1FMJA

Crystal structure of mercury derivative of retinol dehydratase in a complex with retinol and pap
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
PFPYEFRELNPEEDKLVKANLGAFPTTYVKLGPKGYMVYRPYLKDAANIYNMPLRPTDVFVASYQRSGTTMTQELVWLIENDLNFEAAKTYMSLRYIYLDGFMIYDPEKQEEYNDILPNPENLDMERYLGLLEYSSRPGSSLLAAVPPTEKRFVKTHLPLSLMPPNMLDTVKMVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAWAKRHDPNMLFLFYEDYLKDLPGCIARIADFLGKKLSEEQIQRLCEHLNFEKFKNNGAVNMEDYREIGILADGEHFIRKGKAGCWRDYFDEEMTKQAEKWIKDNLKDTDLRYPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A helical lid converts a sulfotransferase to a dehydratase.
pubmed doi rcsb
source organism Spodoptera frugiperda
molecule tags Transferase
molecule keywords RETINOL DEHYDRATASE
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fmjA00
2QQ0A 2XSZA 4Z1MA 5BN5A 5AR1A 4EFMA 2F1IA 2FU5C 1FNMA 1H8ED 4EPWA 5C18A 3BOSA 1OXTA 1DAHA 4B3XA 4B43A 2V3CC 1E0AA 4B3BA 2CK3D 2X8AA 4LRWA 4GPTA 1BMFD 2K5UA 1EFHA 5B57C 2O8FA 4TYYA 5EE5B 2BM1A 5JWHA 5KHOC 3NC1C 2PLFA 3Q9LA 4KLZA 3R9IA 3DM5A 2J0QA 3CX6A 1OT3A 5FTKA 5JS7A 4D0NA 4OHYA 1E9RA 2XJ4A 1P7CA 1KGDA 2XSZD 3U5ZB 4OQMA 3SBEA 4Q1AA 3ADCA 2WZQA 1TF2A 1E9CA 1W2GA 1OV4A 2MMCA 4WIAA 1WF3A 2IYWA 2ZXUA 2F1HA 1CRPA 4A2WA 3DMDA 3PCRB 4MUBA 1GAJA 3QG5A 5C46F 5JJKA 2F6RA 4DUGA 4EQ6B 4JLNA 2VIIA 4S35A 4I1SA 4DEXA 5BQ5A 1MRSA 2O0JA 4TTQA 4URZR 3VX4A 4JMPA 3EZ6A 2VSFA 2XNSA 1OH7A 3T12A 4JLVA 4GDFA 4Q03A 1HV8A 1N0UA 2KWIA 2WIBA 4GP6A 1Y3AA 4KU4A 3X1DA 1PZNA 1GRRA 1N3BA 4F4IA 4F4CA 4JSTA 1VIAA 1R8QA 4C0KA 3UPUA 1EX7A 2QUZA 3CBQA 5FL7D 4MGKR 4DT1A 1QG4A 5F9FA 4E22A 2WWXA 4QRHA 4P4TA 2ZYWX 1P2UA 2BBWA 3DOFA 1B23P 4JJZA 2PCLA 3F5FA 2CL6X 3TQFA 4RFSB 2W0MA 3E5HA 1AQUA 2R2AA 2EWWA 5JEDA 2J87A 4EIWA 5J4KA 4IKEA 1CJTC 1L4YA 1SHZA 3DKPA 3QEJA 3FDIA 1LW7A 3K09A 3Q72A 1XCMA 4WZ6A 1HURA 3T35A 3SU8A 2X1VA 2VYFA 3L8YA 1VCIA 4S2EA 1K5GA 1COWD 3CPHA 3I4LA 1GKUB 3LH5A 4F4JA 5LB2A 4QBFA 2IYLD 4DB2A 1FP6A 5HE9A 1WCV1 4IW3B 1J90A 3CF6R 4M4SA 2QMHA 5FBLB 1TTTA 3SZRA 2ONKA 4TL6A 3LXXA 1HH4A 1OIXA 2B8WA 1VPLA 1UDXA 2DPXA 2QENA 4RD1A 4ASUD 2XB2A 3H0KA 1PLKA 5CK5A 1E0SA 4BWYA 2YV5A 2P67A 4QNMA 3SJCA 2JLVA 2W6ID 1TQDA 1NLYA 5J47A 2BMEA 4C0LA 4V03A 3K1JA 4G5RA 2OFOA 3GLIE 4QL3A 5EP3A 1OLOA 1HE8B 2GA8A 3X1ZA 1RRGA 1M6NA 1GRQA 2VBCA 4KCGA 2I3BA 3T5GA 1F5NA 2FV8A 2ZUDA 5EUMA 3SDZA 1HT2E 1GM5A 1EFRD 1XMIA 1N25A 2ZITA 2OCAA 2J46A 2LWIA 1Z08A 1TPZA 1ZNYA 1P61B 3QF7A 2PMDA 4QFMA 1SKYB 4Q18A 1C9KA 2CLSA 4V0ME 4FW9A 3TKLA 4URUR 2KSQA 3PUWA 5C4GB 1IM2A 5KNBA 2WWGA 2GVZC 2H1LA 4DXAA 3B9QA 2JIZA 3CM0A 3FOZA 4CZ2A 5HPYB 5ANRB 1KJWA 1SVOA 1HUQA 4MGYR 3HU2A 1RW4A 4ABYA 3BGWA 1G6OA 3GLGB 4MKIA 3HR7A 3UANA 1DG1G 2N46A 4LBZA 1FFHA 2W00A 2HCJB 1PUIA 1AK2A 4ZIRA 4XSGA 1C1YA 3RABA 3HWSA 3M6AA 3CPJB 3TUZC 5L3QB 1KO8A 821PA 3CRW1 1SVKA 4NYIR 5HTKA 2KE5A 1N5IA 2DWOA 4LJ6A 4BRWA 1M34E 4JVLA 1QBKC 2BM0A 2EU8A 4TLAA 2WPDA 3TIFA 1DARA 4LY6A 3CH4B 4V0NA 3DMNA 4XOIA 2HF8A 3K9LA 4WXPA 3BWDD 1LNZA 121PA 1W4BA 4KJZA 4IDHA 3GPLA 1UEIA 2JLUA 4Q4HA 5FPTA 1G7SA 5DGXA 1ZD1A 3X1XA 2BC9A 4C2TA 4BFVA 2ANBA 2FX3A 1X8LA 1T8UA 4M22A 4ARZB 2WTUA 4MYCA 1E1RD 1FP7A 3EIQA 3GLFE 2X2EA 3OIYA 4EKDA 1YZTA 2FF7A 1YR9A 5BYJA 1LS1A 2J0UB 1T5IA 4MA4A 3U3JA 1YZGA 2RGBA 1RJ9B 2HLDA 2W2TA 5CB8A 2ZTSA 3X1YA 2R6FA 4MDEA 2PEYA 3EC1A 3QNUA 4KXFB 5E7IA 2CE2X 2QRZA 2W2XA 3Q8XB 4JLDA 4TYPA 3EPHA 1EFCA 5JHHB 4WOPA 1SKYE 1N5JA 2FSIA 1S4QA 5CYOA 2CLCX 2HYIC 4GP7A 1EWRA 2QTFA 3KKPA 4OK5A 4XH9B 3WBJA 2XTZA 1NSTA 2WV9A 4PO9A 3CH5A 4Y0AA 1KSJA 2IL1A 2VF8A 1UDWA 4L15A 4RFVA 1U8AA 3ADKA 2B92A 1G41A 3LBNA 4KBFA 4CRWB 3W5IA 4P32A 4Q1FA 4ITRC 4BFSA 4HDQB 2EYQA 4OHWA 1VYVA 1CR0A 1W36D 3U3MA 3HYTA 1ZM9A 3MSXA 4JVMA 1N6KA 2H5EA 4GT1A 1FTNA 3VKGA 2BCJQ 3G5UA 2WSSD 4UJ5A 4DWJA 5FR2A 3MCAA 5J4YA 1OE0A 5LPNA 2AN9A 3VKHA 2YOGA 5E7MA 3RYTC 4AKEA 4F91B 3DM9B 5KDLA 2HLDD 2R65A 3TBKA 2FDCA 1Z6TA 1D9XA 4D4KA 2P2LA 2VEDA 2HF9A 1E0JA 1OJLA 3TGPA 1G3UA 1OHHA 1G7RA 2ZJBA 4Y0VA 2LKDA 4HSEA 4GZLA 1ZM3A 1W4RA 1UADA 4NYJR 3AEZA 5B30A 2VHQA 4GI7A 5KOYA 1GKYA 2WSSA 1TMKA 5TDHA 4NYJQ 3NHBA 5JJIA 1NI3A 2FFAA 4DSNA 4OI4A 1EFUA 5B2ZA 3AGPA 5KNDA 5EXXA 1XF9A 3A1VA 2QE7D 2KI5A 3CKLA 4LYHA 1KI9A 4BZPA 4DIDA 3DVLA 5JWRA 3LO5A 1Q57A 5DN6A 1DAMA 2O8CB 2HEIA 2ZS8A 3IHLA 3ZYCA 4ASUA 4YMUA 3AUXA 3L8ZA 2RAPA 1SQ5A 1CR1A 2LCFA 2KB0A 1W46A 1NVWQ 3FMIA 4TLCA 3AUYA 4JBYA 2V55B 4GSYA 1KO1A 2N1BA 4I81A 3MD0A 4DCUA 1AGPA 2BMDA 1QHSA 3A1WA 2O8BA 4JLKA 4OI1A 1E9SA 3KL4A 4LOAA 4LV5B 2OAQ1 4TTPA 3U4QB 2FNAA 1R7RA 2QTHA 5JRZA 3B5JA 3TW8B 2ASEA 3DHWC 5J40A 2ZJOA 2XTNA 1ZM7A 2ZAOA 3AVUA 5GVRA 4NYMQ 4Z51A 2IF0A 4DB4A 3PUVA 5JECA 2IA5A 2AWNA 3MGCA 4TMZA 2PT5A 2ZRKA 2F43B 4URWR 3Q85A 3RSLA 1VYUA 3BRWD 4TL8A 4A82A 1P62B 2R44A 3CUEF 3BBPA 2O52A 3TMKA 4NHOA 1F6BA 1FQJA 4TMXA 1T0HB 3ONWA 4DCSA 1F2TB 2Q3HA 4XTCS 1L2TA 2ZS9A 2AWOA 4B3GA 4ARZA 1E9DA 1JALA 1KK2A 1FL9A 4JT2A 5EXSA 2A2ZA 1J8YF 4DVGA 2H18A 1ZU5A 1KK1A 4DLXA 1G3IA 1TL7C 5JBQA 1SZPA 1YR6A 1KMHA 1G3RA 5G41A 1X86B 3BJIC 5FOWA 4HLUC 4YDHB 3FHTA 3U6KA 4OK6A 2QA5A 2ZU6A 4JBWA 4TQ9A 4WBSA 5FI0B 1LTQA 