WV7A 3R77A 2ZSJA 1EP2B 3QVLA 2AI1A 1G42A 2RHGB 3H99A 5IH7A 4G0WA 2VC2B 4YMUA 3LSYA 4XCVA 1GV0A 5GWXA 2QRQA 2XKAA 4MGIR 2IITA 3E7WA 1JW9B 2IEBA 1QIMA 2QVXX 3C1AA 1SBIA 2XF2A 3C7TA 2GM3A 2V3WA 4MYSA 2VPIA 4P36A 1JTEA 1IY2A 4NU8X 1JR6A 2H1HA 2QQEA 4KQ9A 1EP3B 1L8QA 1FP4B 4TZTA 1DV1A 3WIDA 3ZLTA 1RWWA 3H2ZA 5DMHA 4PSDA 1IY0A 2ZBUA 3TPZA 4IBOA 4FJ0A 3ITDA 2O8BB 5CDGA 4OHYA 1QDEA 4WRRA 5CB6A 4MCAA 1T1SA 3PHJA 4EAAA 1U8AA 3OCYA 1WHTA 3I09A 4C7JA 4XOUA 3R20A 2JFWA 4DV4B 4BNGA 1X8XA 3W34A 3OE7A 2R0QC 4N6GA 1QK5A 1KC3A 3RAFC 1UDCA 3NBYC 2Z2IA 4B7XA 4DKJA 3FCCA 4OUDA 3DDWA 1XCMA 1HE5A 1V3VA 4JC5A 3ZZ1A 1UBHS 4NOLA 1A0OA 3HFSA 4INJA 1NBMD 1L7VC 4ZVTA 5JNTA 3NBXX 5CIQA 2A4KA 2AH5A 2XQVA 3N86A 3PA6A 3L7LA 5E6RB 2JB9A 4ZAZA 3VR2D 2QMUA 4G0UA 2AJCA 5DRYA 2V45A 1GAQA 2EATA 1G5RA 3P9SA 1NP7A 2UUBB 1W52X 2IYLD 4BTEA 2YV3A 4CLRA 1PJ4A 1YBVA 5EPOA 3FOCA 1YR3A 2AN4A 1DHTA 2CK3A 3GEPA 3IJRA 2CL0X 3LOUA 3PU6A 1HEUA 3Q41A 4WUVA 3D7RA 2FAXA 4PNHA 4RLFA 3FUWA 2XDYA 1MH1A 2WM3A 4RADA 4WEQA 1UP6A 3HCNA 4PLHA 3KD3A 3EDYA 2G09A 5IK2D 1K5HA 1C4OA 1XAHA 4WY5A 3RIEA 1K98A 1TKCA 1R4MA 2UYYA 4FHDA 3KQMA 3LL4A 3SBEA 1GQFA 2EXXA 2Z8XA 3NQ41 8OHMA 1IUKA 1CIJA 3FJYA 3HVUA 4N0PA 2PUVA 3KO8A 4W5RA 5HJEA 1LJUA 2ZRQA 1RWKA 3MTQA 1T13A 2WI8A 3Q8XB 2ZI6A 4CU2A 3B3JA 2ORVA 3PKZA 4PX5A 2ATIA 2HSJA 5HIIA 3S0JA 4C7XA 4L2IB 1B74A 1FTNA 3O26A 3GDHA 2HQRA 5DHFA 5JSZB 5ENDA 1M1NB 4GX0A 1F6WA 4PR3A 2ZT5A 1P7YA 1UPXA 2GTIA 4KLRA 4LOIA 5JSKA 4CIWA 2XBMA 2YWEA 3I58A 1OFIA 1Q3HA 1SC6A 3ACBA 3HVIA 2AC4A 1K0UA 3HA5A 4NU0A 3P97A 1SCJA 3EIEA 3OFKA 2UAGA 3ND6A 4DA4A 2FWMX 4D9FA 2C96A 1CR1A 2WJHA 4R1TA 1GD1O 1VKNA 2ZRGA 3FYDA 3QH4A 2EEZA 1TECE 3KQQA 3AHFA 1ONOA 1ZUWA 1J0DA 3UATA 3QX7A 2FFRA 3IT0A 5KKAA 