1FMD3

The structure and antigenicity of a type c foot-and-mouth disease virus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
219
structure length
219
Chain Sequence
GIFPVACSDGYGNMVTTDPKTADPAYGKVYNPPRTALPGRFTNYLDVAEACPTFLMFENVPYVSTRTDGQRLLAKFDVSLAAKHMSNTYLAGLAQYYTQYTGTINLHFMFTGPTDAKARYMVAYVPPGMDAPDNPEEAAHCIHAEWDTGLNSKFTFSIPYISAADYTYTASHEAETTCVQGWVCVYQITHGKADADALVVSASAGKDFELRLPVDARQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and antigenicity of a type C foot-and-mouth disease virus.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Virus
molecule keywords FOOT-AND-MOUTH DISEASE VIRUS (SUBUNIT VP1)
total genus 35
structure length 219
sequence length 219
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fmd300
5CFDB 1QJU3 1COV3 3TN93 1X36A 4RR3C 1AR82 4N43B 4JGYA 5FMOS 1NCRC 3J8F1 1RUC1 2HWB2 1RUC3 1OHFA 2XBO2 4CDQB 3LOBA 5DDJ3 1H8TC 5K0UA 5BNOC 1VBD1 2HWC2 1RB8G 1BMV2 1VBE3 4YVWA 4CDUA 4GH4C 1AL0G 1RUD3 4YVSB 1AL23 1PGL2 4WM7C 3ZFEA 1VBB3 1ASJ1 4AEDA 1QJZA 1QJU1 1MEC1 2XBO1 1POV3 1RUJ1 1VBC1 2MEV1 2R071 4Q4Y2 1AR73 1D4M1 2HWB1 1AR61 3VDDC 1VBC3 1PIV1 3VBUC 4Z92B 2RS53 4N53A 1PO13 5CFDC 2BUKA 4RHV1 1COV2 4RFT0 1ZBE2 1CD3G 4IV3B 1RVF1 3DPRA 4N43C 1MQTA 3JBG1 4CEWB 1R083 4IV1C 1C8M1 2RR11 3VBFC 2RS11 1EAH1 4FTBA 3FBMA 1RUF1 1EAH3 4CDQC 2GH8A 1POV1 1RUJ3 2RS13 4JGZC 2RS32 1V9U2 3J8F3 1HRI3 4WM8A 1RUE1 5C8CA 2X5IB 2VQ0A 2RMU1 1VBE1 4PDWA 4WM7B 5JZGA 5L7OB 5ACA1 1NA1C 1RUD1 4CDUB 1QJX1 3VBOA 2WFF3 5ABJB 1RMU1 2R042 1B35A 2WWSA 5D8AA 2Y26A 2HWF3 2XBO3 1MEC3 1RUH3 1C8M2 3CJIA 5CFCA 1R1A2 1NOVA 5J98B 4CDWB 5AC93 1RUG1 1ND2B 1VBE2 1CJDA 3NAPA 4CDXB 5L7OA 2GSYA 1RUC2 2WLPA 2HWE2 2WS93 2RS51 1PIV3 4BCUA 1VBA3 1TMF1 3VBRC 3VBSC 1OOPC 4QPGB 3VBFB 4IV3A 5C9AC 4GH4A 1PVC2 2PLV1 1Z7S2 1AL22 5CFCB 4RQPB 2ZAHA 2BFUS 3ZFEC 1QQP2 2BPA2 1PO12 4FTEA 2ZTNA 4LLFA 1HRV1 1X33A 1RUG3 1Z7S3 1EV11 4QPGA 5BNPB 1R092 3ZFGA 2RS52 1VB4A 1QJY2 4Q4Y1 3VBUA 4QPIB 1PO23 1AR63 2WFF1 1BEV1 1VBB2 5BNNC 1IHMA 4CDWC 2DF7A 1ZBE1 4N43A 1MQTC 1QJX2 1RVF3 1FOD2 5C8CB 1VBA2 1NY72 5A33A 4AEDC 2WFF2 2PLV2 1ZBA1 2HWB3 5C9AB 3JB8A 5J96B 1NCQB 4Q4Y3 3ZFFB 1F8VA 5D8AB 1VAKA 5AC92 5C4WA 3HAGA 1E57A 1RUI3 3JD73 3JB4C 5K0UB 1ZBE3 1NY71 5CFDA 1RUH2 1PVC1 4CEWA 1AL21 3ZXAC 1FPN2 2TBVA 4Q4V3 1POV0 1SMVA 3CJIC 4RHV2 4GB32 4YVSA 4QPIC 2HWE1 5BNNB 3VDDB 2HWD3 4GMP1 1AYM1 4WM8B 1FPN1 2WS91 2X5IA 4RHV3 1TMF3 1W39A 1R1A1 1RUG2 1MEC2 4IV3C 5C8CC 4NWWA 3VBOB 4CEYC 1R1A3 5ABJA 1R082 4AEDB 1QQP3 1PGW1 3M8LA 1TMF2 5A32B 1AR62 2RM21 3DPRB 1QQP1 1FMD3 1NCQC 1AR92 1B35C 3ZFFC 2RMU2 5D8AC 1RUF3 1ZBA2 3NAPB 1Z7S1 1QJY3 1K5MB 1HQNA 1BBT1 5L7OC 1HX6A 1NA1B 1PIV2 2RMU3 4JGYB 2QQPA 1RUE3 1AYM3 5DDJ1 1ND3C 1RUF2 1RHI2 1FPN3 5BNNA 2PLV3 4Q4X1 3VBRA 1AR91 1VBD2 2HWC1 1OOPA 1C8NA 4RQPA 1TME3 1RUH1 5GKAC 1RVF2 4RS5A 4Q4V1 1RMU3 1RUE2 1ASJ2 1WCDJ 2WZR3 1AYN1 2R063 1K5MA 4CDXC 1PO22 3VBHA 5C4WB 4SBVA 1VRH1 3IDEA 1AYN3 2R061 1HXS2 4GMP3 1VRH3 3VBRB 1ND2A 1VBC2 3VBSB 4QPGC 1BEV3 1NCRB 3ZFGC 4FTSA 1EV12 1AYN2 1OPOA 1H8TB 1R081 1PGW2 5BNOB 1NG0A 2HWC3 3JBG3 4CDWA 2R043 4RR3A 1HRV3 4YVSC 1EV13 4QPIA 1GFF2 4Q4X2 4JGYC 1COV1 5BNPC 1M06G 1RHI3 2XPJA 2RS31 2MEV3 2R073 1DDLA 1BBT2 1D4M3 2HWE3 1AR93 4GMP0 4Q4X3 4EJRA 1AR81 5BNOA 3VBUB 4YVWC 1VBA1 1MQTB 1QJX3 1RUD2 5C4WC 2HWF2 1FOD3 2WZR1 4Y5Z0 5AC91 1NCQA 3ZFFA 4N53B 1A6CA 1FMD1 4CEWC 4NWVA 4IV1B 2RM23 1BEV2 3ZFGB 4Q4W3 5LK7B 1BMV1 2HWD1 1NCRA 4JGZB 4RS5B 3J8F2 5FOJB 1HRI2 1ND3A 2RM22 1QJU2 4Q4W2 5ACA3 2IZWA 2X5IC 1TME2 1H8TA 3TN92 1FMD2 1PVC3 5K0UC 3VBHB 1RUI1 3JD71 1RMU2 2R041 4IV1A 4Q4V2 4CDUC 2ZZQA 3VBFA 2WZR2 3CJIB 4CEYA 4GB33 5ABJC 3S6PA 4PDWB 4WM7A 5JZGB 5ACA2 4CDXA 4JGZA 1RUJ2 1VRH2 1RHI1 2HWD2 1HXS1 2RS33 4YVWB 1V9U3 1ZBA3 4WM8C 2BFUL 3TN91 1R091 1ND2C 1NA1A 2FZ2A 1EAH2 1HRI1 1AR72 4RR3B 1PO11 5A32A 3VDDA 2WS92 2RR12 3VBOC 2RS12 4CEYB 4N53C 1OOPB 1AUYA 2R062 1VBD3 2FZ1A 3DPRC 5CFCC 1C8M3 2BBVA 1B35B 4GB31 4RQPC 5DDJ2 1PGL1 1F2NA 2RR13 3ZFEB 3NAPC 4Q4W1 4RS5C 1VBB1 4FSJA 5BNPA 4Y4YA 4GH4B 2MEV2 2R072 4CDQA 1BBT3 1D4M2 1K5MC 1QJY1 3VBHC 1HXS3 3VBSA 5A33B 1AYM2 1V9U1 1ND3B 1R093 1AR71 5C9AA 1PO21 1HRV2 4PDWC 5JZGC 1RUI2 3JD72 1AR83 1VB2A 5FMOL 1TME1 2HWF1 1ASJ3 3JBG2 1FOD1
chains in the Genus database with same CATH superfamily
1FXZA 3ZPOA 5CFDB 3PVBB 3SCGA 5T55A 2WUHA 4AQ6A 4FAGA 1X36A 4RR3C 5FYHA 2WO2A 4K1YA 4AGVA 3DEMA 4EE2A 3ABZA 2ZJCA 3QLQA 2VCMA 4B4RA 3OGGA 5FP3A 1O3QA 2B7YA 1A8DA 2E63A 2GNTA 2Y33A 4R52A 2VW2A 1KQRA 3MIBA 5T54A 2NN8A 4HONA 1RUC3 4LO8A 1LKNA 2JB4A 3AM2A 3EMRA 2D3RA 3FLRA 3A4UA 4EYUA 4FOQA 2YFUA 3LOBA 2WA3A 4AEKA 3VD5A 3UL2A 4Q1RA 4AI2A 4LBMA 1VBD1 1CAVB 2HWC2 2JDNA 3W21A 4CPBD 1BMV2 1VBE3 2ZX2A 1EPZA 4GH4C 4CDUA 2VE1A 4OVEA 1BK0A 1N47A 5A1AA 1RUD3 2RDQA 5T3NA 4YVSB 1AL23 1W6PA 3KF5A 4XCAA 1OA2A 5CIRA 5IFPA 3V0AA 4MX3A 1ASJ1 3J9SA 5FPBA 4AEDA 1QJU1 2HH9A 1KS4A 4I0AA 4QAWA 4CCEA 1RXFA 2CV6A 3DCQA 3WOGA 4BMEA 4F83A 2OZJA 4PHZA 1DLLA 1SLIA 3J4UH 4ZS2A 1CX1A 1A78A 1RUJ1 2X8KA 1PVXA 1XPWA 2O8QA 2OQ6A 1CIYA 2R071 4M0NA 4A41A 2P17A 1D2SA 4A7KA 3SKJE 3ZIWA 2HWB1 4OCTA 