1NIJA 2DYKA 3A4NA 4M1WA 3HR8A 4A2QA 3K0FA 3VNUA 5EE9A 3MWLA 5KPDA 2DWPA 3QXCA 1E79A 3Q3JB 1UBEA 3FYHA 2BJVA 5LD2C 2XB4A 2WAYA 2CBZA 3BK7A 4D0GA 3U44B 2ZROA 4CIDA 5CB6A 4ON9A 1VHTA 5DYGA 3CWQA 3MFYA 2QRNA 2B7BA 3SHWA 2QBYA 1E2HA 3DZ8A 4J0QA 1U8ZA 2WJVA 4HB2A 4RKEA 2ZE8A 2HXYA 2PJRA 4DLUA 4ERNA 1AZTA 3UKDA 5TB5A 4KI0A 2GZHA 1OIVA 4BLSA 3IIKA 4EPTA 1SGWA 1IY1A 2OESA 4UKDA 2OE2A 5JWOA 5J4LA 1NMXA 4Q02A 4RFSA 1Z0DA 1LFDB 3BORA 4PPGA 4JBXA 4YMTA 1ZCAA 3O8DA 2KJQA 4DLVA 1Q0UA 2WVJA 2J7KA 2ZIAA 3RS2A 3BH7A 2UZIR 3K8YA 3GLHA 2VP5A 1KDTA 4IOJA 2AHOA 3TAHA 1ZUIA 1OHHD 4BLPA 3B85A 2FSHA 2JDIA 3I3SR 4W5WA 1OB5A 5HZHA 2GJSA 2ODWA 3EARA 2CVHA 2EYUA 2JGNA 3AP1A 3GCGA 3GLGE 3RDPA 1ZIPA 1YZNA 4LBVA 1VG0B 1E2NA 1JXMA 5CITA 2EFHB 2OBLA 1OB2A 1XMJA 2O0HA 3RS7A 3ZQJA 4MYTA 5KU1A 2OLJA 3NDBB 1CIPA 4EJSB 1GITA 1U9IC 1T5LA 2GHIA 4PSVA 5SZIA 3LX5A 4Q47A 1G20E 3JVVA 2Z4RA 4LHWA 3K0AB 4PR0A 1F60A 2H17A 1CJUC 2C78A 4BFXA 3BFXA 3LQQA 4B47A 2Q9AA 1KI7A 5AUNB 4EFLA 3EX7C 3H1TA 1YQTA 2GRJA 4EPYA 3U3KA 2EW1A 5DI9A 1R8SA 4P4SB 2J5XA 3FFAA 1P4SA 1IXZA 3L0IB 5FPKA 4DSTA 3A1TA 4BPBA 3THYB 4MYHA 2RHDA 5TY0A 4TTRA 2ZI5A 2J0SA 4E03A 2GJ8A 2UVQA 3KJIA 3VHLB 5EE0A 1ZC3A 2HT1A 1P2SA 3WMFA 4UXHA 3QY0A 2PMKA 1UJ2A 1IHUA 1J70A 4KODA 1DAFA 4LJ5A 3S1AB 2ZI3A 2FA9A 4WA7A 1F2TA 2VL7A 1D2EA 2ZE7A 3X2SA 2JCSA 4KHZA 2DB3A 1J2JA 1Q1ZA 4A0GA 2WIAA 4ZV4A 1U0JA 2AD1A 1FTSA 3QQ5A 1YR8A 3CR8A 4BGDA 2FEOA 3GEHA 4Q1CA 2VP4A 4QBIA 5TV2A 2IHYA 3T1QA 3IHWA 721PA 4CF7A 2W6JA 1II9A 3F8TA 1N2CE 4O2RA 4B48A 1E2QA 1NVUQ 5TVKA 4B33A 4Q4JA 1P73A 2NO0A 2ZRCA 4FCWA 1S3GA 1G6HA 3DKVA 4YXWA 3SN6A 4OL0A 2RHMA 3OEHD 4IOKA 4NU0A 1KJYA 1RKBA 1Z29A 1V5WA 1XRJA 4NZYA 2A9KA 1W5TA 4RD3A 3J81k 3OESA 2VHCA 3OE7D 4AYTA 1XNJA 1TEVA 4NCIA 4EFNA 2VP9A 4NH0A 4X8MA 3OEHA 1BIFA 4PC1A 5DE3A 1I4LD 4E09A 3Q7PA 2CCKA 1JXOA 3F3YA 1KYIA 2XNDD 3EA5A 5BN4A 1KO7A 5C2JB 2YKGA 1F2UA 1CJMA 1P6XA 3P32A 5CJPA 4PC2A 4TWZA 2ONJA 1MKYA 3VFDA 3KZ1E 1AGRA 4TYQA 4AI6A 5G40A 3PXGA 3WMGA 5EP2A 5JFGA 2DFNA 3OIVA 4JKIA 4N3NA 2XZPA 1J7KA 2X19A 4JT4A 4QBGB 2NPFA 3LV8A 4F93B 3O8RA 4Q66C 1RRCA 2A5JA 1BKDR 2GJ9A 1IN7A 3B1WA 3AF0A 1E6CA 1G291 1U9IA 2WJJA 3A36A 3HP1A 4LC0A 3PITA 3CF0A 5L8VA 4OK3A 4DDTA 3H84A 4LUCA 1VHLA 2PZGA 2IUUA 1DO0A 1OXXK 4A8JC 1VIYA 4D81A 2QP9X 3ZIAD 3FB4A 1N6OA 2B6HA 1FQKA 1U94A 2A78A 2ATVA 3TH5A 4DLSA 3TW4A 1ZAKA 1MO6A 5DISB 3QXSA 3B1YA 4HB3A 1QHHB 3ICQB 2O8DA 1DVRA 4U02A 2CNWD 3LW7A 2FJUA 5H70A 1P9WA 2J59A 4BFUA 3GP8A 1JAIA 1XEWX 3QKUA 1D8TA 2GCNA 1J8MF 1QHXA 1CXZA 4OQLA 2KBEA 2H57A 2E87A 4PZLA 3E1SA 4JJKA 1S96A 4O2LA 1Q22A 3C16C 2REOA 4Q1BA 1BMFA 2HJVA 4M9XA 4LC1A 1S1MA 4CT4B 2WOJA 3IIJA 4GMXA 2CEAA 1N6NA 5EP4A 3CPEA 5KDDA 2AR7A 4EDHA 3PV0A 5AJYA 4D4JA 3EZ7A 4Q9IA 4WXRA 1R10A 3IEVA 1GL7A 1GP2A 4M1TA 1JR3A 2A5FA 4I1UA 2ZJZA 1NG9A 2IEZA 5UKDA 1T3HA 3OFND 4Q4AA 4D0LB 3AF4A 2ZI9A 1VKJA 5DYIA 4F92B 4PC7A 1TAGA 2Z0MA 3K0CC 4ESVA 2P3SA 1Q44A 2VA8A 2Z83A 3GJ4A 4NYIQ 3NVAA 1UKEA 1R5OA 1XTKA 1NVVQ 2HJGA 1AKEA 2O8BB 3B8HA 3EXAA 4DKXA 3I73A 3GJXC 1SULA 3UMFA 5EE1A 5JSZA 5B64A 1MH1A 1CR4A 2XITA 4YQFA 5DSZA 2BEJA 1JAHA 4KAXA 521PA 3IEUA 4Q4JB 1G9XA 4YDSA 3LVRE 1XD2A 5BW8A 3CRVA 3KXKA 1XMSA 1FW6A 3W34A 2QM8A 2G83A 1N6PA 3ZD6A 3VMFA 3GEIA 4HZIA 1S9DA 2X2FA 2ECKA 3PJRA 4DIEA 4Q19A 1S1CA 4QJ5A 3RVBA 3LNCA 4OQNA 4PPNA 3UWOA 4RVCA 2JIZD 2FGJA 3QF4B 3PR1A 1NG1A 3GJ7A 4G5GA 4CEHB 1IJEA 2P65A 1T91A 3GLHE 4FMCF 3IPYA 2BDTA 3T15A 1EWQA 4PAOA 2ZETA 4IDPA 5FPSA 2WBLC 1G3QA 3H2YA 1O87A 3WHLA 5FOTA 3IUYA 1W7AA 2FFQA 3KJHA 2EFCB 2IT1A 3LX8A 1KMHB 3ZIAA 1JPJA 1KSHA 1NP6A 4C0HA 1P75A 3SR0A 3ZZTA 1X6VA 1TF5A 3KQKA 1G3MA 2EFDB 3SS8A 1K5DA 1TQ2A 3I72A 4IXMA 1GNRA 2OFXA 1Z0JA 3K0FB 1T6NA 1KY3A 1BYUA 1KOFA 3HDTA 1VDZA 3W8RA 1T4GA 1W0KD 2B7CA 3QVUA 4R98A 5A5GA 1ZW6A 3GMTA 1AS0A 5H8WA 3AVQA 1WP9A 3MG9A 3PUXA 4DC9A 1OFHA 2AD5A 1ZJ6A 3KB1A 3WP0A 2NIPA 3UG7A 2UZ3A 4GZMA 4DLRA 3REGA 4G5SA 1AIPA 2PX3A 1NNEA 3VTKA 4P31A 3NKVA 4RCYA 4LJ4A 5B58C 1NN3A 2G1KA 3B6EA 4JL8A 1OSNA 1OKKA 2XOKD 3W5JA 2QZ4A 2FE4A 2C99A 4DDUA 3ASYA 3RLFA 2X77A 1IQPA 5L3SA 1NVVR 1E2LA 2F9LA 3EPLA 1KZ7B 2BMFA 2GKSA 1C4OA 1X1SA 1QHHA 2WHXA 3JZMA 3KKOA 1IN6A 1GILA 2ZRHA 3Q5DA 4PC3A 5IHPA 2R6AA 3B82A 3CW2A 2QTVB 4HLCA 3W90A 4PHHA 3MJRA 1G5TA 1G64A 4BZXA 2RGEA 3CF2A 4P4UA 5JJLA 3QENA 3WRYC 1CP2A 1Z6YA 5TMPA 3FTQA 2F43A 1N5KA 2XTMA 1IXRC 3I32A 3CB4A 5HKKA 1QRAA 1RRPA 1DE0A 5AJZA 3D31A 1R5NA 2GEDA 4ZKEA 1MOZA 4TLBA 1UBGA 4B6FA 3AF1A 2ZE5A 2RGCA 4LPKA 1AM4D 1OXSC 1S0UA 3ZVRA 1ZIOA 4NCJA 5IDVA 4KVAA 2Q0HA 2IS2A 3KQHA 4YMVA 2C96A 1E2IA 1ZUNB 5AJVB 3UIEA 4BFYA 3WYGA 2Q3FA 2QI9C 2XGJA 2V1XA 1E1RA 2AFIE 2JLXA 1MABB 3ZLJA 1JQJC 2HDNB 5K8TA 3I61A 4BUJA 1KI1A 2QROA 3EIHA 4HLQB 3OHMA 3OIUA 5CJ2A 4URVR 3LDAA 1G17A 2RKOA 3RWMB 3R7WB 1US8A 5AUOB 2IX3A 4NCKA 4G0NA 1NY6A 4GOKA 5SZJA 3B7GA 3QVVA 4EJSC 3QKRB 5F2EA 1TF7A 2Q9CA 2A30A 4DZZA 2QEQA 1YRBA 3A4LA 2F55A 4ZDKA 1G7TA 2ZANA 1IY2A 4KYUA 4BRUA 2RH5A 2GILA 1WMSA 4HAUA 4TSFD 3E70C 3NHAA 2YC2C 5JLJA 2OV2A 5IRCD 1ESMA 2W6IA 4NL4H 2OBNA 5FUVA 1GDDA 3W3ZB 3ZZUA 1OFUX 4IFEA 5H1YA 4ZDIA 2NPIA 1UEJA 4LX0A 