1FMJA

Crystal structure of mercury derivative of retinol dehydratase in a complex with retinol and pap
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
PFPYEFRELNPEEDKLVKANLGAFPTTYVKLGPKGYMVYRPYLKDAANIYNMPLRPTDVFVASYQRSGTTMTQELVWLIENDLNFEAAKTYMSLRYIYLDGFMIYDPEKQEEYNDILPNPENLDMERYLGLLEYSSRPGSSLLAAVPPTEKRFVKTHLPLSLMPPNMLDTVKMVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAWAKRHDPNMLFLFYEDYLKDLPGCIARIADFLGKKLSEEQIQRLCEHLNFEKFKNNGAVNMEDYREIGILADGEHFIRKGKAGCWRDYFDEEMTKQAEKWIKDNLKDTDLRYPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A helical lid converts a sulfotransferase to a dehydratase.
pubmed doi rcsb
source organism Spodoptera frugiperda
molecule tags Transferase
molecule keywords RETINOL DEHYDRATASE
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fmjA00
5FL7D 4TYWA 4JLPA 3EASA 4PPQA 3KKQA 1LS1A 2P6UA 1VMAA 2EYQA 4JT2A 5A0FA 5TB5A 4LC0A 3SR0A 4DHEA 1E2PA 4M9ZA 4B3DA 4M1KA 3TAUA 3CX7A 3V00A 1U94A 3U3OA 5FH9A 2A2ZA 2WSSD 1RC8A 1UEJA 3DM5A 3A58B 5JHGB 3SJCA 2W58A 721PA 2FMXA 2H16A 3K8YA 4BRUA 1Q57A 4LYJA 4HEJA 2RCNA 2JJ8A 1W46A 4GSYA 1NVWQ 4DSUA 2X8AA 2PT5A 2OESA 3RSOA 4AI6A 4D25A 1Z0AA 1QRAA 3I4LA 2CLDX 2CE2X 2E9SA 2QE7D 4P33A 3MWJA 5JWHA 2OCBA 4PQYA 2J7PA 2G1KA 2JEOA 2Z43A 5J4HA 5HE9A 4C0AC 3UG6A 2WM9B 1DPFA 3GJ3A 4DB2A 1GG2A 3MLEA 4KYUA 1UM8A 5CIWA 1KJZA 1W48A 1OSNA 2YYZA 1XD9A 2FGJA 1IJFA 4Y0VA 2IWRA 1G7SA 1G3RA 4NE2A 1Q1ZA 3LLMA 5FR1A 2IXEA 3IBGA 4MRSA 4EFNA 3NBYC 2ZR0A 2A9KA 3DO6A 2WIAA 4RY2A 5HCNA 1KMHB 1YU9A 1DARA 5H1YA 4MYUA 1KO7A 3OE7A 1P2TA 2XTNA 3CNNA 5EZ5A 1YE8A 3LY5A 2FFQA 5G3ZA 2GHIA 3U3KA 3T15A 4UXJA 3FFAA 4GZLA 2JLWA 4LBZA 5HPYB 2H7VA 1C9KA 1VG0B 3S1AB 4ON9A 1DE0A 4D0LB 2OAQ1 2WWIA 5IT5A 3ICQB 4OHWA 3R8CA 1IY0A 2ZRAA 1NIJA 5SZIA 3IO5A 4PPFA 4DDTA 4V02A 3A36A 1EWQA 3EWAA 2IYRA 4HUTA 2WBLC 4XD7D 2OEPA 4QHSA 5E3HA 1F3OA 2IX3A 2JLVA 3PG5A 4A8JA 4NYIR 4UXIA 3OE7D 1QHIA 1UDWA 2H17A 4IDNA 1F5NA 5EQTA 5CIQA 5J4KA 4B6FA 5JI2E 3LBNA 2XX3A 3QSYA 2ORWA 1JR3A 1KO4A 1NLZA 4S2EA 3SBDA 2C95A 2XITA 4NDZA 4DDUA 4B47A 1US8B 1TU4A 2V8OA 3LQQA 3RS0A 3RWMB 3AKCA 1R8SA 4DDWA 2ZPTX 3B6EA 1Z6XA 2QPAA 4MGYR 2P6RA 1FP6A 1YHNA 4LC1A 2C9YA 5JSZB 1QHYA 1NN5A 3EA0A 2QORA 1KI1A 4RKEA 3ZQJA 3EPKA 4FIDA 1IY2A 1Z6AA 1QG4A 2DWQA 3EXAA 4PZZA 3TJZA 5HCIA 2C04A 1G8FA 1P60A 1GZSA 5TARA 4OHXA 1E1QD 4TQAA 2BBOA 4XWAA 1EFRD 1EX6A 3CF6R 3TH5A 1JJ7A 1JI0A 4FW9A 4LHVA 4Q66C 3ADBA 3IKJA 5HKKA 2D7DA 1Z6GA 3B60A 4LYHA 4PHTA 4BPBA 3VR4A 2W6JA 4A2QA 3RNLA 1J70A 2GDJA 4PHGA 4AYTA 4YXWD 3SYLA 1UKEA 1ZVQA 4QBFA 1KMQA 1AGPA 1RIFA 5C4MA 5GJCA 4DCSA 2KE5A 3DZ8A 1C1YA 4LUCA 1G20E 1IBRA 4AD8A 3MFYA 1ZNWA 4URWR 1KI6A 4WZ6A 1MV5A 2YOGA 1XZQA 3T1VA 4KCGA 4KU4A 1WMSA 1KSGA 2XJ9A 1EG7A 4NCJA 4U7DA 1W4BA 3PCRB 1KJYA 3AB3A 1R4AA 2W2XA 1Q20A 1TAGA 3UKDA 3O8RA 1CRQA 3FMPB 3K0CC 4CDGA 3Q5DA 2CVFA 4AWXA 4EFMA 2HEIA 1XEFA 4HB4A 3ZDQA 3IEUA 1QHHA 1XMIA 2ZYVX 3MCAA 1CF4A 1SXJC 2FEMA 2J0UA 4NL4H 1JEEA 2ZQ5A 5LD2C 1DG1G 4W5JA 5JEEA 4JSTA 3KJGA 4Q4JA 3Q8XB 5E7IA 1IAQA 1IY1A 2O8CB 1TF2A 2WIBA 3UANA 5IDVA 3WMEA 1AN0A 2RMKA 1W5TA 2RGNA 4CEJB 1GL9B 1OXUA 1JR3E 1P73A 1DO2A 2DFKB 3LLUA 4WXRA 3PEVA 4Q4AB 1KHTA 2BOVA 4TZ0A 3O8CA 4KYIB 4G5RA 2HYDA 2ZI9A 4HZIA 4JSYA 5TY0A 3O8BA 1DEKA 1XPRA 3OAAA 2LCFA 2X19A 3W8NA 1V43A 1KAGA 3Q9LA 4PAQA 1IN7A 2WJIA 4YMWA 3SOPA 3VU9B 1OB2A 1SHKA 4G5SA 5C18A 5C46F 1OV4A 5BYKA 2QN6A 4QJ5A 2Z0MA 1IJEA 1E0JA 5TV2A 4QBHA 3QVUA 2O0HA 1QZXA 3VTKA 3MWYW 4JT4A 4M22A 3G0HA 2IYLD 5CITA 1P61B 2UKDA 2QP3A 2VHUA 4DLXA 1II8B 3BB3A 4OI1A 1F6BA 2DCUA 4POAA 2ZE8A 4DXAA 3ZVNA 4HLDA 1XD2A 5BN4A 1TQ2A 4IVPA 4QHTA 2NMVA 2D4HA 3SFZA 2GEDA 2IYWA 2V54A 4DEXA 3SN6A 3LVQE 2NZJA 2ORIA 2XB4A 3QQ5A 1OB5A 2QE7A 2Z83A 5SZJA 3GJ6A 5EE5B 1SZPA 2VP4A 2YOFA 2O5VA 4BZXA 1RJ9B 4BFTA 1E6CA 1XCPA 2GEUA 2Q6TA 3SYNA 2ZROA 3UWOA 4R2IA 4LK2A 4AG6A 4NCNA 4PC6A 1H8HD 3QIAA 5DH9A 3OIUA 4RSGA 2BMEA 2ODBA 1W0JD 3W3AA 3C15C 4NPHA 5K8LA 1S4QA 2IK8A 3B82A 3RS5A 2PEYA 4O25A 2BMJA 1ZM9A 4L16A 2YWHA 1HTWA 2CLSA 4V0KA 5DI3B 4D81A 1KJWA 4I4LA 4S35A 4EPXA 1T3SA 3TSWA 1E99A 1WB9A 3K0SA 3LFUA 3K1JA 5K8IA 1GKIA 1E9CA 4HAVA 4B73A 2PEZA 1M2OB 2DFNA 4G01B 1P2VA 3A1TA 4PC1A 4LDJA 2GF9A 4TMXA 4JLMA 3FHCB 1E9BA 2WSMA 4OQFA 1Z2AA 2O0KA 1J90A 4P31A 1UKZA 3ZVLA 3LBHA 3KQUA 1T8TA 2QAGA 1N25A 3B1VA 3TSZA 1GILA 2ECKA 4BLRA 2G9NA 4MUAA 4OYHA 1E2GA 1WBDA 1MO6A 1SVLA 3FHOA 5JS7A 4GNKA 3IGFA 1E0SA 3ZIAA 1NN1A 1RVDA 3OIWA 3QXJA 1VYTA 2QL6A 4FINA 4ACBA 1RKBA 1H65A 1ZNZA 3UATA 3QJYA 1ZM3A 3U3JA 5JBQA 1G19A 4P0TA 3CNLA 5K8UA 4DCVA 4B43A 1ZCBA 2F43A 3OIYA 2JLSA 3AGPA 3UG7A 4Q4HB 2IC5A 1OH7A 3HYRA 2C2HA 1K8RA 1DBSA 4X8HA 4W5WA 5DHAA 4ARZB 4ZI3A 5H68A 1PV4A 1DAHA 3WMGA 1D8TA 3TR0A 5DSZA 4JLJA 1JQLB 2GBLC 3ZZ0A 2W00A 1G8YA 2W0MA 4I1OA 2WPDD 1GKUB 2BCJQ 2JDID 3O8DA 2HJVA 1G8HA 1XF9A 2WJJA 2JLYA 1M8PA 1GRRA 3BH0A 3NDPA 1M7BA 1Z0DA 4CEHA 5FL7A 5FPTA 1W0KD 2ZJAA 4WIAA 4CGZA 3ZGXA 1KK2A 4KBFA 5AJZA 1VIYA 4PSKA 4F92B 2BCGY 4TT3D 3SQXA 5SZKB 4F93B 3BE4A 3OHMA 4TMKA 2QQEA 1XTQA 4FI3C 1K6MA 1COWA 1Q12A 2VRWA 3E5HA 3LH5A 2FDCA 1E1RD 1JR3D 1XFAA 3TLXA 2ZSEA 5G40A 