1FMJA

Crystal structure of mercury derivative of retinol dehydratase in a complex with retinol and pap
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
PFPYEFRELNPEEDKLVKANLGAFPTTYVKLGPKGYMVYRPYLKDAANIYNMPLRPTDVFVASYQRSGTTMTQELVWLIENDLNFEAAKTYMSLRYIYLDGFMIYDPEKQEEYNDILPNPENLDMERYLGLLEYSSRPGSSLLAAVPPTEKRFVKTHLPLSLMPPNMLDTVKMVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAWAKRHDPNMLFLFYEDYLKDLPGCIARIADFLGKKLSEEQIQRLCEHLNFEKFKNNGAVNMEDYREIGILADGEHFIRKGKAGCWRDYFDEEMTKQAEKWIKDNLKDTDLRYPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RETINOL DEHYDRATASE
publication title A helical lid converts a sulfotransferase to a dehydratase.
pubmed doi rcsb
source organism Spodoptera frugiperda
molecule tags Transferase
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fmjA00
1P9RA 4Q19A 1AS0A 5GJVC 4K46A 5EQTA 4N1AA 2CL7X 5J4HA 3LLMA 3KKOA 4D4LA 1XEXA 1GL7A 4GI7A 5FL7A 3T1TA 1TQ4A 2F1HA 1OSNA 3S1AA 4DLWA 1OIVA 1OKKD 1HURA 2GJKA 2OCPA 2OZEA 3ASZA 2KE5A 4EJSA 1XP8A 1IJFA 1D9ZA 3K0AB 4FMDF 4JMPA 4OJQA 3U60B 3OIVA 3D7MA 5JI2E 2O8FA 3TVTA 1XEFA 4XTRA 1C9KA 3CRVA 4G5GA 5CIWA 3OHMA 3QG1A 5KYKA 1WA5A 2QAGA 1MR3F 3CR7A 4GL2A 2ZPTX 1SVIA 4D0LB 2X1VA 3TUIC 3TK1A 4MQBA 3X1YA 2RGNA 4P4TA 5AR1A 3VMFA 5FR1A 3L0SA 1W4AA 1KKMA 3PUVA 5IK2A 3W6NA 2QQEA 1JAHA 2A3RA 1VYVA 2VQSA 1E0KA 2WSMA 5EUMA 4TYPA 2GXUA 5KDLA 1GL9B 1L4UA 1MOZA 4WXRA 2FDCA 4RFSB 4DC9A 2FMXA 5HCNA 3ICEA 4RCZA 3SYKA 5IT5A 3U44B 721PA 2J41A 2D62A 1JJ7A 4PPQA 4BLTA 1JEEA 2VHTA 2C77A 2ZSBA 3QIAA 4TLBA 2GJAA 4MKFA 2FPLA 4BFYA 2WJYA 3QKSA 3W6PA 2QPAA 2O52A 5J5CA 1W47A 1Z22A 1E9RA 5EXPA 1IN6A 2CJWB 3RAPR 1QHGA 3QNUA 3TSWA 1IJEA 3FMFA 1KAOA 2XOKD 4IXMA 3UATA 1SQ5A 3CF2A 1TQ6A 4PO8A 4HLUC 2FG5A 3DZDA 1Z3IX 5JJIA 3B7GA 1QZXA 3W8RA 2FN4A 3AVQA 1XDBA 4LI0A 4IDPA 4LZZA 3TKLA 3WHLA 4IEEA 2J0SA 5DH9A 2KI5A 3FKSA 3W5JA 3W8NA 4A2WA 1NP6A 1WXQA 4QGFA 1DAIA 1KMHB 3IEUA 4FCWA 2B8TA 5JRJA 2ONJA 1PLLA 4DLYA 4B33A 3FKQA 5KNDA 1ZCBA 3KXIA 4Q9KA 4DDVA 4OI4A 2NO6A 1RRFA 1RW4A 1GIAA 1II9A 1G3RA 2C8VA 4A0RA 1NMXA 2XJ9A 2Z0MA 4N3NA 1KI1A 1T8TA 5TB5A 1XJQA 2WJIA 3IPXA 4ZKDA 3EX7C 4M1OA 4F4JA 1EGAA 5FTKA 2VP6A 1NIPA 3A8TA 4MYHA 1KGDA 1W5TA 2QNRA 1Q1ZA 2XTNA 1P2UA 3IQXA 4BEBA 5CB8A 1JXOA 2GCNA 3ONWA 1OH7A 2JJ2A 3BBPA 2IUTA 4TSFA 1JB1A 4C0AC 1MO6A 5A5GA 1VIAA 3AF2A 4PX9A 4LRWA 3FPAA 2YJTD 1YZUA 3AB3A 2JDIA 4YDHB 4RZUA 4A6PA 4C0HA 1ZJ6A 1W0KA 2ZJ5A 2IS4A 1JR3E 1E2NA 1VG8A 2R6AA 2OHFA 1VCMA 1OLOA 4X8LA 2HEIA 2AKYA 2BHRA 3AF1A 4KLZA 4L9WA 4Q9IA 3T34A 5EP1A 5E7MA 5D3QA 2Z5FA 4I4LA 1F3OA 3ZH9B 4QJ5A 1OXUA 2IYSA 5D3MA 2ZRLA 2H7VA 3BS4A 4GOKA 5FBVB 2WMOB 1NMYA 1OYYA 1ZUHA 3DMNA 1PUJA 1L4YA 2YWGA 1F2UB 2QI9C 2OCAA 3MWYW 4YLGA 4I1OA 4R71A 4Q66C 2AD1A 2XSZD 5FI0B 2ORVA 4OK5A 3TQCA 1PVOA 1BMFA 5J4VA 2W2TA 3VAAA 3DPUA 4PFSA 3L0IB 1X8LA 3SHFA 3E2IA 3M1IA 4LV8B 1Q12A 1NJFA 2VF8A 1I2DA 2JA1A 4R2IA 2QBYB 3WRXC 4I99A 2CMKA 1ZM7A 2P0EA 3QY0A 4M9SA 3N5CA 4W7SA 1ZNWA 2RGXA 4W9MC 2J7PD 2AR7A 4BLSA 2Z4RA 2RGBA 2ODNA 5KOYA 1OH6A 2WJVA 2OAP1 4KFTA 4Q9JA 3IHWA 3WY9A 5J4KA 3THWB 3BFVA 3K8YA 1CEEA 1Q3HA 4QGHA 3QXCA 1N6LA 4LSGA 4ASUD 3KX2A 4DLRA 1NI3A 3L82B 3AVYA 3ZIAD 2D06A 1P2VA 5A0FA 2O8DB 2YVUA 5GJBA 2YC2C 3KJEA 1X8JA 1GM5A 3M0EA 1KI7A 2EWWA 2ZSDA 2VP2A 1BKDR 3LVRE 1R10A 3EC2A 1COWA 1ZUNB 2WPDD 4URUR 5EXXA 1G16A 3NHBA 4MA4A 2BIFA 4D4KA 3MAAC 2W83A 5JRZA 1N0UA 2FZLA 2YZ2A 2ZU0C 3A4LA 4DDTA 4TTRA 2GJSA 4PANA 2QZ4A 4YC7A 3EZFA 4YXWD 1G291 3MMPA 1G7TA 3EC1A 3KKNA 2BM1A 3A1WA 4HAWA 4E22A 2O8EB 4QL3A 1ZBDA 1YRBA 1ZC4A 3SFVA 5KPDA 3H2YA 2QU8A 4HDCA 3QQ5A 3VR1A 1II0A 1X1RA 2AKAB 4B32A 4PHGA 2JLXA 3U4QA 4Q4JA 4AIIA 3H0KA 1EWQA 1CJVC 2OXCA 2ZRPA 2CDNA 3RS3A 4F7WA 1YRAA 2J3EA 3TBKA 4KJZA 2FSGA 4LC1A 4ARZA 2HDNB 2WOOA 2FJUA 3QKUA 2QT0A 2WJHA 1D8TA 3DM5A 4DB2A 1N6RA 4GBMA 1FFHA 2YKGA 2IYVA 2OLJA 5KHOC 3PQCA 2FOLA 4LHWA 1UFQA 4US2R 2H5EA 1S1MA 4A2QA 3CIOA 3KUCA 4LJ9A 4ZCLA 2XB4A 5E4FA 2C5LA 2WSSD 4HZUB 2CLDX 4BZXA 1PJRA 4A92A 1OF1A 5C4GB 1SHZA 2AD5A 1XPOA 4JLJA 2H16A 4W5JA 4B3GA 5JS7A 5HPYB 4OQLA 1E4VA 2QY9A 4C2UA 4NCJA 3VNVA 3U3JA 5JSZB 2JJ1D 4RKEA 1Z2CA 4U5XA 3WMGA 3GJ3A 4URVR 3I4LA 2W2VA 3GLFE 1HA3A 1LF5A 1YZGA 3RSOA 2EU8A 2D2EA 4FMCF 4IFBA 1XFAA 1X1SA 2CVHA 4MRPA 3BK7A 1G18A 1W1WA 2QGZA 1E2EA 2VBCA 1DAHA 1GILA 1G17A 1JAIA 4OHXA 4XWAA 2JATA 1IN8A 1NJGA 3QBVA 3RS2A 2EFEB 3R20A 5DI3A 1U0LA 3PUXA 5JCZA 3AGPA 3NWJA 2P6UA 1XEWY 2OBNA 4CEJB 1EWRA 2W6ID 2Z4SA 3CH4B 1YKSA 4O0MA 2A78A 1U2RA 2IEYA 3BIFA 3X1XA 1RFLA 4GDFA 1TUEA 5M04A 3PXGA 1N5JA 3K0EA 3IEVA 2ZYWX 4M9ZA 2BDTA 3T12A 5G3ZA 4HUTA 3FTQA 4MGYR 1XTQA 821PA 4AYWA 521PA 1FP7A 2W00A 4MKHA 