4N0DA 5D3MA 5JEEA 2ZI4A 4MRRA 3ZS9A 5EE3A 3AVOA 3B2EA 2GF9A 3NH6A 4DLTA 3QXJA 2IS4A 1NIPA 1R5BA 2REBA 4GMDA 3SQWA 1SXJE 2FG5A 4HYYA 1L7VC 1Z83A 3TR0A 2NMVA 2C03A 3V4FA 2Z43A 1MO3A 1UF9A 2D2FA 4K81B 4TMWA 4XVRA 1VECA 2NGRA 4RJLA 3CIOA 3S1AA 3TVTA 2DBYA 2CK3A 2NO6A 4D25A 4LJAA 2ZJ5A 1P2VA 2ZAMA 3KB2A 4IXNA 1G8PA 2JLQA 4LYJA 1FUKA 1K6MA 4M9QA 2C9CA 2NOAA 2R8RA 1XPUA 2C8VA 3U3RA 3FKQA 4AG5A 2D4HA 1AA9A 4MITA 4LCBA 3EA0A 4QJ3A 5JS8A 1U0LA 1VG8A 4HUTA 3DOEA 2VSXA 4CDGA 3D3QA 1WQ1R 3KKQA 4PO1A 1KSGA 3X1WA 2D3WA 4IEEA 4TQUS 4NCHA 4M9ZA 4URYR 3U6BA 3ZVNA 5ELXA 5A0FA 2QE7A 1QZXA 3KJGA 1SVIA 3N70A 5E4FA 3VR1A 3VKWA 4GL2A 2ZRDA 2YOHA 3JVUA 2I4IA 2I1VB 1XTIA 2GK7A 3ZVLA 2E1RA 5HCIA 1W49A 2H7VA 2IS1A 1WA5A 1JNYA 5FOVA 2BBSA 2IUSA 4A6PA 3WRXC 1HE1C 3IPXA 5KSZA 1KNXA 1HQYE 5L3SB 3PEWA 2XZOA 3NH9A 3GLIA 4OI0A 4P4SA 2CMKA 3SNHA 3TVDA 1E9AA 4DSOA 2ZR0A 3IGFA 1ZINA 1P2TA 4M1YA 2FFHA 1TU3A 4UNRA 1YKSA 2OILA 2QL6A 2V6IA 3GFOA 1XJCA 3CNLA 1DADA 1UBCA 1P5ZB 4OJKA 2YC4C 4LWZA 1ETUA 1A4RA 1OXUA 3KKNA 2XAUA 1Z6XA 3QPWA 2WKPA 1Z63A 1Z06A 2ZR9A 3GJ0A 4A9AA 3HPRA 1E79D 3MUFA 4HB0A 4BQSA 4GOJA 3AKYA 1WBBA 5FBQB 4KITB 1DTSA 2E9SA 4TZ0A 2V4ZA 3O47A 2QPAA 4LHYA 3VR5A 3MWYW 3U60B 4HI0E 5BWMA 1YHNA 5F9HA 2C9OA 3MAAC 1Z3IX 3I92A 5H68A 4PQFA 4C2UA 3B13B 4KV9A 4PFSA 1YZQA 4A8JB 5SZHB 1DAGA 2J7PA 4P33A 2JJ2A 1H8HD 5GADl 1MABA 1W47A 1XB2A 1ZMXA 1E2PA 1W44A 4HZUA 1UKZA 1W2HA 1M8PA 2CCGA 4YMWA 3DL0A 1CS4C 4LBWA 1VMAA 3AF2A 1US8B 2PH1A 4NP6A 1KK3A 1KO5A 3ND8A 2HUPA 5EZ6B 3L0OA 1D5CA 2RGDA 1VCMA 2P6RA 1G16A 3L43A 1XCPA 2D7DA 2QNRA 3P4YA 4PX9A 4IOLA 2J1LA 4JVSB 4RZ2A 3KKMA 3D7MA 1GG2A 2D2EA 4ESHA 1RFLA 4FMDB 1XWIA 4M21A 2QAGA 1UPTA 3SYNA 2ZPTX 3ZH9B 2IF2A 5JRJA 1SXJC 1YR7A 3WYFA 1XJQA 1A2BA 3NBYC 4JSYA 2GESA 4TYNA 1OPXA 3M0EA 3K9HA 1UBFA 3BS4A 3B9PA 5FBRB 3L0PA 1FX0A 3EZ2A 4EPRA 2QM7A 2P6NA 4M1KA 3GLFA 1VYTA 3EASA 3R9WA 1E3MA 2V7QD 1S9HA 3H86A 1ZYUA 4V0KA 4PXAA 4TL7A 2ZYVX 1V43A 4NMMA 2PEZA 3GJ8A 3KQNA 4CGZA 1HTWA 4IVPA 2O5VA 3EZFA 3RS4A 3SC3A 4DJTA 1SHKA 3ZZ0A 4FI3C 2WMNB 2ZUCA 4C0BA 3THXB 3BXZA 1R2QA 4RZXA 4B2PA 3BE4A 4XVUA 2WWFA 1QHIA 4BZQA 1NF3A 4IFBA 2GXUA 3FHCB 1MO5A 2WSMA 3B1XA 4HAVA 3I62A 5HE8A 4CYMA 3CONA 1CR2A 1JJ7A 4LHXA 2BHRA 2ZVQX 4AC9A 3N5CA 4IHQA 4M2LA 2O8DB 1N0VC 3WHKA 3ADBA 3CX8A 1EFRA 1ZUHA 1Y63A 3K9NA 4R7ZA 3R8CA 1F48A 3QXXA 2D7CA 3TSZA 1CTQA 1E2FA 3EW9A 4DEYA 4IRUB 1EGAA 4KO8A 2WPDD 4JVNA 1A2KC 4LV6A 1CEEA 2VF7A 3P27A 2C04A 3AM1A 2P0EA 1JECA 1NVXQ 2PJZA 1ANKA 1P60A 4NTZA 3QIAA 3GJ5A 1XU4A 4UQOA 2W58A 2GZDA 1YU9A 3GFTA 3EZ9A 1GRNA 1II8B 1KI6A 4GNKA 1A7JA 1ODFA 2GAAA 2V7QA 3A58B 3NIBA 2WKRA 1IN8A 2ZSFA 4V02A 4ZPXA 4ACBA 2ORVA 1GSIA 4A4DA 1DOAA 5FR1A 2D06A 3UATA 5FPHA 1I4DD 2PT7A 2WAXA 4I99A 5F98A 3L82B 4GBMA 1WXQA 1U2RA 2ZRIA 4OBEA 2KBFA 4I1VA 3WP1B 1TUIA 1W1WA 4G1UC 4ZCIA 3LBIA 2QSYA 2ZRGA 4TT3D 1XEXA 2NO9A 1SVWA 3OAAD 1JJVA 4Q9LA 4B32A 4PSAA 1ZM4A 3VNVA 2YINC 1KY2A 2WOOA 1ZC4A 3K70D 2REXB 4DLWA 8OHMA 5L3QA 1NBME 4PTLA 1AKYA 1LS6A 3PFIA 4ILEA 4A8JA 3NBXX 3W6PA 3DZDA 2GDJA 1VTKA 2BOVA 2BV3A 5L3VA 1GNQA 1ZNXA 3BD9A 4RY2A 3EAQA 4X8HA 2HV8A 3QKTA 1XEWY 4AD8A 5L3RA 3W6NA 5CLLA 4U5XA 3K09C 4WZBE 1GVNB 4DCNA 1LF0A 5FBVB 1XZQA 2Y8EA 3NBZC 3U7EB 2OEPA 4PAQA 2G3YA 3LXRA 2J0VA 4UNPA 3SYLA 2EFEB 4E07A 1FUUA 3DPUA 3MMPA 4XD7A 1W4CA 4HLUA 3AVTA 2C77A 2GWHA 5HR5A 2WJGA 1IJFA 4MRNA 1ELOA 3PVSA 4BLQA 3T1VA 4TT3A 1LB1B 4PHTA 5FI1B 4HLDA 1G5PA 3EC2A 3ZD7A 1GZSA 5EUQB 1W5SA 3UWKA 4UNQA 1DO2A 2J0UA 4A92A 1R0XA 1YZLA 2FSFA 3IO3A 1YZKA 2WWHA 1XD9A 3LVQE 3V00A 3ZVMA 2R6CA 2WWWA 1NN0A 3PENA 4B74A 2FN4A 3VU9A 1X8KA 3CO5A 4IVQA 3GLFB 1E9EA 5DIFA 3RRNA 2NZ8A 2GF0A 2ZRBA 3R7WA 3QPVA 2ATXA 2R9VA 1G19A 1QVRA 2CJWB 2JJ1D 3N2EA 4PQYA 4C9BA 3T1OA 5KYKA 4ZDJA 4TSFA 3W6OA 2GCPA 3D8BA 3QSYA 4C30A 2QMOA 1EX6A 2IWRA 2IYTA 5A4JA 1G21E 3PG5A 4F7WA 1E9BA 1Z28A 2WJYA 1Q1BA 5EXTA 1M74A 2IXEA 2QPOA 4D82A 2FMXA 2V8OA 3KTAB 4LHZA 3RAPR 3REFA 4CEIB 1QHNA 5AUPB 2DHRA 3NEYA 4KBGA 5J5CA 4C3ZA 3KJEA 2DWQA 3IDQA 2QGZA 1YVDA 2P5TB 2VO1A 2Q21A 3RSOA 1T3SA 3IO5A 1P3JA 4KSBA 2VHJA 1RE0A 2IW3A 4Q7JB 4A0RA 3AQ4A 1E4VA 2VP0A 4TMKA 3SJZA 2D74A 1R0ZA 2CL7X 2ZSEA 3NTUA 4KVGA 2IC5A 4JLBA 2YWGA 1OH8A 1II8A 1KI6B 1KI8A 3TNFA 3P26A 1KTVA 2LKCA 2QORA 2QY9A 2ZEJA 4QHTA 5J4VA 1HT1E 4BEJA 3SJBA 2YWHA 4L5BA 2OBMA 1E2JA 1E0KA 4Q1DA 4Q9KA 1ZD9A 3NXSA 5CM9C 3RWOA 1NN5A 1UKYA 5EJEA 4BLTA 2W0SA 3M1IA 4LPSA 1KMQA 2OZEA 3C4JA 3RRMA 3NBFA 1ZM2A 2IK8A 5E3HA 4CT5A 4DBLC 4KLNA 1XCGB 3GLGA 2ERYA 4XSHA 4Q7LA 1ZVQA 3F0TA 1W0JD 3QKRA 3SBDA 2YWEA 3CNNA 4W5JA 4FMBB 4Q9HA 1E2DA 1XMVA 5BXQC 3TUIC 3BH0A 3OF5A 2Z5FA 4N1AA 3U4QA 2CL0X 1MV5A 2ZREA 3R9XA 1XZPA 1TQ4A 1ZNZA 3TR5A 1CU1A 1BS1A 5DI3A 2RGGA 5TARA 2ZSAA 2VHUA 3PEYA 1E1QA 3FKSA 5GVSA 4IJMA 3L0SA 1JEEA 1OKKD 4D6PA 1RZ3A 1CKEA 1TADA 3GQBA 1TQ6A 2Q6TA 1SKQA 3A37A 2QQEA 3EPKA 2RCNA 1MR3F 1Q3HA 1R0WA 2ANCA 1S2MA 5FUXA 1KJZA 4Q4LA 2PZEA 4OQFA 4QGHA 1Z47A 1QVAA 4RSGA 4HAWA 4P0TA 4QXAA 5JZVA 3SQXA 2F3RA 4I4LA 1T8TA 4A36A 1G1MA 1N6IA 4MRSA 4TQAA 4PO8A 5HCNA 2YNMA 3THWB 4KFTA 1Z07A 1U8YA 4LYFA 3WNCA 2YHSA 1KKLA 4RCZA 2NZJA 1NN1A 