4H14A 3QOPA 3PLQA 3VBUC 4Z92B 5FYCA 3ACHA 4K8RB 2HEYF 2D43A 4XF4A 5G04L 4C91A 5CFDC 1NE6A 5DAVA 3WCRA 1COV2 5JAXA 1ZBE2 1NT0A 3QD6A 1VMHA 1E5HA 2GU9A 2EIGA 2JG8A 4IV3B 3WDYA 1H1MA 1XNTA 2YFZA 1LGBA 3KV6A 4P9IA 3U4SA 5FZLA 4CUBA 2FQPA 2A1XA 1R083 1Q8PA 3KCXA 4NRPA 1OQEA 2B8MA 1IQAA 5F5QA 5J48A 4FTBA 4TSVA 3WD5A 2CHHA 4D3WA 5IK5A 2VOKA 1EAH3 2A6WA 3MF6A 5EPAA 4D7YA 1RINA 3CNAA 4XBLA 2E53A 5FZDA 1R64A 1JZ3A 1H6XA 2A6XA 3BTAA 3WSOA 2RS13 3NJXA 3Q9OA 4AVTA 3U14A 5F7UA 1V9U2 3J8F3 3KV9A 4IEVA 5F6LB 4IL7A 4GULA 2JDAA 3THPA 3N7JA 2VQ0A 2RMU1 1VBE1 1RJ8A 3MGUA 1LENA 5DZEA 4D94A 1J83A 5ACA1 2D7FA 1BK1A 1RUD1 4Q0QA 3E97A 4RA0A 2QZ3A 3WVJA 3S0MA 3I54A 4ARXA 1HJGA 3IIIA 2C4XA 3WP4A 4IGPA 1NUKA 5LY1A 5A1LA 3T2OA 2R042 3ZXLA 1B35A 2CL2A 2YC2A 4LA3A 3ZYFA 1PK6A 5IYYA 2Y26A 5FZBA 4AFDA 2ORXA 4P9GA 4Y4RA 3MLKA 3W5MA 2R1BA 3AYCA 5HI0A 3VDCA 3WF3A 3IPVB 1UCXA 1JU3A 2IVIB 1CJDA 1OLME 2H6CA 1NXMA 3NAPA 1GOFA 4IW3A 2WT0A 3WNPA 4ASMB 1V6LA 1CJPA 2WS93 2WA4A 5C33A 5FUNA 1VBA3 2BDRA 3INAA 3NJVA 2BRTA 3VBSC 5LA9A 2LRPA 5FOBB 4QPGB 3S30A 5FZOA 1DGRN 3CIHA 4COUA 1PK6B 5FXVA 4L99A 1YCIA 1Y9MA 2VQTA 2PLV1 2Y0IA 2DWRA 4I01A 1FV3A 5EFUA 2AH2A 3LFMA 2ZAHA 2A71A 4Y1VA 3K2OA 1QQP2 5IVFA 4LQRA 3B9CA 1PO12 1QKQA 4CYDA 5FTTC 5A70A 2ZOEB 5DG2A 1XOYA 3NW4A 4LLFA 4IGOA 4YYOA 4KMQA 1DU3D 1JHJA 3AYAA 1WA4A 1LGCA 2XL9A 5A6XA 2P6HA 2YXSA 1R092 1KXGA 4B1LA 3VKOA 4UI9L 2RS52 2Y6FA 4I09A 1QJY2 1PZ8A 2DDUA 4XAEA 3VBUA 4BOWA 2R16A 3N9NA 2VZOA 4PI0A 2V4AA 2G9ZA 5CG8A 3ZKYA 2LROA 2DVFA 3MF9A 2PYTA 3FMGA 2D3SA 3KV4A 3WXPA 1CR7A 4P9XA 5FYMA 5KHIA 4C90A 2VG9A 3KWVA 2WO1A 3POSA 3H8RA 1LCLA 4H7MA 5FZIA 4QX0A 4K1ZA 3VZMA 2XGXA 3T1MA 4NN0A 5AVPA 4ZXEA 1RIRA 4OHYA 1RVF3 2PHRA 3AMPA 5E6HA 1FX5A 1I3HA 3AKRA 2JDYA 3LEKA 2Z2SB 2JDMA 4OMCA 1XYOA 2TNFA 1ZBA1 4CCJA 4QMAA 1UPSA 1AX1A 4LUKA 4MO3M 3HMYA 1H2NA 3POGA 1KJRA 5J96B 1NCQB 4FPCA 5D8AB 4CCMA 1YO8A 2I74A 3WNMA 4MLOA 1RUNA 2BEOA 4W6WA 2VD7A 1YNAA 3ELNA 1KD7A 2EXJA 1NKGA 5FZGA 3LSEA 1C5IA 1UKRA 2BV4A 2GH2A 4LBOA 1E57A 1SLCA 2JG8B 3JD73 3WF4A 1N1SA 5A3NA 1NY71 1MVQA 3AP4A 1JZ6A 4L0PA 5JSOA 4Q1PA 3WW1A 1ULFA 4WZCA 1GOHA 4GIQA 1A8MA 3GCWA 2TBVA 4Q4V3 2R30A 3CJIC 4IE4A 1W6MB 3V0BA 1QOSA 5JOWA 4QQHA 4PJYA 2VMIA 3LA2A 3KCCA 5CAZA 1S0EA 1MS5A 5FP4A 5JXJA 1HIXA 3PUSA 4ZU5A 3MLLA 1JYCA 4NHYA 3EXUA 4EN6B 5FDBA 4Z2AA 5JOZA 1AYM1 3H0OA 5FY4A 4RGKA 1FPN1 3WW3A 2OYZA 2L9LA 2WS91 1SFYA 2X5IA 3HBZA 3ZN6B 2P3JA 2WYSA 4DUVA 3ZSKA 1S0IA 2D6PA 4YZ4A 5D2AA 5A7PA 1D0HA 3GDBA 4AI8A 1IKQA 1DGWX 2R0HA 3IMMA 3VBOB 2QCSB 4PCRA 4Z2WA 2VY0A 1DP0A 3D5OA 4QQPA 2H0BA 1OD5A 4BDVB 5F2SA 1Y9GA 1W0NA 2CYFA 4I0WB 2RM21 3AKPA 1AR62 1ZREA 4NO4A 3DPRB 3NJZA 3OTFA 1NCQC 1YYNA 2EALA 1US3A 2JIJA 3IB3A 3FX3A 4IETA 3R6SA 3C7HA 1ZBA2 2O0OA 5CNAA 1CGPA 1UOGA 1JI6A 3Q8FA 4K20A 4XAAA 5BXXA 4P5HA 5C3PA 1KGYA 1OD3A 2V09A 3VD3A 2VZUA 4JCKA 4XF3A 4BQ4A 3EO6A 4WV8A 3POBA 3VL8A 1BBT1 2P34A 2WRAA 3HNBM 1IS3A 1IZ3A 4YZ5A 1QWRA 3MPBA 5L7OC 3U4XA 1MS3A 4RGAA 4XFIA 5DUUA 3T0DA 2ZX3A 3VBRA 1UXXX 2D6KA 3WQBA 3NNMA 5FMCA 5LA2A 3W58A 2IUWA 4JHZA 5GLUA 3O14A 1NZIA 4RQPA 3NNJA 3WHTA 1MZ5A 2DUQA 2J1UA 3JXSA 4QB6A 4ZXKA 2OZ6A 4RS5A 4ZU4A 3I97A 1MZFA 3AZXA 2VAUA 1SFNA 3PVEA 4YRDA 4ZKTB 5EWSA 1AYN1 3HQXA 1EPWA 4CDXC 3BB6A 1AXYA 2BGCA 1YIFA 3IDEA 1DIWA 2PHUA 3URFA 4DOUA 4XURA 5JMCA 1VRH3 4N8MA 5A6QA 2VOWA 5FZ7A 2VW0A 4QU1A 4P14A 3VD7A 5I0SA 3B01A 4YGBA 4HPKA 5FREA 4BPZA 5JVVA 4HL0A 1BEV3 3ZFGC 2DUOA 2NLRA 2W2IA 5FZ1A 3KSCA 1VAVA 4Y24A 1J1LA 1EV12 5L9RA 4DZGA 2NMNA 2LUWA 3GZAA 1XNBA 1H8TB 2FMDA 2YG0A 3M7AA 4PT6A 5HCBA 3BI3A 1DGWA 2PELA 2WBKA 4FPKA 5FZOB 5BNOB 3VL9A 4AVCA 2HWC3 1ZRFA 1SLAA 3JBG3 3PL0A 5JI9A 1AJOA 3I3DA 5CG9A 1IS4A 1ODMA 1HRV3 1YJLA 5FYVA 4AI9A 1WCSA 3T09A 5A3WA 1F4HA 1EV13 3S57A 3AK0A 1SBDA 4IEOA 1OFNA 1EY2A 1HKDA 1T6GC 5LW9A 4XPVA 3KLSA 5BNPC 1M06G 4HZFA 5CKNA 1RHI3 1OT5A 4Z8BA 2K46A 2RS31 5JSPA 1XNKA 1GP4A 2YGLA 1ALYA 2ETEA 4IEXA 1BBT2 4QM8A 4R4XA 4XFBA 4TXWA 5DAWA 4AQSA 2XJUA 1K5JA 4M0HA 2NZ9A 4GMP0 4B4QA 1MS4A 4EJRA 4EQVA 3CF6E 2QDRA 3C3VA 4MXVA 1WD4A 1VBA1 5FP7A 5JMOA 2TEPA 1MQTB 1I6XA 4UWDA 3N3HA 1O8SA 1IG0A 4HETA 5C4WC 3KF3A 2HWF2 1FOD3 2W95A 3WDWA 5AC91 1US2A 4COVA 1FMD1 2EIEA 1JH5A 4AI1A 2XHKA 5LEJA 4AFCA 1V6NA 2HWD1 3NNLA 1DQ1A 4LK7A 4P08A 2YBKA 1PHMA 1E5SA 3T30A 4E4DX 3VDAA 1BZWA 1DGRA 4JV4A 4HPKB 3ILRA 4XHBA 4AVVA 1EYBA 3RMXA 1N1YA 3JU9A 3MPPG 3THTA 5BYNA 1IPJA 1IQDC 1YQ6A 4XE9A 3J8F2 4R4ZA 5FOJB 3PNAA 2ZGTA 4Y22B 3HNYM 5F8PA 1U5XA 2OQ7A 3WQ7A 4AAPA 1LHWA 1C1LA 2VXJA 4HKWA 1UY1A 1QJU2 3O1PA 2IZWA 1H8TA 4PIYA 3TN92 1PVC3 4EROA 5K0UC 5FBZA 1ULGA 1UOBA 1RUI1 2JENA 3HBKA 2PAMA 3MYXA 1ZRCA 1NAEA 1RMU2 4IV1A 3NRUA 1HV0A 1UU6A 2ZHKA 3H50A 4JTNA 3GBGA 1TNRA 2P3YA 5FUPA 2QQOA 5IJRA 3UESA 2EAKA 2JXAA 3R4DB 4CEYA 3S6PA 1UMZA 1PMJX 2ILMA 2E9QA 2UY9A 5FPLA 3JCIA 2FDFA 2G4IA 1BHGA 4CDXA 4D0QA 4JX0A 4Q8KA 1UMHA 3GBWA 3IAQA 1DFQA 1RUJ2 5FKBA 5FPUA 1H1AA 1C3HA 1QXRA 1SG3A 4HVRA 5DZGA 5FYSA 2XWBB 2VCCA 2A3YA 3OPTA 5FZ8A 2UYAA 3APBA 5KC6A 3WEZA 3LIGA 5FY8A 3ZYGA 2FZ2A 1ZA7A 1OUSA 2WS92 3FHAA 3MV01 4DXZA 2YBPA 5FPVA 1VE0A 1OLRA 5E1RA 