4RSGA 2VHCA 1E2DA 1P6XA 1E96A 3AVXA 2DB3A 1T9HA 2Z83A 4LJAA 3RNLA 2C9YA 4BEJA 4F92B 3VR5A 1YR6A 1M7HA 1Q1QA 2HLDA 3K9LA 5KSOA 1W36D 4ITRC 5KNBA 3B78A 1GUAA 1SVLA 2BVNA 2OBMA 3RS0A 4DCUA 2ZETA 4JT2A 1TX4B 3BFKA 5H70A 3K1JA 2DWPA 1U99A 1GVNB 2XGJA 4H1UA 3GLHB 4P31A 5G3YA 2ZRIA 1QG4A 1P73A 2GEVA 2VIIA 5F3WB 1KK2A 3TVDA 4QNMA 1BYUA 1MABA 1SXJE 4TTPA 3K0AA 2EFGA 1G3MA 4BUJA 3TR0A 3LBIA 4ZDKA 1OFUX 5JS8A 1G19A 2V1XA 1SVOA 3TJZA 1CKEA 1YHNA 2YHSA 2J59A 3SHWA 2AX4A 4Q01A 3GLIB 1GKUB 3VHXA 5EZ6B 3C5CA 2UZ3A 1E2HA 5J4LA 1P9WA 1T5LA 3WMFA 1ZIOA 2YWEA 3BH7A 2G83A 1NSTA 5TARA 1SHKA 4ERNA 2AFIE 3EXAA 4R9UC 1HQYE 3GD7A 4D81A 4P4SB 4CT4B 3SQWA 1Z2AA 1Z5ZA 4A0HA 1XNJA 3THXB 5LB2A 2QTVB 4WVFA 2WMNB 1G7SA 3HR8A 3GMTA 1Y63A 3VU9B 2CLSA 2V1UA 4KO8A 1AKYA 1ESMA 1JXMA 1A2KC 1KSGA 5FL7D 2PX0A 2RH5A 3UG6A 5EE5B 4V03A 5JCPA 2FNAA 4JKYA 4UJ5A 4HI0E 3TIFA 1FNNA 1RJ9A 3RS7A 3RDPA 3U3OA 1D2NA 2OUKA 1YR9A 4X8HA 1P7CA 2OFWA 2GAAA 4JZKA 1OJLA 2ZJYA 3LBHA 1SGWA 4GZMA 4WIAA 4BLQA 1CR1A 4LWZA 2LKDA 4PC6A 1IY2A 1EK0A 4V0LA 3LQQA 3B9QA 2R9VA 1RKBA 4B2IA 3EA0A 3PR1A 3WP0A 3TAHA 1IXZA 4PXAA 1OXSC 4Z54A 1R6BX 4E07A 1RPZA 3CKLA 5BQ5A 1EXMA 2WM9B 1VCNA 5CYPA 6Q21A 4HSEA 2ZIAA 2BC9A 2JJ8A 3OFND 5KSPA 3QEJA 2GBLA 3U3MA 3VR3A 4JLOA 3CONA 4EJSC 1E9AA 2JLVA 1EG7A 1CR0A 4FCTA 1W48A 2OFOA 5F9HA 2NO1A 4KYIB 4AG5A 2EWVA 1NVXQ 2AHOA 1WDTA 1DOAA 2JGNA 4AKEA 2FF7A 4RD0A 2YWHA 5E7JA 1KZGB 3CNNA 2ATVA 2F43B 2QRZA 4G01B 3RS4A 1F5NA 4NBSA 1R0YA 3X2SA 5GJWC 4DT1B 3OEHA 3FHOA 4JS0A 4CGZA 4QC2A 1KHTA 2E1RA 2ZJ8A 3ZJYA 1TU3A 4PR0A 4TLCA 2XXAB 3U7EB 2JLZA 4PZLA 1FTNA 4UXHA 4IVRA 4A2PA 1S1CA 2ERXA 4MRRA 1HE1C 1GKYA 1P2TA 1RVDA 4BE7B 1DE0A 4JLPA 5TXGA 4WXPA 4DDWA 3NH6A 5AJWA 2CCGA 3GEEA 3NBZC 2QM8A 3E1SA 2Q3FA 3R7WB 2FEMA 2DFNA 1U8ZA 1XCPA 4Q03A 2FZ4A 3T1VA 1R5OA 4KBFA 4NYMQ 2VP0A 1TQ2A 1GOTA 4CT5A 3Q8XB 5EE1A 2ODBA 1FNMA 5L3SA 1WBDA 2P65A 1J8MF 3SE0A 1FMJA 4ZCIA 2C9OA 3MWKA 4GMDA 1NBMD 4TWZA 3CH5A 3BB3A 3MSXA 3EWSA 4DLVA 3SOPA 1VCIA 1QVAA 1TMKA 4BASA 1E2MA 1CXZA 1W2GA 2YC4C 5C2JB 4P33A 5EP2A 2NZJA 1GRRA 3QVUA 1Z06A 2Q9CA 1KDOA 2NPFA 4DBLC 2LKCA 3HPQA 5FI1B 1Q0UA 3FDIA 4LY6A 1CP2A 3SBEA 2EFDB 2QBYA 4NPHA 1E1QA 1E69A 3MWJA 4DXAA 3FHTA 4N0EA 4LPKA 5KU1A 1SZPA 1V43A 2V7QA 4MUBA 4OHWA 3CF0A 1MKYA 2WICA 2HF8A 3LA6A 4B3DA 3MD0A 3PUYA 5BYJA 4WZ6A 2FH5B 3IIJA 3Q7QA 4LBYA 2QMUA 2JASA 2RGDA 2ZR9A 2FWRA 5GVRA 2RHMA 3V4FA 3O8CA 2ZI7A 4O3MA 1IAQA 2RGGA 2OCBA 4KHZA 2WIBA 2EW1A 2D3WA 4C0SA 5L3VA 5IRCD 3A37A 2G1JA 3SR0A 2FU5C 3GJ0A 4TT3A 1NLFA 4KCGA 2O8CB 1JR3A 1ZM9A 1N5IA 1W44A 1VHLA 4FN5A 1TEXA 5JHGB 1IY1A 1DAGA 1ZC3A 3A58B 3GFPA 3DVLA 4V02A 3TRFA 1W2HA 2J1LA 1DS6A 4BFUA 4DJTA 1CR4A 2NO7A 3SU8A 2SHKA 3SFZA 3F8TA 3IUYA 4JLMA 4TL9A 2X77A 1SKYE 3CW2A 8OHMA 3SJAA 3RLFA 3UWOA 3B1XA 3QE0A 3VNUA 5LDDC 3K0FB 3KFXA 1YZNA 1KIMA 3CX8A 1ZYUA 4AKGA 3AEZA 3CRW1 1N2CE 5LB4A 2IYLD 5FFMA 2ODWA 2ZJ2A 3CRQA 5TMPA 3D6TB 3W3ZB 2NZ8A 3WBKA 1XPUA 2O8BA 3AKCA 4O25A 3LXRA 3QKRB 4KYUA 2QAJA 4QBFA 2OEPA 1NL3A 2FPMA 3UMRA 1AK2A 3MG9A 1COWD 3A1SA 4NE2A 5C46F 1B0UA 2ZJBA 4OYHA 2GXSA 2J0UB 2Q0HA 3WBJA 2W0MA 4Q1BA 4IFEA 5DIFA 4AC9A 5AWFC 1HTWA 4PSVA 2QG6A 3BH6A 2P3SA 3RWOA 3K9NA 4JL6A 1ZMXA 3PCRB 1K5GA 2B7CA 5LBIA 1GAJA 3ETLA 5JSZA 4X8MA 121PA 3LV8A 3WP1B 3KXLA 3ZS8A 2NTYC 1ZIPA 3SC3A 2HCJB 2IF0A 1M34E 1U8AA 3QENA 4NONA 5KDDA 1N6OA 3G5UA 4ZIRB 1AQUA 5FPKA 1R0XA 4YMTA 4Z8XA 4JIMA 2JLSA 3K70D 1IHUA 1UBGA 2QPTA 1ZW6A 3LNCA 3PG5A 1KSJA 2FFBA 1E79A 4LHXA 3I73A 4IRUB 3Q5DA 1EFCA 4KLNA 4IOLA 4JVLA 1SKYB 3L43A 4CEJA 1QHYA 1XF9A 2DFLA 2XNDD 4KSBA 2GF0A 3OE7D 2WWHA 1G8HA 3W6OA 4F4IA 2IWHA 2RGEA 5FTNA 1RYHA 3CR8A 4MYTA 1R4AA 5EP4A 3RRYA 1XBTA 3TH5A 3A4NA 5L3QB 3U7FB 1M6NA 3RANA 5P21A 1NVUQ 4IVPA 5FOSA 4L9SA 1VPLA 2IA5A 3AP3A 1U98A 3GPLA 1GWNA 2V9PA 2GCPA 3KL4A 4O2RA 5FBRB 1J2JA 2QE7D 3EIQA 4Q1FA 1Z07A 2VP9A 2ZRKA 4J0QA 2OV2A 2WWGA 1OB2A 4D25A 4MITA 1L8QA 3K70C 4BPBA 1YZTA 3TUZC 2HYDA 1KO8A 1KSHA 5FOTA 1NKSA 4G5OA 4BRWA 2ANBA 1YQTA 1QHHB 1XTJA 4Q5IA 1ODFA 1Z8FA 3TMKA 1ZRHA 4ZCMA 2ERYA 3ND8A 4Q00A 3IDQA 2CVFA 2OG2A 4IDNA 2MMCA 3B60A 3EZ2A 3TQFA 4MRSA 4TZ6A 4DEYA 2D7CA 1GNRA 3ECCA 4NCIA 2OO7A 1VYUA 5FUWA 2WBLC 1IBRA 2XX3A 2C95A 2CK3A 3THYB 2F6RA 4IW3B 4EPVA 3GLFA 2AFHE 5G40A 2IXEA 1HT2E 2OM2A 4M0LA 5KSZA 3FYHA 1E1RD 1XTIA 3DL0A 4UKDA 1OXTA 2PH1A 3CF6R 2FV8A 3A36A 3B1WA 4JLVA 3B13B 2PZGA 3B5JA 3OIUA 4M4SA 2WKQA 3LDAA 2CHVA 3H1TA 4WA7A 4EPRA 2C9CA 4C7OA 4M22A 1E6CA 1G6HA 3H4MA 3GJXC 1YJ5A 2IXFA 4PAOA 4TMKA 2JLUA 1E0SA 4DCVA 4D26A 4DLZA 4KSCA 2FSIA 1NN0A 2CCKA 2R44A 2WIAA 3GJ7A 4KVAA 3W9YA 2IC5A 4BLOA 4LYJA 3GP8A 1JR6A 2QEQA 1KK3A 4B75A 4BGDA 