5LBIA 2IYQA 4R2IA 1KDPA 1KI4A 3QOFA 3CNOA 5JI3E 1AS3A 4RZ3A 3U7HB 1PLJA 1JR3E 2IUTA 4Z8YA 2Q9BA 4G01B 1Q12A 2JLSA 1PUJA 3OZXA 1NLZA 3LAWA 1A1VA 1D2MA 1O3YA 2FZLA 2V54A 3PUZA 1HA3A 4AG6A 3V4RA 4NONA 2A5GA 2CJWA 4MRPA 3RS0A 1DG3A 4W5HA 2OM2A 4B44A 4IOMA 1UAAA 1NY5A 2J3EA 1IBRA 2G77B 3QEOA 2QAJA 4M1SA 4HUQB 3AVYA 3UXMA 5GJVC 4WAUA 4QM6A 2GZAA 2QBYB 1KZGB 3QBVA 3GFPA 2RGXA 2FPKA 2JJ1A 2OHFA 4NYMR 2BIFA 4A1FA 2ODBA 2RGNA 4MYUA 1ZRHA 2VH5R 4NCNA 4PAMA 4W7SA 4MDFA 4YXWD 2MSCB 2O0KA 4OYHA 3GLIB 4D4LA 4D80A 4B2LA 1SVLA 1UM8A 1UKVY 1XXHE 5FH9A 1Z6GA 2FSGA 3LFUA 3HU1A 2JA1A 4K8OA 5AUQA 3U2QA 5FOXA 4KFUA 3CWZA 5CM8B 1AQYA 3BH6A 4JLOA 1DAIA 1IXSB 4PZYA 3VHXA 4QGAA 3KTAA 4LI0A 3NWJA 2ZRAA 4LK2A 4RZUA 4B6EA 1U99A 1FX0B 4V0MA 3LBHA 4CEJA 4L8GA 4L16A 2V9PA 3IIMA 4AK9A 4RD2A 1PV4A 1R4AA 3T06B 5CIWA 2F9MA 3GLHB 1RPZA 1W0KA 4TMVA 4AIIA 5FOUA 2ZSDA 1XP8A 4JLAA 3TUJC 3B60A 1Q1QA 5E95A 4LHVA 3ZGXA 3C5CA 4JL5A 1TUEA 4O0MA 4DLYA 5HKKD 5CDFE 5C4MA 4V0LA 3UG6A 1KDRA 3EPJA 4EUNA 4XWKA 3VR3A 4Q7MB 5IK2D 5P21A 2G0NA 3BIFA 2MSEB 1D9ZA 3MWJA 1VG1A 4DLZA 2N42A 2PX0A 5KTYA 4X8OA 1E9FA 4L4UA 2ZJYA 1XFAA 2SHKA 3GJ6A 1N6HA 3IILA 4DHEA 2R6GA 4C0JA 4YMSA 4QM7A 2IS6A 4M9SA 3WMEA 2O8EB 4QG7A 4Q7KA 3IBGA 3B78A 4XIGS 2Z4SA 3BAFA 4QBHA 2RGAA 1XBTA 4ACAA 5KSOA 3O8CA 2H8KA 1N5LA 5FOSA 1EFTA 1II0A 4HDCA 2JEOA 2R62A 1VG9B 1R0YA 3NEJA 1W4AA 4AYWA 1M7BA 2F1JA 3DDCA 1JBKA 5BN3A 1KAGA 4FCTA 4MQBA 4URXR 2GVDC 4AURA 2JAQA 4JIMA 3ECCA 1GIAA 5G3ZA 1BO6A 2OO7A 4OI2A 6Q21A 3MJHA 3C7KA 4IEIA 5F3WB 2FPMA 3SYKA 1K8RA 1E99A 1I2DA 1ZD8A 1S3SA 3HJNA 3SEAA 4B76A 1WE2A 3K70C 1T0JB 4JLMA 4FINA 1P9NA 5DNYB 2XXAA 4QNRA 4DCTA 2ZYTX 3QBTA 4HDOB 1XEXB 3LA6A 5FPYA 2HYDA 4KFRA 4EAQA 1G8FA 5AJWA 4MKGA 3SI7A 4Q5IA 3AB3A 4L9WA 3THXA 1CJKC 1LV7A 1NJGA 2JLZA 2BJWA 3C8UA 1GL6A 1PLLA 3K0EA 3SFZA 1Z6AA 4P3YA 4BEBA 1N0WA 5EXPA 1XXHB 2CDNA 4WW0A 3LWNA 5TXGA 3UMSA 1L8QA 3VQTA 3K9GA 4PHFA 1DAKA 3BERA 2OSBA 2OUKA 2GK6A 4IDOA 3I5YA 3P20A 3QUSA 4BASA 3U44A 2AXPA 1OH5A 3DO6A 2C98A 4F38A 4BE7B 5KSYA 1QDEA 3AF3A 1U90A 4Q21A 2V1UA 3CZPA 4LJYA 3D6TB 5J4HA 1NJFA 2ZU0C 4O3MA 2CXXA 4DSUA 2ZRFA 1CBUA 2BVNA 1Q3TA 5KDOA 1WBDA 2IXGA 1LF5A 4IVRA 1SXJA 2EVWX 4US2R 5IK2A 2XOKA 3U7GA 2GCOA 2QAGC 1F2UB 3MWKA 2YJTD 3PUYA 5HZKA 4V0OA 1MO4A 1KAOA 1OIWA 2EFGA 1WDTA 4B3CA 2FPLA 2J7PD 5G53C 3LLUA 3ND9A 1RRFA 221PA 2NO1A 1LVGA 4XD7D 4UNSA 2WWIA 2GJAA 1VCNA 2NQ2C 2ODEA 5DHAA 5AK0A 3MRSA 2AXNA 4QHSA 4FMDF 1SXJD 1CULC 2OG2A 5FTJA 2XNDA 1G8YA 4ZCMA 4R9UC 3FGNA 2WJHA 3LW8A 2F1RA 4GOXA 4CVNA 1JR3D 1H65A 2CHGA 4UNNA 1JQLB 2QPTA 2DY1A 2A5YB 3C14C 1COWA 2QN6A 3ZJYA 4D2IA 1BH2A 3E2IA 4FD2A 1Z2AA 3U3OA 2CLDX 3KQUA 1J99A 2HT6A 2YYZA 5GJWC 3SE0A 1GKIA 1OXVA 2ZJAA 4C7OA 3RRYA 4K46A 4EJSA 2JASA 4XVQA 5GJBA 4CEIA 2OFWA 4ZO4A 4XWAA 1NKSA 4ZKDA 2EQBA 4RD6A 2TMKA 1F3OA 3K0AA 3KFVA 3M4YA 4AKGA 4GFDA 1HYQA 1U98A 2GAOA 3GD7A 4FWIB 3VAAA 1G18A 2AK2A 3HPQA 1AN0A 1G8GA 2D62A 4MUAA 4NKRA 4PSKA 4FMCB 1XJ0A 3SHFA 4HB4A 5CYPA 5GJCA 4KFSA 2OCPA 3THYA 4D4MA 2JLRA 1FOEB 1RIFA 4M53A 4FIDA 4OHVA 3BFKA 4YONB 4PC6A 5AJXA 4RD0A 3WXMA 2A7QA 1CF4A 5LB4A 3TSWA 3C15C 4TZ6A 4TL9A 4Z8XA 2J9RA 2BBOA 2IYYA 1P9RA 2PZFA 1ZP6A 3PEVA 3VU9B 1XPOA 2P5SA 1JEDA 3GEEA 4XTRA 3PEUA 3ZS8A 4LBYA 3TE6A 2WJIA 1WB9A 4MKFA 1CRQA 1ZU4A 2XXAB 2ORWA 4YLGA 3Q7QA 4LSGA 1TNDA 1Z2CA 2JJ2D 4CW7A 1N6RA 2BKUA 2ZS7A 4Q48A 4HAYA 1B0UA 1YE8A 4NE2A 2V6JA 1ZNWA 2G0TA 2GBLA 2ZRPA 4US1R 4A6XA 2JLWA 2R6DA 4LGMA 1IN4A 1G5RA 3AP3A 4H1VA 5D3QA 2ZJ2A 4B35A 1XXHA 4TN1A 1G4UR 2G1JA 3AH8A 1DELA 1HQCA 3R20A 4I1OA 4B3DA 2RGNC 5KPJA 3EG5A 2G88A 4AY2A 3VR6A 4JL6A 1OFIA 3RC3A 1EESA 4ZI2A 1L4UA 3RNLA 4DDVA 1D6JA 2QU8A 4FCVA 3ICEA 3PQCA 4C0QC 5FUYA 3TQCA 3THWA 3LLMA 4TLDA 4B3FX 3RC8A 1Z22A 1Z5ZA 3QI2A 4IDQA 4C0AC 3GJ3A 4DT1B 2RB4A 5EZ5A 2UKDA 3B1ZA 2H92A 4MRVA 4POAA 4LJ7A 4U7DA 2AX4A 2OT3B 3T34A 2DFTA 3BB1A 3HU3A 1E2MA 1OF1A 3TRFA 2ZRNA 3NC0C 3B1VA 4EPXA 1TU4A 4JLPA 1KI2A 1ESNA 2VTKA 3CRMA 3AVVA 1KNQA 2BKEA 2IEYA 5LD2B 4WZAE 3BB3A 1JR6A 1EG7A 2ZJ8A 4LV8B 5DLQC 2O8FB 3QKSB 1NMZA 2DR3A 2GETA 3AVPA 2IYSA 2W83A 5M04A 3C41J 2XEXA 4TMTA 1FPMA 1M1YE 1OFTA 621PA 1HEIA 3OIWA 1FNNA 2G9NA 4OJQA 2ZRLA 4PQRA 5KO2A 2GXQA 5LDDC 1G7CA 3L2OB 1W36B 1DBSA 2IHBA 2ZRMA 4B71A 4MH0R 4DCVA 1XTSA 1OYWA 2VP2A 3H4MA 3BC1A 2NO7A 3AKCA 4Z54A 4H9GA 4JZKA 3OAAA 2WM9B 2ZSBA 1X1RA 2BMJA 1EK0A 3FMOB 5DI3B 3A4MA 4L9SA 1ZCBA 4LZZA 4EQ6A 3A1UA 4NBSA 4RD4A 5FTMA 4AKHA 3CZQA 5K8IA 4QC2A 4E5UA 4PANA 3VR2A 4ZDWA 5KSPA 4G5QA 4QHYA 2OLKA 1A82A 1GWNA 1XX6A 1Z8FA 2VRWA 2FEMA 2W2VA 4QGFA 3KUDA 5CIQA 2GXAA 4BLOA 3LD9A 1FZQA 3JZAA 5DH9A 5JHGB 1KK0A 2CHQA 2QT1A 1FMJA 2GTPA 1NRJB 4PPQA 2EWVA 1D2NA 3CRQA 1IAQA 5KUTA 2PLRA 2WMOB 3C5HA 5E7JA 3KFXA 2L0XA 3RS5A 4OQXA 1Z0KA 3KXLA 1NBMD 4IDNA 2GJKA 4FWTA 3N2IA 2B8TA 2OAP1 3QJYA 3I8XA 1G8HA 3WBKA 3EWSA 2BWJA 1KO4A 2J41A 4Q4AB 2ORIA 1E4YA 2BBTA 5JI2E 2ZE6A 2FWRA 1XD8A 1XPRA 1W36C 5DHFA 1NBMA 2FFBA 3A6PC 2AK3A 2C2HA 1U81A 2ZI6A 1N6LA 3VR4A 1E2KA 1YJ5A 4Q1EA 1BOFA 2JJ8A 2YWFA 3SOPA 4TYWA 1PVOA 1KIMA 4ZIRB 3OFNA 2A5DA 2NTYC 4LYAA 2ZYUX 1I2MA 3G82C 3CLVA 4LJ8A 4HUQA 3KUCA 