1ST8A 4CEYB 3WF2A 4JQTA 3U1XA 5IVYA 1OLQA 2BNMA 1V00A 2XONA 1TVGA 1N1VA 1FYUA 3NKTA 3MO4A 3VZOA 1PK6C 3GZEA 4AOCA 1VBD3 4FPOB 4W8JA 2ARBA 3X29B 1WMXA 1OKQA 3NV1A 1UIJA 1BYHA 1C8M3 4A4AA 2WNEA 2KD7A 3RI8A 4K7JA 4B7KA 1J3QA 2YB7A 2ZX4A 5IK4A 1W28A 1PGL1 2DTYA 4LJHA 5C3QA 1KRIA 1JYIA 3Q8AA 3NSTA 2YGMA 4LLOA 4S2GA 4C1XA 5KXCA 1VBB1 1UKGA 2QFEA 2UU8A 4KI5M 2R072 2Z5WA 5KXEA 1SZBA 3DV8A 4BWOA 3OCPA 1K5MC 3A23A 1AJKA 2FDKA 1GWMA 3LF7A 1XU2A 2KA3A 1ENRA 1AYM2 2RDNA 5JWPA 4MGIE 3HT2A 4FT8A 1R093 4J25A 4OHXA 2FDJA 3W20A 1GU3A 1PO21 4NRQA 2XJSA 2XJTA 2WWJA 1HRV2 3E6DA 3O7OA 2J22A 1W6PB 2OVUA 4PLMA 4ZU7A 3V0AB 3IWZA 4CUCA 1RUI2 1VB2A 3B02A 2HWF1 2IXCA 1W6NB 4BQYA 4X6RB 2ZAAA 4JKKA 1FT9A 4YPJA 1FOD1 1GZTA 3H42B 3VLBB 1BVVA 1COV3 3IDBB 1QOTA 5F9TA 4Y5SA 4LITA 3ZR6A 5HBAA 3RJ2X 2JDUA 4XMIA 3DYMA 1XJAA 4NIHA 2VU9A 1MZEA 4Y5TA 2JG9A 2RJ2A 4Y1UA 4DY5A 5LBEA 4JGYA 2JX9A 3J7MA 5FMOS 5FY7A 5FZAA 4B8EA 4MYEA 4TZDA 3OG2A 3O1UA 3J8F1 4AK3A 4YGCA 3O1RA 4BM8A 1QY4A 3NV3A 4EN0A 4AL9A 2GC2A 1W05A 5FO9B 4IE6A 2WYFA 2CWSA 3BTXA 2BJSA 3U0ZA 2VNOA 1YIPA 2A6YA 5I8SA 4HN1A 2ZMLA 4ATFA 3CJXA 4JKLA 3ZSJA 3IM0A 3I2JA 4GKYA 4LNVA 2DTWA 4FPFA 2G1MA 1C5HA 1AL0G 2DFCA 3SH5A 3AFKA 1OSGA 2QDNA 3I49A 1PGL2 3MFCA 4QKFA 1Y4WA 2LW8A 3OGSA 1UL9A 4XUQA 1QJZA 3HVDA 4EWEA 5C3OA 3PVOA 1N1TA 2VZVA 1LESA 5FYUA 1MEC1 1WLCA 1JS9A 2J1SA 4Q0UA 1E5IA 1CAUB 1POV3 5FLHA 4NIIA 4HOOA 1VBC1 1W90A 4KWUA 4H55A 2MEV1 1AR73 1UYZA 3EHKA 2Q0AA 3CZJA 4EZ4A 5B2GB 4OI2A 2OPKA 3ON7A 2PA7A 3RG0A 4E8DA 1A34A 3BOPA 3TEZA 1X8MA 4N53A 2C0ZA 1KEXA 4RHV1 1QDCA 4JKMA 4YLZA 4RFT0 5LBCA 2W68A 3ZX7A 4HANA 2VMFA 3AXEA 1W8NA 4NPMA 3PUAA 4AGRA 1Q8SA 1C28A 3AP6A 1J84A 3VZJA 1LOFA 3L2HA 4XF0A 3AJYA 3RGBA 1U5YA 4CEWB 4FPYA 3GJAA 1LR5A 1NZCA 3AMQA 3IAPA 1C8M1 4JDOA 3VBFC 5JOXA 3DYPA 2J1RA 1QJFA 1RUF1 2V5DA 4PQQA 2X10A 3ZN5A 5FZHA 2RJLA 2ZZJA 5F5CA 1OH4A 1YFYA 1Y3TA 3MEPA 2B46X 5GZGA 5JIAA 1W6QA 4YG6A 3HJRA 1UPIA 2RS32 4EN9B 1HRI3 4HVOA 2VMGA 1VRBA 1LHVA 1DZTA 1OF3A 4WM8A 2E33A 4K6BA 2QNKA 1H4HA 1QXJA 3NVCA 4LUMA 4LPLA 5L7OB 2D6NA 4P5YA 3RVHA 4QHOA 1SACA 5A3TA 4DNYA 3VBOA 1F4AA 2WFF3 3E6BA 2ENRA 5ABJB 1GUIA 4MG2A 1RMU1 4KU7A 4OI1A 3ZSEA 3H3ZA 4K21A 2ZMNA 1S0BA 3CEWA 2EF6A 2PHLA 1Y7BA 1RUH3 2Z42A 4YARA 2LTNA 4BQXA 1G9BA 5IUQA 4DRVA 1NOVA 5AC93 2FD8A 2AZ5A 2Q1MA 1PNGA 1VBE2 3VHRA 2HKXA 4JAAA 4N90A 3MIFA 1ZNPA 5EYYA 4CDXB 5L7OA 3I4IA 2GSYA 1S0CA 2QQVA 2WLPA 1WMFA 2YDEA 2CY6A 4GWJA 4URTA 4A6OA 4O61A 4BK5A 1UY0A 5JR7B 1W6MA 2GC1A 3EBRA 1LOEA 4UFJA 2GP3A 1XU1A 2WNOA 3TNQA 1QNWA 4UBGA 5FY5A 3FWEA 2CAUA 5KHHA 3VBFB 4IV3A 3R4UA 3SITA 3N9QA 1G9FA 1UZWA 1STMA 5EJZB 1H1IA 1NLSA 2JDHA 5DAXA 3D0JA 3VZKA 4BXSV 3AKSA 1BCXA 3KT4A 4KWJA 2BFUS 3NWKA 4QQLA 5ANNA 1JZ4A 4XJUA 4CP9B 4NHMA 2R32A 2WZ8A 4R9CA 1ZZ7A 2XJPA 5FAXA 1TG7A 1OF4A 1X33A 5LWBA 1RUG3 2VZTA 4HKLA 5CU1A 2XHNA 1UY3A 3RWKX 1PZ7A 1UYPA 1WA6X 4JVAA 3PMSA 4M3CF 1ENSA 1U5IA 2Y8KA 3ZXDA 5BNPB 3T4VA 1K42A 5DPNA 4Q4Y1 4AEMA 4FFIA 1MPXA 1W9SA 2VBPA 4QPIB 1LOAA 4NHLA 1O4YA 2WFF1 3MFAA 1MVEA 2RDSA 4LBQD 4B29A 1OLMA 1MS9A 4OFGA 3KVAA 3POFA 1IHMA 3LDBA 2E26A 1O59A 4Z82A 4CDWC 1TQ5A 3N35A 2WNUB 2DF7A 3AKTA 1IOAA 1GWLA 4N43A 3AXDA 4QDQA 1AVBA 3SLIA 1MQTC 1RL3A 2B42B 3ITQA 2IXLA 4L97A 2B5HA 1WW4A 2BNNA 2W39A 2CSGA 2QVSB 4QWNA 2VCBA 5T5LA 3VHOA 1FOD2 2JKBA 3AFGA 4DFSA 1CWPA 2WZPP 3FBYA 1SDWA 4HK9A 1UXZA 2VW1A 2XL7A 4XETA 4XJZA 5FZ9A 1HLCA 3WDTA 4L92A 3OJBA 2PLV2 2VOXA 4XTPA 4L8QA 2WN2A 3OEAA 1UYXA 4XJAA 3KQ4B 5EJ1B 1XE7A 5A7QA 2F17A 3ZFFB 4XW3A 2Q4SA 3AB0A 2YROA 3Q8CA 4X8NA 4WVZA 1ZZ9A 4WVMB 1W06A 1YWKA 1AZDA 1KDKA 2NPIA 2YPDA 4PIXA 4LBNA 5IVBA 5C4WA 4AQ2A 1Z78A 2FBEA 3BIWE 2D6MA 3DECA 4IE5A 2R0FA 1ZBE3 5CFDA 2D97A 3ZYHA 2EIBA 1WCKA 4CEWA 1AL21 4AHXA 1DYKA 4FVVA 3ACLA 3ZXAC 4CP9A 1V0AA 2V5YA 2XVLA 4CZSA 1VLNA 5IATA 1POV0 1SMVA 3GZTB 1OUXA 5EIYB 4YVSA 3AZWA 4BQ3A 3CBNA 4QPIC 1MR5A 5C7GA 1LULA 1U5ZA 3SC7X 1L7LA 4OHWA 2D5FA 1LECA 2DBNA 5HXMA 3D4KA 1WCUA 1M4WA 3OY8B 2HYXA 3L2YA 2GC0A 3MIDA 3HIFA 3I59B 5I8TA 4BZ4A 1QGLA 4LBQB 3V64A 2YC4A 2XR4A 3O0XA 2BQPA 1TMF3 2DU1A 1W39A 2VQAA 1R1A1 1YXWA 4CU6A 1LOGA 1DQ4A 4GQ7A 3R4SA 3GALA 1CZTA 1GV9A 4ZONA 1IKPA 2Y64A 2BU9A 2VOVA 2X05A 5C8CC 3WNNA 4NIDA 4JC1A 4NWWA 4CEYC 1GQHA 4AHYA 5ABJA 3K77A 1JZ2A 2A6VA 1DZRA 4QX8A 3ZOIA 1YEWA 4LHNA 2Z4FA 3WP5A 2YU1A 4U2AA 5APAA 2PHWA 2SLIA 1TMF2 3BKZA 4HSJA 5F3IA 1J3PA 2J1VA 2WSVA 4K8FA 2WQ4A 1QH6A 5FY1A 5FZ3A 2AREA 4UF0A 4HFSA 4A3XA 5I0RA 1FMD3 1S2BA 1AR92 3M2MA 2GC3A 4LHLA 5FBJA 2RMU2 2JE9A 3FLPA 5L73A 4QXBA 3O1MA 1ACCA 4XFCA 3PIGA 1ZRDA 1CVNA 1XQNA 3H7JA 5CKQA 1OC1A 4MV2A 3SCHA 3T1LA 3V65A 3I7DA 1GZCA 2W0XA 3I3MA 3TEYA 4QGMA 2QE3A 4Z1VA 5T5OA 4P00B 2Y38A 4JGYB 2DU0A 2RMU3 1AYM3 2D5HA 4Q5OA 5DDJ1 3NQHA 4XMAA 1RHI2 1FPN3 4LMFA 5CVRA 3RYPA 5BNNA 1W6NA 3TEWA 2JWPA 4ARYA 1OOPA 2ZGRA 1TME3 4I0BA 1SQ4A 5GKAC 4FPJA 1LODA 4IGQA 3B3QE 4JDNA 4AW7A 4AXOA 4XIKA 4E2QA 1JN2P 1L7QA 5BV6A 1XBFA 2XLFA 5L19A 1UIKA 1WCDJ 5J7MA 2VVDA 1ZYBA 2WZR3 4QPYA 4XUOA 4NPRA 4EV0A 4AFAA 5JDBA 4XJ8A 4FOYA 3HQRA 4KWKA 1LB2A 3AX4A 3OY8A 5C4WB 5FLIA 3VGIA 1WBFA 2JE7A 1RGSA 2JKXA 2XWJB 