2OBLA 2MSDB 5LD2C 3DM9B 1E2IA 4I1UA 2G1KA 3SJCA 1RC8A 1PLJA 2VRWA 5JFGA 3P26A 4R2HA 2QL6A 3Q9LA 2FGKA 3T06B 4PC1A 2RCNA 2MSCB 2ODEA 2R65A 1AZTA 3KTAA 1G5PA 1XCMA 4P4UA 4QGAA 2ZTSA 1E0JA 3L0OA 2I1QA 5CITA 3AKEA 2FX3A 1NF3A 2PT5A 4FD2A 1UBEA 2IYUA 2A5YB 3SBDA 4Q48A 3SS8A 1Y3AA 1UM8A 1RYFA 2ZEJA 1S0UA 4OL0A 4PAQA 3W90A 1FPMA 3L0PA 3SN6A 2HV8A 1SULA 5EP3A 2W2XA 4IHQA 2BMEA 3B6EA 1VDZA 2ZSEA 3AQ4A 5TY0A 1KI3A 2HXYA 1X8KA 2O0KA 5JEDA 3LO5A 5KSYA 1AIPA 1N0WA 3ZD6A 4EQ6B 1SXJA 1XXHE 5HCIA 3EZ9A 1D9XA 4ACBA 1F2TA 3ZZ0A 4ESVA 4C9BA 3Q72A 4WAUA 4YONB 5KPJA 2GILA 1IM2A 3L8YA 4RD4A 3TR5A 1KDRA 1KMQA 1IN5A 4CYMA 4HB0A 4RD6A 1WRBA 4JL5A 1JECA 1N6PA 5HKKA 1ZINA 4HEJA 3RS5A 1ZNXA 2HUPA 3HWSA 3AM1A 1KYIA 3TSOA 4MYUA 1CULC 3HDTA 2F43A 4I81A 4M1YA 3R8FA 1AKEA 5KDOA 4HB2A 1KNXA 3LFUA 3U3RA 5UKDA 2HF9A 2VF7A 2R6CA 5CB6A 1DG3A 1UKYA 3DEFA 4CEIB 2XXAA 1U0JA 1U81A 3EIEA 4Q1AA 2PZFA 3UKDA 5FUYA 2P2LA 2XTZA 2Y8EA 5EJEA 2ECKA 5HR5A 4PQRA 1DAFA 3AGQA 2ZJZA 3IIMA 5J40A 4DSNA 1FMLA 5IHPA 4Q4LA 1VMAA 1X3SA 1GNQA 1NIJA 1NVWQ 2QGNA 4RJLA 4LJ8A 3ZZUA 1G8PA 1K5DA 2ZITA 4IOJA 4PC3A 4CDGA 4LBZA 2P6NA 4G3XA 3EPJA 1Q20A 2R62A 3GFOA 3EASA 4XD7D 1OHHA 1VG0B 2ZU6A 3BWDD 4TMVA 4D6PA 1R8QA 3QPWA 4B35A 3AVVA 4TYQA 4WOPA 1LFDB 1Z83A 2A5JA 4E09A 4NYIR 1H8EA 4H9GA 1GDDA 4Q9LA 1G3IA 1IXSB 2GVDC 3N2EA 1IOZA 1D2EA 4NYIQ 1FOEB 4JLBA 3B1ZA 5FOXA 3PEVA 1XXHB 3OEHD 1W49A 3HU3A 4D4JA 1GNPA 2ZS8A 4OI0A 1EFUA 4MGKR 4C4PA 3K0SA 2G6BA 1SVKA 2G88A 2IEZA 4FI3C 4YDSA 5AUQA 4ZI2A 2I4IA 1XWIA 3C7KA 2GBLC 2O0HA 3CPEA 2BJVA 2NPIA 4PPFA 2VTKA 1FX0A 4MKGA 2CNWD 4PC2A 3I5YA 1RRGA 5JJLA 2QORA 4OI1A 3RRMA 2ZUCA 1HY3A 1E94E 1T3SA 5HZKA 3U7GA 1CJUC 4Q18A 3EG5A 5FOWA 5H1YA 3V9PA 4KVGA 1XD2B 4EKDA 4L5BA 2YINC 3QBTA 2CHQA 2QMHA 1WP9A 2V6IA 3ADKA 2GHIA 4AKIA 1KI9A 3DHWC 2XNSA 2JIZD 3QF4A 4MUAA 3SI7A 1HEIA 1CU1A 2GZDA 2V6JA 4QNRA 3ZQ6A 2AWOA 4NKRA 3GEIA 2E87A 5BN5A 5DN6A 3TE6A 4FCVA 1Z6TA 2O8CA 1OH5A 1SKQA 1KI6A 3IILA 1KDTA 3MWLA 3NHAA 1E4YA 1HH4A 3BAFA 1HV8A 3AVOA 3T35A 1UDXA 1W36B 2VH5R 1Z6GA 1CJTC 2QMOA 2GCOB 2ZI4A 4JT4A 3GLHE 5AJXA 5EXTA 5B30A 2GJ9A 2GXAA 1KTVA 4YMVA 2V7QD 5FR2A 1R5NA 2QROA 3EZ6A 2IBMA 3Q85A 3T15A 1TNDA 3K0FA 4E5UA 4QJ4A 1MH1A 3NH9A 4URWR 1P4SA 3RRZA 5BYKA 3KJGA 3BB1A 4GRAA 1LF0A 1R8SA 2F1IA 1TF2A 1F48A 4YMUA 2J7KA 4JYCA 3BXZA 4X8OA 3BOSA 4HUQB 4P32A 4B74A 1Q21A 3QKRA 4JLAA 3LY5A 5BN3A 5CM9C 3TUJC 4FMBB 4AK9A 1C1YA 1GFIA 4M2LA 4PZYA 3GLIE 5DHAA 3BORA 4IKEA 2F3RA 3FOZA 1KZ7B 5JEEA 4LUCA 3X1DA 5CDFE 1XMSA 3GFTA 4LYHA 4TL7A 4CZ2A 4PPGA 1H8HA 4Z1MA 1UBFA 3WNDA 4Q7KA 3PV0A 2QSZA 5JWRA 1JPNA 2N42A 4JJKA 1M1YE 1YZLA 2GZAA 1O3YA 3D31A 2ATXA 1JPJA 2XAUA 2GWHA 3HYRA 4ILEA 2QN6A 4POAA 3UG7A 2A2ZA 4DKXA 3C14C 2HYIC 5JBQA 1UKZA 4DIEA 4QBHA 1E2PA 2LCFA 3PEWA 1OFHA 3I62A 3JZAA 1XMJA 3H86A 4G5SA 4AWXA 3T1QA 2PT7A 2CEAA 4BFSA 2ZRMA 1GTVA 2ZR7A 2PBRA 1QDEA 4EFNA 3MUFA 3EPLA 2VLIA 4RD1A 4UNSA 4ZIRA 3QSYA 3OEEA 3S1AB 2CLCX 4IEIA 5FBLB 3W5IA 4LV5B 1G5RA 3IBYA 2QMEA 2ZS7A 3CPJB 1G3UA 4PTLA 3KQNA 1G9XA 2ANCA 4M21A 3ZQJA 1P72A 1Z28A 2OSBA 2ZYTX 2F9MA 2O8FB 2IL1A 3IO3A 3A1TA 3JVUA 2VA8A 2G9NA 3VFDA 2GA8A 3HYTA 4YMWA 4HAZA 1VG9B 2L0XA 2XOKA 3WYGA 2ZRFA 4JVMA 1KJWA 5TDHA 3I5XA 1RRCA 4KAXA 5CM8B 2WJJA 2WJGA 3P1JA 4TL8A 4PO1A 2XTMA 4Z51A 2H92A 2ZSFA 4IXNA 3IIKA 2DFKB 2WV9A 1W4RA 1NBME 5AUNB 2O0JA 3D3QA 2RGAA 4JVSB 2AK3A 4LJ5A 2VP5A 4MRVA 5JHHB 5G41A 4B47A 1W0JD 1LW7A 1E2KA 3F5FA 4FW9A 5E95A 4JBWA 4EPXA 3KUDA 5B57C 1ZM4A 3MJRA 1AZSC 2RGCA 4K81B 3PEUA 1DVRA 4M8NE 3Q3JB 4B43A 1U94A 4CF7A 3EZ7A 5F98A 1JQLB 5ELXA 4OHVA 1G8FA 2GAOA 2DWOA 2JLQA 2B8WA 2V3CC 1G20E 2VSFA 3M4YA 1A82A 4IJMA 1E79D 3IBGA 1OIWA 4LOAA 1VCOA 3PIRA 3U6BA 1A1VA 3AV0B 2BKUA 2X8AA 4RFSA 3U44A 2ZRNA 2HJGA 3IGFA 3WNCA 3REGA 4ON9A 3THYA 2ZAOA 4TN1A 5DI9A 1VKJA 4F93B 1KK0A 3G0HA 3KDSE 2PCLA 3EPHA 3I32A 3BFXA 2H18A 4O2LA 2CJWA 5IF9A 4W5WA 1OV4A 4B34A 4ZDWA 2EFCB 5FOUA 2OXRA 4F4CA 5JLJA 4RFVA 2R8RA 4UQOA 5E3HA 4MH0R 4PHFA 4MDEA 5K8UA 5TVKA 1E9BA 1XX6A 3NBXX 4UNPA 3BH0A 2XZOA 1KK1A 4JYBA 5JZVA 5IK2D 4ZPXA 3SYNA 5B58C 3U61B 3A4MA 1HE8B 1HYQA 4G1UC 5CYOA 5B2ZA 3A1VA 3HU1A 4PSAA 1X6VA 2OESA 3B85A 1BIFA 1ETUA 5TV2A 1A4RA 4D0NA 1OH8A 1E0AA 2PMKA 4WZAE 4B76A 1KMHA 4PQFA 3BRWD 5EZ5A 3R8CA 2ZRBA 3EWAA 2ZANA 4BLRA 2ZUBA 2PEYA 2C96A 2CK3D 2QQ0A 3UWKA 2XSZA 2YWFA 2ZRGA 4B2PA 1B23P 2BJWA 3ZVLA 4A8JB 2QAGC 1JJVA 4ZDIA 4B3CA 1N0VC 4D2IA 2CBZA 4Q1CA 2PMDA 1ZM3A 4H1VA 4C30A 2RGNC 3DOEA 5FPSA 1XD9A 1S8FA 3SQXA 4XTCS 3VQTA 3CX6A 4XJXA 2R6GA 3WXMA 421PA 1P9NA 1G21E 1UKEA 4BQSA 3AP1A 1P62B 3B1VA 1EFHA 1ZAKA 3RC3A 2JCSA 4BRUA 4LBVA 1OT3A 4ASUA 5DYIA 4EQ6A 2GXQA 2ZE7A 3P27A 