4TMWA 1OIWA 2H57A 4Q4AA 5FOUA 2GXUA 3TSOA 2G6BA 4PZLA 3K0EA 1ZM7A 1KIMA 1VCIA 2CNWD 4CEIB 1GIAA 1AZTA 1LFDB 2GA8A 1U8YA 2VF7A 5D3MB 2F3RA 3A1VA 1N6OA 3FHTA 1IN4A 1H8HA 2MSCB 2QSZA 2BEKA 4QGHA 4D6PA 4ZV4A 2YC4C 3BFXA 1DAEA 4KLNA 2CL0X 4EPVA 1VCNA 3ECCA 4YLGA 2CHQA 1X8JA 2GNOA 1T3LA 3C14C 4MGZR 4QJ3A 1UDXA 2OBMA 4OJKA 4Q1AA 3AKYA 3THOA 2GZAA 2NGRA 1XEXB 4HAUA 3WNDA 1E79D 1SULA 4LWZA 4L4UA 1TF5A 1E96A 5J47A 3CLVA 4K8OA 3U3RA 1A2KC 3KXIA 1EESA 4EDHA 2HF9A 1Z28A 1N2CE 1S8FA 1CXZA 2LKDA 4FMDB 5DO9A 3GLGE 1SVOA 1WDTA 1VCMA 1IQPA 3H84A 4Y0AA 2O8FB 1T9HA 4JVNA 1CU1A 2FPMA 2C03A 2ZYUX 3NEJA 5SZHB 4A36A 1M74A 4MUBA 2F7SA 4YMSA 4DLUA 5KHOC 1TL7C 3BAFA 4LBVA 5J4YA 4C0SA 3OAAD 3GP8A 1XTKA 1E9AA 1T3HA 4BUJA 4DT1B 3GLFB 4ABYA 4GP7A 4CZ2A 1FOEB 4GT1A 5JEDA 2V6IA 3PUVA 2V9PA 1U2RA 1Z5ZA 3CR8A 1H8ED 4QM7A 4R98A 1E9FA 4C4PA 2GEVA 1XPOA 3GJ8A 2V1UA 1OXVA 3AGQA 3AKEA 1ZUHA 2R8RA 3DOFA 3AVTA 5CM8B 1GFIA 1CJTC 3CPHA 1AM4D 2G1JA 5LB2A 1NI3A 2CE7A 1UBEA 3E70C 1EXMA 3Q3JB 1H8EA 2CEAA 3P26A 2BDTA 2FH5B 1AS3A 2DB3A 1XMSA 1X8KA 3FKSD 4QGAA 4NTZA 3ZD6A 4GDFA 4QHYA 4TWZA 1G7CA 3AH8A 4A6XA 2OFXA 3WRYC 1ZUIA 4PR0A 2HXYA 4DJTA 1RW4A 2KBFA 2F6RA 4G1UC 5FUXA 3MSXA 4WA7A 3K0CA 4Q9LA 5CYPA 1UBFA 4M1TA 3DHWC 1YZGA 2CCJA 4Z54A 2NIPA 2R6GA 3C16C 1F60A 2FU5C 2XOKA 2Z4SA 4XTRA 3RS2A 2BM1A 4BEJA 1KDTA 5FL3A 4PTLA 3CZQA 3DKPA 1ESNA 4Q02A 3TW8B 3OFNA 2ANBA 1NN3A 4JVLA 4PHFA 1D2EA 2IXGA 4QBGB 1JJVA 4AY2A 3CX8A 4B48A 1KO8A 2GJSA 3NBZC 1ZNYA 4LRWA 1EK0A 1ZNXA 3QI2A 2ZRFA 3CM0A 4QGGA 3SBEA 4JLNA 5EE1A 2CK3D 2W0SA 2WICA 5KU1A 4KO8A 3SC3A 4HZUB 3BK7A 4H1VA 4NHOA 2DBYA 1B0UA 2BJWA 2DR3A 5AJXA 2AL7A 5F98A 3R7WB 3P1JA 2WAXA 2ZRJA 5HE8A 4C0BA 1TUEA 3HPQA 4F38A 1L8QA 3DMDA 5BQ5A 4EPYA 1QHGA 2NOAA 2RAPA 4MKIA 4Q7JB 5FOTA 1S2MA 2R6FA 4NZYA 4MKFA 1E2MA 4BECA 3M4YA 4LSGA 5AK0A 2JLUA 4HLQB 2BKEA 1Q0UA 3BB4A 3B9QA 4JJZA 1XJ0A 1P9NA 4WZAE 4LJ4A 4II7A 4JJKA 4Q01A 5CK4A 5IF9A 1HE1C 1PLJA 1CR2A 5KNDA 2F1JA 3KJHA 5DYIA 5JRZA 3SHFA 2OO7A 4BWYA 1VG9B 1TQ6A 4LY6A 2YWEA 1NVVQ 2VO1A 3LVRE 5CLQA 3RWOA 1XEWX 2NO9A 3BBPA 5JFGA 2PH1A 2XNSA 4ZIRB 1G5PA 3OF5A 3TQFA 2YNMA 4C0LA 3AVQA 4URUR 2ZJOA 3ADKA 2I4IA 2P3SA 1G21E 2ZI3A 3DMNA 2G0TA 2E87A 5GJVC 1LW7A 2OV2A 5CK5A 2DFTA 3H2YA 3I5XA 4I1VA 4UNRA 5A5GA 1A82A 2OAP1 5AWFC 3BOSA 1XMVA 1YZQA 2I1QA 1E2KA 4OBEA 3GLIA 1NG1A 5FOVA 3WXMA 2WKRA 5ELXA 2OXRA 3VR1A 1BYUA 4HSEA 4UNQA 3K0FB 1J8YF 2Q3HA 5IK2A 2X2FA 2RGAA 4M8NE 4URZR 2FX3A 4QM6A 2IYSA 4FMCB 2O8EA 3IIMA 3K70D 5FR2A 1OFTA 1XX6A 1R5NA 4IOMA 1EX7A 1GNQA 1WP9A 1W36C 1N6NA 2F9MA 4IOLA 5J5CA 2IA5A 4TTQA 2ZJ8A 3L0PA 1FMLA 1OJLA 2VHJA 2A5GA 4RZ2A 2FSGA 2QEQA 4ESVA 2CCKA 3A4NA 4CW7A 2EFHB 1G17A 1JB1A 3OFND 4DRZA 4AKIA 2OG2A 1HQYE 4PXAA 2DWPA 3FFBA 3WHKA 5EXSA 3MG9A 4PO1A 3CRW1 5CDFA 2OFOA 2IUTA 3UIEA 1A5TA 3FDIA 2XGJA 2VSXA 4D4JA 3TIFA 1N6PA 1NSTA 1HEIA 1E2NA 2IW3A 2F43B 621PA 2C99A 2IEYA 2XTZA 4YDHB 1LNZA 2CJWB 1EFUA 3EARA 1BMFA 3R7WA 4JLDA 1SKYE 1G5TA 4DUGA 1JQJC 2KI5A 3IDQA 3CRMA 1OKKA 1XTRA 4PQRA 2RGXA 1UBCA 2D62A 1NVVR 3HDTA 2FWRA 3A1UA 2AWNA 3E1SA 4RFSA 3N5CA 5ANRB 3THWA 3D6TB 4Q4LA 1HA3A 1N5LA 2YINC 3L8ZA 2A3RA 4MKHA 3NXSA 3QKRB 1X3SA 5FTJA 3L8YA 2Q3FA 2ZE6A 1ANKA 2IT1A 5J4VA 4IVQA 3W6OA 4RCYA 1KKMA 2PL3A 4LBWA 5FI0B 4YMVA 3RRMA 1Z63A 2FJUA 2AKYA 3RC3A 3GPLA 2CCGA 4FXPA 1XEWY 1AA9A 1U9IC 2ZUCA 3V9PA 2ODNA 1ZCAA 3BWDD 3ZQ6A 3KQLA 4LCBA 1FZQA 2P65A 3THXB 2GZHA 1W0KA 5C4GB 1NRJB 4IHQA 1TU3A 3AF2A 3LX5A 3QG1A 2BBTA 5CYOA 1AS2A 3A4LA 4M53A 4B3XA 4TLDA 3W6NA 4EKDA 2ZJYA 4YMUA 1G1MA 3SZRA 5BXQC 3QXCA 2CMKA 4Q03A 3AM1A 3MRSA 1E0AA 1AQUA 1GNPA 2W2VA 3VKGA 2KB0A 3HU1A 1N5IA 2EW1A 3TW4A 2XZPA 4EJSC 5EXPA 2VEDA 4TQ9A 1Z0FA 3V4FA 1A4RA 2ZRMA 3VQTA 1E9DA 3NH9A 3I92A 4US1R 4QJ4A 2OE2A 3AKDA 3P4XA 4F7WA 5CB8A 4LV6A 5BN5A 4LV5B 3CWQA 4TYYA 1RRGA 4HLCA 2HYIC 4DT1A 3V4RA 3TAHA 4NMMA 3KQHA 1AJEA 1MOZA 2E1RA 4LBYA 2WJHA 5K8TA 1YZTA 3QKUA 5CM9C 1ZAKA 2FGKA 1E2EA 2AXNA 1DOAA 4Q19A 1HQCA 4HLUC 4V0ME 2N46A 2J46A 3JZMA 3EX7C 4CEHB 4I99A 2O8FA 2G0NA 1E2DA 1KSFX 4YQFA 1NIPA 1R0ZA 4OQNA 2B7CA 4O2RA 3NHAA 4QOSA 5KPDA 1W7AA 2ERYA 4RKFA 3SDZA 4Q7MB 1R2QA 2JJ1A 1Q1EA 4UJ3A 5AUNB 4TT3A 4A9AA 2UVQA 4C2TA 2FA9A 4CVNA 2F3TA 1DVRA 4C0QC 2GF0A 4F4JA 3T1QA 3SFVA 4PO9A 1E1RA 1XTJA 3I8XA 1QF9A 1NKSA 3X2SA 3IO3A 2J1LA 2ZETA 3O47A 4M4SA 5FPYA 2X2EA 2B92A 2Z6VA 4PAOA 4ZDKA 2OBNA 2O8CA 1TQDA 1E0KA 1S0UA 1ZUNB 2XXAA 2G83A 2AR7A 1G4AE 2Q9BA 3EIHA 5IRCD 4CIDA 2WKQA 5LB4A 2ZR9A 5C1BA 3G82C 4PSAA 4Q21A 4CEIA 3WNCA 3THXA 4YXWA 4Q00A 4TLBA 5UKDA 3AVXA 3QVVA 5CLLA 1SXJE 4TMVA 5J40A 3VHLB 1X86B 3LDAA 2QAGC 2WMOB 4RD0A 4TYPA 1KK0A 2FV8A 3NH6A 3NDBB 3LNCA 3QXHA 2WWFA 1NLFA 3LW7A 3OIVA 1OYWA 2AKAB 4B44A 3WP1B 3WYAA 2ZI7A 4AURA 4HAZA 3LX8A 2WKPA 2AHOA 2PX0A 4W5HA 2C98A 4JLOA 1PUJA 1BH2A 1OFHA 5TMPA 5GVSA 1VTKA 1E2JA 1XTIA 5JJKA 2AWOA 2A5YB 5LD2B 1VKJA 1L2TA 2ZVPX 3DL0A 3RLFA 1MO5A 4DEYA 1JEDA 4Z8YA 1IN8A 4XSHA 4DLVA 3OZXA 3KJIA 4B35A 4ARZA 4ESHA 1XZPA 4DCTA 3U7EB 3AVUA 5FOXA 3QEJA 4Q1CA 2FFBA 2GCOA 1SGWA 1U0HC 3AEZA 5FPSA 3FOZA 2ZVQX 4MH0R 3EZ7A 4OHYA 3WHLA 2NO0A 5L3VA 1KI2A 5KDLA 3QBTA 1FL9A 4WW0A 