3QXHA 4PZZA 5JSZB 5AWFC 2AL7A 1E98A 1M7HA 2IYUA 1X3SA 3LQRA 4QGGA 4Q00A 4B34A 1U0HC 2ERXA 3IQXA 2VHTA 3NG1A 3KX2A 4A15A 3IQWA 2G6BA 3FPAA 4FN5A 3PIRA 1EXMA 1XD2B 2AFHE 1Q1EA 1RC8A 1H8HA 2AKYA 4AWXA 3FWYA 5CK4A 1KI3A 2DCUA 3AVWA 2IBMA 1Q21A 5D3MB 1ONBA 1XTRA 4B73A 3RANA 1CLUA 3QF4A 4CEHA 4CEJB 2B21A 2GEVA 4UXJA 3T5DA 3CRRA 1XTJA 1GNPA 1SVSA 1DPFA 2VSOA 4JKYA 3V9PA 5JCPA 1QHGA 2CE7A 2IYRA 2DFLA 2C95A 5DN6D 4BFZA 2ZRJA 2BEKA 3KDSE 4QOSA 3MLEA 3NDPA 4Z1MD 4UXIA 1E69A 5FL3A 1LY1A 1Z0AA 4KSCA 5IF9A 3QG1A 2CHVA 4QJ4A 3A1SA 3FE2A 2GNOA 1JB1A 1RYHA 3BB4A 4A0FA 4N0EA 4HEJA 1E2EA 2QSZA 4X8LA 3K0CA 1DAEA 3FHOA 3QKSA 1RVDA 2ZVPX 2CVFA 5K8UA 4OKSA 2MMGA 1WRBA 3ETLA 4JYBA 5EQTA 1FMLA 3AGQA 5DO9A 2O8EA 1E94E 4MGZR 3I5XA 1T9HA 5JCZA 1NLFA 1OW3B 2IYVA 4XJXA 1Q20A 4MGIR 3QE0A 1Z0FA 3KXIA 1XDBA 2WKQA 1QF9A 1QG2A 2AKAB 2PBRA 3AKEA 4ZCLA 4HAZA 1DEKA 2WICA 4G5OA 4DUGD 4W9MC 2NG1A 2I1QA 2QGNA 5EP1A 1GL9B 3TJZA 2F3TA 4JS0A 1GUAA 5KNCA 2GCOB 2QT0A 3RRZA 3WY9A 4BFTA 1IN5A 1R6BX 5FFMA 1IONA 3W9YA 3VX3A 3TSOA 2ZR7A 4BLRA 3KQLA 2Z6VA 2FOLA 4O25A 3UK6A 4OHXA 2GEUA 3FFBA 1M7GA 4Q4HB 2HCBA 1E32A 1JPNA 5C1BA 3ASZA 1MT0A 2IYZA 1E2GA 3LRPA 1YRAA 5CLQA 3W3AA 4A2PA 1YZUA 4WVFA 4YC7A 4G3XA 1ZBDA 3WNBA 3DEFA 3ZQ6A 1NSFA 1W48A 4II7A 4C4PA 2GXSA 2YOFA 1RJ9A 3I1FA 2JLYA 2A3RA 2JDID 2CNWA 4DRZA 1SVMA 4HAXA 2O8CA 1HY3A 3FVQA 3OEED 2OCYC 3AKDA 1QHYA 3THOA 1AZSC 4JLJA 3AVXA 2VP6A 4HZUB 5IT5A 1G4AE 1E1QD 3FKSD 3Q5EA 3O8BA 4KYIB 1XEFA 2QMEA 4C7OB 1NMYA 3HYRA 3ZDQA 3AP2A 4GRAA 4BFWA 2QG6A 2ZI7A 4U00A 3SFVA 2P6UA 2ZQ5A 3OEEA 4LDJA 421PA 3UMRA 5K8LA 3R8FA 4XWOA 3T1TA 5FUWA 4R2HA 4M8NE 3OE7A 1KDOA 4RKFA 4UJ3A 2QAGB 1M2OB 1SXJB 2J45A 4D26A 1VCOA 3CX7A 1IY0A 1GTVA 3U61B 1P72A 2ZUBA 4MKHA 2XZLA 3BFVA 5FBWB 4ZI3A 2QP4A 3QPUA 3FMFA 4M1OA 1PJRA 4A0HA 1Z0IA 2IYXA 1OH6A 2F7SA 3K0SA 3IBYA 1A5TA 1GFIA 2YVUA 2YZ2A 2QMUA 3P1JA 3G0HA 1XTQA 2JATA 4FXPA 1GOTA 4M1MA 4PPFA 2C9YA 4H1UA 3AV0B 4DDWA 1CJVC 2W6JD 2OXRA 2BCGY 1BYIA 4Q01A 3EIEA 1E96A 1AJEA 1W0JA 2FZ4A 1TEXA 2HXSA 2XJ9A 1H8EA 5G3YA 3RHFA 4OHZA 1OYYA 3T61A 3WYAA 1NL3A 3I8SA 2ZM5A 5SZKB 3TK1A 5FL7A 5FTLA 2C5LA 3K53A 2ODNA 1KKMA 4TLEA 5FTNA 1JI0A 2IWHA 2WWYA 3SJAA 1KSFX 1IOZA 4AKIA 2IXFA 1MRNA 2VLIA 4NPHA 3TLXA 3EWAA 1X8JA 2RMKA 3W8NA 1DS6A 4JYCA 2PCJA 1AS2A 2XX3A 4B75A 1T3LA 2H16A 4HATA 2OXCA 2VQSA 3P4XA 3RS3A 4R71A 4Q9JA 2VPPA 5CDFA 2PL3A 4LJ9A 3K70B 5JMTA 3A8TA 2OCBA 2FH5B 4EPVA 5BYKA 3U7FB 3TAUA 4B2IA 4NDZA 4QKQA 3WNDA 4US0R 4PHGA 2MSDB 2GBLC 2FGKA 4M0LA 2QP3A 2Q3MA 2CCJA 3FMPB 4AYXA 3IKJA 3ADDA 1TX4B 1UFQA 4BECA 1NKTA 1I4TD 1KHTA 3LY5A 3CR7A 4C0SA 2DFKB 1S8FA 1RYFA
chains in the Genus database with same CATH superfamily
1ATIA 2XSZA 3LYLA 4GVXA 4L0MA 4M38A 2G71A 2FW6A 3JWPA 1OXMA 3VYVA 1DAHA 1G5QA 4ZK2A 4B43A 2W4IA 5I9BA 1OWPA 2BM8A 2CK3D 4ISBA 3MGGA 2UXCB 3E3OA 3EGVA 1PFWA 4QUIA 2O8FA 4IUBS 1R3DA 1EFHA 3JR3A 3HBNA 1KKUA 4CMHA 1H69A 5CRIA 4Y1RA 2QUKA 2IDJA 4UMEA 4P3OA 3KU1A 3TSAA 3VAYA 5AVVA 3MJEA 1E3DA 4DIBA 1VJ1A 4CI9A 4OHYA 3U5ZB 1PT7A 1DZ3A 3DONA 4OQMA 3MCZA 1XHLA 3GHHA 4Q1AA 3IMCA 3SBEA 3GCXA 4ISCA 1OV4A 2WM8A 4QRIA 1DUSA 3ZCSA 2IYWA 5H9WA 2ZXUA 2F3UA 4PFJA 2Z4TA 3PCRB 3QLTA 3SXPA 4RTRA 1GAJA 2FN3A 2GN8A 3T9BA 3T3OA 3AJAA 1H9AA 3A9CA 4FDAA 5G2OA 4CQLB 4E32A 4WRRA 3MMSA 4CM5A 2YHIB 5GGYA 3QU4A 2HDOA 4EQ6B 2VIIA 1UPXA 4CMCA 3EGXA 5EZSA 4KTTE 2HCFA 4EITA 3WYBA 2B1QA 4RJJA 4URZR 3VX4A 2YZNA 3B7PA 2BFDB 4BBZA 4JY7A 5DK4A 2V7XA 3ZXIA 5E2AA 4GDFA 1NKVA 4FR0A 3EXG1 1O4VA 1PJTA 1Q7BA 3MTDA 1CP3A 4HH3C 4IIFA 4ZA2A 3X1DA 5CA1A 1DBIA 3U17A 1NSYA 1GRRA 1N3BA 3TI7A 5AP9A 4JSTA 4C1NA 1VIAA 3JALA 4C0KA 3AL2A 2FR8A 1RI4A 1EX7A 1GPKA 3P2OA 1UXOA 2QUZA 3CBQA 1C0PA 4IF4A 1FRFS 4KNVA 4TTVA 4E22A 3FCUB 4GKJB 1GUZA 1W19A 2BGTA 3LHIA 2BBWA 1V25A 4FZ5A 1B23P 4JJZA 3OQPA 2ZVDA 1I2CA 3F5FA 4ZQEA 4EFKA 1QX3A 3GRYA 1PUXA 2E2WA 1XKTA 4GHWA 4PCAA 5JEDA 1U7PA 1XLTA 1Q19A 2O2CA 3UWSA 2E48A 2VDLB 1CJBA 5DMHA 3DKPA 4QREA 3K5PA 3FDIA 3QEJA 1H2AS 3ORHA 1LW7A 1NA5A 1NQOA 5JQGA 2EF1A 3Q72A 5LQAA 4BQFA 5EJAA 2QW8A 3O6VA 1XCMA 3I01M 1YE3A 1LC3A 4RADA 1PAUA 2LBPA 3KS9A 1VCIA 1F0YA 4EI2A 5BYAA 3LH5A 3CPHA 4F4JA 1GKUB 1XCLA 4QBFA 2IYLD 3N0RA 3OU6A 1GNLA 1WCV1 2R2GA 4IW3B 1RZUA 3HNOA 5HE9A 1W25A 2RK6A 3GRCA 2NXNA 1Z4NA 2I78A 3A1NA 2ZXEA 3VM6A 4FX2A 4X45A 1OIXA 5JAPA 1UDXA 5LMZA 2W8BA 1H2XA 1L4BA 4FW8A 3N2GB 1PLKA 2C0QA 3OQBA 1YDMA 3LXUX 4BB5A 1JA0A 4N3CA 3WSWA 4NNOA 2YV5A 1N5OX 1CPYA 2QD2A 3NP9A 4BWYA 2ZSJA 1R8YA 1HNNA 2W6ID 4XB6B 4WBXC 4BN4A 1TQDA 4JNCA 2XRMA 3EF0A 2DBVO 2BMEA 3G79A 4C0LA 4DA0A 3G1WA 1MVLA 1X1QA 1GGVA 4G5RA 1ZZEA 4QL3A 2LRHA 1PGQA 2Q50A 2NU7A 3CT4A 4F46A 1E61A 1IAVA 1RRGA 2VBCA 5EIBC 8ADHA 4O4JB 1R0LA 3T5GA 3WJ2A 1F5NA 3RI3A 1ZVJA 3FTNA 1HT2E 1QAQA 5A1JA 4KO3S 3V32A 1JDJA 1KP2A 1EFRD 2CV1A 5ENVA 2G09A 2OCAA 1QK3A 4GM4A 2M32A 1WZUA 1TPZA 4W9NA 1ZN8A 2CMFA 4ALJA 1FF9A 2EHDA 3PNVA 5IT4A 3G85A 2H7CA 2OL4A 3WMWA 1HPLA 3EWNA 4FW9A 1ZJZA 2FDRA 1MCZA 1ZGAA 4OLAA 3W5DA 2KSQA 3PUWA 1Y3IA 1ZX1A 2GVZC 3R3VA 3L7OA 4PZCA 2JIQA 4DXAA 5HOQA 3UFXA 1OR8A 4HXEB 1RHJA 1X7WB 4BY9E 3HEAA 2GZ1A 4CZ2A 3WKDA 5EZQA 