3ZIAA 3U2QA 3WMEA 2R6DA 3RYTC 1L2TA 2IHYA 3ZYCA 1AQYA 1S4QA 2WWIA 2ZRAA 3FKSD 2XZPA 3FMIA 4IOKA 4GSYA 3ZS9A 3LW7A 2A30A 4ZO4A 4JLDA 5GADl 1BH2A 1N3BA 4NYMR 1XTKA 3EIHA 3KJHA 4AI6A 3AUXA 3K09A 3LXXA 1H65A 3GLGE 4CVNA 5CJPA 2A5GA 3FWYA 3QXXA 4YXWA 2IW3A 1LY1A 2GZHA 4LJ4A 4AKHA 4TYNA 2CCJA 2GESA 2QA5A 3GJ4A 3D8BA 1VIYA 2V4ZA 3CNLA 1UAAA 1F2UA 2VHUA 2KBFA 1XRJA 3LBNA 4KI0A 2N46A 1JNYA 2JJ2D 1OPXA 4TSFD 4Q1DA 4HDOB 2P5TB 4TMZA 4NP6A 1E2GA 3UMFA 4DWJA 2EQBA 3VKWA 4A36A 2IS2A 3GEHA 4OQFA 1SXJD 1WMSA 1M8PA 1Z6AA 2WTUA 2J0VA 1ZU5A 3FB4A 2JDID 3T5GA 1S9HA 2BEKA 1TPZA 2OT3B 1US8B 1W0KD 1KJYA 4TYYA 2GDJA 3FFBA 3PITA 2D4HA 2HJVA 1AS3A 4TMXA 3THWA 2BMDA 3C16C 1P3JA 3QXHA 5HKKD 3G82C 1UEIA 4RD2A 3TW4A 1N25A 1PUIA 4II7A 2WVJA 1YVDA 1ELOA 1LB1B 2WSSA 3QEOA 1G4AE 2IK8A 4OHZA 2O8DA 2YOHA 1A7JA 3DKVA 3I3SR 4FINA 3WHKA 3KKQA 4ESHA 1XXHA 4LYFA 2PLRA 3U4QB 2ZRCA 4Q4JB 4GZLA 1W7AA 1XTSA 1ZVQA 2JJ1A 1E32A 1DBSA 1SXJC 5FTLA 4YQFA 2DPXA 2RAPA 1SVSA 3CWZA 1OB5A 1BMFD 1UEJA 1NG9A 1ZD9A 2REBA 4US1R 1TTTA 4Q4AB 4NHOA 1UF9A 3O8RA 3UIEA 4A9AA 3GLGB 2O8EA 4ARZB 1VYTA 4C0BA 1XEWX 1OYWA 4AG6A 3K70B 2BBWA 3N70A 3THOA 4RZ3A 2UVQA 3NTUA 1DPFA 3DKPA 2C03A 4FWIB 5EE3A 4JBXA 3AP2A 1M7BA 4M1KA 1XD2A 3JZMA 3MRSA 4NDZA 4B6EA 4XWOA 2BEJA 3KQUA 4P0TA 1OHHD 3NVAA 4CW7A 3CPHA 4LGMA 1KKLA 4PC7A 4L15A 3UPUA 1TQDA 2PJRA 5FPHA 1H8ED 3EPKA 3LX8A 5FUVA 4PHHA 1T0HB 2GRJA 1FL9A 2REXB 2FFAA 4ZI3A 1XCGB 2ZM5A 2NOAA 2VEDA 4MRNA 1XZQA 5EE9A 3WYAA 5G53C 5HZHA 1NNEA 3A6PC 4AY2A 1LVGA 5ANRB 4R7ZA 4LHYA 4Q1EA 1S96A 3TGPA 5JI3E 1Z47A 5HTKA 2YV5A 2FPKA 3CWQA 2ZVPX 1DG1G 4HZUA 1OW3B 1QHSA 2EYUA 2QP9X 1IN4A 2JEOA 1NLYA 4B48A 3DO6A 2J87A 2ZI6A 2GCOA 2ZRJA 2W58A 2FSHA 4TZ0A 1AM4D 2F1JA 5CJ2A 1Z0DA 2GTPA 4CEHB 3KB1A 2HCBA 2DCUA 1XMIA 4UXJA 3AVTA 1IQPA 2ORWA 3PENA 3DOFA 1S2MA 2ONKA 4U02A 3IKJA 3NXSA 1NN1A 3CNOA 4PHTA 1EFRA 2BWJA 2IUSA 3VR2A 1J90A 2N1BA 1NY6A 2JLYA 4N0DA 5CK5A 1GKIA 2IYXA 3LD9A 221PA 1UADA 4C2TA 1HUQA 1UDWA 2QUZA 3TSZA 4OBEA 5AK0A 1E99A 5DN6D 2REOA 1DEKA 5DE3A 3ND9A 1LTQA 1NMZA 3KFVA 3DZ8A 5FUXA 5CIQA 2XB2A 3REFA 2X2EA 1ANKA 3ASYA 1WF3A 2I3BA 3K53A 3GCGA 3B9PA 2C78A 4A4DA 4TQ9A 3EW9A 4DSUA 2QT1A 4OQXA 1CLUA 3B82A 4MKIA 4ZV4A 3AKYA 1BS1A 1CTQA 3KZ1E 3M6AA 4JJZA 4GP7A 2ZJOA 5AJVB 3O8BA 2J9RA 1MO5A 1U9IA 1UBCA 3UMSA 2ZRHA 3NC0C 2VO1A 3NEJA 2E9SA 4JBYA 4EDHA 1MABB 2VP4A 4KV9A 4G5RA 2BOVA 2ZROA 4LK2A 4XOIA 4URZR 1UPTA 2WWFA 3AVUA 3VHLB 5DO9A 4GFDA 3P32A 1RE0A 4UXIA 1Q1BA 1KY3A 3GLHA 4HB3A 2PJZA 2ZI5A 1G8YA 2R6FA 1H8HD 2NO9A 1Q57A 3B2EA 3OIWA 4FMCB 4NCKA 3SZRA 4Z1MD 2JLWA 4QM6A 1P75A 4KFSA 3MLEA 2WAYA 3SYLA 5AUPB 1NG1A 1QHIA 4DUGA 4G0NA 4JLKA 4B3FX 4XSGA 4L8GA 4RVCA 1CJKC 1GZSA 2G77B 5EUQB 3ADBA 5J47A 4EIWA 1KDPA 5DGXA 3C4JA 3OFNA 5JMTA 1Q3TA 3E5HA 4P3YA 4BFVA 4DCSA 3GLIA 3HPRA 4F38A 1I4LD 2DWQA 5DLQC 4QHSA 1I2MA 3RSLA 4BWYA 5CDFA 3AVWA 2QPOA 2VL7A 3MJHA 3OEED 1RRPA 3CLVA 5FTMA 1HQCA 2V54A 3BJIC 1EX7A 2HLDD 3B8HA 1RJ9B 5HE9A 4P4SA 1LS6A 2YOFA 4QOSA 3THXA 1II8B 4BFZA 1OXVA 4JKIA 2F9LA 2EYQA 1U8YA 3VU9A 5BW8A 2W6JA 2FFHA 4B71A 3VX3A 2AXNA 1Z0IA 4XVRA 3IHLA 4NL4H 4UNQA 4K8OA 2PZEA 1KY2A 2IHBA 1KSFX 1E9SA 1TF7A 3OAAA 3ICQB 3UXMA 2BCGY 1TUIA 1VG1A 4A1FA 1I4TD 4TYWA 2WAXA 5JECA 2J46A 4TLEA 1W46A 3VKGA 3QF7A 1QRAA 4RD3A 4LDJA 2P5SA 3L2OB 4M1TA 1IN7A 2IS6A 2GEDA 1G7CA 4DDUA 4LHZA 2BM0A 2IT1A 4V0ME 1YZKA 3OZXA 3ZD7A 2GETA 3FE2A 1ZD8A 4V0OA 4BLPA 3P4XA 1EX6A 2Z6VA 3CX7A 4TLDA 2WOJA 4TMTA 4RKFA 2UKDA 5HE8A 2NGRA 5C1BA 3W34A 2JAQA 1NBMA 4GNKA 3RVBA 2NO0A 4ACAA 1G7RA 3CB4A 1D2MA 3GJ6A 3PFIA 4LJ6A 5FOVA 4BZPA 4DVGA 1T3LA 2VYFA 2ZRDA 1MO3A 2OLKA 1XPRA 1GITA 1N6HA 2QSYA 2G0NA 3CBQA 4A8JA 3F0TA 5JWHA 4FWTA 3QPUA 1W5SA 4QHTA 3TW8B 2OILA 2ORIA 4GMXA 3ZGXA 1F6BA 2FEOA 1KOFA 1QVRA 4W5HA 1GRQA 2MMGA 4QGGA 5CLQA 1FTSA 4DT1A 2ZE5A 4OQNA 2BV3A 2H57A 3ADDA 3J81k 2FE4A 1GG2A 4NH0A 2FFQA 2VSXA 1T4GA 4GOXA 4KITB 4Q4HB 4B44A 4TQAA 3KQKA 2BMJA 2HT6A 2GJ8A 4GT1A 4CIDA 1Z08A 2CL6X 4I1SA 2NIPA 5E7IA 2B92A 3SJBA 3AF4A 2DFTA 2ZI9A 4A6XA 1IONA 5L3SB 2XITA 3LH5A 4LYAA 1GP2A 1T6NA 3R7WA 4EFMA 3KQHA 2IX3A 4DLSA 4RZ2A 2G3YA 3NDBB 4DSOA 1QHNA 3KJIA 2IWRA 4AYTA 1AJEA 1CF4A 2VHJA 2ZS9A 2DY1A 2IYYA 1MRSA 2D7DA 1HT1E 4L16A 3UANA 1JI0A 3RWMB 1G3QA 3ZDQA 4CRWB 4UNRA 4GP6A 2XJ4A 4S35A 5A4JA 5KNCA 3C41J 3K9HA 1FQKA 5SZKB 2X2FA 3FFAA 3MFYA 2BMFA 4NYJR 4URYR 5L3RA 1DELA 1NSFA 3BGWA 3NBYC 5L8VA 1ESNA 4NYJQ 5DYGA 1YE8A 1KJZA 3LQRA 1OFIA 3PJRA 3ZLJA 2Q3MA 1FUKA 3I8XA 3E70C 2PL3A 4M1SA 2CE2X 4URXR 4C0LA 2D74A 1Z0FA 4MGZR 1US8A 4C3ZA 4HAXA 3K0CA 4A82A 4KFUA 5FL3A 5SZJA 1AS2A 1YR8A 4YMSA 2ZQ5A 2IYWA 4GOJA 4TQUS 3N2IA 5GJCA 3DMDA 2GNOA 