1XRJA 2Q21A 5HR5A 2YKGA 4L9WA 3B9PA 1R6BX 4IDOA 3K09A 4D82A 8OHMA 3QBVA 1JAIA 2PLRA 2PLFA 3ASYA 1JPJA 2XJ4A 1OIXA 2JAQA 2ZRDA 3NHBA 3TK1A 1US8A 1WA5A 4P4UA 4WVFA 1RFLA 5FOSA 2JIZD 3EC1A 4ZDJA 4TSFD 2BM0A 4R71A 5EXXA 4KLZA 4K81B 5DGXA 3SEAA 5AUPB 4D4LA 2I1VB 1E3MA 3OEHA 3F5FA 4Q1DA 2ZS9A 1VHLA 2XAUA 1R7RA 3BXZA 4NYJR 4DZZA 1OH5A 4ACAA 1T5IA 3VKHA 4A8JB 1N6RA 3VU9A 2IUUA 2JATA 3LWNA 3KJEA 4NU0A 1GUAA 1OKKD 2VQSA 4M1WA 1JXOA 2IYQA 1CIPA 4HUQA 3GLIB 1ZMXA 5DIFA 5EUQB 1N3BA 3U6KA 1BO6A 5LBIA 1IN6A 1T91A 2A7QA 2NO6A 4K46A 5B64A 2C8VA 2D2EA 3L0SA 1SVKA 2DHRA 2J5XA 3ND8A 4LHXA 4X8LA 3QUSA 4OHZA 2J7PD 4RFSB 1PLLA 5TXGA 3VR6A 4GI7A 1M34E 4Q4JB 3SHWA 4PANA 1FNMA 2EWWA 1E9RA 2OLJA 2A30A 2ZS8A 3MUFA 4LYAA 1SVWA 1Z6YA 4KV9A 2GILA 1NN0A 2CJWA 2MMCA 2GAOA 2VPPA 3HWSA 1N5JA 1B23P 1T4GA 3H86A 2VP2A 4W7SA 3IUYA 3VHXA 3VR5A 4IRUB 1VCOA 2W6JD 3BD9A 3ZS9A 1RZ3A 4A2WA 1JBKA 5FPHA 1PLKA 2FEOA 3NVAA 2P6NA 4JBXA 2RKOA 3GLFE 3CZPA 4QG7A 1XWIA 2IYVA 4LJAA 4RCZA 2OLKA 1ZU5A 4M1SA 4F91B 1E32A 4RZUA 1CJMA 1QHXA 2HUPA 1OXSC 1X8LA 4Q47A 5KPJA 1VG8A 1ZM4A 5DN6A 2EYUA 2IYUA 3FKQA 1NBMD 3PENA 3TVDA 4NYJQ 1WCV1 5JJIA 4GMXA 3TRFA 1IOZA 1T6NA 1W49A 2VP6A 3REFA 2VP5A 4DLZA 4IVRA 4NCHA 3C4JA 4IFBA 4PQFA 2IHYA 1W2HA 2VHQA 2GESA 4YMTA 1NBMA 1N0UA 1TX4B 1E4YA 2DWOA 4TL8A 3U3MA 3U61B 2G3YA 4TTRA 3KKPA 2H8KA 4CEJA 5JSZA 5FOWA 4I1UA 3WP0A 2FSFA 2IYZA 2ANCA 2QY9A 4TL9A 1GOTA 4DB4A 4URXR 2HDNB 3QKTA 5FUVA 1R0YA 2QPOA 5A4JA 4R9UC 1HT2E 4C2UA 2ZI6A 3NC1C 3CH4B 4PPGA 4CF7A 1P6XA 1Q22A 3TVTA 1DAGA 3W5JA 2J9RA 3AUXA 1TMKA 3KFXA 1IN5A 2XNDA 1S3SA 4PC3A 3LAWA 2VLIA 3N70A 4IOKA 4GOJA 3WY9A 3P4YA 4I81A 4RD6A 4RD1A 4Q9IA 5KOYA 3L2OB 4TMTA 4GFDA 2PCJA 1W36D 1RRPA 1GVNB 3REGA 1U98A 4NBSA 4A8JC 1S96A 1JNYA 4JVMA 1MRSA 3PR1A 3MJRA 3LO5A 4KJZA 3MJHA 4N0DA 2IF2A 4R2HA 2GAAA 1Z83A 1HH4A 1M7HA 1W1WA 2LWIA 5FTLA 5JS8A 1O3YA 4MYTA 5B2ZA 4OK3A 3T5GA 2GCPA 4Q7LA 2NPIA 1TF7A 3HU3A 1IXRC 2RGEA 1Q1BA 4HDOB 4BE7B 3CF0A 2UZIR 3QKRA 2P67A 3WNBA 1M1YE 1T5LA 3GLFA 4GZMA 4HZUA 2N1BA 1GKYA 2ZJ2A 3L0IB 3PQCA 2ODWA 1VPLA 2W83A 1CP2A 2AFIE 2ZS7A 4LJ7A 2J0SA 4NCKA 2BMDA 3L0OA 1NY6A 4OK6A 1BKDR 1LVGA 1ZD8A 4NYMR 5JZVA 3GD7A 4CRWB 2EFGA 3R9XA 4OQMA 1P9WA 5M04A 5F9HA 3B85A 1AQYA 2NO7A 3JVVA 3THYB 1UPTA 2PJRA 1NLYA 3I32A 1CJKC 1W0JA 5DE3A 3X1DA 1TNDA 1RRCA 1VIAA 3NEYA 3EPLA 1OFIA 5KNCA 4LHZA 5B30A 1ZBDA 1CR1A 3RYTC 4BASA 2BVNA 2FSIA 3BFVA 3HR7A 2FF7A 3EIQA 3L43A 4RVCA 2WAYA 4N0EA 1ZINA 3UWKA 5KSPA 4MDFA 1WBBA 4E07A 1QHSA 3TMKA 2PMKA 3TE6A 1OXTA 1CKEA 1C4OA 2JLZA 1UADA 3B1ZA 2BJVA 2B7BA 2GK6A 4IDQA 3W90A 4AKEA 3DOEA 4B75A 3I62A 1II9A 3A8TA 3KDSE 2OCPA 3FGNA 2V6JA 3LXXA 1HY3A 4IDPA 221PA 1RRFA 4OQXA 4BEBA 3KB1A 4IDHA 4YDSA 4C7OA 4PO8A 3U6BA 1E2FA 2JDIA 1JALA 1D2MA 3D31A 3AF1A 1CJVC 3CONA 4PHHA 4QNMA 4A0HA 3BORA 2RGNC 3VNVA 4FCVA 2OM2A 2WWYA 1E79A 1FNNA 4KXFB 5E7MA 2HLDD 3NBFA 4HDQB 4JIMA 3RS4A 4O3MA 4DSTA 3CRVA 4ZIRA 2QTHA 4DIDA 2SHKA 3WYFA 3E2IA 5CJPA 4JMPA 5HKKD 1E2IA 1NJGA 3Q5EA 5DYGA 3GLHE 5EP1A 4KFUA 4LPSA 3FKSA 2R9VA 3VFDA 1KMHA 4QL3A 1ZM2A 4U02A 3TUJC 4IW3B 2J7KA 3JVUA 3DVLA 5CB6A 5FBRB 2IS6A 2FFHA 3UMSA 2QRZA 3K09C 1UF9A 1XMJA 4IKEA 3L82B 3BERA 1SQ5A 1GAJA 1M6NA 1RE0A 2BV3A 1P2SA 2DY1A 4QRHA 5B58C 2CVHA 5JMTA 1CEEA 1KSHA 4L5BA 3T61A 2OILA 2QROA 4WBSA 3VX3A 1SVSA 3U4QA 1KDPA 2HCJB 2ZE7A 4KVGA 1MABA 3QF4B 3QPWA 4DKXA 3TUZC 4W9MC 1YZNA 2D3WA 1HUQA 3VR2A 3LRPA 1KNQA 1ZIPA 1JXMA 3KFVA 3A1SA 4MKGA 4Q1BA 1QHNA 1R0WA 4LJ6A 3GEHA 3B1XA 4OI4A 3IHLA 2PMDA 2QMEA 4PZYA 2ONKA 5AUQA 5L3QA 2IXFA 1S3GA 2CHVA 1DADA 1YVDA 1XCGB 1P9RA 1Z29A 2NO1A 2G77B 4BFXA 3FTQA 4C9BA 4FWTA 1XPUA 4KI0A 4A6PA 1ELOA 3CNOA 5LDDC 3I5YA 2ZRKA 1YR8A 2PT7A 4JLVA 2VP9A 2QAGB 3ASZA 2J87A 2OHFA 3SU8A 3T1TA 3MWLA 2GJAA 2HT6A 3IQWA 1JPNA 2R62A 3W6PA 1OXXK 2RGDA 4E5UA 2XSZA 3R20A 1NL3A 5P21A 2VTKA 2W6IA 1KI4A 4M9QA 2X1VA 4TTPA 3BB1A 4D4KA 4LPKA 4DLYA 1G291 3M1IA 1Q3HA 2A78A 3CUEF 3X1XA 1VYUA 3KKMA 2ZUBA 1PZNA 4XVUA 4JYCA 5KTYA 4WAUA 2QMUA 3HU2A 2OSBA 4RD4A 3B1WA 3AP1A 3RS7A 1COWD 1GP2A 1DTSA 5KDDA 3CW2A 2ZRHA 5FFMA 3GLHA 3I3SR 5JWOA 1I4TD 3W9YA 1V5WA 2XOKD 4BZPA 5JWRA 4ZI2A 3GLGB 2P2LA 1D9ZA 2Z4RA 2QTVB 1XP8A 3QXXA 1E94E 2WJVA 3QXSA 1BS1A 4DBLC 4V0MA 1K5GA 1LY1A 4A2PA 2JLXA 3OEEA 4XWKA 3JZAA 1KSJA 2J3EA 4GOKA 4KFSA 1DG3A 1XBTA 1GNRA 1Q44A 2GVZC 2NZ8A 5DN6D 4QBIA 2HT1A 1G8PA 2ZAMA 1E98A 1WE2A 2AD5A 1LV7A 1II8A 2BKUA 3EA5A 2GETA 1T0HB 4JLAA 4HB2A 5EUMA 3I72A 4P4SB 3I61A 1Z47A 2JLRA 1HE8B 2ZAOA 4Z51A 4OJQA 2JJ2D 2QBYB 2R44A 1S1MA 2QPTA 3U7GA 1UBGA 1Q3TA 2XZOA 2FZLA 4EPWA 1YJ5A 5BW8A 4A82A 3MMPA 4DSNA 1YZUA 5FTNA 1HYQA 2QMOA 1ZD1A 3CWZA 4HATA 3ETLA 2YV5A 3WBJA 5J4LA 2FSHA 4B6EA 2YC2C 3DDCA 5KUTA 4B3BA 1IHUA 4UNNA 2VSOA 4NONA 1NMYA 1DS6A 1AIPA 2FG5A 1BOFA 3KX2A 5H70A 2IS2A 1NP6A 1UFQA 1VHTA 2W2TA 1DO0A 3NC0C 3UK6A 1QG2A 2GCNA 3CR7A 5JJLA 4PX9A 3IPXA 4GRAA 5DI3A 4O0MA 4G5QA 4URYR 3IEVA 3DM9B 4BFYA 3PUWA 4JKIA 3GEIA 1DAMA 4TL6A 1XXHA 3B78A 4O2LA 4Q18A 2XXAB 2KWIA 1G5RA 2ZJBA 5D3MA 2ZITA 3FB4A 1YRBA 4AG5A 1KGDA 1XJCA 2C96A 2IL1A 1XTSA 2CBZA 1CBUA 2PCLA 2UZ3A 4M1OA 4OQLA 4BLSA 1L4UA 4QGFA 2QNRA 