3OGVA 3ZFFC 1AYN3 2K0GA 1HXS2 4GMP3 2D93A 3WG2A 4XIOA 1ND2A 2WJSA 4XQDA 2ZA9A 1DQ5A 1WUVA 4W6YA 3RNSA 1BKZA 4AVBA 4DUXA 4LBLA 3K4AA 4FTSA 1V6KA 2VXRA 4NIAA 1YRZA 5IVCA 5F6KA 4ZHNA 1AYN2 1RXGA 4GKXA 5IK8A 5A6ZA 3CL1A 1SPPA 3D8CA 4IE7A 2GN7A 4XZPA 3BPSA 1NG0A 2EVXA 3OF1A 5A3UA 3QH7A 1HV1A 3WNKA 3AVRA 4DB5A 1SEFA 2VC9A 2WQZC 4YVSC 2C1FA 1N3OA 2G9GA 4LBKA 4MUVA 2BYVE 4JGYC 4TN7A 4FPEA 3VUOA 3BPZA 1T2XA 5A6YA 2V4VA 3U07A 3U37A 3LCPA 4UAPA 2BERA 4S2DA 3I2HA 1D4M3 1HW5A 1Q5OA 3B00A 3PTYA 2HWE3 3DXTA 3DL3A 1VJ2A 1UO9A 4K9SA 2A6ZA 4FP3A 1PMIA 1XSRA 3UT0A 4Y20A 1CESA 3VBUB 1JOBA 3J7LA 5FWEA 4CCOA 2VCAA 4FP2A 1XXNA 1QJX3 5T5JA 1QU0A 5ANQA 3ACFA 4QM9A 1NX9A 3OUHA 3MW4A 5KHKA 4FBFA 3UGHA 5F2WA 2QBXA 4OZXA 4CCDA 3RZGA 1HB4A 3QCWA 5CZKA 3ZFFA 2UWCA 2E6VA 5CKMA 1UZ0A 2W9XA 1GKBA 2FDHA 3RI9A 2J1EA 5L36A 1DYPA 3VD9A 1BMV1 1HB3A 1QF3A 1V6OA 3AKQA 2AGSA 4FXKB 1GQPA 4JRLA 4KNCA 1GQGA 2J1TA 2WINB 5EYXA 1UOFA 3OSDA 3H8XA 4H2AA 4GWNA 1BQPA 3ZMNA 3GHNA 1LHUA 1HRI2 3LDRA 3ZPYA 4YW3A 1GLHA 5C8WA 1KFXL 1W03A 3BVCA 4WZFA 3SISA 1ZA4A 5I0DA 4XEZA 5FWJA 2VJXA 1FMD2 1H9PA 3EB7A 4R8HA 3WNXA 3CQOA 4OLLA 3JD71 5JR2A 2VBDA 3UNPA 1W3VA 4C0HA 1DF0A 1D0GA 1OURA 2W1QA 3KV5A 5LB6A 5LRRA 4KGQA 4E27A 4GB33 2ZKNA 3OOXA 3G6JB 2DCKA 2QKDA 4F3JA 5KWRA 2W1UA 3DKQA 4E4ZA 4YM3A 4YW7A 1O6UA 2FMYA 2IVJA 3KT1A 5FY0A 3ZSLA 4CCCA 3UKNA 3UKVA 2HWD2 1HXS1 3F95A 5J3UA 5FCCA 1ZBA3 3I2GA 2WAOA 4WM8C 3TN91 1CPNA 4GALA 4YFZA 1G6NA 3LQCA 2QQWA 3LEMA 1NA1A 3IZOA 4NPLA 2NP0A 1F9KA 2WT1A 3NV2A 4QU2A 3VKMA 4A7YA 4E2GA 4TTGA 1IS5A 5C70A 1S2KA 3BIEA 1G86A 4JTOA 5GZCA 2PN5A 4CCKA 3POJA 1Q8VA 3RZJA 3K51A 1F15A 4NAMA 3UKTA 4YSFA 5BPXA 3ZXEA 1VAMA 5IVJA 5HCAA 2GP5A 2VMHA 4UFKA 2XKPA 5A3MA 3ENRA 1SDDB 1F2NA 1OFSA 5FRAA 2Q8CA 3Q8BA 4HT1T 1ZZBA 4B4PA 4FSJA 3LKJA 4NE9A 2AYHA 5K8SA 4AR2A 5HV4A 4QXHA 1Y43B 1UU5A 2MEV2 1W0OA 2RHPA 3SCFA 1K45A 1OKOA 5EZWA 1WD3A 4UXAA 1QXPA 4XQWA 1OA3A 4N7IA 4FPHA 1JMUB 3B5LB 5C9AA 4OUMA 1CONA 2BOIA 5DQ0A 5A32B 2GNMA 4BMBA 4EN7B 2DVAA 4PDWC 5JZGC 1HN0A 4AVAA 2PTMA 5LRSA 1XYNA 2ZS6B 3JD72 1AR83 4M3CE 2Y6HA 2OUJA 2ZEZA 2JE8A 3BALA 3HQUA 3HWJA 1C4RA 3ECQA 3MW2A 1VMJA 4XC9A 4FPLA 1F5FA 3RPQA 2WNUC 1LAJA 4ZS3A 1O7FA 1KDMA 3RYKA 1GYKA 4OZOA 1YQ2A 3JBG2 3OB8A 4UW6A 4QHBA 1QJU3 4NOTA 4XILA 4EN8B 1FAYA 4CP2A 4EWAA 1GP5A 3MIHA 3TN93 1Q3EA 1AR82 5I93A 1GZWB 4J1WA 1YLLA 1Q56A 1Q8QA 4CU7A 4P02B 1X9PA 2NM1A 2VTXA 4BQ1A 3OGRA 3KCYA 2J42A 3WY6A 1WW6A 3L9JT 3PU8A 1RUC1 3OD4A 4YW6A 1OXCA 1YC61 4RFRB 1OHFA 2XBO2 1VR3A 4TLGA 3ES1A 3LD8A 3OYWB 3S7EA 1W0PA 2BZDA 5DXDA 4IEPA 2I2SA 1RB8G 3LA3A 4YVWA 2ZHLA 3CMGA 3WG3A 4IEUA 2ADDA 2XJQA 3KGZA 1PM4A 3RZHA 5FZ6A 2VPVA 3ZFEA 3MUZ1 2VZQA 2K9ZA 1VBB3 3ORJA 4FPGA 1K3IA 2GNBA 5CB7A 3AP7A 2C5DA 5HV0A 3EYPA 3OUIA 5FJHA 4BIOA 4CP1A 3JUUA 2C9AA 2FDGA 2VUJA 3FZ3A 3LPFA 4E2SA 3AL6A 3AL5A 1OQDA 1DYOA 2ZGLA 4I3PA 5IT6A 4ORFA 3OBAA 4LORA 3HNMA 1U12A 4MSVA 5C3RA 5C6CA 4Q4Y2 2HEVF 3ZXFA 1REFA 2BNOA 5DN2A 5BY5A 1F31A 3DGTA 2Y6KA 3U10A 1VBC3 4FO9A 4GJYA 5F5IA 1H6YA 2RS53 2JD9A 4F8AA 2C9KA 3DN7A 2HJIA 1SPPB 1S1AA 5LASA 1WGPA 4HVQA 4ZZ5A 2BUKA 1MS1A 4E4HA 5D21A 3N9PA 1UU4A 1RVF1 4UF0B 3WX5A 2H0VA 3FE5A 3CU7A 3JBG1 2Q1FA 2G19A 2IXKA 3J7NA 4BJ0A 3OBRA 4IV1C 2GN3A 4TYSA 3FHIB 2YV8A 1AF9A 1J1TA 2RR11 3LSDA 3OPWA 2DURA 1EAH1 3LDKA 4A6SA 2ZEYA 3WV6A 1W99A 4NHKA 2X29A 4XDOA 4YM1A 4LE3A 3WZ1A 2D6OX 5J1XA 1ULPA 2BBAA 2GH8A 1RUJ3 4META 4QKDA 2QQNA 3FHQA 2D40A 2EXKA 4JGZC 5FJKA 5HCHA 2ARAA 2OA2A 2PQQA 4LHKA 1RUE1 4JDMA 4IDZA 4LO7A 5C8CA 3E5XA 3POIA 2VMEA 2X5IB 4BQ5A 1XNAA 3IMNA 4PDWA 4WM7B 5JZGA 1REEA 3S7IA 5JXIA 2VO5A 1REDA 4P9LA 4WBBA 4CDUB 4Q2FA 1CPMA 3UGGA 4CTEA 4DRRA 4OI0A 4KH9A 2EIDA 2CDOA 3RS6A 3FN9A 5C5TA 5D8AA 5A1FA 5JLVA 4ISRA 2N7GA 1V6MA 1MEC3 1C8M2 4XFFA 5GZEA 2I45A 3CJIA 4RGGA 3GCXA 2VZ1A 1R1A2 4GAZA 3UK9A 4B7EA 1X50A 4CDWB 4JHTA 1RC6A 3OYWA 5JXGA 1ND2B 2F6BA 5EV7A 5K9YA 2FCUA 2QQJA 3RZKA 2R6QA 3HN3A 4G9SB 4LO5B 1RUC2 3H3UA 3KQRA 4Q8LA 4L2NA 1PIV3 1GP6A 1NLQA 3ILFA 3GBFA 4W50A 1TMF1 4DY3A 2A5ZA 3WP6A 1OOPC 3ZXJA 3I2KA 4BA6A 1X8EA 3PDQA 5FYTA 4QQOA 5EJ3A 1JTZX 2HEWF 4CSWA 1HN1A 4MGYE 4GH4A 1AL22 2HLEA 2JDKA 3D6EA 3O12A 4CU9A 3H1WA 3UYJA 2GDFA 1WLDA 4LKEA 3ZFEC 4L11A 1S0JA 3BTZA 1Q43A 2UWAA 3MW3A 4CU8A 4C1WA 1MACA 1BLZA 1SLLA 2ZTNA 1L7RA 1CN1A 1HRV1 2YY1A 1YFUA 4HBNA 5LK5A 5I91A 1EV11 1I9RA 1T6BX 1GANA 2YC0A 4D6SA 4IXLA 4R9AA 4V2WA 2UURA 2GMEA 2BVBA 1JBCA 2DCYA 2ET7A 1UZYA 1Z0HA 3C7EA 1PO23 1UW8A 1KFUL 3GXUA 3OPZA 1UN1A 4XYXA 2VZRA 3WF0A 5JUVA 3FUQA 1BEV1 1VBB2 3ACIA 1VP6A 3TAYA 3O1VA 1LU2A 4NROA 2VNGA 1UZVA 1VPHA 4WVMA 3KHCA 1QJX2 4OUEA 1WLTA 3RYRA 5KHJA 4DXTA 1SFPA 4XFGA 1Y9QA 4BYYA 5CA6A 1HB1A 4AAXA 5C8CB 2QUOA 3ALQA 2RVAA 3MZHA 5IVVA 1W9TA 2QQMA 1QMJA 3K75B 4XCBA 4Y1ZA 1GZ9A 2WFF2 1OBNA 1POQA 3BGAA 4LA2A 4NMIA 3ASIA 3B7MA 1JXNA 2HWB3 1GICA 1SBFA 2ZABA 2DFBA 3GNEA 3JB8A 4FFFA 2ERFA 4PI2A 4A3ZA 1F8VA 1H8VA 2P4EA 3LPGA 1VAKA 5IHRA 2IXIA 1W2AX 4NIGA 4ONUA 5AC92 2YYOA 4HMZA 5FZKA 3VN4A 5BNQA 4OUSA 1JZ8A 3WW2A 2O14A 3HAGA 4ATEA 1YQ5A 4A7ZA 2P1BA 2GZWA 3JB4C 4RN5A 5K0UB 1W8OA 1WKYA 1HQWA 4K40A 1PVC1 3SHRA 