4BZQA 4A0GA 2K5UA 5KUTA 4EUNA 1K8RA 4M1MA 2QRNA 3T61A 2CHGA 2IUUA 3CRMA 4GPTA 2CL0X 4HLQB 4RZXA 4RCYA 4JVNA 4UNNA 3MCAA 4EPWA 3V00A 4BFXA 4C0JA 2IYZA 1MO4A 3NIBA 1EESA 3NKVA 1XTRA 4D82A 4Q4AA 3ZVNA 1Z63A 1Q44A 1TU4A 3CZQA 1GL6A 4DRZA 3CM0A 4DZZA 3GLGA 1CJMA 1MT0A 2RMKA 4MYCA 4C0KA 1E1QD 4Y0AA 2O8BB 4BFWA 3K09C 4WZBE 5K8LA 1IY0A 3O8DA 1E2FA 1KO1A 4DIDA 3U3KA 1E9FA 4DHEA 3GJ8A 1G41A 1SVWA 5DNYB 1NRJB 1E9DA 4TLAA 1L7VC 2GKSA 2XNDA 3FGNA 1NN5A 2ZUDA 2C04A 1OKKA 3OE7A 1M7GA 1Z29A 2IYRA 2YNMA 4PSKA 4JSYA 1NKTA 4NCNA 3PUZA 5B64A 3T1OA 1W4BA 3FMOB 4DCTA 4DLTA 2ZXUA 3VKHA 5CLLA 1CR2A 1G64A 1D5CA 4A0FA 1I4DD 4TT3D 2QE7A 4PPNA 1PZNA 1GSIA 1JR3D 2J0UA 2A5DA 3FHCB 4US0R 2Q6TA 3VR4A 5C18A 3R9IA 1G4UR 2KSQA 4Q7LA 2AXPA 3BE4A 4KU4A 3I1FA 3B1YA 3EAQA 4HLUA 2Z43A 4M53A 1Z0AA 4B2LA 4JL8A 2FGJA 1MRNA 4FIDA 1WBBA 2QTFA 4CEHA 1XMVA 2NQ2C 2ZI3A 5H8WA 2MSEB 1KO4A 1O87A 2BBTA 1CS4C 1M2OB 3U5ZB 4DLUA 4FXPA 2PX3A 1XEXB 2WWWA 2O5VA 3LLUA 3CRRA 2BCJQ 4LHVA 3P20A 1C4OA 4HATA 2XZLA 3SJZA 1NN3A 2KBEA 3AH8A 2DR3A 4EJSB 1ONBA 4ABYA 3UK6A 2ZE6A 3VTKA 1XJCA 1E1RA 2A7QA 4F91B 2IS1A 5F2EA 2Q3HA 1LV7A 3QPVA 4M9QA 1TF5A 4IDOA 2ZE8A 3C8UA 2QAGB 3HP1A 3QI2A 4OJKA 3RHFA 4QM7A 1N5LA 1YR7A 4AURA 5BN4A 3AF3A 2F3TA 4OKSA 2OAQ1 2GVZC 1S3GA 3LW8A 1T8UA 2UZIR 3OIYA 1BYIA 1MV5A 2GEUA 3KKPA 2Q21A 3O47A 2B7BA 3AUYA 4MGIR 2X19A 5L3QA 1FP6A 1E98A 1G1MA 3VX4A 2PLFA 2RKOA 4G5QA 3SDZA 1J7KA 3PUWA 4Q7MB 2CE7A 4QG7A 1QF9A 1R2QA 3SNHA 2AL7A 1ZCAA 2IF2A 2C98A 4KFRA 5KTYA 1E3MA 1S3SA 1AGPA 3GQBA 5AUOB 1EFRD 1QHHA 2ZREA 3GLFB 1UJ2A 4LX0A 2LWIA 3FVQA 4HB4A 3U7HB 3QKSB 4I1VA 1E9EA 4QRHA 1RIFA 4TMWA 1P5ZB 4Z8YA 3QUSA 2ZYUX 3I61A 2QM7A 4C7OB 1M74A 2J5XA 2ZR0A 1W36C 4IDQA 1A2BA 2BBSA 3SEAA 3LRPA 1N5KA 1D6JA 4HLCA 3ADCA 3AKDA 4OK6A 3CZPA 1FQJA 3U6KA 2GK7A 1ZUIA 2QP4A 1OIXA 2RB4A 1E2LA 1XJ0A 3RC8A 4JSTA 2ASEA 3T5DA 2EVWX 5KO2A 3AVPA 1DAMA 1FUUA 2XEXA 2IYTA 3Q7PA 4QJ3A 4FMDB 2H17A 2ZSAA 4HYYA 1X86B 4QBIA 1LS1A 1XB2A 2YOGA 3QVVA 4LPSA 4LJ7A 2WZQA 1TL7C 2ZVQX 3KTAB 1Q1EA 5AJZA 5FTJA 2D2FA 2F7SA 3WRYC 1VTKA 1II8A 3HU2A 1IXRC 4ZKEA 4IOMA 2H8KA 1JALA 3TAUA 1TAGA 4LBWA 1T3HA 1OE0A 1P61B 3I8SA 3LX5A 1G6OA 4QKQA 1CRPA 4QHYA 4DB4A 5SZHB 3TLXA 4OHYA 4AD8A 1J8YF 4EPTA 4NU0A 4A15A 4OI2A 3LWNA 4DUGD 4U7DA 2J0QA 1AN0A 4S2EA 2PEZA 3IQWA 3LVQE 3QXJA 4HAVA 4D0GA 1Z0JA 3PEYA 1SXJB 1U9IC 2R2AA 1F2TB 3IPYA 5FBQB 5FPYA 2J7PA 4IDHA 2G0TA 1DAEA 4L4UA 4BFTA 4XD7A 3NC1C 2IXGA 4QBGB 2DHRA 1R7RA 1ZP6A 4R98A 3QJYA 4NMMA 2P67A 1CRQA 4BECA 5D3MB 3L8ZA 2GF9A 4U00A 3FMPB 2WKRA 5SZIA 1N6KA 5GVSA 1GRNA 3ZVMA 4AYXA 5BWMA 1S9DA 2KWIA 2W6JD 2WPDA 1G5TA 1R0ZA 1A5TA 3HJNA 1N6NA 5DHFA 4EFLA 2DYKA 4Q47A 1VECA 4DCNA 1YU9A 2B6HA 3OAAD 5C4MA 4OQMA 1LNZA 3JVVA 4D4MA 3BC1A 1XU4A 4IVQA 1ZNZA 2HT1A 3I72A 4TTQA 1NVVR 2H1LA 2CNWA 2W0SA 3F3YA 4JLNA 2AK2A 3BD9A 4XH9B 2J45A 1NVVQ 2QP3A 4V0NA 1ZU4A 3GJ5A 4OK3A 4CEIA 2WHXA 4XSHA 2DBYA 2A9KA 4QXAA 4Q4HA 1CIPA 4XIGS 4RY2A 1KI4A 1AA9A 5DSZA 1PV4A 4MDFA 4KBGA 5BXQC 2TMKA 2AN9A 2JIZA 2F1RA 5FPTA 1ZD1A 4Q02A 1OXXK 5AJYA 4PQYA 5H68A 1J99A 2OFXA 4LV6A 4XVQA 3QXSA 3CO5A 4KODA 3WNBA 4ZDJA 4DLXA 3Q5EA 1DO2A 1YZQA 1VHTA 3P4YA 4DEXA 1E9CA 5F9FA 2OCYC 3QOFA 3NEYA 2WWYA 1TEVA 2I1VB 4HAYA 2QENA 1KAGA 5LPNA 4HZIA 3C5HA 3EARA 4PZZA 1J70A 1QBKC 2AWNA 4V0MA 4B73A 1Z6YA 1KO5A 3MGCA 1AGRA 2CXXA 2ZAMA 1FX0B 5FH9A 4B6FA 5J4YA 4E03A 2EFHB 2VPPA 2ZJAA 4WW0A 3RABA 1BO6A 5DISB 2BKEA 1P60A 1T91A 2V55B 5EXSA 1N6IA 1DO0A 2C2HA 2YYZA 1WE2A 3LAWA 4KXFB 1Z0KA 3NG1A 3NBFA 2GK6A 3QF4B 1FW6A 1DARA 3QG5A 3K9GA 1Z6XA 4M1WA 2F55A 4PO9A 4C0QC 5JJKA 1KO7A 5EE0A 4Y0VA 621PA 1ZM2A 1K6MA 1W4CA 4A8JC 5JWOA 1Q22A 1PLKA 2FA9A 2Q9BA 3KQLA 1UKVY 3VR6A 3ZZTA 1V5WA 1G8GA 2W6IA 3QKTA 3RRNA 4WBSA 1QG2A 1JEDA 1FZQA 1KI6B 3PVSA 3BERA 2KB0A 4NCHA 3R9WA 1WQ1R 4LC0A 3I92A 4B3XA 1JBKA 1KI8A 4UJ3A 3A1UA 4Q21A 1T5IA 1R0WA 3CUEF 3IO5A 1NLZA 4NZYA 3BB4A 5FBWB 1E2QA 3OF5A 4Q9HA 1QHXA 1WB9A 1ZNYA 3KXKA 4HDQB 1KNQA 1JQJC 5CK4A 1WCV1 3KB2A 3WYFA 1R5BA 2VHQA 2A5FA 2NMVA 4TL6A 3EA5A 2JLRA 1E2JA 5IDVA 5K8IA 1SVMA 1RZ3A 2C99A 3ZVRA 2WWXA 3KKMA 2IYQA 1EFTA 3X1WA 1KI2A 1OFTA 1F60A 1XD8A 2BBOA 3NDPA 4B3BA 5DI3B 3V4RA 3OESA 4EAQA 2FSFA 3H84A 2P6RA 2B21A 2ZYVX 4D80A 2RHDA 3DDCA 4DSTA 2Q9AA 4M9XA 3C15C 1DTSA 4PAMA 4XVUA 5LD2B 2PCJA 4HUQA 3R9XA 4HLDA 3X1ZA 4Q7JB 4QFMA 1TADA 1DAKA 4V0KA 1P2SA 2NG1A 2OE2A 1U90A 4LCBA 2HXSA 2WKPA 1BOFA 2KJQA 4EPYA 1CBUA 2VSOA 3AF0A 4XWKA 1XZPA 2V8OA 3W3AA 1NY5A 1T0JB 1W0JA 4HAUA 3TNFA 2QTHA 4NTZA 1DADA 5K8TA 4LJYA 1U0HC 3K0CC 3HR7A
chains in the Genus database with same CATH superfamily