2FR1A 1Z5ZA 2SCUB 1LWOA 3CTPA 1VGRA 4MJLA 1CRQA 4MXDA 2YJTD 1BVUA 1PK8A 3GN1A 4F2PA 1MUUA 2FDXA 3LL7A 1HYBA 2BE7A 3IH5A 1C1XB 4AX4A 1UPCA 3KQWA 4UTPA 5I9SA 4MKIA 2WYUA 4WOJA 2GCOB 3QIAA 1EU1A 2GDZA 1R5JA 3AL2A 1KSGA 3SIPA 1RWXA 4BMSA 5B4TA 5JBQA 3E1SA 2FDCA 2EX0A 5DBEX 3JYPA 3CZPA 1O8BA 5GV8A 1U8CB 5J4VA 3IEKA 1E7SA 1GZVA 1CFJA 2BMVA 4PG4A 4X84A 3NOQA 721PA 2COKA 1IMOA 1JAZA 4OM7A 4RF3A 1XDGA 1E9EA 4H1VA 1N6IA 2FP4B 1ZN2A 3Q11A 3SOPA 3VMFA 3FUCA 2HNBA 4YCBA 4GXNA 3VU0A 1MAAA 2ZT7A 5CURA 1I4DD 3BGOS 4KVAA 3VMMA 3VR6A 4CL3A 3GMIA 4F71A 3I01M 4LYDA 3GK3A 1G4AE 1GYRA 4G9GA 3ORHA 2PR2A 1CQXA 1AZLA 2HU2A 3A8TA 2AMJA 4PHTA 4D6YA 3UC5A 1ZEJA 4L78A 3AEZA 1G6KA 1T9KA 1Y37A 2GUWA 2WFLA 3JWEA 4HJRA 4P7FA 1TJ5A 4DC9A 3LUFA 4GC5A 2WU3A 1E1NA 1PS9A 4RHUA 3HUDA 3WNCA 1HDOA 1P1BA 2Q5OA 4M0PA 1QH9A 3ZWKA 4C3VA 2IS4A 2FWRA 4DR4B 4L5CA 1MT0A 1Z12A 2FSPA 3U3KA 1YDFA 1PYOA 1TO1E 1ZVKA 4IUDS 4BDTA 5KYWA 4QHYA 3O4VA 4BRWA 5BYJA 1EFRD 5DNVA 3MHPA 121PA 1KFBB 3PKIA 1DTWB 4IUYA 4J94A 2GETA 4IIFA 1FYDA 4PRZA 2B98A 2IBSA 2A57A 3ZDBA 1R0CA 3WZMA 3CF2A 3SCZA 5H3CA 3GDFA 5JS7A 4TUYB 4RJJA 1XCOA 1STOA 4FIDA 3SZ3A 3T0FA 3DV9A 1EWRA 4O33A 4OHUA 5BQOA 4EABA 1O94C 5EJIA 2KSQA 4FC7A 3GQBB 1Y8CA 2V65A 3MYRA 3GFQA 4A03A 2HCFA 1WXIA 1S8OA 1R0XA 1SC1A 4AROA 1EESA 3SFZA 1CUFA 4B31A 4FEYA 3FM9A 3WGGA 2PS0A 4KKVA 3W2EA 2EGGA 7AT1A 2OEPA 5EXTA 5JHGB 3MCZA 2B78A 4TKVA 2HK8A 2C4KA 2G63A 4GLBA 2IXBA 3DBHB 1JQAA 5CITA 4B32A 2B83A 1I94B 1A2QA 1UKYA 3VR4H 1AKTA 4IIXA 4RDIA 4EF6A 4FFNA 5LZ9A 1NJGA 4WFIA 2C4UA 4BNJA 5EUMA 1HT1E 2KLHA 3Q85A 3UMVA 4WZAA 4YR7A 1OLXB 5B53A 5C7YA 1P9OA 2TECE 4GSLA 4Z9FA 1XNRB 1QGOA 4NENA 1E98A 2ZE6A 4EB3A 4KJZA 5AW7A 1T5OA 5A3JA 3WTCA 5AI8A 3VGPA 5K6RA 4BUCA 3K20<