1JOJA 4YZ2A 1W2OA 4XOGA 1FPN2 1YI7A 3OUJA 4LHSA 3E1F1 3T08A 4YFWA 2JIGA 4CUGA 2DCJA 4E4SA 1DCSA 2XJVA 4GB32 4HK8A 3K46A 4QX7A 2VZ3A 1OH3A 2Y6JA 3ZKUA 1WWYA 2KM2A 3OD0A 3T2QA 4O65A 3I2IA 3J26N 3ZLIA 4LKFA 1GNYA 5CBLA 3VDDB 1YFXA 2HWD3 4GMP1 4LEJA 4YG0A 2ZCWA 4WM8B 2PHFA 1JZ5A 4AE2A 5FR3A 2ATFA 2V72A 2BW8A 5F32A 2Q30A 1XC6A 1WCQA 4AYUA 2PQSA 1RUG2 2GNDA 5LEKA 1MEC2 3E6CC 1MZ6A 1YJKA 1EUUA 2WZEA 1HB2A 3WLUA 5C5UA 4HSLA 4Q0VA 4BHPA 1R1A3 1O4ZA 4Y26A 3PU3A 4AEDB 1QQP3 1PGW1 4XVHA 3M8LA 1HQLA 4G3YC 4A45A 1WMEA 4OHVA 2PFWA 3W5NA 4AI0A 4ET7A 3FL7A 1AXZA 2CAVA 3KB5A 5A7WB 1G9CA 3FC0A 5IAXA 4OI4A 4FQZA 2ZACA 3NNGA 1RUF3 4XDPA 1Z7S1 4YZ1A 3VHNA 1QJY3 2BGPA 3JZVA 4M3CA 1I5ZA 3R05A 5LBBA 2ET1A 3AMNA 1GZWA 1UD1A 4NUBA 4J6GA 3TRSB 1K5MB 4AVSA 5BUVA 2AUYA 4YNIA 4I2OA 1HX6A 1NA1B 3P3NA 4PQ9A 2OKXA 2Z79A 1MS0A 4QX1A 4O9GA 1RUF2 1V6JA 3WQ1A 4FOWA 2OPWA 2B45X 2PLV3 4Q4X1 3PUIA 5FZEA 1QDOA 1AR91 5DAQA 3VV1A 5CYYA 1N3PA 1LU1A 4TWTA 1C8NA 4ES8A 5T52A 1KITA 4QDRA 4XFAA 1UX7A 5GZFA 1RVF2 2WFPA 4LIUA 1ZZCA 2R49A 4R9DA 1RMU3 2W08A 4CPBA 1W9WA 1B09A 3PUQA 1PZ9A 2ZPXA 2XB6C 2YHJA 1WBLA 2XLGA 4DXRA 1KJLA 2R063 3OEBA 1U0AA 3ZYIB 1PO22 3PJYA 4MH0E 4AF9A 4SBVA 1VRH1 5ERLA 4XQ4A 2W1WA 1PMHX 3LE0A 3UGFA 3IPVA 2IXJA 3VBRB 4AEJA 1J59A 1YUDA 4DMIA 4QPGC 3MHZA 1G7YA 5E89A 2W87A 2ZGNA 1DZQA 4QX3A 4UFMA 3AMMA 1OPOA 1IGOA 2AACA 2WNUA 3M4FA 1VMFA 2Z69A 4Q29A 5T5PA 3ZN6A 1ULOA 3C7OA 3ZYJB 5JSRA 1PGW2 1JZ7A 5DZFA 4UW3A 3N7KA 3WUDA 2ZEXA 5T50A 2C26A 4PF1A 4XJWA 4XF9A 3LZZA 2R043 5G05L 4CDWA 4RR3A 1OPMA 3H7YA 5EQUA 5AVAA 1WZXA 2XMLA 3KM5A 4NAOA 3WUCA 3NNFA 5FFOC 3C2UA 3BUCA 1QEXA 5JPNB 1UF2C 1COV1 1ODNA 1LJ7A 3BOWA 1L3JA 2QTWB 2R073 4FQ4A 4K3UA 3VHPA 3PURA 4M01A 2AEZA 2QQKA 3DYOA 3ZR5A 1OVPA 1DDLA 2EICA 3Q8EA 1AR93 1O5UA 4HXCA 3N9MA 3LFIA 4GWIA 3DUIA 2B9UA 3UV9A 4EWDA 2Y6LA 1YQCA 1LOCA 4YVWC 1LEDA 3W9AA 4L9BA 1FV2A 1JOPA 2VUCA 2RDRA 4KG0A 1XRUA 3LEIA 3S5AA 1CAXA 1LOBA 3N7LA 2BWAA 4Y3OA 1RUD2 2WR9A 3AVSA 3PJQA 1NE4A 1UAIA 2VGDA 4UT5A 4DINB 1W2UA 4MVTA 1GMMA 4BQ2A 3KD4A 1I1EA 5GJ6A 5KBFA 2WZR1 4U36A 1RITA 4OMDA 3V0BB 1NCQA 4N53B 3USSA 4B1MA 1ZRRA 4CEWC 3HR9A 2GMMA 4D7SA 5FYIA 4IV1B 1BXHA 3NV4A 2RM23 5EHDA 2PHDA 4Q4W3 4QKBA 1FNZA 4O7XA 4Y1YA 2Q1ZB 4FI9A 3VKFC 2F4PA 1YI9A 2BVVA 3TYJA 4XXPA 2ZEWA 4A44A 3RZMA 3KZ4C 1JODA 1NCRA 4JGZB 4I30A 3B9IA 1JUIA 1O8PA 3J7HA 3M3EA 2RV9A 3M3IA 3VD4A 2RM22 1G9DA 3GZUC 4ISQA 2JG8C 4Q4W2 5ACA3 3A7QA 3AP9A 2EA7A 4KL1A 1QIQA 1W04A 2JG9B 3VBHB 4D8MA 3ROUA 1GWKA 1D2QA 4XBQA 3WR0A 3QH6A 1ENXA 4FOVA 5CEHA 4XFHA 5FZCA 1ULCA 3CJIB 2AC1A 2Y60A 1ZZ8A 2VECA 1LEMA 3F2ZA 5ABJC 2O1QA 4PDWB 4WM7A 5JZGB 1E5RA 4PLNA 3WDXA 4M4RA 3RQ0A 3ZVXA 5ACA2 2UY8A 3S5QA 3TBDA 4MXWB 2YMZA 2CU5A 4JGZA 1BJQA 5LY2A 2XUMA 1VRH2 3AZVA 2P6CA 2KR2A 3EQEA 4YVWB 1IPKA 1V9U3 3CHXA 4KQ7A 5A3LA 3OGJA 4D6RA 5IK7A 1ZRIA 2R1DA 2VM9A 3WHUA 3IKWA 1W3XA 3P6BA 1UNBA 3M1HA 4LBJA 1HRI1 1AR72 1PO11 3DKWA 2DBIA 3VDDA 4RL7A 4Z07A 2Q5TA 2YU2A 4LXLA 2RR12 4LBQA 4XDQA 4N53C 4BH9A 3I2OA 3I3EA 2OXBA 3KHBA 4XXAA 2R062 5HXVA 1P8JA 2XDVA 3O0VA 1ZM1A 4S2FA 1I5PA 2VUAA 3VDBA 3SKVA 1SLTA 3K3OA 4IUGA 3N4MA 3DPRC 2JJ6A 2YBSA 2BBVA 1B35B 2AR6A 1YHFA 1JYWA 4C8DA 2RR13 2XUEA 3ZFEB 2MPFA 1EUTA 3NAPC 3A22A 5BNPA 4Y4YA 2TUNA 2DVDA 1CIWA 2VZPA 2WQ8A 3ZN4A 2VBBA 2WAAA 4CDQA 1BBT3 2P3KA 1RTVA 2CWMA 5B4XA 3T0AA 1JYNA 3VBHC 3DF0A 4QX5A 1HXS3 2IWGB 5FXXA 3THCA 3VBSA 3ZSMA 1ND3B 1QJEA 4RYDA 1DQ6A 2A3XA 3NL1A 2JDZA 1CAWA 3WF1A 1UOJA 1O3RA 4ASLA 3G7DA 5FMDA 5C3SA 1RYYA 3WW4A 2NMOA 1KS5A 3WDVA 4ASKA 1RJ7A 2D6LX 3TOJA 2QZ2A 2DCTA 1TME1 4WVWA 5FXWA 2QQIA 2W91A 1ENQA 4IEYA 4CXXA 3PVNA 1ASJ3 1W9YA 2I07B 2C24A 3POYA 1GOGA 2DV9A 1WMDA 3A0NA 3T2TA 2PHTA 4LOTA 3O5SA 3SEEA 3POEA 3ZXGA 5GM0A 1JHNA 4Q0SA 2HBUA 3K3NA 2FDIA 2HYKA 2WO3A 1APNA 3JQWA 2QJVA 4LO4B 5L9VA 1G8WA 4N43B 3GGLA 4COZA 5A7NA 3KGLA 3ILNA 3N7MA 1NCRC 3CLPA 3RDIA 1XE0A 4DEQA 5A7SA 4JRAA 3MDPA 2HWB2 4BE3A 4CCNA 4NHXA 4H3WA 4CXYA 4JQRA 1DGLA 2J7MA 4OYUA 4URAA 3GYDA 1Q8OA 4CDQB 5DDJ3 1H8TC 1UQXA 4PIZA 1UZZA 5K0UA 5FQ0A 4AQTA 5BNOC 5FXZA 4IEZA 1IPSA 5FKCA 5I0UA 5B4NA 2A70A 2PAKA 4GA9A 4X8PA 2IC1A 1JYXA 3K4DA 3ZM8A 3FJSA 3ETPA 4WM7C 2JEMA 2ARXA 2LALA 5DABA 3O1OA 4ZPIA 3B69A 2LS6A 2ZMKA 1TEIA 2VULA 3RFRA 1H4GA 2A3WA 4YW5A 4UFHA 4DO0A 2XBO1 4RD7A 3ZDSA 5GLWA 1EP0A 4CUAA 1NQJA 2JDPA 4MGSA 1D4M1 1NYWA 3AYDA 2Q8OA 2BGOA 1AX0A 4GJZA 1AR61 3VDDC 1PIV1 1JYVA 3RZZA 4BQWA 4UFLA 1PO13 3BCWA 3UETA 2B39A 3D0SA 4ITCA 3AC0A 2J1AA 3IBMA 3NKGA 3EJKA 3BODA 3TWIA 3I8TA 4GXLA 4ZY9A 1CD3G 2MHFA 5F1RA 3M70A 3MBWA 2DUPA 4QDSA 4Q26A 4W6XA 3DPRA 4N43C 4BISA 1MQTA 3BU0A 4W65A 3NO8A 4BXFA 2WL1A 5FY9A 3WP3A 2XVKA 4LTAA 4CVUA 2HBTA 2ADEA 2RS11 1W8ZA 2VZSA 3FBMA 4MHUA 3HT1A 3SH4A 2WIIB 5LBFA 4CDQC 3KT7A 4AFMA 1POV1 3CZUA 4A2UA 4DEVA 5H9PA 5J36A 1LTEA 1NLRA 2FCVA 4QKNA 3ZIXA 3R0RA 2LM3A 1DQ0A 5IAVA 3IT8A 1OVSA 1TZOA 5FPAA 1O5LA 4P9WA 4IERA 2R7EB 3I2FA 3MI8A 1NA1C 4AI3A 1YFWA 1CAVA 5I8YA 1X7NA 2BTVC 3USUB 1QJX1 4YW2A 4AG4A 5KXBA 3MIGA 2OUHA 1C57A 2WWSA 2IFRA 1CZSA 1QOOA 4LKDA 2HWF3 4XF1A 1W8UA 2XBO3 4MZUA 2WDBA 3KVBA 3NJYA 4FAHA 3IDAA 3K4ZA 