1ODTC 1DQZA 1H69A 2Q5QA 3T4EA 1UK7A 1PR3A 1P9RA 4PYQA 5FLKA 3BZUA 1GKLA 5GJVC 5ALDA 3I01A 1NQOA 1ZVKA 1E5QA 5EQTA 5JCOC 3MSCA 3DBRB 1UZAA 3ESCA 1CQPA 3WA6A 5FWDA 1KTIA 1OBVA 3DCIA 4KAAA 1I7PA 4GI7A 5GONB 1TQ4A 2D1FA 2GS9A 2PT9A 2VZ8A 3WV4A 1ADYA 5HEKA 5T6MA 4HVLA 1OIVA 1OKKD 1WPRA 3F6EX 4YRGA 5E1BA 4NOMA 4KZKA 4RTMA 3D1LA 2VTDA 3EFOB 2GBGA 3NOVA 2OP1A 4YVFA 4CDMA 1IJFA 1D9ZA 1KVSA 3H9GA 4JMPA 3UJNA 1L8OA 2V97A 1BC5A 3CPSA 4FQ8A 2C2BA 4WOBA 1N92A 4OQZA 3TVTA 1XEFA 1K7XB 4N3AA 1C9KA 1QNFA 2B9VA 2X0IA 1M2WA 3F6YA 3HKBB 3OHMA 3QG1A 1NBIA 3SM3A 1TTHA 3E9QA 5IKOA 3CZ9A 4QD3A 2G07A 2F8MA 2JGEA 4L3OA 3IH5A 1RLIA 1DG9A 2D0DA 1U7XA 2XVAA 2ZPTX 3I09A 4N5HX 3VR4D 4JJ7A 4D0LB 4CMJA 1AK9A 1W581 3GCWA 4FOTA 4MQBA 3K71B 2RGNA 4F4UA 4ZTBA 1DWQA 2AC4A 4JP3A 1MT3A 1YC5A 5FR1A 3L0SA 3VYWA 4RMJA 1BE0A 3W6NA 3SYRA 2HGSA 2P9TA 2CDBA 1KPGA 4PGHA 3PFFA 3ZCTA 2VQSA 2VAXA 1H1DA 5EUMA 4X66B 4TYPA 5IDWA 1VXRA 2GX6A 1U63A 2FDCA 2X41A 4OM8A 1JZTA 3STWA 4A6EA 4RFSB 5JDCC 3SYKA 3LKVA 1U3GA 2M98A 3I2KA 1DRUA 4R7TA 3G9ZA 1JZQA 3BICA 3FBGA 1UL1X 4NESA 3S2IA 2EWMA 3RJ9A 1MDFA 5H81A 4BKQA 2ZSBA 3K9CA 4XQEA 4BFYA 4QDUA 1PKEA 3DE2X 2QPAA 1N9GB 2ZUVA 4IIYA 1Z22A 4OXQA 4RHCA 4I5GA 1KE1A 4D8XA 3IE0A 5BORA 1REQB 3IQFA 4H35A 2XOKD 3OOEA 5AK4A 5BNIA 3CF2A 5IAAA 4FZ3A 2IPLA 3PCTA 4PBTA 1QZXA 3W8RA 2FN4A 5KYNA 1SCJA 2KX7A 3AVQA 1JHPA 2XUOA 3WL3A 2D2XA 2BSXA 1V96A 1Z9BA 3UHJA 3OPNA 2WWVD 4PX5A 4D42A 5DW3A 2C94A 4PG5A 1I6MA 3CLRD 3KWLA 3H6KA 4S1NA 2JI9A 4IEEA 4XYMA 3WB1A 1JHRA 1TK3A 2KLHA 4BNXA 3PL5A 4D6YA 1YMVA 2W90A 5ICMA 3CF4A 3W5JA 5ARBA 1M1UA 4ZAXA 1B2RA 3W8NA 4K3VA 3K16A 1V9CA 1YS9A 2IDJA 4QGFA 5LLSA 5KTNA 2FN9A 3GJRA 3GMIA 2ONJA 1ZEMA 2HBQA 1CUWA 4WMLA 4DLYA 1ZCBA 3KXIA 4IMJB 4OI4A 5AW6A 2QZPA 1P0PA 1XN4A 4CIBA 5KJFA 3R0ZA 3UYLA 5FWXB 3T9CA 1DBVO 2C8VA 5FKJA 3WKEA 2AEMA 1VP3A 2Z0MA 4JK3A 4L5CA 1YTUA 2XWBF 1KI1A 3UJCA 1JIUA 3JWJA 1XJQA 2CDRA 3BT7A 4M1OA 4F4JA 2Q28A 1I1NA 2AG8A 4QU9A 1NIPA 1Z3CA 4F5EA 3R09A 2IOHA 2QNRA 1Q1ZA 1U7HA 2H2GA 3CLRC 4NWIA 5LR6A 2A9OA 3OCCA 4L2IB 2HRQA 2QD2A 4CM9D 2Q27A 3KTFA 4IH4A 1JXOA 3IJRA 2WKSA 3TN7A 3VVMA 4D57A 3UT6A 1T3TA 3WLSA 2HHLA 4L75A 3FUTA 2V45A 4TSRA 3OTGA 1BKSB 1U0FA 5AW1A 2VCHA 4HX9A 4ND1A 5ALMA 3KLBA 3HWX1 2NU8A 5FBHA 4B81A 3BGVA 4ZCTA 3ENQA 2IY8A 2JDIA 2Z08A 3AIMA 4YDHB 2HMVA 2Y05A 4C0HA 2VP3A 3LXUX 1YZHA 1GQYA 1XZDA 4AJPA 3ILXA 4FTWA 1B00A 2IS4A 1RKXA 4OM7A 5KYVA 1LSSA 1H3EA 1I13A 4X8LA 1EBBA 4B5LA 3NYWA 3A9SA 3UV6A 4Q9IA 1B3RA 1ZHFA 3RUDA 4QFBA 4W5RA 1G2IA 1PKXA 4WADA 3SF8B 3JWGA 5D01A 1F3OA 2VDWB 4LF7B 1Z5UA 4KQMA 2VCEA 4FHGA 4MQFA 2B94A 5FBVB 3I6MA 4C4SA 3ZXSA 1LQTA 1OYYA 1AK1A 1SURA 1ZUHA 4CMBA 6GPBA 2WIDA 3AR3A 1PUJA 5AI6A 5JBIA 2DM6A 4EYOA 2Z95A 4FVTA 5I4CA 1GZHB 2W42A 1IZ7A 1PFUA 1RP1A 3I2HA 2AQKA 3V32A 1QZUA 4QUDA 4YLGA 1T2NA 4UCQA 4R71A 2ZJ0A 4OHRA 4UD6A 4ZOEA 4ZQCB 3TQCA 1TUGA 2HA6A 3FNHA 3HKEB 5AP9A 3WHIA 5BPFA 3O2NA 1ABBA 1HNNA 3VAAA 3DPUA 4EMBA 5BVHB 3MCZA 3E18A 2Q5IA 1RXCA 1X8LA 1U04A 2H0QA 4KQHA 5BRAA 4OYRA 2JIPA 1T25A 1Q12A 4HH0A 4NAHA 4UCFA 3U9SA 2JA1A 2YN2A 3L06A 3RUEA 3IRVA 4I99A 3UCXA 3IAM1 4WBXC 4RZIA 4DV6B 2P0EA 1SRQA 5IARA 1R6AA 3N5CA 4W7SA 2RGXA 4W9MC 5A5VA 1RXWA 4H60A 2IPMA 3R7NA 1OH6A 1E1LA 1X19A 1CT9A 4Q9JA 4FHEA 3IHWA 1UC9A 1A77A 1PR9A 2NZVG 1U7DA 5AOCA 2HDWA 5IEBA 3CRNA 3Q40A 1M2VA 4PZ9A 4ASUD 4IX9A 3KX2A 2JD0A 3EUWA 4Y9SA 5A0FA 1OQAA 4DV1B 3LSYA 2O8DB 5GM2A 2YC2C 2A33A 4B4OA 5DF1A 2QR3A 3BHNA 3FCCA 4LF8B 2O48X 2ZSDA 2Q9UA 1OVMA 2YXDA 3K1AB 4QRIA 5GTDA 1ZUNB 2WPDD 4RVOA 2GN4A 3NHBA 4UTNA 3PHJA 1E2UA 4H31A 1ZSNA 3R41A 3MOGA 1AG9A 2RK6A 4W6QA 2ZIWB 1VE5A 1YVUA 2H59A 4FGWA 2YZ2A 3GEBA 3G5LA 2X8WA 4DDTA 3TZKA 2FZ5A 4J4TA 3MMPA 4B84A 4J6FA 1TVKB 3A1WA 3HV2A 4RBNA 2BONA 2O8VA 4XXHA 3UQZA 1ZBDA 2GD6A 3AW9A 5D1HA 3SFVA 1JQBA 2QU8A 1H2BA 4W8HA 5HGJA 3QQ5A 4O1IA 2AKAB 3VR1A 2A1UA 3U4QA 1H0SA 1Z88A 1UK8A 3H5VA 4YCMA 5MHTA 4BNIA 3JXEA 3Q5GA 2OXTA 4AIIA 2GA9A 2OXCA 2CDNA 4GF5A 2GEBA 3TTTA 3LG2A 2CKMA 1YRAA 4PO3X 3S99A 2VYND 3TBKA 4AJEA 5IJ0A 4G0PA 3GUHA 4BTEA 2Z5GA 4KJZA 4LC1A 4ARZA 2P3OA 4ZZIA 3FPFA 2HDNB 1QAOA 1KC1A 2ZYAA 2QT0A 1DIBA 5FNVA 3WIOA 3DM5A 3HNOA 1SD1A 2IV3A 4AM8A 3CLUD 1WTCA 4EDFA 1PJ2A 3EF1A 4MYSA 3N59A 4R1LA 4MR8A 5AOVA 2AQ8A 2YKGA 2OLJA 2FOLA 3ZHBA 4LJRA 3ZCRA 1AO3A 2HBZA 2H5EA 1KRHA 4TKUA 2B35A 1RWNA 4OQPA 1UAYA 5B1IA 5KJ1A 3CKKA 3OFKA 2XB4A 3U3DA 1SA0B 4LIPD 2CLDX 4D79A 4YT5A 1U2DA 1U3TA 4E13A 2XCSB 1DJNA 2WDPA 2FQQA 2PLWA 4JLJA 3TYXA 1S7CA 4YR7A 3RVJA 1A9YA 4WKCA 4RSRA 1E66A 2CMGA 3GLUA 5ERGB 5HK8A 2CNBA 1RRKA 3I1IA 5I9MA 3OJLA 4WUVA 4RKEA 4QATA 3GA7A 3WMGA 1QFJA 1UJMA 1X7GA 2NTVA 3C7AA 3CEHA 3GJ3A 4QBKA 2OYSA 2W2VA 1P2GA 3RO7A 1LF5A 5F2NA 