1ZW6A 2ZM5A 1Z0KA 1I4DD 4LZZA 1NSFA 4TMZA 1UKYA 4DIEA 3GEEA 4FMCF 1AKYA 1Z08A 2C5LA 3W5IA 4EFLA 3TQCA 1NNEA 2ATXA 1W4RA 1CTQA 2EFEB 2C9OA 3AVYA 4AYXA 2O8BB 1LTQA 1CR0A 4CYMA 3R9IA 3U60B 2H18A 4IEIA 2L0XA 3VX4A 2AXPA 1G18A 2QM8A 1KI6B 5EE0A 1CR4A 3KKNA 3DPUA 1SKQA 1NY5A 1Z8FA 4UNPA 2KJQA 2QGNA 1SVMA 1MKYA 3C7KA 2VYFA 4GPTA 3UPUA 3P20A 2CNWA 2H1LA 2QRNA 2O0JA 2NTYC 4MA4A 1VDZA 2J45A 2WZQA 4B2IA 1G3UA 1XXHB 3DKVA 2TMKA 4GMDA 3PEWA 1P2UA 2IWHA 1QVAA 3M6AA 5JRJA 3W34A 2ZANA 1KZ7B 3LV8A 2ZJ5A 4QC2A 2OXCA 3GMTA 4B34A 1P75A 4CT5A 1NMXA 2JA1A 2MMGA 2ZEJA 4OL0A 4Q4HA 4JLKA 2FN4A 4EJSB 4KFRA 4KFTA 2GKSA 4LGMA 3U7FB 4G5OA 421PA 3GFPA 4BFZA 1NKTA 1WQ1R 1R0XA 4IFEA 3OEED 5EP4A 4ILEA 2N42A 5JCZA 3LBIA 2Q3MA 3AUYA 3P27A 3AVWA 1A1VA 5JCPA 4A0FA 2GXSA 4US0R 1KNXA 4FCTA 4JL6A 4IXMA 2BC9A 4IEEA 4B3FX 4KSBA 3NG1A 2B21A 3I8SA 2PBRA 3IIJA 1G9XA 1CRPA 2VP0A 4M1YA 3LW8A 4B2PA 2WWHA 2R6CA 2PZGA 5BYJA 4E09A 2B8TA 4B74A 1LF0A 2ZREA 4LJ9A 1EWRA 4YONB 3N2IA 4GP6A 1HV8A 4CT4B 1W5SA 1PJRA 1FW6A 1ESMA 2ZSDA 1P3JA 3ADCA 2RHDA 4MITA 2BWJA 3T12A 3CO5A 5F9FA 1CULC 1DAIA 3AP2A 4BFWA 1KTVA 3RS3A 3T5DA 1IM2A 1DELA 2HLDA 4AC9A 1YZLA 3AP3A 2R2AA 4A1FA 4ERNA 4RD3A 4ZCIA 2QQ0A 1FUKA 2A5JA 3RABA 3EZ9A 4EPRA 4KVAA 3GFTA 3B7GA 4MYHA 3ONWA 3QOFA 1QBKC 4MRVA 1R5OA 5E95A 1G16A 3THWB 4N1AA 1GTVA 2V55B 5FBVB 4ZKEA 3GJXC 3T35A 3KUDA 3FMOB 2CXXA 2IHBA 3D8BA 4C3ZA 5AUOB 3HJNA 4NCIA 5KSYA 1SHZA 4B76A 4ZCLA 3A6PC 1RJ9A 1J99A 1F48A 1T8UA 4EPTA 2JGNA 2NQ2C 1SXJD 5HZHA 1N6KA 1X6VA 3VNUA 4RJLA 2GVDC 4B32A 1NMZA 2ZSAA 1R8QA 1ZYUA 1NG9A 3B1YA 1G41A 1BYIA 1D9XA 4HYYA 4B71A 2OCAA 1XD2B 2DPXA 4WXPA 121PA 4DVGA 2YOHA 1G8GA 4G3XA 2QMHA 4QFMA 2QTFA 5FPKA 5AJWA 3NIBA 3U5ZB 2V3CC 2ATVA 3ZYCA 3FMIA 1F2UB 4FMDF 4RZ3A 3HR8A 1G6HA 4C30A 3OESA 2QGZA 3RANA 3EC2A 2BEJA 3EWSA 1YZKA 1Z6TA 2RHMA 2O8EB 1R10A 3AF4A 2K5UA 3RRZA 1KY3A 2WOOA 3FVQA 2P0EA 1OHHD 1KK1A 2D06A 3K0FA 3CH5A 1ZC4A 2F1RA 2C78A 5AJYA 4Z8XA 3RHFA 4RZXA 1M7GA 1DAFA 3PVSA 1MABB 1HURA 1KAOA 2YVUA 4XH9B 1MO4A 1FX0A 3A37A 5BN3A 4G5GA 1LF5A 1NVXQ 2GK7A 3AVVA 1ZJ6A 4EQ6A 3K0AB 1YQTA 3HP1A 4WOPA 3R8FA 2AD1A 5AJVB 1E4VA 4XIGS 1OYYA 4DC9A 3LXRA 2WJYA 3IIKA 4M2LA 2NPFA 1GITA 3CRQA 2J41A 5FUYA 4BLQA 2DYKA 4TLAA 1KK3A 4BLPA 3PIRA 4BFUA 1E2QA 4HAYA 3WRXC 4LHWA 3TR5A 2KBEA 4D0GA 1AGRA 1YKSA 2Q0HA 3SJBA 3UXMA 521PA 1TEVA 4FWIB 3KZ1E 1U0JA 3ADDA 2ASEA 1U90A 1G7RA 4DLTA 4C0JA 1G7TA 2IBMA 1G64A 2ZTSA 5DLQC 2X77A 3TKLA 3VR3A 1EFTA 4HB0A 1JAHA 2XSZD 1GL7A 4L8GA 2B6HA 4X8OA 5F2EA 5HTKA 5KSOA 4HDCA 2MSDB 2GTPA 4H9GA 4I1SA 4QXAA 4B33A 2D7CA 4LV8B 4UNSA 3SI7A 3WBKA 2XTMA 3SJZA 1MO3A 4IOJA 4KODA 1UEIA 4GBMA 4L9SA 1D5CA 1II0A 4Q48A 3EG5A 1VECA 1N6LA 4KAXA 3QY0A 4BGDA 4OKSA 4TYNA 3J81k 1YR7A 3K9NA 1FPMA 3QNUA 2YWFA 1WF3A 1GSIA 4DUGD 3Q7PA 3C8UA 5GADl 2IYYA 1KDOA 4BFVA 4LJ8A 5KSZA 4JLBA 1SXJA 4PPNA 2XEXA 2OZEA 2AX4A 3FMFA 3MAAC 4D80A 1OE0A 3KB2A 3PXGA 1XJQA 2Q9CA 3CBQA 1NBME 4DLSA 5KNBA 2XB2A 4PFSA 4P4TA 1UAAA 4N3NA 4MDEA 3BH7A 3DZDA 1ZU4A 2GJKA 2R65A 4RD2A 4ZDWA 5GJBA 5HZKA 2D74A 3EAQA 1TUIA 4ZCMA 1LS6A 3QKSA 3BJIC 2YZ2A 3N2EA 4DLWA 3R9WA 4ZPXA 1N0VC 2CK3A 3PUXA 4Q9JA 2VL7A 3KQNA 2ZXUA 1BIFA 3H4MA 2IS1A 1SXJB 2RGBA 2P5TB 1X1SA 2IEZA 4US2R 3X1WA 4D26A 1EFRA 4A4DA 2EU8A 3B13B 4UKDA 5FI1B 5E7JA 2CL6X 2REXB 3ZIAD 2ZI5A 2QT0A 1GM5A 4MGKR 4KHZA 3KKOA 3K9LA 4NP6A 1FP7A 4JZKA 3H0KA 1FTSA 4M0LA 1OPXA 2GRJA 5JECA 2B8WA 3S1AA 4AIIA 2ZU0C 2ZRPA 3K70C 1D6JA 3ZVRA 3H1TA 3K9GA 1QVRA 2VH5R 1VYVA 4AKHA 2VF8A 3I73A 2ZRNA 3KXLA 1S9HA 1OF1A 5D3QA 2D2FA 2OT3B 1F2TA 5DISB 1L4YA 1Z07A 4XD7A 4HLUA 2F9LA 3BH6A 4U5XA 1IONA 4TLCA 5DNYB 2JJ1D 2JJ2A 2NG1A 1U0LA 4AYWA 2WPDA 3EZ6A 4KSCA 2R6DA 3FYHA 2QU8A 3FPAA 3K0AA 2QG6A 3AV0B 4BLOA 3GJ0A 3EPJA 3SQWA 3EIEA 2RB4A 4HB3A 1PVOA 1ETUA 1XEXA 2A5FA 4URVR 1KI7A 4JYBA 4FMBB 1FX0B 1R5BA 2DFLA 4MRRA 4G0NA 3X1ZA 2ZR7A 1A7JA 4XSGA 2ZRLA 3BFKA 3F0TA 2QT1A 2FZ4A 1ZRHA 4MRPA 2FOLA 3IBYA 3EZ2A 4XOIA 2H5EA 1J8MF 2I3BA 4A92A 5EJEA 2FFAA 4FN5A 3BRWD 1W44A 1RPZA 1FQJA 3GJ4A 5EP2A 5LPNA 2GWHA 2ONJA 2ZU6A 1Z0JA 1YRAA 5G41A 2Z5FA 3GJ5A 2C9CA 3EPHA 1X1RA 4LOAA 3GLIE 1U8AA 3G5UA 5L3SA 3DEFA 4RFVA 4F4IA 1W2GA 3GFOA 1KI3A 1Q1QA 1MR3F 2HJGA 3ZD7A 1AS0A 2HCBA 4JBWA 1O87A 2IUSA 4JL5A 4MYCA 3AQ4A 2IYXA 1FQKA 1KDRA 2O8BA 4D2IA 1PUIA 1T0JB 2EVWX 2VSFA 1OIVA 1Y3AA 4PC2A 1W4AA 3AF3A 3ZLJA 1ZC3A 4Q1FA 3FE2A 4DSOA 2H92A 4XJXA 3UMFA 4TSFA 2WMNB 3T34A 4M21A 4EUNA 4AK9A 1TTTA 2F55A 4WZBE 5EZ6B 3Q7QA 5FTKA 2EQBA 1U99A 1JR6A 2RGCA 4LI0A 5EXTA 1P5ZB 3IQXA 4JL8A 2ZRCA 5GVRA 4B2LA 1KZGB 2WVJA 1YR6A 2PZFA 3ND9A 3U44A 1EGAA 3F8TA 4TQUS 1OT3A 2RH5A 2WWWA 4EQ6B 1P7CA 2IF0A 3C5CA 2O8DB 4UQOA 5L8VA 3W8RA 3QPVA 4BZQA 2ZYTX 1AK2A 1N6IA 3RRYA 2BHRA 3BIFA 4HUQB 3PUYA 1BMFD 1E9EA 2QP9X 2YWGA 3QF7A 3WMFA 4BQSA 4DDVA 1RYFA 5KYKA 4TYQA 2V1XA 3K70B 3NBXX 2ZJZA 4IXNA 2VIIA 2VA8A 3SE0A 2QUZA 4LHYA 4OI2A 3RC8A 2AN9A 4A15A 2F1HA 2F1IA 1FUUA 4XVQA 2CHGA 4D4MA 1W36B 2QBYA 3KTAB 2AK3A 4MGIR 1F2UA 2WV9A 4JKYA 3IPYA 1Z3IX 3RVBA 4KITB 4MQBA 4Q9HA 4OHVA 2ZUDA 2GBLA 4E22A 1IXZA 3FWYA 2ZSBA 3KQKA 2YJTD 4IJMA 3SS8A 1CJUC 1RYHA 2CLCX 3MGCA 4AKGA 4XWOA 