3LEGA 5GALA 4KBBA 3VKLA 5CFCA 2H6BA 3BU7A 2WO7A 2AEYA 3MICA 5J98B 3H8OA 4MGZE 1RUG1 4COWA 4Y33A 1W8WA 4BIFA 1AHSA 4LOSA 3O1TA 2HWE2 3WG4A 2RS51 3H8UA 3RWNA 4BCUA 4MGQA 4GZ9A 5J37A 5F3GA 3VBRC 5H9SA 2V73A 3H3LA 4N9IA 4QXKA 1WLWA 5FO7B 1F5JA 3BN6A 1DQ2A 2JB8A 4PBOA 3WNLA 5C9AC 2ZX1A 2WNVC 3MUY1 5K4LA 2BP6A 5FYZA 1PVC2 1W9FA 2NQYA 1Z7S2 3GJBA 4FCAA 2VVFA 1NXD1 4HKOA 4RQPB 5CFCB 2OW4A 1VALA 4D6QA 5FV3A 2Q8EA 5LZ6A 4NVPA 4HN0A 2CTVA 5J09A 2BPA2 5FUIA 4FTEA 4QB2A 2ZHMA 1QNYA 5L9BA 3HD8B 2WN3A 2E7QA 2ZGMA 1H2LA 4WVVA 4D69A 2B9VA 4CP0A 1Z7S3 2UYBA 4YGEA 5TSWA 3AP5A 1O3SA 2W3JA 2XLAA 3ETQA 5JXHA 4QPGA 3PHMA 2P37A 2YZ4A 3M3CA 4V1PA 3ZFGA 1VB4A 2Y34A 2AENA 3FFZA 4PLOA 2ZHNA 4UYBA 3I59A 5HCFA 2BWCA 4AGGA 4G4FA 1AR63 1K12A 2G9FA 2W46A 2XH6A 1GNZA 3I2DA 5C71A 4GD4A 2ZBJA 3HN1A 2P5BA 1JUHA 1LHOA 3T0BA 5BNNC 2FHRA 4KWLA 4PF5A 5FZMA 3LIHA 1ZBE1 1PNFA 1S0GA 3PMEA 1W8HA 1FATA 1A3KA 1LOFC 2QQLA 5KHGA 3BYWA 1ONAA 1O91A 1W8TA 4TLFA 3ZYPA 4YWAA 1H30A 5GLZA 4GWMA 2OX0A 3LB9A 3N36A 3U11A 5FZFA 2ES3A 2XJRA 1VBA2 3CO2A 4XACA 3V56A 4YM0A 3FUOA 3T3YA 1NY72 4S2HA 5A33A 4AEDC 1QHDA 1W2NA 4E9KA 1JW6A 3ME2A 5JCTA 5FQ0B 3D3AA 5F39A 3ST7A 4AWDA 4Q0PA 5C9AB 3RSJA 1JYTA 5FK7A 5KR7A 2EXIA 2E51A 1SCSA 2X53S 2WABA 3VZNA 4QPWA 1V70A 2D98A 4LO6B 4N7UA 3IDCB 1JU4A 4Q4Y3 1XNCA 4UFIA 4M00A 3DXUA 3K48A 2W47A 5DG1A 2OIIA 4H7LA 3SNMA 4XTMA 1GBGA 2VOTA 5FO8B 3I3BA 2OT7A 4FFGA 2W94A 4UOJA 2K2SA 3ZO0B 2BOJA 1UMIA 1RUI3 4LR4A 5E8AA 5F3CA 3ZYBA 1DBNA 1OA4A 1RUH2 2ZKLA 3KS7A 1J3RA 3B94A 4KU8A 4QX2A 2VL4A 4Y22A 2CGOA 2MNGA 5KXDA 2VTFA 4MOAA 4RHV2 1W8FA 1XSQA 2CDPA 1S2EA 1V6IA 2PXJA 3SMHA 4CCLA 4I3GA 4XZUG 4OHZA 3H1YA 4BB3A 5AFBA 5A80A 1XYPA 4LE4A 4X6QB 2XG3A 2HWE1 1C1FA 2Y6GA 5A3OA 3VKNA 5BNNB 5FP8A 2NYYA 5A7WA 1OQ1A 1S55A 5A7OA 5FPXA 5LA0A 3LGRA 2P3IA 4IESA 5DUWA 3NMBA 1AXKA 1BVP1 4RHV3 1S0FA 2D44A 1SLBA 1TE1B 3A0KA 4YG3A 2O8OA 2ID4A 1HDKA 4IV3C 3UJQA 2WNVA 5GZDA 1CX4A 5EXOA 1ZVFA 5FP9A 5SV5A 2W52A 5IWFA 3AMHA 2DVBA 5D1IA 3ZYRA 1R082 2JD4A 3WG1A 2DVGA 3AZYA 3H1MA 3RJRA 4UW4A 2E31A 3GM8A 4FFHA 2E7TA 4QGNA 5F3EA 5JPMB 2ZGUA 3E5QA 4BU2A 1QQP1 1B35C 3I3QA 4LULA 4J1XA 5D8AC 4CXWA 3SQOA 4XUPA 3NAPB 2XVGA 3GHMA 2XQRA 3USUA 4W4ZA 3HPNA 4YM2A 5KC5A 1OI6A 1YQ8A 1CAWB 4QHZA 1D4VB 1HQNA 1PIV2 1AX2A 1W6OA 3TEXA 1RUE3 4OQ8A 2VMDA 2QQPA 5SV8A 1ND3C 2JECA 5ISLA 4QB1A 4CE8A 5LCWL 4SLIA 4UW5A 2P2KA 4XHXA 1QH7A 4FXGB 1VBD2 2HWC1 4NR1A 1H2KA 2SBAA 1ULDA 2GALA 2QQUA 4LT5A 1CQ9A 4XBNA 1WW7A 1RUH1 4IEWA 3LOIA 3ZMOA 3RZLA 5DUXA 1LNSA 2ZXQA 2WWUA 4Q4V1 1X82A 1RUE2 2EXHA 3FLTA 2ZGPA 1ASJ2 5FYYA 3TNPB 3AJZA 3CKHA 4KG8A 5LATA 3OBTA 1WW5A 2ORZA 3POWA 2VR4A 3N9OA 4MADA 4XUNA 4YW1A 2IFWA 2YPJA 1K5MA 2XQXA 3OBZA 3VBHA 2VNRA 3LA7A 3PUHA 3PTRB 3GF6A 4O9EA 2R061 2JICA 3THDA 1N3QA 2ZGSA 2XXZA 5IFTA 1VBC2 3VBSB 1LHNA 1NCRB 1URXA 1OMIA 2Q8DA 3A21A 4A42A 3IIAA 3C8XA 2VTXJ 4F7ZA 1UWWA 1LGNA 2VQUA 4M3CB 4N9HA 5DMYA 5GLTA 1HJFA 5FK8A 5GLVA 1R081 3HEIA 3P3PA 4IE0A 4E8CA 3PIJA 5JOYA 1GR3A 1PM7A 4Y1XA 4Y20B 3ES4A 2VVEA 4EZHA 5F37A 4YGDA 4QT6A 4CRQA 4QPIA 1GFF2 2JG9C 4Q4X2 2WKKA 2GMPA 2CGNA 2IXHA 4AHWA 4M4PA 2A73B 5FIXA 2WT2A 3T2PA 2W5FA 2OS2A 2XPJA 1O4TA 4COYA 2MEV3 4KBZA 1IG3A 1LRHA 1MS8A 1W6OB 5DAPA 5K7PA 2E7AA 4Q4X3 1DHKB 1AR81 5H9RA 5BNOA 5FYBA 1SHWB 1S4CA 1S0DA 3SH3A 5AFEA 1J58A 1CAUA 1UX6A 1GNHA 5DUVA 3SEPA 4DXSA 1ZX5A 1UY2A 3VZLA 3M3QA 2RE9A 2WLQA 3TB0A 2KXLA 4DS0A 4Y5Z0 5JIUA 2X09A 1A6CA 4P9JA 4V2VA 3BTYA 3ZDVA 4NWVA 4UBHA 1IS6A 5E88A 1BEV2 3P5BA 5IW0A 3ZFGB 1RUOA 2WSUA 5LK7B 4LIVA 5JI7A 2XOMA 4HLTA 1H0BA 4XUTA 4AFBA 4OQ9A 3AYEA 4BK4A 4D7TA 3U78A 4CA9A 2UWBA 1NQDA 1XE8A 4C0BA 1F35A 4RS5B 1UY4A 1ND3A 1DG6A 3QBQA 1DLCA 1TME2 2X5IC 3CDZB 2ZGOA 5FPZA 3P1IA 1PX4A 5M0TA 2B4KA 4MHRA 5CISA 4BLJA 4DPNA 1W2TA 2EAAA 5FLJA 2R041 3WCSA 5A3PA 4XJ9A 4Q4V2 4CDUC 2ZZQA 4MGKE 2WZR2 3QACA 3VBFA 3MIEA 1H2MA 2RG4A 3ATGA 5H9QA 2D3PA 3M3OA 4HG6B 3VB9A 4JZRA 1ZZ6A 2F4LA 4NJ4A 4P9YA 4DIQA 3C7GA 3C7FA 1XNDA 4QD2A 4QGLA 2E32A 1PGSA 1RHI1 2WC2A 4XABA 1SBEA 2ZX0A 3ZXKA 2RS33 5I0TA 2BFUL 1W6QB 1R091 3MV11 1ND2C 2GAUA 4YW4A 1PX3A 3D82A 4I02A 5LA1A 3AZZA 2CGPA 1EAH2 4RR3B 1GSLA 5A32A 2PAEA 4Q27A 4QQ2A 5EP9A 5IVEA 4R9BA 1CZVA 1SCRA 2RS12 3VBOC 2PMWB 2XKOA 1CAXB 2PHXA 4LKSA 1OOPB 1AUYA 1UYYA 3RRDA 3IN9A 3WT3A 1R1ZA 4INDA 3O0WA 2FZ1A 2WNVB 4OULA 3LWCA 4KGGA 2YUEA 5CFCC 1H9WA 4GB31 4IQPA 4RQPC 5DDJ2 3UJOA 3HOBA 4DQAA 4NRMA 3JQXA 4DUWA 1TNFA 2DCZA 2VUDA 3FFQA 4Q4W1 4RS5C 1ULEA 4AZZA 5E16A 2CNAA 3WDUA 1X9TA 2FCTA 3ACGA 4RSUA 4GH4B 4B3NA 2VNVA 3B93A 4BLIA 2VMCA 3RMYA 3WNOA 1O3TA 4MGTA 2ARCA 5HPOA 3U75A 1D4M2 1FNYA 2RJKA 2ZGQA 1G9AA 3H9AA 1VIWB 5FZ0A 3LAGA 5FMBA 1QJY1 3T4HB 3KMHA 4ES9A 4PBPA 2VH9A 1V9U1 2Y0OA 5A33B 4MXWA 3N9LA 2C6SA 1AR71 2DYCA 3O1SA 3WINE 4QXCA 4ZZ8A 3WQ0A 2A7AA 3W59A 3MLJA 5F5AA 4LK6A 5CADA 1D7PM 4YZ3A 3E5UA 5FMOL 5FZ4A 1FI2A 4AHZA 2W92A 2ZGKA 2A75A 1XB9A 4IEQA 2W1SA 3SXWA
chains in the Genus database with same CATH topology