1YZGA 4B85A 3T5MA 1C81A 3CLUC 3NKFA 3RSOA 2EU8A 2HLPA 5MFZA 1XFAA 3M3PA 1K3TA 1X1SA 3B3QA 1YNSA 1YVRA 4ETIA 4O4JB 1GILA 5FWYA 1ES9A 2PQMA 2JATA 5HFNA 1NJGA 3QBVA 3C97A 2FKNA 4C07A 3E82A 1WW2A 2SICE 1XC7A 3SIRA 3AGPA 3GRVA 2ZT7A 2P6UA 1O96A 2OBNA 3M5PA 1YACA 3S2YA 3EK2A 1EWRA 2VJCA 3CH4B 4XIFA 4YAWA 2O2ZA 4K88A 2YJ6A 2VKQA 5AHOA 3GT7A 3OH8A 4O0MA 3I9FA 4IUYA 2DUNA 2IEYA 2XLBA 3X1XA 1A72A 2KHZA 4Z2AA 1J25A 3IEPA 3HSKA 1BQ3A 3HZZA 1ZUWA 5CPBA 3W5CA 4ANFA 5DM2A 4CKBA 1TU0A 2ZYWX 4YQYA 3C3EA 2YQZA 3MA0A 4CGYA 4HUTA 1ISMA 4MGYR 1XTQA 2O6LA 821PA 1FQOA 3OZUA 1FP7A 2W00A 4MKHA 4EKGA 4PN3A 3CA8A 3V8QA 2FF5A 5DGDA 4AUKA 1ZW1A 1XYYA 1XDZA 4YQEA 4DARA 4IHJF 3EF3A 4NJMB 1G59A 3AVXA 2XQIA 3CLHA 4RLSA 1JWBB 1GTZA 4BEJA 4F92B 2ZZMA 2AMLA 1UC5B 1YR6A 1M7HA 1RLUA 2A4KA 2HLDA 1W36D 4BY9E 2F1KA 2Q2VA 5KOJA 1GYRA 2XT6A 4FUTA 3V1LA 4HN9A 3B78A 1SVLA 4YECA 4IV0A 4JT2A 1Q0RA 4L5JA 4OB7A 3PFBA 4H3SA 3UGQA 2DWPA 1U99A 4CR7A 3PGMA 2DGDA 1K7FB 4FS3A 1KF0A 2ZRIA 3DJFA 4FYYA 1UCFA 6NULA 1Z5GA 2DLCX 1ORDA 2IE8A 1PK9A 1ORIA 1SRRA 1KK2A 3TVDA 3H2ZA 5JIBA 2JD2A 2KYRA 1CF9A 5AM4A 1A9RA 3FLEA 4GEKA 2ON6A 1PZEA 2CXSA 1G3MA 1CZKA 2EFGA 4KXWA 3LBIA 3WGKA 2Q3DA 4WH0A 3NQ41 1R0BA 1Y7LA 3W79A 4B45A 4CCWA 3TJZA 2P8SA 1CKEA 3CISA 3K7EA 3GLIB 4AJNA 3GYBA 3K4HA 3NWOA 3CVOA 3VHXA 4JI3B 1R6XA 2I2WA 3WNZA 3TLKA 1P9WA 1T5LA 2ZDGA 2QJWA 1M66A 2YWEA 4RETA 5JDIC 1OGYA 4DJEC 1SHKA 5FJJA 3R3XA 4PICA 4TXMA 1NQUA 4W9NA 2OCLA 1HQYE 1LZLA 4D81A 2WVGA 3B89A 3RCBA 1P8AA 4CT4B 1Z5ZA 1BCRB 2R7KA 4Y2YA 4A1OA 2Q4TA 3D6FA 3KJXA 5TGZA 3N0TA 3ROQA 2ICAA 1BXRA 1Y63A 1SXHA 5EOVA 2V1UA 2CLSA 3FJYA 3WLRA 3LBYA 1A2KC 2NX2A 4RL6A 4C7XA 2CFOA 2PX0A 5K0NA 1SIOA 5LUBA 5JCPA 4B8ZA 3ADPA 4TTJA 1TKAA 1GT6A 1QTRA 2C4UA 3L4BA 1E6WA 3OEYA 1VJ5A 2W6OA 3FR7A 3TIFA 2P6MA 2I2FA 1D2NA 1V5GA 2CB9A 3U3OA 1HRKA 2O2CA 2OMKA 4BEWA 3AHIA 2EQAA 1NVEA 5BOVA 3BTVA 1G2QA 1RPNA 3WK8A 4Y30A 2ECOA 1GGVA 3M8KA 5B7QA 5KWSA 3NPMA 1PUXA 2FZEA 1CR1A 3K73O 1WLSA 4J1TC 1M6HA 4ZRMA 4PC6A 1FS4A 4EUKA 1EK0A 3UBMA 3REQA 4GGPA 2VRCA 3L6BA 1MFPA 4B2IA 3EA0A 3PR1A 1N7IA 1LW6E 2GPNA 2XIJA 2ZB3A 1FNCA 2YVAA 1R6BX 5CW1A 1GPAA 1WSAA 1WKBA 1EYZA 3AFNA 3NPAA 3OQVA 4ZO7A 4CMGA 1RPZA 3Q3GE 1EVJA 1NRIA 1P39A 2WM9B 4PCUA 1QGUB 4HSEA 4U2CA 5LOVF 2MYUA 4RZSA 2QUIA 3L1VA 3WQRA 5LQMA 2WD7B 3U3MA 2GBLA 1LC0A 3IMEA 4Q3BA 2NZYA 3CONA 4DQKA 3OPQA 2V6FA 1O5TA 1EG7A 2PGXA 1CR0A 2Z8YA 3OMXA 3Q3HA 3ZGZA 3X1MA 2HAEA 2C3UA 1PWXA 4P7KA 4AG5A 1JFFA 1RI4A 5TNXA 8AT1A 2O2YA 4KXVA 4RD0A 4JD5A 4AKEA 1QGZA 1TEZA 4TMYA 3CNNA 3UENA 2D1YA 1IZ9A 5IM5A 5BPHA 4YMHA 3PLNA 3RF6A 2Q50A 2Q4BA 2ZB4A 4L4ZA 4L8VA 4DT1B 2UYCA 4JS0A 4HRYA 1MG0A 4RJKA 1KHTA 3BMQA 1T4MA 2PV0A 3ZJYA 1YT5A 4TLCA 3U4DA 2XXAB 4CM5A 1CG6A 2BZ0A 1Y3HA 4R2MA 1DBWA 4QQRA 1YTLA 2WSBA 4J8PA 4PR3A 3OURA 1JWAB 1CUUA 1S1CA 2PGDA 2DKFA 1ILEA 5C5IA 4WWHA 2ZDQA 3KR1A 3U0VA 2XCRB 4YPVA 1QBGA 4DDWA 2NVUA 1SC4A 3S55A 2DCMA 2CCGA 1Y4DE 1V8DA 3NBZC 1DB3A 1ZGGA 2XQVA 3E1SA 1JG2A 3R5XA 4MWEA 3R7WB 2BEVA 4C5BA 4C5CA 2DFNA 3MWEB 4Y2RA 1XCBA 4J75A 5D6NA 3R6LA 1SH7A 2LD4A 1RACA 3OMWA 2XZDA 1R5OA 4IINA 4ISBA 4KBFA 4Q03A 3T1VA 5KCZA 1H85A 1U4OA 2O7SA 4EY8A 5H9VA 1SUEA 4ZCPA 1NJ6A 3VZDA 1MMFB 4ZAFA 3Q8XB 2VTEA 4ZT5A 3HDJA 2FQWA 4ZYWA 1WBDA 4FOOA 1FUYB 4INAA 1J8MF 3SE0A 1FMJA 4ZCIA 1SUDA 1ZGBA 2JI8A 5I8PA 5C31A 1RQGA 2PUEA 2XY4A 3C1AA 3I9LA 3BIXA 1QOZA 3R4VA 2IHVA 2JHAA 2V4MA 3DXFA 3HJUA 3BB3A 5DLDA 3UMCA 1BW9B 2PMEA 5AXBA 1JKJB 4ZT2A 2WAMA 1VCIA 3D3NA 3G2KA 2ZTLA 5ALKA 3VPFA 2IEAA 2OM6A 3F5MA 4BASA 3E9EA 2FFRA 1E2MA 1CXZA 1W2GA 5EMMA 3STXA 3U56A 2EL7A 4P33A 1TQ8A 1GRRA 1L7AA 1S3IA 3QVUA 3TI7A 4FGZA 2DZDA 1QDLB 1VCHA 2B8NA 4PCVA 3T3NA 1XLTA 1CP2A 4LY6A 3VV3A 3SBEA 2GN6A 4P5PA 3KSUA 1CJBA 2QBYA 3I2IA 1I5OA 1QH8A 3MWJA 3OTIA 1Y1KE 4IIJF 2AMFA 3ZE7A 1SUCA 1A8UA 1V43A 1JQAA 3BYZA 3HJRA 3TSCA 2Y2UA 2PR7A 1VJDA 2BRUC 4GECA 3LZCA 4OHWA 4DSAA 1FDTA 2HMUA 4HQ0A 2JGAA 3E27A 1NXSA 2XUAA 1UM9B 4N48A 5A5FA 1KIFA 2B9EA 1TYEB 4U8HA 2QMUA 1X13A 2RGDA 1U02A 4CF6A 2W2LA 1D8AA 1SCDA 2YDXA 2YV2A 3TE7A 4E1BA 5GVRA 2DFPA 5FYDA 2JIOA 3U4AA 3PKIA 3PQEA 1SIUA 3MTAA 3FSEA 3N7TA 4I36A 4Q12A 3SOZA 1NVMB 4BX2A 1IAQA 1P8JA 4KHZA 2WIBA 2EW1A 4R2XA 1OLUB 4QXMA 3U1VA 3A37A 4RDCA 3SR0A 2FU5C 2JI7A 3QPDA 1EXVA 4YGYA 2J67A 3DAOA 4KCGA 5JMPA 2H51A 3TQRA 5JAUA 1ZM9A 3LHKA 1RLJA 1N2EA 5F7JA 4LZLA 1J2UA 2EBFX 4DAOA 3UUEA 2XT9A 3GFPA 4HYQA 3V46A 4BRSA 2Q8NA 2PA3A 4RGQA 1XRLA 3ETDA 4BFUA 1VKNA 3GWZA 5HYVA 2SHKA 5B5SA 1HFKA 3GY0A 2EJVA 3G7NA 3L9WA 3DSRA 3SFZA 5LP6A 1GZ7A 2DQ4A 2ZDHA 1TJ4A 3BUSA 3H9EO 3NHFA 3DC7A 2ZIXA 2O6HA 3OUZA 4BN4A 1EUZA 3Q0TA 3AONB 3TIGA 2AOXA 