2IS4A 4NKRA 4KBGA 2GJ8A 3GQBA 5FBLB 1AKEA 1E1QA 2JCSA 3U2QA 3PEYA 1VG1A 1KY2A 1NVUQ 2GXQA 5FBWB 3ZVMA 2FNAA 1TPZA 2GCOB 4YC7A 5CDFE 2QENA 3CKLA 4TL7A 1G3IA 3TGPA 4BLTA 1OH6A 3QPUA 2QM7A 2VHTA 3CB4A 3U44B 2PX3A 1J7KA 3F3YA 3RDPA 4NH0A 1OLOA 4P3YA 1KOFA 2QP4A 5DI9A 2G88A 5JHHB 1Q21A 2J0QA 1W47A 1MH1A 1KO1A 1Z22A 4V03A 1GDDA 2REBA 3W3ZB 2YHSA 3CPEA 4Q5IA 5TDHA 1CS4C 1G6OA 1E9SA 2WWGA 2HV8A 3A1WA 1NJFA 1XNJA 1SVIA 1OH8A 3MD0A 2FPKA 4HAXA 1ODFA 1MT0A 4JVSB 2QZ4A 3PITA 3Q72A 4D0NA 1XU4A 1XXHE 1ZIOA 4U00A 1E2HA 3QENA 1EFCA 2BMFA 1JECA 3EZFA 5CJ2A 2BBWA 3K9HA 2Y8EA 3VMFA 1GWNA 4B3CA 5B57C 4LJ5A 4HI0E 4C0HA 2LKCA 4C0KA 5L3SB 1WRBA 3KTAA 1ONBA 2ZIAA 4MRNA 3TUIC 2CL7X 3NWJA 4E03A 3KL4A 5JI3E 3AVOA 2CDNA 4BFSA 6Q21A 1G4UR 2Q9AA 3BS4A 4M1MA 1I4LD 1N5KA 4EIWA 1OW3B 2BBSA 4FCWA 4GOXA 1GL6A 1A2BA 1TADA 1E2LA 4QKQA 4JBYA 1UKVY 3T06B 2HXSA 2VHCA 4J0QA 1GRQA 1U81A 1AZSC 3UMRA 4ASUD 2GZDA 3M0EA 1P62B 4PAMA 1S1CA 1OFUX 4EJSA 4V0LA 821PA 3T1OA 1KI8A 1E69A 2O8DA 1W4CA 4LYFA 3PJRA 5EE3A 1XCMA 2OBLA 5F3WB 1P72A 1D2NA 4PSVA 4OI0A 2AK2A 4UJ5A 2J0UB 2RGGA 2QAJA 3Q85A 3CX6A 2JLQA 1QHHB 3D7MA 3QG5A 5BWMA 4EAQA 1N6HA 1QDEA 3AVPA 1SKYB 4QNRA 2EFCB 2V4ZA 4DLRA 2XNDD 2PJZA 2KSQA 2O52A 4HAWA 2ZRGA 4NYMQ 4P32A 4DCUA 1U8ZA 4ZKDA 2VBCA 1KI9A 1OHHA 4V0NA 4UXHA 2J59A 3VKWA 1I2MA 4B3GA 3LD9A 2QA5A 3LQRA 3SJAA 2P5SA 3I1FA 2A5DA 3OEHD 3GLGA 5FUWA 4NYIQ 4C7OB 4LJYA 2WOJA 3GLHB 2J0VA 3PEUA 2FPLA 2QSYA 2WSSA 2OCYC 1GRNA 3NKVA 5L3RA 1KKLA 5TVKA 2JIZA 2C77A 3ICEA 2ZE5A 2GXAA 2ODEA 3AF0A 5E4FA 2REOA 2ORVA 3B2EA 3CRRA 4H1UA 1FTNA 3CF2A 1Z2CA 3GJ7A 3ZZUA 4DCNA 2QI9C 4DWJA 4TN1A 5FBQB 2FE4A 1P4SA 3PFIA 2HF8A 4PC7A 3A4MA 4Q1EA 3WYGA 1ZD9A 2V7QA 4OK5A 2AFHE 5C2JB 5KDOA 3ZS8A 2ZI4A 3D3QA 5EE9A 1XB2A 3K53A 5AR1A 4A0GA 1N0WA 4TZ6A 3U7HB 1G3QA 1XDBA 1YR9A 1ZP6A 3EW9A 4M9SA 5G3YA 5GJWC 3MWKA 4GL2A 1EFHA 1TQ4A 1G3MA 4Z1MA 5IHPA 3LA6A 1Z06A 3THYA 1Y63A 1I2DA 2WHXA 3P32A 3QEOA 3KXKA 3RAPR 3BGWA 5DHFA 3HPRA 4V0OA 3GCGA 1F2TB 3HYTA 1UJ2A 2PZEA 4P4SA 4XTCS 1HT1E 1XD8A 3X1YA 5L3QB 4XVRA 1IXSB 4ZO4A 2R6AA 1Z0IA 4L15A 4FD2A 2W6ID 4F4CA 2BIFA 3IHWA 3SYKA 1KO5A 2WJGA 5FTMA 5G53C 1S9DA 1FMJA 2MSEB 3B5JA 1LB1B 1DAKA 2EWVA 3PUZA 3PV0A 4ITRC 2EFDB 4ASUA 1NF3A 3C41J 3QE0A 3TBKA 2GJ9A 1WXQA 3B8HA 3QF4A 2WWXA 4Q7KA 5EP3A 5JLJA 4M9XA 3CPJB 3U4QB 1K5DA 3BC1A 3VAAA 5KO2A 1KYIA 5H8WA 3IILA 3RRNA 5IK2D 4Z1MD 1CLUA 2OFWA 3NTUA 2XZLA 2ZSFA 3SNHA 1FFHA 3ZZTA 2ZYWX 3RSLA 3ZJYA 1L7VC 2ERXA 4A0RA 1MRNA 4X8MA 4BRWA 2IYTA 4Q9KA 1J2JA 4TLEA 2JASA 2OUKA 3ZH9B 2WTUA 1TEXA 2ZRIA 2V7QD 3KUCA 4JS0A 4R7ZA 2ZRBA 1U9IA 4ZDIA 3CIOA 3TNFA 3QKSB 3C5HA 4LX0A
chains in the Genus database with same CATH superfamily
3QEAZ 4M88A 3KWJA 4MROA 3PNKA 2Z2XA 3CCFA 1LDEA 2EYQA 4R9UC 1G9SA 1PL6A 2ZB4A 5AW3A 1E2PA 4M9ZA 3GJTA 5LA6A 3D2AA 4ALNA 3AIKA 1U0NA 1TW3A 3N2YA 1U94A 3DM5A 1YMUA 1VIVA 2ZTLA 1AE1A 5AKGA 3TLJA 1TK2A 1RPTA 3FAZA 2IYOA 2H9AA 2FMXA 1KJQA 1KORA 1TJNA 2NUPB 1L5WA 1CY4A 3UV3A 5A4IS 4G09A 4FDLA 4LYJA 3NWBA 1JSLA 2RCNA 1W46A 2GVNA 4J91A 4UTOA 4DMLA 1NVWQ 1DHRA 4JUCA 3RSOA 5BMOA 4AROA 3PJDA 5IU6A 1YKGA 1DWPA 1QNLA 4KYVA 1Z0AA 4C7JA 2QJOA 1M3SA 2E9SA 3I4LA 2F67A 3M6UA 3ILYA 3DWGA 4UHCA 2OCBA 5JWHA 5AVUA 1JHVA 3G3EA 1T9CA 4O6VA 4PYOA 5HE9A 5AW5A 3TQRA 4DA8A 5CA1B 3M3DA 4KTVE 2C7OA 3DNMA 2IXBA 3F5MA 1I2ZA 3PVCA 3OPYI 1IULA 1H5NA 4PGGA 4QYWA 1KJZA 1HYHA 1W48A 1YB6A 1YAJA 4IGAA 3NJ8A 3B3GA 1TUBA 1UJ5A 2IWRA 2DVMA 3FDXA 2BHSA 3PTAA 4TM7A 2VBIA 3E2MA 3PGJA 4ML3A 3DFZA 3IBGA 4MRSA 3HWRA 1OBHA 1DMRA 2G9QA 4PM4A 3HI4A 1M1UA 1QE0A 4EYQA 4Z4GA 4RY2A 1Q6YA 4KMSA 4M9CA 1QFJA 4R68A 1PJZA 4EUSA 2GWRA 4B31A 2EKZA 1Z62A 2WVHA 4M83A 1YE8A 2OCDA 5IAKA 5G3ZA 3HTXA 5YASA 1KQNA 2ISCA 4NZ9A 1JB9A 3HBLA 4IJUA 3EDMA 4R8MA 3WGHA 1HLPA 2H7VA 1C9KA 3PDCA 1GR0A 1RIIA 4D0LB 3NBAA 3ICQB 2Z2IA 5JCXA 2P62A 4DM4A 2EG5A 2PIAA 3VC1A 4PPFA 2MTBA 5H0IA 1EP1B 4DDTA 4V02A 1H2AS 1EWQA 1JIVA 1DBQA 1QCDA 3HKBB 4XPIA 4RGQA 1EUQA 3ZHOA 2IYRA 1G8SA 3TD2A 3G1UA 3L8HA 3W04A 1KH2A 1EFVA 5E3HA 5GZ1A 3KZMA 1RQ2A 3LZCA 2EBWA 1B4DA 2ZTUA 5KWEA 3LE8A 3JQBC 1F5NA 2HX1A 5CIQA 4FFSA 3FYDA 1EBFA 2I54A 1UZAA 3LBNA 5ERYA 2ORWA 1QP8A 3ZLTA 1BFUA 5I8PA 1NLZA 4S2EA 3BSFA 3RC7A 4D44A 2XITA 2DKOA 1XK7A 2EKPA 2LNDA 3Q3VA 2I7DA 2NZUG 3QKWA 3UJ6A 2BGUA 1ONNA 3GFFA 2VDWB 1V11A 4NV1A 1HFKA 2XUZA 3AKCA 4H6PA 1U9ZA 3IURA 1K8QA 4WCDA 1H3NA 5EKSA 1XPJA 2ZPTX 1DDGA 3B6EA 4MSUA 4CT0A 4DDWA 2ZDQA 1FP6A 2HEGA 2PJDA 3HY6A 4H3HB 3V2UA 4WJLA 3S3TA 4QOGA 2LV8A 1UQRA 1QOQB 4CV2A 2JFBA 2QORA 3ZQJA 1NYLA 2ZIFA 3E9QA 4FIDA 5FWXB 3IBSA 2OYCA 2YXNA 4DMCA 1O95D 3TJZA 3EIXA 1AURA 4X6YA 2C04A 1KZYC 3RVKA 1GZSA 3KTFA 5DM0A 3F6CA 1FXSA 1I1OA 1XMPA 1E58A 4NV0A 4QFCA 5I47A 2IYNA 3CF6R 5IG2A 3QFTA 5HKKA 2N3ZA 1T3GA 5G0UA 4ZVPA 2B61A 2DKFA 3L7OA 3RNLA 4A2QA 5BUZA 5ICCA 1HDXA 1NR1A 2GDJA 1RXEA 1NFRA 4YWHA 2PMWB 4QBFA 1KMQA 1AGPA 4ZQIA 5GJCA 4TWRA 1YWGO 2QG4A 1DKPA 4ZGWA 2XDYA 4JBLA 3FCXA 1E6EA 1W5BA 1U28C 2BFEA 1ND6A 2VJDA 4AD8A 5B6JA 3RVOA 2ILVA 4U7FA 1WVMA 3PT9A 3SD7A 2DUWA 2VI5A 3J7AC 1JEYA 4KQHA 1UKAA 3T1VA 4K7JA 1EFDN 2E89A 4ED9A 3OUZA 2ZUFA 2FR8A 1WMSA 