2OZLA 5ANRB 2J08A 5HPYB 4OO3A 1J22A 1QAOA 1SVOA 3NWOA 2H1WA 5JT1A 1KYWA 4DR5B 1WF6A 2Q5CA 3RC7A 1KEZA 5KOYA 3L7MA 1FTYA 2WC1A 4W8GA 4ABYA 1UAAA 4LE2A 5AOCA 3GLGB 5H4HA 2VJOA 3HR7A 2FW7A 4Z2YA 1DG1G 1HM5A 1WXWA 1VP3A 2ASVA 3F2IA 4FGUA 4LBZA 1SNYA 1N2OA 2HCJB 3H3JA 1ND6A 4JUFA 4YR7A 4ZIRA 3TFOA 2D1RA 4IIXA 1P9LA 2HJ9A 2CNLA 3HWSA 4MPJA 2DOKA 2X5NA 2HJHA 3CRW1 821PA 4WFIA 3CEJA 2JRLA 1MAWA 1QR6A 2D54A 5CAEA 3M3PA 4B45A 3PC3A 2ZIWB 4I55B 2KE5A 2G40A 1N5IA 3LIIA 3TFWA 1NU6A 5FX2A 1CUUA 2HF2A 3IVXA 2DR2A 4BRWA 1RBZA 3OLXA 2OHXA 5J2UB 2RG7A 1CZNA 3CLHA 1AHNA 1NXSA 2LPMA 4TLAA 2WPDA 2ZDHA 1NF2A 3S99A 4TZKA 3TIFA 3VVBA 1LTKA 4KX3A 2XEDA 4FPXA 1JZSA 2WYHA 1KHHA 1C9NA 2DSNA 4FI3F 2WQ7A 3PXBA 1W4BA 4WDRA 5IP5A 4IDHA 1YTUA 3GPLA 4Y9DA 5D1NA 1JB9A 3ZY2A 1E4OA 3G1TA 3IA7A 3ZDEA 1G7SA 4NABA 1D0SA 3RJTA 3H7IA 1R0SA 4WQMA 1E7QA 3BA1A 5LQRA 2ZJ3A 3U4IA 4ARZB 4M22A 5KTKA 2VJMA 4MYCA 5D2CA 3RRJA 5ALVA 2IPLA 5MFPA 2HI0A 4YLYA 3EIQA 3V8NA 1CUIA 3AFGA 4J1NA 2FF7A 5BYJA 1B6GA 3QVKA 5TNXA 3KWJA 2CMDA 2HLDA 5GMOA 4LXUA 3SR4A 4UBKA 1GAWA 1DBQA 4EHJA 2PFGA 2QIOA 3F4KA 4I2NA 2XNCA 3EPHA 1EFCA 5JHHB 1NYLA 4WOPA 4WHMA 4PWZA 4DL9A 5I7UA 3R6LA 4W5RA 2HREA 4GP7A 5C32A 1C8VB 2QTFA 3CKMA 2O3TA 3M1YA 3NVMB 1PVVA 2VYNA 2X9QA 4OK5A 4K03A 4PO9A 2PSJA 3TCXB 5JSQA 3CH5A 3GRAA 1EK6A 4ECAA 1RQ2A 1JWAB 1Q14A 1Y1LA 1X8XA 3KZNA 2B98A 4LF8B 4ETIA 1GUFA 4CRWB 2BKVA 2EATA 5HJ7A 4MMYB 4P32A 3UMBA 2Q5LA 4KDFA 4OP1A 4HDQB 4OHWA 4JUIA 3GLUA 2OYSA 3KT0A 4HMOA 1KFCB 1LLUA 4PG4A 1ZHOA 5DHQA 3NWBA 4Z5XA 1ZM9A 3MSXA 4GSKA 1BX3A 3BXFA 4LXYA 1OI2A 4O4IB 4UJ5A 4L8LA 4CL0A 5GQSA 5J4YA 1D03A 1JYEA 1ZCFA 2W71A 5EERA 4KH1A 3EXFA 5JZSA 2FRDC 4DEVA 1H42A 2JFGA 3W5SA 2AVDA 1XEAA 5LPNA 3V3TA 1J2RA 1W5AA 1Z2DA 3KKLA 2O3RA 3E9YA 4QDUA 5KDLA 4BO2A 1OCEA 4GVPA 2Y76A 2HLDD 5LLSA 5BNZA 3AKZA 1JFTA 3IKLA 3ZGLA 3E8SA 4B6JA 3HCAA 4PZPA 2PX4A 2VEDA 2XA2A 3JTEA 4R1TA 4RHUA 5EI5A 1E0JA 2I33A 2XHZA 1F8FA 2JA2A 1G7RA 1BJTA 4Y0VA 1GPYA 1X2EA 2GN9A 3AW8A 3HI4A 1S89A 4DGSA 4H3SA 4D3ZA 1F0PA 2VHQA 4F6CA 3FH0A 5LQCA 1GKYA 3DD1A 4K3VA 1WUJS 1IEVA 3IBTA 2GLXA 2F8LA 4BX2A 3KYJB 3HM9A 4NYJQ 3CXUA 5GM2A 1NI3A 3CO0S 1QKJA 2R1VA 4PZAA 4OI4A 1EFUA 1DJNA 5B2ZA 5KNDA 5EXXA 1APBA 2GSWA 5A2QA 4HEA6 2C4MA 3CW9A 4BJ5A 2F48A 5JWRA 1AZLA 1ZMTA 1Y6JA 1Q57A 3LO5A 3PUHA 2HA0A 1RAAA 2HEIA 2ZS8A 2QLJA 1U7TA 1WHTA 3G13A 4MV5A 4WXEA 5E6RB 3G5TA 2RAPA 2LCFA 2KB0A 3T1YB 1NVWQ 2H1VA 2I8CA 4QXMA 4IWYA 4JBYA 5ILGA 5EXDA 4EA8A 1FC0A 4Y6QA 4GSYA 1YS1X 3QSGA 2N1BA 3UQYS 1U6IA 2JI7A 1VLJA 8AT1A 2FQXA 3UJNA 4X24A 2RSLA 1OA1A 1A69A 4JH0A 3DLBA 4IXDA 4LOAA 3ROMA 1Q77A 3TNYA 1QGZA 3U4QB 5DSXA 3MRXA 2DF8A 1IUOA 1HKUA 2FNAA 4UMDA 3SYRA 5CNKA 3WAKA 2QTHA 2UVDA 4ALNA 1UK6A 3B5JA 4EFDA 1GZ5A 4HAIA 2ASEA 3UHJA 3T8YA 1EFVA 1M2OA 1ZM7A 2ZAOA 4R1MA 1V1MA 1M2NA 1VHDA 5GVRA 4NYMQ 1BOOA 2BEUB 1BE0A 4Z51A 3ZW7A 3OM9A 4AG3A 2YWRA 3HZOA 4BP1A 2JH3A 2WA2A 3AEQB 4AY3A 2ZTLA 5FYDA 3D3KA 2PO7A 2WLTA 1E8DA 1K27A 1FE8A 1EFLA 2IEGA 2WM2A 4LZWA 5A5DA 3IUPA 3BZBA 2R44A 3TMKA 1F6BA 4TMXA 3S2FA 4BE9A 1T0HB 1L7QA 5MN5A 2ZS9A 3FR7A 4AXXA 2AWOA 1HG1A 2C8JA 3A3NA 5GZ6A 5ENDA 3TCKA 1KK2A 4CU2A 3AY0A 3BRWA 4D9BA 3STUA 3D43A 5DOVA 1U2SA 3ZWYA 1KK1A 1XN1A 3T3GA 4LRQA 1O95D 1SZPA 3OFVA 1X86B 2Q6OA 3VOAA 2GKGA 3AEKB 3FPHA 3UOGA 3WKCA 5FI0B 2QA5A 4AO8A 1LBEA 3HR4A 4P82A 2ZB8A 4TQ9A 4WBSA 1AX9A 3A4NA 3EMKA 3ZY4A 4F2WA 5I7FA 3HR8A 1XRNA 4Q3DA 1LW6E 1BCRA 3VNUA 1QVZA 5KPDA 4IS3A 4Q82A 3TLGB 1KPIA 3WISA 2X7HA 2Q8PA 1WXDA 4P3NA 2BJVA 3W8DA 5JDIC 3CINA 5KYTA 1A1SA 4XWTA 1CHNA 1GPBA 4KR3A 2ZROA 3V33A 2C8LA 4CIDA 3NPMA 4CQNA 5ALEA 4UVEA 2I3ZA 1VHTA 4I8XA 1P5FA 2GMWA 3BHNA 3O5AA 1RQGA 4K9RA 1E3IA 5DYGA 5JNLA 4F3TA 3VH3A 2B7BA 3FZGA 3U26A 1K97A 3DZ8A 4Q3OA 1U8ZA 2ZZKA 1WXFA 1PJBA 2WJVA 3H19A 3MOGA 4HB2A 2MOKA 4UDNA 4KOEC 2I8LA 1A7AA 2XE7A 3VC2A 3RIMA 2ZE8A 4C21A 1WEKA 2PJRA 4H6VA 2G8NA 1B2LA 2J5QA 4WUVA 4G4SP 5TLSA 1KIFA 2R5WA 1NURA 1JSCA 5HJ2A 2BAGA 3LUDA 1JLSA 3JYLA 1PZFA 1PWZA 3IJRA 4EPTA 3G6KA 5BQFA 4RYLA 3CGGA 2QIPA 1TAUA 2HA4A 5K1ZA 5T4FA 4FDTA 1NMXA 5G0VA 1LFDB 3M2TA 5JY1A 1BHO1 4IHJA 3HK2A 1ZCAA 3LLCA 4UUBA 2KJQA 5KJCA 3IH5A 1Q0UA 1TK2A 2BL4A 2WVJA 1FBNA 2MU1A 2ZIAA 4J0KA 4K88A 1G55A 1CR6A 1GQQA 1NNUA 1OLXA 2G8LA 3HNPA 3NGMA 1KFBB 1Z82A 4IGAA 4B7UA 2AC4A 3H9CA 3TQRA 2DQZA 1GNSA 3TAHA 5AQEA 1OHHD 4OP2A 3VSAA 4BLPA 4F2DA 4WK2B 3VGJA 1R6AA 3L1IA 2GJSA 1R66A 5TF0A 2EYUA 2AYXA 1RTTA 3OZEA 3H1AA 3PNBA 1WSBA 4FYXA 3GLGE 5CITA 3FVRA 5BPFA 1YA6A 4REOA 2EFHB 3PD0A 4KDRA 4LKRA 4YYZA 3TPCA 2UYHA 1OB2A 5BVGA 5FLEX 3KQYA 4IFTA 2GAIA 5C34B 1U9CA 5LXTB 5FQNA 8MHTA 2VCYA 2W2OA 4UQPA 4Y2VA 5DULA 1H6CA 1KDZA 1T5LA 1QB7A 4NFYA 1KVQA 3N8IA 4M8LA 1V48A 1ZHFA 3LX5A 3DWIA 1G20E 3JVVA 3ZKWA 5DPMA 1A98A 4AMGA 5ER6A 1JEQB 4GWLA 1E66A 1QPGA 4PWYA 2YJ5A 3LQQA 3SX2A 2Q9AA 4TXHA 5EJ5A 3OC0A 4J2OA 1K7XB 1U3WA 1Y4AE 5AUNB 1FX1A 4YV2A 4RTMA 3EX7C 4DA7A 1YQTA 3ZNQA 2Q3LA 2PMBA 1QK5A 3F5MA 4HF7A 4Y6PA 3FFAA 4CN9A 2VHZA 3KPYA 4IIDA 1T25A 4OUKX 1VDMA 4M7RA 4RXTA 4DSTA 5THXA 1W35A 1V7PC 4I7EA 2XECA 3A1TA 1KEUA 5HEKA 2FXIA 5AI8A 5CFZA 5TY0A 3WTBA 2CKDA 2GJ8A 