1FXZA 5CFDB 3PVBB 3SCGA 5T55A 4AQ6A 4FAGA 1X36A 4RR3C 4K1YA 4AGVA 2ZJCA 3QLQA 4B4RA 3OGGA 1O3QA 2B7YA 1A8DA 2E63A 2GNTA 4R52A 2VW2A 1KQRA 3MIBA 5T54A 2NN8A 1RUC3 4LO8A 1LKNA 3AM2A 2D3RA 3FLRA 3A4UA 4FOQA 3LOBA 2WA3A 4AEKA 3UL2A 4Q1RA 4AI2A 4LBMA 1VBD1 1CAVB 2HWC2 1BMV2 1VBE3 2ZX2A 1EPZA 4GH4C 4CDUA 4OVEA 1N47A 1RUD3 5T3NA 4YVSB 1AL23 1W6PA 3V0AA 1OA2A 5CIRA 4MX3A 1ASJ1 3J9SA 4AEDA 1QJU1 4I0AA 1KS4A 2CV6A 3WOGA 4BMEA 4F83A 2OZJA 1DLLA 1SLIA 3J4UH 1A78A 1RUJ1 2X8KA 1PVXA 2O8QA 4M0NA 2R071 2P17A 1D2SA 4A7KA 3ZIWA 2HWB1 4H14A 3QOPA 3PLQA 3VBUC 4Z92B 2HEYF 2D43A 4XF4A 4C91A 5CFDC 1NE6A 5JAXA 3WCRA 1COV2 1ZBE2 3QD6A 3WDYA 2GU9A 4IV3B 2EIGA 2JG8A 1H1MA 1LGBA 4P9IA 2FQPA 1R083 1Q8PA 3KCXA 1OQEA 2B8MA 1IQAA 5F5QA 5J48A 4FTBA 4TSVA 3WD5A 4D3WA 5IK5A 2VOKA 1EAH3 2A6WA 3MF6A 4D7YA 1RINA 3CNAA 4XBLA 2E53A 2A6XA 3BTAA 2RS13 3Q9OA 4AVTA 1V9U2 3J8F3 4IEVA 5F6LB 4IL7A 4GULA 3THPA 3N7JA 2VQ0A 2RMU1 1VBE1 1RJ8A 3MGUA 1LENA 5DZEA 4D94A 5ACA1 2D7FA 1BK1A 1RUD1 4Q0QA 3E97A 4RA0A 2QZ3A 3WVJA 3S0MA 3I54A 3WP4A 2R042 3ZXLA 1B35A 2CL2A 4LA3A 1PK6A 2Y26A 4AFDA 4P9GA 3MLKA 2R1BA 3AYCA 5HI0A 3IPVB 1UCXA 1CJDA 2H6CA 3NAPA 1NXMA 2WT0A 4ASMB 1V6LA 1CJPA 2WS93 2WA4A 5C33A 1VBA3 3INAA 3VBSC 5FOBB 4QPGB 3S30A 4COUA 1DGRN 1PK6B 4L99A 1YCIA 2PLV1 2Y0IA 2DWRA 4I01A 1FV3A 5EFUA 2AH2A 2ZAHA 2A71A 4Y1VA 1QQP2 3B9CA 1PO12 1QKQA 4CYDA 5FTTC 2ZOEB 5DG2A 3NW4A 4YYOA 4LLFA 1DU3D 3AYAA 1WA4A 1LGCA 2XL9A 2YXSA 1R092 1KXGA 3VKOA 2RS52 4I09A 1QJY2 1PZ8A 3VBUA 4BOWA 2R16A 5CG8A 2DVFA 3MF9A 2PYTA 3FMGA 2D3SA 3WXPA 1CR7A 4P9XA 5KHIA 4C90A 2VG9A 3POSA 1LCLA 4H7MA 4K1ZA 3VZMA 2XGXA 3T1MA 4NN0A 5AVPA 1RIRA 4OHYA 1RVF3 2PHRA 3AMPA 1FX5A 1I3HA 3AKRA 2Z2SB 1XYOA 2TNFA 1ZBA1 4QMAA 1UPSA 1AX1A 4LUKA 3HMYA 1H2NA 1KJRA 5J96B 1NCQB 4FPCA 5D8AB 1YO8A 2I74A 1RUNA 4MLOA 2BEOA 4W6WA 3ELNA 1YNAA 1KD7A 2EXJA 3LSEA 1C5IA 1UKRA 2GH2A 4LBOA 1E57A 1SLCA 2JG8B 3JD73 1N1SA 1NY71 1MVQA 3AP4A 5JSOA 4Q1PA 3WW1A 1ULFA 4WZCA 4GIQA 1A8MA 2TBVA 4Q4V3 2R30A 3CJIC 1W6MB 3V0BA 1QOSA 5JOWA 4QQHA 4PJYA 2VMIA 3LA2A 3KCCA 5CAZA 1S0EA 1MS5A 1HIXA 4ZU5A 3MLLA 1JYCA 3EXUA 4EN6B 5FDBA 5JOZA 1AYM1 3H0OA 1FPN1 3WW3A 2OYZA 2WS91 1SFYA 2X5IA 3HBZA 2P3JA 3ZSKA 1S0IA 2D6PA 4YZ4A 1D0HA 4AI8A 1IKQA 1DGWX 2R0HA 3VBOB 2QCSB 4PCRA 4Z2WA 2VY0A 3D5OA 4QQPA 2H0BA 1OD5A 2CYFA 1ZREA 4I0WB 2RM21 3AKPA 1AR62 4NO4A 3DPRB 3NJZA 3OTFA 1NCQC 1YYNA 2EALA 3FX3A 4IETA 3R6SA 1ZBA2 2O0OA 5CNAA 1CGPA 4K20A 5BXXA 4P5HA 2V09A 4JCKA 4XF3A 3EO6A 4WV8A 3VL8A 1BBT1 2P34A 4YZ5A 5L7OC 1IS3A 1IZ3A 3U4XA 1QWRA 3MPBA 1MS3A 4RGAA 4XFIA 5DUUA 2ZX3A 3VBRA 2D6KA 3W58A 5GLUA 3O14A 4RQPA 3WHTA 1MZ5A 2DUQA 4ZXKA 2OZ6A 4RS5A 4ZU4A 1MZFA 3AZXA 1SFNA 3PVEA 4YRDA 4ZKTB 5EWSA 1AYN1 3HQXA 1EPWA 4CDXC 3BB6A 1AXYA 2BGCA 1YIFA 3IDEA 1DIWA 2PHUA 3URFA 4DOUA 5JMCA 1VRH3 2VOWA 2VW0A 4P14A 5I0SA 3B01A 4YGBA 4HPKA 5FREA 4BPZA 5JVVA 4HL0A 1BEV3 3ZFGC 2DUOA 2NLRA 3KSCA 1VAVA 4Y24A 1J1LA 1EV12 4DZGA 2LUWA 2NMNA 3GZAA 1XNBA 1H8TB 2FMDA 3M7AA 5HCBA 1DGWA 2PELA 4FPKA 5BNOB 3VL9A 4AVCA 2HWC3 1ZRFA 1SLAA 3JBG3 5JI9A 1AJOA 5CG9A 1IS4A 1HRV3 1YJLA 1WCSA 1EV13 3AK0A 1SBDA 4IEOA 1OFNA 1EY2A 1HKDA 1T6GC 4XPVA 3KLSA 5BNPC 1M06G 4HZFA 1RHI3 4Z8BA 2RS31 5JSPA 1XNKA 2YGLA 1ALYA 2ETEA 4IEXA 1BBT2 4QM8A 4R4XA 4XFBA 4AQSA 2XJUA 4M0HA 2NZ9A 4GMP0 4B4QA 1MS4A 4EJRA 3CF6E 2QDRA 3C3VA 4MXVA 1WD4A 1VBA1 2TEPA 1MQTB 1I6XA 3N3HA 4HETA 5C4WC 2HWF2 1FOD3 3WDWA 5AC91 4COVA 1FMD1 1JH5A 4AI1A 2XHKA 5LEJA 4AFCA 1V6NA 2HWD1 1DQ1A 1PHMA 4E4DX 1BZWA 1DGRA 4JV4A 4HPKB 3ILRA 4XHBA 4AVVA 1EYBA 3RMXA 1N1YA 3JU9A 3MPPG 3THTA 5BYNA 1IPJA 4XE9A 3J8F2 4R4ZA 5FOJB 3PNAA 2ZGTA 4Y22B 3WQ7A 1U5XA 1LHWA 1C1LA 4HKWA 1QJU2 2IZWA 1H8TA 4PIYA 3TN92 1PVC3 4EROA 5K0UC 5FBZA 1ULGA 2JENA 1RUI1 2PAMA 3MYXA 1RMU2 4IV1A 1HV0A 1UU6A 2ZHKA 3H50A 4JTNA 3GBGA 1TNRA 4CEYA 2EAKA 2JXAA 3R4DB 3S6PA 1UMZA 2ILMA 2E9QA 2UY9A 3JCIA 2G4IA 4CDXA 4Q8KA 3GBWA 1DFQA 1RUJ2 1H1AA 1C3HA 1QXRA 4HVRA 5DZGA 2XWBB 2A3YA 5KC6A 2UYAA 3APBA 3ZYGA 2FZ2A 2WS92 4DXZA 1OLRA 5E1RA 4CEYB 1OLQA 2BNMA 1V00A 3NKTA 3VZOA 1N1VA 1FYUA 1PK6C 1VBD3 4FPOB 2ARBA 3X29B 1OKQA 3NV1A 1UIJA 1BYHA 1C8M3 2WNEA 3RI8A 4K7JA 4B7KA 1J3QA 1PGL1 2ZX4A 5IK4A 2DTYA 1KRIA 1JYIA 3NSTA 2YGMA 4LLOA 4S2GA 4C1XA 5KXCA 1VBB1 1UKGA 2QFEA 2UU8A 2R072 2Z5WA 5KXEA 3DV8A 4BWOA 3OCPA 1K5MC 1AJKA 1XU2A 2KA3A 1ENRA 1AYM2 5JWPA 4MGIE 3HT2A 4FT8A 1R093 4OHXA 1PO21 2XJSA 2XJTA 3E6DA 1HRV2 3O7OA 2OVUA 1W6PB 4PLMA 4ZU7A 3V0AB 3IWZA 1RUI2 1VB2A 3B02A 2HWF1 2IXCA 1W6NB 4X6RB 2ZAAA 1FT9A 1FOD1 3VLBB 1BVVA 1COV3 3IDBB 1QOTA 5F9TA 5HBAA 3RJ2X 4XMIA 2VU9A 1MZEA 2JG9A 4Y1UA 4DY5A 4JGYA 2JX9A 5FMOS 4TZDA 4B8EA 4MYEA 3J8F1 4AK3A 4YGCA 4BM8A 1QY4A 3NV3A 4EN0A 2GC2A 5FO9B 2CWSA 3U0ZA 2VNOA 1YIPA 2A6YA 5I8SA 4HN1A 2ZMLA 4ATFA 3CJXA 3ZSJA 3IM0A 4GKYA 4LNVA 2DTWA 4FPFA 1C5HA 1AL0G 2DFCA 3SH5A 3AFKA 1OSGA 2QDNA 1PGL2 3MFCA 1UL9A 1QJZA 4EWEA 3PVOA 1N1TA 1LESA 1MEC1 1WLCA 4Q0UA 1CAUB 1POV3 5FLHA 1VBC1 4H55A 2MEV1 1AR73 3EHKA 2Q0AA 5B2GB 4OI2A 2OPKA 2PA7A 3RG0A 3BOPA 1X8MA 4N53A 2C0ZA 4RHV1 1QDCA 4YLZA 4RFT0 2W68A 3ZX7A 4HANA 3AXEA 4AGRA 1Q8SA 1C28A 3AP6A 3VZJA 1LOFA 3L2HA 4XF0A 3AJYA 1U5YA 4CEWB 4FPYA 1LR5A 1NZCA 3AMQA 1C8M1 4JDOA 3VBFC 5JOXA 1RUF1 3ZN5A 2RJLA 2ZZJA 1YFYA 1Y3TA 3MEPA 2B46X 5GZGA 5JIAA 1W6QA 