3HE3A 5LYJA 1KSGA 1JR4A 3STWA 1KFEB 1X7HA 4NCJA 4I36A 3MJEA 4V3BA 3WHPA 1QAQA 1R4AA 3DLCA 1TAGA 3PFCA 3QBEA 3T5PA 4LF4B 1VLZA 2OQ2A 3AW8A 3QXGA 3VHXB 1X1BA 2W6ZA 2XGSA 4EFMA 4X61A 4JHXA 2ZVDA 3MCAA 3QYAA 3R3VA 3LWZA 4LVUA 2HBRA 1D4ZA 1SXJC 2FEMA 4NL4H 4AJKA 1VDMA 3ZHCA 2B34A 5E7IA 4Q4JA 4JT8A 1E1CB 2XXJA 5I9SA 3GDGA 1C9MA 5JD6A 1S6YA 3LL7A 2VUTA 4QTZA 1IY1A 3IAXA 2XMSA 4HWPA 3AEUA 1ST3A 3NW9A 2IH5A 4DPLA 5IDVA 2DEUA 1AN0A 1W5TA 2HLPA 4U7WA 3WGOA 1PG5A 1WXEA 3FTFA 3W2EA 3LUFA 2AG0A 3P9IA 1YB2A 2DFKB 4WXRA 3WL8A 2ZT6A 4UM8B 2D7JA 1BHQ1 4Q4AB 3QUTA 3VH2A 1T1JA 2AOXA 2HU7A 4QU0A 2BOVA 3G2JA 4HFMA 3RIGA 5F2NA 4G5RA 2GR9A 4JSYA 1L4HA 4B85A 4EW3A 3ER9A 2CXTA 4FEYA 2X19A 1N32B 2VAWA 1KAGA 1ZD5A 3L4BC 3ROKA 3K8QA 1GHTA 2Q3BA 3K1AB 3QYFA 4N54A 4PAQA 4CM8A 2WP8J 4EY4A 1SHKA 2I3DA 4WINA 1OB2A 3A7DA 1R6XA 2QSUA 3HRIA 4BMYA 1E7SA 4QJ5A 1IJEA 3QVUA 1G9TA 4GECA 3N76A 1P2FA 1AQLA 4PBTA 3H99A 3TZKA 5HDQA 2XDQA 2IYLD 3HY4A 3MJ4A 5HM6A 1YNSA 2D13A 4MR9A 3Q9SA 3EVZA 2ZYGA 3ACDA 4GF5A 3V3TA 4POAA 4FZ5A 1KEEB 2NP6A 1E9VA 2O6HA 3ZVNA 4QOHA 4M9RA 3NP9A 2YJ3A 1OGIA 1XD2A 5JSKA 1TQ2A 2MDTA 2C4VA 4QHTA 2INGX 2FEWB 2QN2A 4DA9A 3AFHA 3KDAA 1T5SA 1F8GA 5IKPA 2NZJA 3BTSA 4DRXB 2QE7A 3IV9A 1X7ZA 2Z83A 3O6VA 4M98A 5SZJA 2WTXA 1QTQA 2O5VA 3NX4A 3S5JA 3EUAA 3E23A 4E5NA 3S2EA 3UWOA 4R2IA 4BATA 4NCNA 4PC6A 5BUQA 1P4RA 1V95A 3BL5A 1KAQA 1WB6A 3JQFA 3KOMA 4P6VF 3I6MA 4V0SA 3OIUA 4D3FA 2GBCA 2ODBA 4FKBA 4MMZB 4I9NA 3C15C 5P8WA 3TECE 4Z4QA 1IBLB 4K03A 3DEIA 3B82A 1OUMA 4FGWA 1G8JA 3RS5A 3DF7A 1IVYA 1TZJA 1FDTA 1XDUA 4L16A 4TMFA 5TNXA 4D81A 1MEJA 1TRKA 1ZNQO 5ALVA 4MUEA 4DAOA 2Q29A 1QE3A 4TRRA 1U2DC 2AT1A 3AFOA 2J9YB 3OCJA 2R6R1 3K1JA 2MCFA 1E9CA 4HAVA 2ZJ7A 1M2OB 2YZMA 4LQLA 2IKSA 2Q2QA 4QT4A 1ZKMA 4G01B 4YT5A 5J3JA 5C53B 1P2VA 1YZFA 5K3FA 2IIVA 1P1IA 3U80A 3G9ZA 1USIA 3FHCB 1E9BA 4OQFA 1TQ8A 4XPZA 4CV1A 3NUQA 1Z2AA 1JT2A 4C4YA 5HJ2A 1RVV1 2I6UA 4JI2B 5K3BA 1UKZA 4PPYA 4UCFA 3LBHA 3EDOA 3GDWA 3ZD8A 4KACA 5CFZA 4PWYA 2G9NA 4Q93A 4GLBA 4INJA 2HWUA 3F3SA 1MO6A 3OX3A 4NESA 3W1VA 3PICA 3VZPA 5J63A 2PUHA 4ZK2A 3BEDA 2PVPA 3M2TA 1RVDA 3QU4A 5EQDA 3OIWA 3SQMA 4H3VA 1AF7A 1XNQB 1VYTA 4GAEA 4KNVA 4AJEA 4DF3A 1IIRA 3OKAA 5JAHA 2AC7A 3OD1A 3GGPA 4EO4A 1H65A 3HYNA 2VUIB 3UATA 4D02A 4P93A 1WWKA 5KIAA 4P0TA 1LQUA 4EWLA 5F3DA 2R751 2XQIA 3CNLA 3PFFA 4GXRA 4QT0A 3VDQA 3ZWOA 4DCVA 5A1TA 4JV5B 3NANA 4RZHA 5TX7A 5JNLA 1WR8A 4IAOA 3MTEA 4P3PA 3F7OA 3T7KA 4O4LF 2JLSA 3S4YA 2PYIA 3HB0A 2DUNA 3TOXA 4FN4A 2JD1A 3A26A 1QPZA 5JS1A 1DL5A 3R0XA 3N07A 3PHCA 4WFIA 3RR2A 5J5CA 3HYRA 3GAFA 4M54A 4BWGA 3KE9A 3ZTYA 2QW0X 1Q92A 1RQPA 1AN9A 1YD7A 4W5WA 4X8HA 5CJJA 3WYCA 4EI9A 4L4RA 4UUOA 4OX9B 3TXAA 4MS3A 4WK0B 4AS2A 1S2NA 2BZGA 2OM6A 5E38A 4D46A 1ORRA 2VJBA 2YDYA 4PFJA 5JQGB 2ZFUA 2WPDD 4F8JA 4MTLA 5JQGF 1KZ4A 2HJVA 2PXHA 2JHGA 1AK9A 1PGOA 4FE3A 2WA1A 1GRRA 1K89A 3KKZA 4J03A 3MPOA 3UJDA 3WNQA 1LK5A 4O33A 1Z0DA 1YC5A 5CT5A 2ZJAA 4CGZA 2CDRA 2HF7A 1DNPA 2A57A 3GC6A 3GOQA 3QWAA 4QPNA 4PSKA 3KQMA 2BR5A 4FOTA 3TINA 5F5LA 4MVJG 3IYLW 2A9OA 5FA5A 3OHMA 4F60A 5ADHA 2CT8A 3C3JA 4TMKA 1SBCA 2C42A 1K6MA 2VRCD 1QK5A 3D43A 2LPMA 4QWMA 1E1RD 1JR3D 4PS0A 1ENOA 1R0SA 3AESB 4X94A 3NP7A 3URKA 4XEHA 1DLIA 3RSHA 4YECA 4O08A 4PLVA 4CFZA 4Q1VA 2H57A 3MYRA 3DE5X 2GXUA 3GAAA 1LNSA 3TSOA 1TQHA 4PZLA 5FWDA 2LIPA 3U5TA 5JW6A 2PMEA 1LKZA 1VCIA 1GIAA 1LFDB 4QWWA 5HBRA 1U8YA 1XWFA 2OGWA 5D3MB 3PC4A 1VXOA 5HIIA 1RKQA 1OX5A 5JPIA 1N6OA 3ZWCA 3FHTA 1J9ZA 1IN4A 1H8HA 4H0NA 5ALSA 2BEKA 3DO5A 3G9UA 3DMYA 1NVMB 1IY8A 1H2BA 1UZUA 4PYLA 4ZV4A 2CL0X 3RYFA 1IBMB 1PKXA 2ASVA 3ECCA 4AJOA 3R7SA 3RK4A 3C14C 4OL9A 4P34A 4AW9A 4ISCA 1N2GA 4JP5A 5AYVA 4PLWA 1JAXA 2A1IA 2BP7B 2VK8A 2PUCA 4QPZA 2AFIA 3RAEC 5BNZA 3WNDA 4AX4A 1QCYA 2SNIE 2VNSA 2J6IA 4J49A 2XDAA 4NEHB 5BRAA 5L4SA 4YJ2A 2VAMA 3BTUA 4OX9Y 4ECEA 2C0CA 4M0KA 1P1BA 1YZ3A 4EDHA 1Q95A 1ISSA 1ISFA 1P31A 5EG5A 3GLGE 4BX3A 2IV7A 3KEMA 3DE3X 1VCMA 4MULA 2BLNA 3FSGA 3CH7A 4Y0AA 1J21A 3O9VA 4N0QA 1HORA 1RJFA 4BAGA 2I91A 2B8NA 1Z56C 2C03A 1XSEA 2ZYUX 4N03A 1D2AA 4TKVB 1OWLA 1A69A 2F7SA 1TL7C 4FC6A 3Q7SA 3VPAA 1KAMA 1CHNA 3D5QA 4JIGA 2NV6A 2LBPA 2DBRA 1JG2A 3N8GA 1I4WA 1XTKA 4DT1B 4BQNA 1MXFA 1VL2A 1ZIDA 4ABYA 4D3XA 2XB9A 4GT1A 2V6IA 5GTDA 3PNMA 4HGRA 4HN2A 2DC1A 4OBXA 5IMBA 1WXIA 1U2RA 1Y80A 1WXHA 3GMDA 1F9AA 2HGZA 3JRNA 1JDBB 4H4EA 2ID7A 2P5UA 4XUDA 1N4DA 1X15A 1XPOA 3OTOB 2V1UA 3OTIA 4ZT6A 3UPTA 1OWNA 4XM1A 4GKKB 2HDWA 4RJIA 3GFBA 1ZR2A 4G0UA 1GA1A 5J9FA 1R6UA 5T6MA 1GFIA 4WE3A 4QVKA 3QEBZ 2RH4A 5F73A 3S2ZA 1AM4D 3RGGA 3K9BA 3WE7A 4EGSA 4YV0A 1NAHA 1N1DA 2JIPA 4LXQA 1QUEA 2PBFA 2H4JA 3PL1A 1EXMA 5F21A 4DCOA 2X86A 5SICE 2W6PA 4H17A 3SE7A 4CLRB 1LH0A 2JBAB 1T1EA 4RDHA 4NTZA 4OH1A 4URVR 3MQFA 3ZGYA 3F6SA 4QHYA 4TWZA 4D45A 4YJFA 3AH8A 4DFDA 3IUPA 1ZUIA 4PR0A 3IAM1 3MUOA 1RZUA 4DJTA 1RW4A 2ZPAA 2EL7A 2F6RA 2I4RA 3JALA 4TUYB 2FAXA 4L28A 1Y6RA 3K0CA 4Q9LA 1DKRA 4OQYA 1X8XA 4M1TA 3WGVA 1VGQA 3DHWC 5HG0A 3VO8A 2A1UA 1SCUB 3GNLA 5MGBA 1PWZA 1IRIA 1W85A 2XOKA 3TPCA 4AZSA 3F5DA 2QX7A 6CHYA 1KDTA 4EFDA 3LG2A 1Y1LA 2I87A 1SBZA 1Z33A 2ZGVA 3CZQA 