3VHLB 3GJRA 5IASA 1ZC3A 4ZOLF 3IBCA 1P2SA 3N7TA 1Z38A 3N07A 1FZTA 2HMSA 4KXLA 1PR3A 1PEKE 1R6XA 3KKZA 1ZD2P 4ZALA 5GONA 2Q7XA 2PMKA 1UJ2A 1J09A 1IHUA 1TKRA 2HC9A 2G4CA 2RKWA 5HKAA 4A6DA 5CLIA 2C7GA 1IZ7A 2PZAA 3R0IA 4TS9A 3DR5A 3L7CA 4RKQA 1NR5A 2XCUA 3EHDA 4AX4A 1BGXT 3STWA 3FPLA 4G63A 5K0JA 4ENTA 1AG9A 2K4MA 5AHKA 2ZE7A 5EGSA 3GRKA 3K20A 5A7GA 1QFYA 3LFTA 5KJEA 4OX9Y 3LT0A 3IPRA 2O50A 3CG4A 3FBWA 4LSWA 3MZ0A 4FILA 2Y0DA 4Q1CA 3NETA 1TAHA 2R00A 1JTFA 3TRIA 3HVIA 3K1AB 4QBIA 3RK4A 5H5JA 4FNMA 4I55A 2OD7A 5DTEA 4Z6KA 1T9GR 1W2WB 4WD3A 3LVBA 4Y0NA 2OHVA 3EGWA 5JQGF 2NO0A 5LC1A 4TVBA 4OOFA 4YXWA 3D3EA 1EB8A 3K9CA 3TECE 2F8MA 2G1AA 1QK4A 1RWBA 2RHMA 4OL0A 2NUBA 5ESRA 4CLRB 1CT9A 4NCBA 5D01A 1K68A 4LAFA 2YV4A 4IOKA 2I7DA 1K66A 2CUTA 5KWSA 2YICA 3PPWA 2VHCA 3OE7D 3WIUA 3ZBUA 2QJRA 4NCIA 4EFNA 2JIBA 1WS6A 5EIBD 1GCGA 3LUAA 3OEHA 2B36A 4J2TA 3ZWXA 2AH5A 3A4VA 1LWNA 2OD2A 3MS7A 1SU6A 3A7EA 2QV7A 2QYHA 2XB9A 3OWOA 4C76A 2NNWB 5BN4A 4CMIA 1P7VA 1XZGA 4PCVA 4E1VA 2YKGA 2EJUA 3P32A 1H4VB 2HRCA 1JMVA 1O58A 2G5CA 4JU9A 4DJJA 2G9ZA 3UWMA 1ZSYA 3VFDA 1NBIA 5FV4A 3C3YA 4L8YA 1QH9A 4Z4GA 1Z6QA 2FUKA 3FZYA 2BZSA 3CSDA 5DHTA 3PXGA 1YDFA 1RZRD 2DFNA 3ZCTA 3FNGA 3FZNA 3RVSA 5KJ6A 3LPLA 2X19A 4JT4A 4PX2A 1N77A 1PFGA 3W7VA 4IH1A 3PYXA 2WYVA 4EGAA 5FO0A 1GQRA 4KPUA 2GJ9A 3AF0A 3PKZA 3A1CA 3L4SO 2JI4A 3HP1A 3PITA 3VR6H 5JROA 4OK3A 2DQKA 4JI0B 3L0ZA 1R6UA 2P2SA 1XZ8A 4G67A 3UAVA 4HFMA 1LPPA 3H84A 3HMQA 2Z2XA 2Z98A 3IUSA 2PZGA 3QPBA 4JB2A 1DO0A 4LUCA 4ND8A 4UCXA 4ZJUA 4BCDA 3FRIA 3D3NA 1C80A 2QP9X 3QNMA 4DCJA 3ZIAD 1HT0A 2P35A 3U40A 5D51S 1A9XB 1N6OA 1U31A 1TMYA 1FQKA 1V45E 1U94A 1FRZA 1M0WA 1U1FA 2GD6A 2RCYA 3HB1A 1CHDA 2L69A 1Q0RA 1ZAKA 2AFHB 2ZBUA 3QXSA 1N0IA 4J43A 5IAJA 4MUYA 1GRCA 1ML3A 4F1WA 2XV1A 2CY0A 1YQXA 4LZAA 4LDNA 1SU8A 3FCOA 5AVOA 1BROA 2W2NA 3U37A 2CXPA 1JKXA 2ZWVA 3RAEC 4KR7A 4HN9A 3OZVA 3KBBA 1A8PA 2B3TA 3N7AA 1SFRA 4F2PA 3R7FA 4Q37A 1D8TA 2GCNA 2SKCA 3PC6A 1YB5A 2PMEA 4AFNA 5C46F 3HUFA 5KCZA 2QZSA 1B1CA 2XYHA 1YMUA 1YB1A 4LMPA 4FOSA 1GUDA 1MJFA 4P86A 4Z3DA 1XO1A 1Z16A 4E15A 1Z75A 2I2AA 2WHPA 5JJKA 1HTTA 4C22A 1S8NA 4O2LA 5JH7A 5DBIA 3C16C 3Q0EA 4FSDA 4BNGA 5B3AA 1SUDA 4X93A 4M9XA 5KIAA 4OAPA 3E15A 3H1PA 4FFOA 5I7AA 1E5QA 1MLDA 2VAVA 3KYBA 4CT4B 1I7DA 4GMXA 1ULAA 4CFSA 1N6NA 1B76A 1YULA 3GN1A 5AI6A 1UP4A 3FDZA 3KJNA 1FDIA 4KR2A 2AR7A 5IUKC 3PV0A 5BSFA 2JFOA 4D4JA 3EXHC 4KQHA 3HQ4O 4KWHA 3IEVA 5ITWA 3FOBA 3MELA 4GI3A 3PTZA 1CZOA 2NT3A 2ZJZA 4AZSA 2E3JA 2RGRA 5UKDA 3EOZA 4D9EA 5CT9A 2UZ4A 5AVWA 4X1YA 1WZEA 4IZOA 1JQEA 4Q3BA 4XM0A 2ZI9A 3D02A 3RVJA 3LC7O 2ZB7A 3ZHUA 3FCCA 3FCXA 3THSA 4ESVA 4MQFA 4QOEA 3OPQA 2WRZA 1Q44A 2VA8A 1HT3A 2YHBA 4NYIQ 4TXJA 4F3NA 2JFBA 2AGVA 3FOEC 5AVRA 4DKXA 1EUZA 3UWDA 4C2AA 1U1GA 2HSWA 2R7MA 3NHZA 4EW6A 3UO8B 1PYOA 1PV1A 4MHTA 1QOZA 1CG6A 3UMFA 2GD1O 5EE1A 5HBGA 3U5TA 1LRLA 4CFYA 2R47A 3N58A 6NULA 1FQWA 3LBFA 3PUIA 2WP0A 5CCBA 5B2EA 1BH6A 4M7PA 4WECA 3VOTA 1DC7A 3MJCA 5DU2A 2JEYA 1QH1A 3IVAA 1JAHA 3QLUA 4NZNA 3IEUA 3NBAA 2OK7A 4Q4JB 5B37A 1PP4A 2Z2JA 3ESQA 4BXOB 2PA0A 1Z4QA 3GCWA 1XD2A 3AM4A 1KR5A 3LVRE 4BNDA 3RADC 2OYCA 2W90A 1XMSA 2DG2A 2FG7C 2H08A 3AG6A 3GZJA 2HRDA 2QM8A 3AEQA 3ROGA 3ZD6A 1CY2A 1JAYA 4HZIA 1TO1E 2X2FA 3KWFA 1L5WA 4BIIA 3PJRA 3WGHA 4Q19A 3O26A 1NQ5A 2AOTB 1T1SA 1SIWA 2D0PB 2VUIB 4PPNA 4CKEA 2JIZD 4RTNA 5L7WA 1NG1A 2VBGA 1IJEA 4BJHB 1RKXA 1SPBS 5DEOA 3NUZA 2C42A 1JPUA 2W7TA 3IPYA 4FGKA 4HBGA 2D0DA 3WZ2A 2EZ4A 4RSHA 4RTQA 4PAOA 1CUBA 3IVRA 4XIFA 3PB3A 1UOEA 4DYVA 4F8YA 5DBGA 3UV3A 5FB3A 1G3QA 4WJLA 2PZKA 1L3CA 4RJ2A 1NUTA 1C0EA 5LR6A 3WKBA 2BN4A 2IT1A 3P9NA 3ZIAA 1JPJA 2O5RA 1KSHA 1UKCA 4LTNA 2DCMA 3PJEA 3UW3A 6REQA 3KQKA 1G3MA 1DJPA 1JVNA 2EFDB 1K5DA 3K5IA 3SS8A 3I72A 1M2KA 1Z0JA 1YFKA 2BEWB 4G26A 1T4GA 1W0KD 2B7CA 4J76A 4S1VA 1M6WA 1LPOA 5DHUA 4YP6A 3AVQA 3DMTC 1XRQA 3PRJA 1ZJ6A 3VISA 2NIPA 4G1EB 4W99A 3UG7A 4GZMA 5K09A 1YI1A 4XUGB 4B4DA 1LPBB 4F06A 3ZEIA 1AIPA 4PU0A 1TT5B 1W93A 4KGZA 2CLHB 3B3GA 2VJDA 4MQ5A 3N0TA 4UHEA 4WCDA 5FTWA 5ICMA 5JCOA 1O54A 2QVYX 2FE4A 4DDUA 5BVHA 1ZQ9A 1TGVA 2YS6A 4YAJA 4B8YA 9ABPA 1IQPA 1DBWA 5L3SA 1X0XA 1OQAA 1KFJB 3PNMA 1E2LA 2WAAA 4HXYA 1L3BA 5CPBA 3JZMA 4X84A 4ILEA 2D7JA 3KKOA 4OYLA 1NLUA 5ALQA 1RDFA 2UYCA 1A8IA 3GXOA 2P68A 1C50A 4PC3A 2R6AA 4S0XA 3B82A 2ZJ0A 1A9ZA 3W90A 3WBFA 4JJGA 4IBOA 1G64A 1NUAA 5D1HA 3EOBI 1HEYA 4N12A 3CF2A 4KQ6A 4P4UA 4BZXA 1JFSA 2BH2A 5DNCA 2Q3EA 2A57A 3C3PA 3SQDA 3TZCA 3WRYC 4ND3A 1K0UA 2F43A 3CC8A 3FTQA 4ZC1A 3T41A 4CR8A 3I76A 2HM7A 2BKAA 3Q3VA 1QRAA 4DA8A 3QLVC 1G2OA 4KO1S 1RRPA 3T7JA 2EZUA 3D31A 3WOVA 4XAQA 3ER8A 3TEMA 3SC4A 3M6LA 2EERA 3GCZA 4KB5A 2A9QA 4ZVRA 3AF1A 1T9DA 2JAPA 3V1NA 1EEXB 4KIGA 5A62A 1FSPA 3O1JC 4NCJA 5KVQA 4CV1A 3PCTA 5AVSA 5M34A 4S1PA 3KZOA 2JJQA 3R5TA 1E2IA 3ISJA 1E4EB 2DPGA 3UV7A 4QAQA 6PFKA 2B30A 4F2HA 2VRNA 4M99A 4FOLA 2Q3FA 2WKSA 4K9KA 4P34A 2J9ZB 2XGJA 4HDKB 5LNK1 2JLXA 5D3ZA 1Y6ZA 1KERA 4V0SA 2V6MA 2J6IA 4DDHA 3I61A 4I55F 4QOGA 5B7PA 1OWMA 1YJQA 4X85A 2X23A 3A6ZA 3OHMA 3QTBA 5CJ2A 2OBXA 1RR6A 2RKOA 3NYIA 1ZL2A 1F1BA 1IY8A 2ZBPA 2IX3A 3QA3E 