4YG6A 1UPIA 2RS32 4EN9B 1HRI3 4HVOA 2VMGA 1LHVA 1DZTA 4WM8A 4K6BA 2QNKA 1H4HA 1QXJA 3NVCA 4LUMA 5L7OB 2D6NA 1SACA 4DNYA 3VBOA 2WFF3 3E6BA 2ENRA 5ABJB 1RMU1 4KU7A 4OI1A 3ZSEA 3H3ZA 4K21A 2ZMNA 1S0BA 3CEWA 2EF6A 2PHLA 1Y7BA 1RUH3 2Z42A 4YARA 2LTNA 1G9BA 5IUQA 4DRVA 1NOVA 5AC93 2AZ5A 2Q1MA 1PNGA 1VBE2 3VHRA 2HKXA 4JAAA 4N90A 3MIFA 1ZNPA 5EYYA 4CDXB 5L7OA 3I4IA 2GSYA 1S0CA 2WLPA 1WMFA 2YDEA 2CY6A 4URTA 5JR7B 1W6MA 2GC1A 3EBRA 1LOEA 1XU1A 3TNQA 1QNWA 4UBGA 3FWEA 2CAUA 5KHHA 3VBFB 4IV3A 3R4UA 3SITA 1G9FA 1H1IA 1NLSA 3VZKA 3D0JA 3AKSA 1BCXA 3KT4A 4KWJA 2BFUS 3NWKA 4QQLA 4XJUA 4NHMA 2R32A 4R9CA 1ZZ7A 2XJPA 5FAXA 1X33A 1RUG3 4HKLA 5CU1A 1PZ7A 4JVAA 3PMSA 4M3CF 1ENSA 1U5IA 3ZXDA 5BNPB 4Q4Y1 4AEMA 4QPIB 1LOAA 4NHLA 1O4YA 2WFF1 3MFAA 1MVEA 4B29A 4LBQD 1MS9A 4OFGA 1IHMA 4Z82A 4CDWC 1TQ5A 3N35A 2WNUB 2DF7A 3AKTA 1IOAA 4N43A 3SLIA 3AXDA 3ZN6B 1AVBA 1MQTC 1RL3A 2B42B 2IXLA 4L97A 2B5HA 1WW4A 2BNNA 2W39A 2QVSB 5T5LA 3VHOA 1FOD2 2JKBA 3AFGA 4DFSA 2WZPP 3FBYA 1SDWA 4HK9A 2VW1A 2XL7A 4XETA 4XJZA 1HLCA 3WDTA 4L92A 3OJBA 2PLV2 2VOXA 4XTPA 4L8QA 4XJAA 1XE7A 3ZFFB 4XW3A 2Q4SA 3AB0A 2YROA 4X8NA 4WVZA 1ZZ9A 4WVMB 1YWKA 1AZDA 1KDKA 2NPIA 4PIXA 4LBNA 5C4WA 4AQ2A 1Z78A 2FBEA 3BIWE 2D6MA 2R0FA 1ZBE3 5CFDA 2D97A 1WCKA 4CEWA 1AL21 4AHXA 1DYKA 4FVVA 3ACLA 3ZXAC 2XVLA 2V5YA 4CZSA 1VLNA 1POV0 1SMVA 3GZTB 4YVSA 3AZWA 4QPIC 1MR5A 1LULA 1U5ZA 4OHWA 2D5FA 1LECA 3D4KA 1M4WA 3OY8B 3L2YA 2GC0A 3MIDA 3HIFA 3I59B 5I8TA 4BZ4A 1QGLA 4LBQB 3V64A 3O0XA 2BQPA 1TMF3 2DU1A 1W39A 2VQAA 1R1A1 1YXWA 1LOGA 1DQ4A 4GQ7A 3R4SA 3GALA 1GV9A 1IKPA 5C8CC 2VOVA 4JC1A 4NWWA 4CEYC 1GQHA 4AHYA 5ABJA 2A6VA 1DZRA 4LHNA 3WP5A 4U2AA 2PHWA 2SLIA 1TMF2 4HSJA 5A32B 1J3PA 2WSVA 4K8FA 2WQ4A 1QH6A 2AREA 4A3XA 4HFSA 5I0RA 1FMD3 1S2BA 1AR92 3M2MA 2GC3A 4LHLA 3ZFFC 2RMU2 2JE9A 3FLPA 5L73A 4XFCA 1ZRDA 1CVNA 1XQNA 3H7JA 3SCHA 4BIOA 4MV2A 3T1LA 3V65A 3I7DA 1GZCA 2W0XA 4QGMA 2QE3A 4Z1VA 5T5OA 2Y38A 4JGYB 2RMU3 2DU0A 1AYM3 2D5HA 5DDJ1 4XMAA 1RHI2 1FPN3 5CVRA 3RYPA 5BNNA 1W6NA 1OOPA 2ZGRA 1TME3 4I0BA 1SQ4A 5GKAC 4FPJA 1LODA 3B3QE 4JDNA 4AW7A 4AXOA 4XIKA 4E2QA 1JN2P 5BV6A 2XLFA 5L19A 1UIKA 1WCDJ 5J7MA 2VVDA 1ZYBA 2WZR3 4QPYA 4NPRA 4EV0A 4AFAA 5JDBA 4XJ8A 4FOYA 4KWKA 1LB2A 3AX4A 3OY8A 5C4WB 5FLIA 3VGIA 1WBFA 2XWJB 2JE7A 1RGSA 1AYN3 2K0GA 1HXS2 4GMP3 2D93A 3WG2A 4XIOA 1ND2A 2WJSA 4XQDA 2ZA9A 1DQ5A 1WUVA 4W6YA 3RNSA 1BKZA 4AVBA 4LBLA 4FTSA 1V6KA 2VXRA 1YRZA 5F6KA 1AYN2 4GKXA 5IK8A 3CL1A 3D8CA 2GN7A 4XZPA 1NG0A 2EVXA 3OF1A 3QH7A 1HV1A 4DB5A 1SEFA 2WQZC 4YVSC 2C1FA 1N3OA 2G9GA 4LBKA 4MUVA 2BYVE 4JGYC 4FPEA 3VUOA 3BPZA 3U07A 3LCPA 4S2DA 1D4M3 1HW5A 1Q5OA 3B00A 3PTYA 2HWE3 3DL3A 1VJ2A 4K9SA 2A6ZA 4FP3A 1PMIA 4Y20A 1CESA 3VBUB 4FP2A 1XXNA 1QJX3 5T5JA 1QU0A 4QM9A 3MW4A 5KHKA 4FBFA 4OZXA 3QCWA 3ZFFA 2UWCA 2E6VA 1GKBA 3RI9A 5L36A 1DYPA 1BMV1 3AKQA 1QF3A 1V6OA 4FXKB 2AGSA 4JRLA 4KNCA 1GQGA 2WINB 5EYXA 4GWNA 1BQPA 3ZMNA 3GHNA 1LHUA 1HRI2 3ZPYA 4YW3A 1GLHA 5C8WA 1KFXL 3SISA 4WZFA 1ZA4A 4XEZA 1FMD2 1H9PA 3WNXA 4R8HA 4OLLA 3JD71 4C0HA 1DF0A 1D0GA 5LRRA 4KGQA 4E27A 4GB33 2ZKNA 3G6JB 2DCKA 2QKDA 4F3JA 5KWRA 4E4ZA 4YM3A 2FMYA 3KT1A 3ZSLA 3UKNA 3UKVA 2HWD2 1HXS1 5J3UA 5FCCA 1ZBA3 4WM8C 3TN91 1CPNA 4GALA 4YFZA 1G6NA 1NA1A 2NP0A 1F9KA 2WT1A 3NV2A 4QU2A 3VKMA 4A7YA 4E2GA 1IS5A 1S2KA 1G86A 4JTOA 5GZCA 2PN5A 1Q8VA 3K51A 3UKTA 4YSFA 5BPXA 3ZXEA 1VAMA 5HCAA 2VMHA 2XKPA 5A3MA 3ENRA 1F2NA 1OFSA 5FRAA 4HT1T 1ZZBA 4B4PA 4FSJA 3LKJA 2AYHA 5K8SA 1Y43B 1UU5A 2MEV2 1W0OA 2RHPA 3SCFA 5EZWA 1WD3A 4UXAA 1QXPA 4XQWA 1OA3A 4N7IA 4FPHA 3B5LB 5C9AA 4OUMA 1CONA 4EN7B 2GNMA 4BMBA 2DVAA 4PDWC 5JZGC 4AVAA 2PTMA 5LRSA 1XYNA 2ZS6B 3JD72 1AR83 4M3CE 2OUJA 3BALA 3MW2A 3HWJA 3ECQA 1C4RA 4FPLA 1F5FA 3RPQA 2WNUC 3RYKA 1O7FA 1KDMA 1GYKA 3JBG2 4UW6A 4QHBA 1QJU3 4NOTA 4XILA 4EN8B 1FAYA 4CP2A 4EWAA 3MIHA 3TN93 1Q3EA 1AR82 5I93A 1GZWB 4J1WA 1YLLA 1Q56A 1Q8QA 2NM1A 4BQ1A 3KCYA 3WY6A 1WW6A 3L9JT 1RUC1 3OD4A 1OHFA 2XBO2 1VR3A 3ES1A 3OYWB 3S7EA 1W0PA 5DXDA 4IEPA 2I2SA 1RB8G 3LA3A 4YVWA 2ZHLA 3WG3A 4IEUA 2XJQA 3KGZA 2VPVA 3ZFEA 2K9ZA 1VBB3 4FPGA 2GNBA 5CB7A 3AP7A 2C5DA 4CP1A 3JUUA 2C9AA 2VUJA 3FZ3A 4E2SA 1OQDA 2ZGLA 4I3PA 4ORFA 4MSVA 1U12A 5C6CA 4Q4Y2 2HEVF 3ZXFA 1REFA 2BNOA 5BY5A 1F31A 3DGTA 3U10A 1VBC3 4FO9A 2RS53 4F8AA 3DN7A 2HJIA 1S1AA 1WGPA 4HVQA 2BUKA 1MS1A 1UU4A 1RVF1 3WX5A 2H0VA 3FE5A 3CU7A 3JBG1 2IXKA 3OBRA 4IV1C 2GN3A 4TYSA 3FHIB 2YV8A 1AF9A 1J1TA 2RR11 3LSDA 2DURA 1EAH1 5IT6A 3WZ1A 3WV6A 4NHKA 2X29A 4YM1A 4LE3A 2D6OX 2GH8A 1RUJ3 4META 2D40A 2EXKA 4JGZC 2OA2A 2PQQA 4LHKA 1RUE1 4JDMA 4LO7A 5C8CA 3E5XA 2X5IB 3IMNA 4PDWA 4WM7B 5JZGA 1REEA 3S7IA 1REDA 4P9LA 4WBBA 4CDUB 4Q2FA 1CPMA 4CTEA 4DRRA 4OI0A 4KH9A 3RS6A 5JLVA 5D8AA 4ISRA 2N7GA 1V6MA 1MEC3 1C8M2 4XFFA 5GZEA 2I45A 3CJIA 4RGGA 1R1A2 3UK9A 4B7EA 4CDWB 1X50A 1RC6A 3OYWA 1ND2B 2F6BA 5EV7A 5K9YA 2R6QA 4G9SB 4LO5B 1RUC2 3H3UA 3KQRA 4Q8LA 4L2NA 1PIV3 3ILFA 3GBFA 1TMF1 4DY3A 2A5ZA 3WP6A 1OOPC 3ZXJA 4BA6A 1X8EA 4QQOA 5EJ3A 1JTZX 2HEWF 4MGYE 4GH4A 1AL22 3D6EA 3O12A 3H1WA 2GDFA 1WLDA 3ZFEC 4L11A 1S0JA 1Q43A 2UWAA 3MW3A 4C1WA 1MACA 1SLLA 2ZTNA 1CN1A 1HRV1