1NRXA 1W5FA 4AO6A 4EK9A 3BSYA 4C5BA 1GGJA 2WM2A 1GPDG 3ELBA 4XB2A 1NN3A 1JR2A 2ST1A 1QUFA 3A3NA 3IOYA 4QAQA 1KBOA 1QIDA 4AY2A 3GUUA 3K96A 1KO8A 2GJSA 2HHLA 4UBLA 3PE6A 2Q4BA 3QVXA 1YCGA 2P2GA 2QYOA 3CM0A 1U9YA 3GBPA 4FFBA 4NECA 4KMRA 3A3KA 5EE1A 2Q9UA 2CK3D 4D8YA 1Y1KE 3N7TA 4R81A 5KU1A 4KR2A 1FVXA 3BK7A 4IIFA 4JEMA 1B0UA 4ALJA 5AJXA 2DR3A 2PZBA 2VF5X 1JT9A 3V7WA 3R7WB 2JD0A 3P1JA 2BE9A 5HE8A 2HC9A 3GP5A 4GWGA 5TGDA 1OBCA 4HG2A 1AUPA 1GGNA 1TE2A 4UMVA 4AT1A 1YFJA 3QOWA 3N7AA 4URHA 2C5GA 2EJCA 1CIVA 2PWYA 4WOJA 4E31A 3PPWA 5IULC 1S2MA 2R6FA 4YTEA 1PJCA 1PR9A 2IDMA 3M4YA 1AXEA 5FORA 2BKEA 3BB4A 1PKEA 1AXRA 1A7AA 3LUDA 4JJZA 4LE1A 4WZAE 2QVGA 4C5AA 1U1EA 2ZB3A 3LDFA 1XRMA 3HKDA 3RK1A 5IF9A 1T34A 3PHBE 1MO2A 2A33A 5C3MA 3KJHA 1T5OA 2LCIA 3SHFA 3TZBA 3A2KA 4Q6BA 1LPSA 3DBLB 4CMAA 4DABA 1TQ6A 3MTAA 4NX2A 3X2FA 2V03A 4R41A 1B41A 2PKCA 3LVRE 3KSMA 1NYQA 3BXGA 1XEWX 2NO9A 5JFGA 1NC1A 1LC0A 1SAYA 1V0JA 4UQPA 4ARCA 3OF5A 2HDOA 3WKBA 2PQMA 5FV7A 3EF0A 4ETWA 4BEVA 1MC4A 3EXHB 3AVQA 4DYVA 2UAGA 1G21E 3P45A 2G09A 5GJVC 3TXXA 1NNLA 2DFTA 5DULA 1P1KA 1P5JA 2PQ2A 4OHUA 3H2YA 3ZW8A 5HUHA 3TZHA 5A5GA 4JOCA 4LC9A 1UDCA 3WFIA 2V7EA 2IEDA 1PFKA 3FWZA 3KQOA 4BVLA 1YZQA 2PLNA 4OBEA 4IWXA 2X40A 8ADHA 3GGSA 1NG1A 1CV2A 2CKDA 1Q1GA 4ND6A 1YE5A 3WXMA 2C82A 4GC9A 5ELXA 5FYQA 2DE0X 3VR1A 4UNQA 5KNBH 2Q3HA 4GO1A 4CUJA 2YL2A 1XZDA 3LP8A 2FZGA 2FF5A 3V7FA 4M8NE 4G0WA 2O8EA 3IIMA 3K70D 2AN3A 3MCTA 4GR5A 5FR2A 3X1KA 3TL2A 2VJOA 4Z0PA 4R05A 2P3OA 4OMDA 1GNQA 3KETA 2W90A 5EOVA 1SCBA 1Y9JA 1X3LA 2F9MA 3CFYA 1QKKA 2ZTVA 3KV3O 4IOLA 4J16C 5EVJA 4I9HA 5FF9A 3L0PA 3H0CA 1FMLA 4I4TB 5CX4A 3DCIA 2VHJA 3QVOA 3HK2A 2F90A 4OAQA 3HDQA 3A2LA 3DOJA 4ESVA 3D4LA 3C6QA 4AS3A 1WOYA 3WA6A 5IWAB 1CQJB 4ZT7A 4WQMA 1JB1A 2QTLA 2PUDA 4EKNB 1E63A 3L92A 3WHKA 2DM6A 2HQOA 4YMIA 3LSTA 3UIEA 1KYZA 1QR2A 3DDWA 4IJ5A 1NM5A 1NSTA 3KYJB 4WESB 3IJ5A 4A5OA 5JAMA 1NVBA 621PA 3L0DA 3U26A 1F2VA 4UUNA 3ZK7A 3N58A 2NADA 4JLDA 1MA0A 1G5TA 4DUGA 1JQJC 2KI5A 2CXQA 3CIFA 3CRMA 4N49A 2V5VA 1NVVR 1REQA 3KOWA 4EAAA 3GWGA 1AV7A 4YCMA 2UYCA 3LCJA 4H7PA 3K0BA 2QLMA 4Q4LA 4XUCA 5ADUS 1NBOA 3AUUA 3ZZMA 3LSYA 1JKIA 2A3RA 4G1BA 5HFNA 1L3BA 1Y5MA 5L7WA 2YVQA 3KOZA 1D2CA 2ZSUA 1F5SA 2ZDHA 3USCS 4DA6A 3GLRA 1CY7A 3BK1A 2HZBA 4FEAA 4RCYA 1QH1A 4LBWA 1RLTA 5FI0B 4B4VA 5HRCA 1J8QA 1D2HA 1W1IA 2XUHA 2XYVA 3RC3A 2I7XA 1G0OA 4EJ0A 5CCDA 1FY2A 1V6SA 1L1RA 1INLA 1QO0D 10MHA 3M2PA 1PQ4A 3RKRA 1Z4PX 3WQSB 4D9IA 1RTKA 1U9IC 2K6GA 1PNQA 1FXWA 1NKVA 3THXB 1ZH4A 2DFVA 5EWJA 3ZE6A 1NRJB 3BXOA 1UWLA 4R3NA 1DIHA 1MH9A 3QG1A 4AN1A 4HADA 2B4YA 1JIQA 2AFHB 3A4LA 3GT7A 4B3XA 2QX4A 4MUFA 2Z8YM 1J97A 3QPBA 3W6NA 1A71A 1SU6A 2H1VA 1G1MA 4HQRA 2AOTB 3SZRA 5LOVB 2CMKA 4Q03A 1YJBA 3DV2A 5DN9A 3EXFA 1FNCA 3OQMA 4OXIA 5A5DA 2HMTA 3HU1A 4P4NA 3GUHA 4I9UA 3FYCA 4MIYA 3ZK9A 1U8EA 3DP7A 2BSXA 1YS7A 1Z0FA 2QRVA 1BW9B 3DV0A 3GLSA 1A4RA 3QVKA 4BNYA 1D5WA 1U2ZA 3VQTA 3ZWYA 2UUCB 1NZDA 3UK1A 2FUG6 4R2KA 4US1R 5AK6A 2OE2A 2O2IA 3AKDA 3ZHYA 5CB8A 5G0SA 2QNIA 4FQ5A 1OZAA 4TYYA 1JYFA 5TRTA 3SVLA 1Y8ZA 4E70A 3C1AA 3T7AA 2C8KA 1T15A 4NMMA 1L7AA 4BN5A 1H42A 2E1RA 1U0EA 2QVBA 2WJHA 5CNMA 1AUXA 1YZTA 4BMOB 1ZAKA 2FGKA 4JJGA 1NUSA 1TVKB 4EA9A 3UHAA 3OH8A 1O5TA 2JK1A 1JKXA 2PKWA 3UN1A 2DGDA 3G9TA 4F85A 2XRFA 2O8FA 4QU8A 3LBYA 1YRQA 2G0NA 1Z18A 2AEJA 2OVBA 2EJBA 2VSNA 4J16A 4KPUA 3R75A 1EVLA 1KSFX 2P9TA 4BEWA 3MT8A 5L95A 4OQNA 1DQPA 4CF3A 1ZI9A 2R6ZA 2Y68A 2A6PA 2ZOSA 3NHAA 2JK0A 4ZQCB 1LZKA 1X7XA 3GHYA 1L5ZA 3ZCUA 1TZBA 4D5GA 1AMUA 5AI6A 2DU8A 4UU8A 4C2TA 2J8ZA 2F3TA 3UQZA 2IH2A 1DVRA 1MJGM 2GF0A 1BGXT 1C5KA 1OC4A 4RL4A 3T1QA 4CTMA 2H31A 5JANA 4NFYA 1QFZA 1SXHA 3V8MA 2XHZA 2WR8A 1VPDA 3RT1A 4MO2A 1UQTA 2AMJA 2XGMA 2HADA 3JYPA 1U3TA 1Q5PA 3O47A 2I7CA 2OXFA 2X2EA 2Z6VA 1MVLA 1KPIA 1E66A 3DHYA 2JPDA 3VSCA 3PNLA 4OSPA 5B2EA 2FUG1 1QIEA 4FHFA 1KEKA 4L7QA 1ZUWA 2AR7A 1G4AE 2Q9BA 4I19A 1U8CB 4MPDA 2QUAA 4BVJA 5IRCD 4RTKA 4YREA 1D0SA 2CUKA 1SG9A 2AOUA 2ZR9A 1C0IA 3TBHA 4CM4B 4Q21A 2BFPA 1QIFA 1CZOA 3VYWA 1UP4A 3WNCA 3AONB 4HDKA 3THXA 4EL5A 4Q00A 2MSWA 4QJIA 4ZVNA 3QVVA 5CLLA 3AVXA 2WB4A 3DZCA 4TMVA 5J40A 4QXPA 1DU4A 3A9WA 4G67A 1B43A 1X86B 4BWVA 5LJLA 2WMOB 2I6XA 2G6TA 3LYUA 4RD0A 2RHLA 1PFQA 5C3UA 3NDBB 1FSZA 1MBZA 2IYPA 4Z7JA 5L40A 3LW7A 3DKKA 3CZCA 3JCZA 3CU5A 1XZNA 1IJBA 4B44A 3WYAA 4AURA 3UTCA 3I4FA 3DULA 2R8PA 3ET5A 3GRYA 2Q0QA 3D1VA 1J6UA 5E9JA 2Z08A 4BNFA 3C6YA 1E1NA 1E1DA 5HIKA 1BH2A 4PS1A 1VTKA 4TXJA 2N1MA 5J43A 2VJNA 3NHSA 3X43A 5DGIA 4IDCA 3WI7A 1RQ7A 1H6AA 4GIBA 1NVGA 2VKTA 4MWZA 1LJUA 1VKJA 4GGMX 5EGSA 1Z6ZA 2H4XA 3DL0A 3RLFA 4EG7A 5FNZA 2AZTA 3ISTA 1E5TA 4DEYA 5C4IA 1IWOA 1IN8A 3ECAA 3ROEA 5BVHB 4X1IB 2V65A 3QLJA 1UDRA 3RJZA 1L5KA 1D07A 3UXYA 4D3DA 4OHOA 1M2GA 5EHQA 4AY4A 3PZRA 1MQ9A 1XZPA 1U1FA 4DCTA 3AVUA 4PZ9A 5AXDA 1NVFA 3QEJA 3HB5X 1MJGA 4NC9A 2G1UA 2GCOA 1RXYA 1SGWA 1U0HC 3AEZA 3KR0A 4B6OA 3S5UA 2VSQA 5BSVA 3FOZA 1TZMA 3HO6A 1ETHA 3C7DB 4QVIA 3M82A 4LF5B 1BE0A 4UPVA 1RKVA 2TECE 4K9DA 1FDIA 4TS9A 3NRBA 5L3VA 1KI2A 3DVAB 3QBTA 1FL9A 1YVPA 3ETJA 4H77A 3IMFA 4E30A 3D7KA 3OQIB 4LTMA 4DV2B 