2QUAA 4CI0B 2PO5A 4A8HA 3GWZA 2JI8A 2PSDA 3LX4A 4NBNA 1FS5A 3KDPA 4MEJA 5F2EA 4QT4A 2XUFA 2B4RO 3IERA 1NBAA 1YRBA 2G6TA 1ZH8A 2ZBEA 4MQEB 4UARA 4LF7B 4BVEA 1QGUB 2CXQA 4L3WA 2ZYSA 3AU8A 3DBLA 3QFCA 3QPDA 4LYDA 3HWRA 3V7YA 4HRXA 5ITZB 1IIRA 1M6HA 1M1NB 2GILA 2EJVA 3AUJB 3P5BA 1P1BA 4L7QA 4QJBA 4TSFD 3VSCA 3E70C 1CFZA 1PJQA 4XQEA 2OV2A 3LBAA 4NL4H 2NZXA 2I1LA 1SXGA 5FUVA 4PVCA 3UYKA 1GAQA 3GNLA 5HFAA 3G9UA 2BRUC 2ZI4A 3HWWA 4MRRA 4YJHA 2QLLA 1WOYA 3AVOA 2HO5A 3L6OO 1MAHA 4MA0A 4PLTA 4DIEA 2NADA 2DUUA 2XYQA 3GYGA 5JXWA 1SXJE 2OOKA 1F14A 2DJ5A 1T2DA 4EX6A 1AGNA 1GGFA 2C03A 2IE8A 3MB5A 4RGYA 2JH9A 4Z2AA 1FDRA 1VECA 2BEVB 4J7XA 4FFLA 2GEFA 1FTQA 3K6SB 3KOOA 2DBYA 1SU7A 2GLTA 3D2BA 3IT1A 3LOQA 2Q3CA 4WOKA 2ZAMA 3PFGA 3S2UA 1TYCA 3Q6IA 4BFLA 1G8PA 3A4TA 3AOGA 3PXXA 4JI3B 3MS4A 2H0AA 2G08A 3GBVA 4AZTA 1Y7TA 5IUJC 1CERA 2C9CA 2NOAA 2IDMA 5L9AA 4EY6A 1R74A 2PVCA 4R5MA 4I4NA 3X1JA 1PJ3A 4MITA 4LCBA 1HDYA 4L3VA 1J1UA 3KFLA 1VG8A 4ALKA 3DOEA 4G5XA 4HUTA 3T1HB 1YFLA 1IBKB 4WUTA 1STOA 1J42A 1KSGA 4PO1A 5DEIA 3V4ZA 3OPYA 1TJPB 2HO4A 5DLEA 5K8VA 5A04A 1J8FA 4BHTA 1FDUA 1QKKA 3WGLA 1UFVA 4UBMA 1QZXA 1S3IA 4RK4A 3N70A 1W59A 1SUAA 2IYOA 5L6MB 1TMGE 2ZRDA 3L1KA 5ECWA 5BSGA 2EZ9A 2I4IA 1Q7GA 2IKQA 3EN0A 2EEPA 2WKWA 3B6IA 1XTIA 1XZBA 2OWDA 4D3DA 5HXAA 5DM4A 2H5IA 2HIGA 1W49A 2NU6B 4P7BA 4FD3A 4LFAB 2R87A 2BBSA 4L5CA 1GPLA 2KS6A 1ZIYA 4U2KA 2P75A 1RJEA 1W9MA 4KFCA 4DR4B 4UATA 4J3JA 5JJBA 4OI0A 4Q39A 2X6TA 3CNHA 3G8YA 5I7OA 4PY2A 3MFQA 4DSOA 3TLBA 3IGFA 2QL5A 3LX6A 3H0EA 2VRBA 3TPZA 4UM8B 3GZNA 2OVBA 1ZINA 1FJGB 1BS2A 1P2TA 2OO3A 1TU3A 2C58A 2QRVA 2HHJA 4M1YA 4CLHA 2XVZA 1QP7A 2ZT6A 1XJCA 3QQPA 4TKLA 1AGYA 3KSMA 3ETDA 1N7HA 3PC8C 2AC7A 4M0UA 3WOHA 1ETUA 2QSJA 3IURA 3QMMA 3HCEA 3S44A 4L72A 5GIOE 3B7WA 1O8CA 3JZDA 1D4ZA 5CM2Z 3SICE 3AEUB 4XX0B 1DRUA 2R5FA 1Z06A 3CZAA 4HVTA 2ZR9A 4MDYA 1JEYA 1QRDA 1P7YA 4R1OA 3HPRA 1E79D 4LXXA 4S24A 1U2EA 4KEAA 3URKA 4DMLA 2AI3A 3AR3A 3HCFA 1SK8A 3BGIA 2EGUA 2JS7A 1V37A 2C9MA 3H05A 1JA9A 4FFNA 4HNHA 4JN6B 4XCXA 5CNIA 3O47A 4PW0A 2QPAA 5F73A 4AY5A 2HKIA 1QIFA 3MWYW 1FSZA 3WA7A 2EBHX 4R7TA 1HE4A 5F9HA 1YHNA 4TTTS 2C9OA 3T7IA 3SSOA 3SPXA 5H68A 4BAZA 4ETWA 1LFAA 1OC4A 2PZLA 4KV9A 4WINA 4NARA 4W6QA 5SZHB 1DAGA 4JT8A 4HYQA 3U1TA 1MABA 4OV6B 2P6MA 1E2PA 4UMVA 4FDVA 2BR4A 2W2KB 1UDAA 4H27A 1KZ6A 3TNDA 1BA2A 4FS8A 1Q1GA 1US8B 4LMRA 2PH1A 4YWJA 4AF6A 3HB4X 1KK3A 3IEKA 3C48A 1OLUA 3CEPB 1D5CA 3SHOA 1VCMA 4N8EA 2H29A 4GQIA 3UVEA 4JYZA 2I55A 3GVHA 3L43A 1HZJA 2BP7A 3DAOA 4IR7A 2D7DA 2QNRA 4KE9A 3KEQA 1F8UA 2I2DA 2J6HA 3BTSA 1DXOA 4IOLA 2J1LA 4RF5A 4JVSB 4B0OA 1K8QA 3UQZA 3KPVA 5DYWA 5EQJB 4K28A 3LM8A 4F21A 1NOJA 2JFNA 3TLYA 3LNTA 5JIBA 3G0CA 4HWTA 3Q8KA 4X94A 3WVNA 4Y18A 3ZH9B 2IF2A 3C6XA 4FYVA 4I66A 1EJ0A 2B94A 2XUPA 2IPXA 1RBYA 4INAA 4KQIA 3BXGA 4HNGA 3OQNA 4R9NA 4OJMX 3GRFA 1A2BA 4DAOA 4JSYA 2C1ZA 2GESA 4TYNA 1JXQA 3NEPX 3VAZA 1KQOA 1QH8B 1UBFA 2C29D 3ILXA 3SF8A 3B9PA 1DV2A 1NQAO 3L0PA 3R7AA 1BQEA 2K7FA 4GI2A 1F2DA 1WX1A 2PZBA 3DVSX 3GLFA 2O1EA 3FGZA 3V97A 5A0TA 1EK5A 2Z3VA 1ZYUA 4FJ0A 4PXAA 3DQQA 5DNDA 1V43A 2XGSA 4NMMA 1VRCA 3OVMA 5BN1A 5LIPA 3GJ8A 3WG9A 2C2WA 4OXRA 3RS4A 3RAFC 1CB7A 4KLAA 4DJTA 4ER5A 1CQJB 1LPNA 1K7CA 2O2ZA 4FBGA 4FI3C 3JAKA 3TI9A 1CY0A 1XAJA 3NYQA 1GPH1 1RABA 2G70A 4C0BA 3WJAA 4BO8A 5BORA 5IDWA 3THXB 2YJGA 4CG2A 4V2UA 4RZXA 1ONPA 2H2HA 5EUBA 4K3UA 3FHCB 3S2YA 1MO5A 3B1XA 1T6XA 4HAVA 1XMQB 3CONA 2X0DA 4ENRA 2FCRA 2Q62A 2BHRA 2L18A 2ZVQX 3VPXA 2WG0A 4IWXA 5IVIA 1D0IA 2HRBA 2BF7A 5LWHA 5L4LA 3FNBA 4RAQA 1N5MA 3WHKA 1EE9A 3AZPA 4FCCA 3UJ6A 3RVMA 4ZAXA 3FUUA 2JL1A 3V34A 3KYCB 4EGCB 4ZI7F 2D7CA 1HDGO 4F3YA 3R23A 4DEYA 5LP1A 4HWSA 4IRUB 3W1EA 1I3MA 1JU4A 3G2KA 1YOVA 2CNBA 5JMPA 4O4HF 1RFGE 5LP6F 2Q5OA 3AJEA 1FFSA 3EXHA 3M6WA 3SVLA 4MUGA 3L6DA 3DULA 3N2LA 1EDOA 1QC5B 1ONSA 2FMKA 3DTVA 5LLTA 2Y3IA 4Q34A 5JJCA 1T43A 1P60A 3HXLA 4RPHA 3GJ5A 1M1YB 1XU4A 1GEGA 2GZDA 1HFEL 3OCZA 2WVAA 3GFTA 4M8IA 1F20A 1II8B 5ICEA 3A58B 4TS4A 3DTTA 3PZBA 2ZSFA 4EVIA 2YWBA 2ORVA 1U28A 1DOAA 1SCUA 4XGKA 2D06A 4MV7A 1PL8A 4GH5A 2MSKA 4ZQGA 1LDEA 2YUTA 3PXDA 5FPHA 3W1WA 3WGOA 7YASA 3E7WA 4OREX 1GXSB 1WXQA 2ZRIA 2KBFA 1OXKB 3MCWA 3RUPA 1W1WA 2GKOA 2X86A 4U3JB 1ATZA 1QYIA 3QKWA 4XQ9A 2X0RA 4ZCIA 2IP1A 2QSYA 1N4DA 5DYTA 2R1TA 5FWDA 3LF1A 3E61A 4NZ9A 4MVJP 5REQB 2D1QA 3ZD9A 1RAGA 2D4AA 4B4OA 1QM5A 4N8DA 2UZAA 5GONF 3UJDA 1KVUA 2REXB 5FDFA 8OHMA 5ELLA 4KDCA 3SQOA 1TT7A 1ZMBA 4OFXA 2NZ2A 4ICIA 3BQNB 5IC6A 2RH4A 3HO8A 4FJ1A 1KAMA 2BOVA 1JMKC 1VTKA 2BV3A 5E4JA 1GNQA 3D0OA 5HA5A 1ZNXA 1VJDA 4OKIA 1JR2A 1CS0B 3AJDA 1XEWY 3CIFA 4AD8A 5J2UA 5BT8A 1U8CB 5CLLA 2O14A 4J49A 4U5XA 4F9FA 1SRRA 4RLFA 4WZBE 5EFZA 2XCQA 3CJQA 3EGCA 5EEGA 3C39A 1KVRA 5KX5B 5LZ2A 5EJ4A 4HN2A 4YGYA 5FWYB 1Y48E 4MROA 2J6BA 3FYUC 2TMDA 2NZYA 4RWZA 4UNPA 4ND2A 3VGPA 4V1CI 2YZGA 4NBLA 5LQJA 3LQ1A 1DQSA 1JBQA 5HR5A 3H11A 1XU7A 2CHFA 4Y2QA 2POQX 3NVKI 3PVSA 3MWDB 4BLQA 1LB1B 4QPZA 5T5QA 2VWGA 1NC1A 1Z6ZA 4N3GA 4O3FA 2R7NA 5EUQB 1MB4A 4KXVA 3UWKA 4UNQA 3ZI7A 1DO2A 4ZICA 2IYPA 2J0UA 2AYYA 4TTJA 4XPZA 2V7WA 1PK7A 2VNKA 1GN8A