2AN4A 3QBVA 4DJJA 3ASYA 2ZRDA 4BCCA 4M99A 3GCZA 1WBJB 4P4UA 1URPA 5CU7A 5IF3A 2JBWA 5JSUA 3EC1A 3UT6A 3KLBA 1JLHA 3CXUA 4KLZA 2H07A 2D0PB 5AUPB 2I1VB 1CW2B 3BRCA 2JAWA 3OEHA 4ARBA 3QQPA 1MHTA 3F6PA 1MOPA 1R7RA 4G9EA 4NYJR 5F1KA 4DZZA 2V74B 2VDVE 2PUJA 4ACAA 1T5IA 2DLDA 2UVDA 4YS6A 1U4SA 3MPUA 4GKAA 3E7WA 4ZVTA 2EX1A 4BO0A 1WQ3A 2IYQA 2Z3WA 3W1WA 1GG8A 5H16A 3HKBA 3GJYA 4EARA 1ZMXA 1DUIA 1ZWLA 1MD9A 1U3GA 1U6IA 2FSVA 3DEJA 4JDUA 5DB4A 5EUQB 1N3BA 1X9IA 1XZJA 3U9LA 9GPBA 3OT4A 2PRYA 5LBIA 5B64A 4K46A 2QZJA 2RHTA 3HZRA 1T1GA 4LJKA 4DIBA 2JI6A 1SIUA 2EV9A 2NVOA 5TQVA 3JVDA 2JGRA 5IJWA 5TPWA 4NXMB 2XUDA 5CVUA 3OP1A 4YRPA 4O4IF 3QUSA 1QYVA 1R3UA 3ZHRA 4RFSB 5TXGA 1PLLA 2Q50A 5AVKA 3WGTA 4MR8B 1A9SA 2PXXA 4MAFA 4TGLA 1HG0A 3F5QA 4RPLA 3L4JA 7GPBA 1E9RA 4LYAA 1N8SA 1QANA 1TYBE 2OB2A 1BHJA 5IKXA 1FCJA 1N5JA 1E5XA 3IT0A 4IY1A 2GN0A 2WU1A 1T4GA 2M1XA 3H86A 3O2SB 2FVYA 4WESA 5DMHA 1L9XA 4IRUB 5A06A 2W6JD 1RZ3A 5DASA 1Y9ZA 1JBKA 2FVXA 1VBKA 2FEOA 4JLWA 2I4NA 3IX7A 3T41A 1XF1A 3NC4A 2FR8C 3PDIA 3T5TA 2IYVA 3PDJA 5CFMA 1ZU5A 1V71A 1GO2A 3G2QA 1NA5A 1XO1A 1UAGA 2AXEA 1CJMA 3FCUB 5F5NA 3SQDA 2IBSA 1X8LA 2FB9A 3V8EA 4F2HA 2VPQA 4X65B 3KD3A 1VG8A 5CA1A 3QSGA 4FJ1A 2DUJA 3A6HA 3PFKA 3WGQA 3LK6A 3FFWA 3TVDA 2OQRA 2BMAA 2QJRA 4AULA 4O8ZA 4PICA 5DTMA 5JJIA 1WCV1 3KEQA 5EIBD 4GMXA 1EFPB 3MWDA 2R4TA 1U3DA 4KUHA 4PYIA 3V8RA 4JI8B 1T6NA 1CZRA 4Y2GA 3REFA 4N0MA 4CLEA 4DDHA 4D9JA 4DLZA 4GM1A 4X92A 1JHDA 1FFSA 1DFGA 1QYCA 4L22A 2P2CA 2WC1A 4NCHA 1W9HA 5A9RA 3LP5A 3ND6A 3VU0A 2G7MC 1OLSA 1P6QA 1W2HA 2GRAA 3H5IA 3WIDA 5HOEA 2PMCA 1K3FA 3O1HB 4MIKA 3SR3A 3G79A 5CHEA 3GLQA 4BP1A 2BGRA 4QFBA 4TL8A 3VZCA 1ZZGA 3C8DA 2PNFA 3PNBA 1JFRA 1G2QA 1DRJA 5A3QA 4MV4A 2ZAIA 5C81A 3VSBA 1RDFA 1SBQA 2NPOA 2ACEA 1ILEA 2ANCA 2IYZA 4KDFA 1QWSA 1GOTA 2C88A 3KR9A 3TX2A 3UGKA 4DB4A 5JAZA 1YCHA 2EJUA 1FLDA 1HT2E 3E3MA 4DV1B 2OV4A 3Q2IA 1OI2A 4PXSA 4I50F 1MG5A 2OA0A 1ZWKA 1P6XA 2UZ1A 4PLPA 4JHLA 2AVNA 3W5JA 2EZUA 1M6VB 1EE2A 3FUVA 5T3UA 4EYKA 3K30A 3JR3A 1WKCA 1S3SA 1SXGA 1EQ2A 2ZJ4A 3H8SA 1W8DA 4KXYA 3CYFA 3KOUA 5JAOA 2DQSA 3OMLA 3OO1A 4RXMA 1T2AA 4LWQA 4Q9IA 4TMTA 4X1KA 1W36D 4YAGA 2V7GA 4I9FA 1JLLA 3E18A 4EI2A 3A4VA 2BEWA 5BNWA 2FQWA 3L8GA 5G0VA 1LLQA 1MRSA 1Y9AA 3UJ9A 1T13A 4LGYA 1F0KA 3MJHA 3P2IA 2X4GA 4MUXA 3UK2A 5JDCA 2GAAA 1WHTB 1Z83A 1ABFA 5FTLA 3PQ8A 5JVDF 1QDUA 4ARVA 3GMSA 4GMHA 2WI8A 2GCPA 3BD7A 4GZ3A 1DJPA 4MVWA 3O2QB 3SLKA 4AMZA 1Z75A 3RYCA 4BE7B 2JLCA 2OZVA 4ZVRA 4A6DA 2P67A 5LZ5A 4BVFA 1LCIA 2YMPA 2XCQA 2BELA 3JYOA 1VHWA 1TZKA 2YY5A 1T5LA 2FR0A 1DC8A 3CE9A 4XIYA 1RBQA 4MV5A 3Q87B 1I4OA 2WTBA 3VOAA 1CUYA 2R5NA 4DA7A 3AY7A 2YHIA 3DBVO 2C83A 1VPLA 5EI5A 4DV5B 3M7IA 2HCFA 2QJWA 4QDUA 3SSNA 1O9BA 1S02A 3ML1A 3OPMA 2DPHA 3JD3A 1BKDR 2BR3A 5JZVA 1DC3A 2OP1A 4CCSA 2A0YA 1IB6A 4NJEB 1SB8A 4N8DA 4MV7A 3RFVA 4P3KA 1QZ3A 1AQYA 4G4IA 5HK8A 5C5IA 5IFKA 1NLYA 2J67A 3GJQA 1W0JA 3I32A 1FLAA 2GN4A 4U39A 3TEFA 4WCFC 4UOZA 4K6GA 1BXRA 3NEYA 3EPLA 5DBIA 2BEWB 4IFIA 4LHZA 4XE5A 1CZNA 5B30A 4DV0B 3GRAA 3LUGA 4BDTA 3EVNA 3JD0A 2QTZA 3S40A 3ZKAA 4CQJA 2VQFB 1C7FA 1PGPA 3D3JA 5DOZA 2PRIA 1GKLA 2WT4A 2OBBA 1YCDA 4RVCA 2WAYA 4N0EA 4GM0A 2AQKA 3MQ2A 1K66A 3QWHA 1UOQA 2FP4B 4U7TB 4E07A 1OTXA 1ZD2P 1SXQA 1SU8A 1HNXB 3TMKA 2PMKA 2H65A 1FIUA 3TE6A 1G38A 1CKEA 4WZZA 4EBFA 1N3LA 4QGBA 1UADA 2B7BA 3JQFC 4AKEA 4ZVQA 3WGLA 4B75A 3OPNA 4M0FA 3WLIA 3MOGA 3WB9A 2W48A 1QP0A 1RRFA 4ZOAA 5TJHA 2VNKA 4AP9A 2IDJA 2OHOA 4PO8A 3U6BA 4GBJA 4JC5A 5DBHX 2CDAA 4J0GA 4QREA 3CONA 4F96A 4QNMA 4A0HA 1CQIB 3T4XA 4FCVA 2WWYA 1V1RB 5B36A 3DE7X 1ADJA 3RJTA 4KXFB 1GUBA 2HD4A 3EQZA 1JMVA 5E7MA 3NBFA 5CDTA 4M7PA 1P4GA 1VHJA 5I3CA 4JIMA 5JLAA 4O3MA 2V4UA 1EVKA 4GZ5A 4QXMA 4ZIRA 3FNRA 4DIDA 1XN1A 1FRQA 2SHKA 4TWJA 5AHXA 3WYFA 5JFTA 1HE2A 3VZRA 5CXUA 3R41A 3FPLA 5HKKD 3HDGA 1M73E 1RXSA 4DXDA 1NXQA 1NWCA 1H9AA 2ZWAA 1M2KA 1JF8A 5DFAA 1A8QA 3VFDA 4QL3A 4TKUB 1SCKA 4WJKB 4U02A 3W3AH 2JIDA 4RGBA 2RG1A 5D8DA 4IW3B 2GFHA 3DVLA 1TEZA 2IS6A 4D98A 4JP1A 1AKRA 4EYGA 3CMMA 5IZCC 1SXPA 3K09C 3PDIB 4NY1A 2C2BA 5J2UA 2OVFA 4P2BA 2FXVA 1KVSA 1SQ5A 3BERA 2BV3A 3K6RA 3RYHA 3KQTA 4L7VA 4LOIA 2CVHA 3F1LA 3QU2A 5LQNA 2WF7A 3FB1A 1K27A 5EJ7A 4NFHA 4BVEA 4Q7EA 3GAMA 2C5HA 3V42A 5BN3B 1Q84A 4RIFA 4ND5A 2BFAA 2GHTA 5CHYA 2HH9A 1KDPA 2XHEA 3WBBA 1MABA 3QPWA 5A71A 4W9MC 1FDVA 4FKZA 2XVMA 3SHQA 2XTJA 5DVZA 4KOAA 3KFVA 1F3LA 1OWPA 3NRCA 4E33A 3BA1A 1IVSA 1EM6A 4JXXA 3ENNA 2XI4A 1QS0A 2HSWA 3ZU2A 3GEHA 3WIVA 1EH5A 2WFZA 3B1XA 3PUIA 3ZY5A 4BYMA 1SELA 2B69A 4TSKA 2VJQA 5MFZA 4CTKA 2ONKA 1SJ9A 1E8DA 1MPXA 4L4SA 4XM0A 1O54A 3TR6A 2CHVA 3VH1A 4QE3A 4C9BA 4GSLA 4PZPA 1TA9A 3QUAA 1ELOA 5LNK6 2CEKA 2IZ1A 1GGHA 1VBMA 2PT7A 3BJMA 4N01A 3WL5A 3GDOA 1EU1A 3L1KA 2J87A 1X80A 2DR0A 4BU1A 3QFFA 2HA5A 5BURA 5BXYA 4K9RA 3IQWA 4C4TA 3G7NA 5HJ7A 1CY2A 1M1YA 1TLTA 4E5UA 3R20A 1FP2A 4RV4A 1HC7A 2VTKA 4RLHA 1CRZA 4Y9DA 4TTPA 2X5OA 4LRTB 5KKNB 1QIMA 4DLYA 1FNSA 4I66A 4M1QA 5ALTA 2PA3A 2A78A 3CUEF 3HLTA 2D0DA 4DYDA 2X1HA 1VYUA 1OVGA 4B7ZA 3H8VA 3PX7A 1PZNA 3IKMB 3OZCA 1UAYA 4HYQA 4RIEA 5EIOA 4HPWA 3RFCA 3W8EA 5LN1A