5JOQA 3B1XA 4F97A 3PL1A 5GZ6A 3VNUA 2PJDA 3PXAA 1KIMA 2DHCA 4KPYA 1N1GA 1OWNA 1FU4A 2F17A 5M7EA 3CRW1 4NMXB 1SKAA 2Y1KA 5IAKA 5J2TF 5LB4A 2QYSA 2R79A 4GVLA 3V7YA 5TMPA 3G7SA 4JSRA 3D6TB 2BHNA 1QLHA 3MLAA 2P9EA 3AKCA 4LJKA 1EK5A 3C0KA 3NALA 5EWMB 4KYUA 4G8JA 2HADA 2QAJA 4QBFA 3ZQUA 2HFJA 3UMRA 2BM9A 1GN9A 4ENWA 5E6RB 1COWD 2PGAA 5CM2Z 3BGDA 1C80A 2I4LA 3V1KA 5JJBA 3BEDA 4CG3A 2J0UB 1RHQA 1WR8A 1X0XA 3ANTA 3K92A 3OJFA 1YB7A 4UBMA 3G2JA 4F60A 5MF6A 1Q95A 4REMA 5AWFC 1HTWA 4PSVA 3UOGA 2EX1A 2JFXA 2I2CA 3BH6A 3NGXA 3O82A 3GBPA 4YJKA 4YUVA 3K9NA 4FS8A 4JL6A 4GS5A 5L4SA 3HJAA 3PCRB 2B7CA 1SR8A 1IULA 5CDSA 3IEIA 3MAJA 3ZCSA 1SMKA 4UMFA 4D3FA 1D1PA 3WLNA 121PA 4JY7A 2X86A 2CSXA 3DOIA 1ORRA 1ZIPA 3G0GA 4ZAGA 1B42A 2IF0A 2HB6A 3RGGA 1M34E 1U8AA 2I22A 3L7BA 1CUGA 4C6SA 3P9XA 3G5UA 4UFPA 1JRLA 3D4BA 4GWKA 1AQUA 1BJTA 2DQKA 2YXNA 3MTJA 3TNYA 4E46A 2J33A 1AMUA 4MWGA 4HXEB 1D1SA 4FQ7A 2QLNA 3EXFA 2RHRA 2COKA 2XYQA 3IHKA 3PJDA 3PQ3A 4JIMA 3K70D 2VRBA 3PRJA 4RHTA 2QPTA 1ZW6A 1KSJA 2FFBA 1E79A 3G9UA 5EXDA 4ZYTA 1QHFA 2F62A 4LXIA 1JEQA 2YDYA 3CX4A 2YY5A 3EDMA 3EUFA 4ZJYA 1XHLA 4KLNA 3UYKA 1EB8A 2D7JA 4DJDC 4WI1A 5CP8A 3AF5A 3ROEA 1XF9A 2DFLA 2I3DA 2EKLA 3W2TA 3W6OA 1G8HA 3T7DA 2XMQA 2ZWVA 1MTZA 2ZBDA 3CR8A 4MYTA 5EP4A 1XK7A 2HIAA 3AHDA 3ESQA 4UAJA 1USUA 2PM8A 3A4NA 3ZNNA 4O2BA 4MR7A 4LY0A 1TK2A 1J6UA 5AW4A 1M5RA 2WYHA 4P54A 1U98A 4BP9A 1KYXA 3ORFA 2BEUB 2V9PA 3AEKB 3KL4A 1A5ZA 3ZV6A 1J2JA 1JW9B 3PDWA 2VP9A 1WXHA 3OQIB 4ZAVA 1NJ5A 1P7VA 2HSGA 2CB0A 1DEHA 5B58T 5IN5A 1OB2A 1V7CA 4EL0A 1L8QA 3K70C 1P0MA 5KCMA 1YB5A 4BPBA 1YZTA 1KSHA 4TX1A 5E0KB 4RJTA 5C34B 3S2EA 2RHOA 4Q5IA 3AUFA 3WKDA 4AVYA 5C53B 1Z8FA 4IO0A 3A4VA 4UDYX 3SZ3A 4Q00A 3GRRA 5H7XA 2CVFA 1F9EA 3UM9A 4LK3A 4EA7A 1ZGZA 3L7JA 4ARIA 4I4NA 4PTYA 4CKEB 4TZ6A 4G5XA 1PU2A 2D7CA 3C45A 3BRWA 4QSHA 1UJ4A 4JEHA 4CTOA 3CG4A 2V5UA 1VYUA 2X7XA 2XRMA 3FI0A 3D5TA 5D2CA 1BFDA 1IBRA 2WBLC 2XX3A 5SYNA 2AFHE 1KPHA 3BWCA 3HC7A 3USZA 1FVHA 1N1EA 4YIHA 4KQIA 3MW8A 3G2MA 1MB4A 3DE6X 4KREA 1MFZA 1OC2A 3URMA 1LK5A 3RVDA 4CCYA 3ITDA 1DQSA 4M4SA 5J23A 4TRJA 2WKQA 2I33A 3EVDA 4CN9A 3UT5B 2TMDA 4M22A 1P3Y1 3DXZA 4KXYA 1B0ZA 5HRCA 4QNNA 3DE1X 1U7TA 3WK7A 4NULA 1VI6A 3UJ3X 5JD5A 1CERA 1MXHA 2PYIA 4U4AA 2P2GA 3VR5D 1E0SA 3ZWXA 1KVUA 4DLZA 3ME5A 5ECWA 2C42A 2Q5HA 2HCFA 2R44A 2MSKA 4KVAA 2XR1A 2X8LA 2IC5A 5C32A 3V80A 1JR6A 3H1GA 1CUCA 4MMYB 5D84A 2QEQA 3AB7A 3S68A 2OBLA 1M10A 4YREA 1WOYA 3ORRA 1PEKE 3WK4A 4JGBA 4B4KA 4LDRA 5AM0A 1SIWA 3OCYA 3BGIA 5EFOA 1PLJA 1Q1NA 3P26A 4HMPA 4FDTA 2Z2XA 1L5KA 4ESOA 3KQQA 1HYBA 5B6PA 1G5PA 4P4UA 3MHPA 1CE8A 5KYUB 4QGAA 2BKLA 2ZTSA 4TTSA 3OX4A 1G6Q1 3A4TA 1PBNA 4O08A 1T4DA 5KJCA 4B4WA 2NSJA 2IYUA 3KOMA 3WLHA 4Q4CA 4F3KA 1H2ZA 4ZU1X 1QFZA 2H7YA 3G6KA 2DP4E 1UM8A 3W90A 5DBFA 2HZ7A 4XW2A 3U26A 1RAGA 4LXYA 4EMTA 2BISA 2NXWA 3OQOA 3BIOA 3KBBA 4UE2A 5DYNA 2O0KA 4G9EA 4J0EA 4L78A 4Y7CA 3TL2A 3VRHA 1BMTA 1MJGA 1SCBA 2IZ0A 4D9GA 3IBSA 4GKBA 4HEA1 5TQ2A 4FYHA 1XXHE 5JATA 2ZWAA 3EZ9A 4KQXA 3KYDB 2RIRA 1SEVA 4YONB 4MR9B 1HDIA 1XWFA 5KVVA 2C07A 3OZTA 4YB8A 2DSNA 1IM2A 2OY0A 3RUAA 5KYYA 2FHSA 2WTEA 5D5QA 4R0NA 3TR5A 1KDRA 3L8DA 1KMQA 3AESA 3IUEA 4RD6A 4MUGA 5ALYA 2PUAA 2OLEA 3L6RA 4L76A 4EGJA 1N2BA 4BVEA 5HKKA 3VGPA 2BGJA 2FX5A 4JEIA 5IWCA 4FFBA 3ILYA 3RS5A 1ZNXA 2ZCUA 1KYIA 2PYDA 1BQ4A 2A86A 5CVDA 2F43A 3R8FA 2BMWA 1AKEA 1IMJA 1O54A 5LQCA 1VGVA 1KNXA 3ZE0B 4H4EA 3T3MB 1SKBA 1PNQA 2HF9A 3K2EA 1QFYA 4M1EA 1PT6A 3AI7A 5A02A 3RBZA 1DCTA 2R6HA 3B6JA 1W5AA 3A1EA 3EIEA 3E5RA 3IUBA 3JASA 3KVYA 2JCXA 3UKDA 5EJEA 5HR5A 3UWMA 3AGQA 2ZJZA 5HF6A 3F78A 3AFIA 4YTEA 1F8FA 4NMLA 5ELLA 4A5SA 5IC4A 2XAAA 4UZEA 3AUKA 4KIUA 5LZ2A 5KX5B 3HFRA 3FA2A 4K26A 4Q4LA 1VMAA 2FOXA 1NIJA 1NVWQ 5IHPA 1E3WB 4CDGA 3TGLA 4PC3A 1PWEA 3BA6A 4KYTA 1CIJA 2Q4DA 4N5MA 4AKTA 2XTJA 4TTTS 1BN6A 1Z6QA 3OETA 1T5TA 2JCBA 3H5NA 4CTKA 1VG0B 3U4IA 2AMVA 2NPOA 4X41A 4OUDA 4NRDA 3MJDA 2A5JA 1EFPB 1H8EA 5AKLA 2HJSA 2Z3ZA 1IXSB 3PNOA 4L8YA 1BOOA 1XRQA 1DMRA 4LXUA 3WGQA 3ORYA 4NYIQ 3KP1A 1V7QA 3B1ZA 4LA4A 1G4HA 1N9KA 1G6KA 1ZXBA 3OEHD 4MIKA 4KXUA 1XIVA 3OPMA 4IJWA 3IAEA 1NYRA 4DCCA 4OI0A 1Z74A 1EFUA 5IKEA 2DERA 4C4PA 2I87A 1Z34A 2AOUB 1IHYA 1YCHA 2Q1XA 1T3GA 3K0SA 1XDSA 2G6BA 4I50A 4FI3C 2IEZA 5AUQA 4ZEWA 4G0UA 3PGVA 2PK3A 5AOBA 3G2NA 2I2DA 4ID9A 4DY4A 4C7MA 1HYGA 5J5VA 2AC2A 1F6DA 4C88A 3ZZMA 3FWZA 3PIIA 1X7XA 3GXOA 3I5YA 4OI1A 4RM3A 1YQGA 3EVEA 2MDTA 3RBVA 1E94E 4JT8A 2HD4A 4UQPA 5HOQA 2WU8A 3UOWA 4Q18A 4XWGA 4LWOA 3L8EA 1V35A 3FCXA 4I5IA 2AXQA 4EKDA 5JFTA 4EGQA 1Z2EA 3ADKA 2YIDA 2GHIA 2B25A 1CUYA 3DDUA 1THMA 3H75A 5F1KA 4G25A 2ADOA 4F3YA 3NASA 1X1BA 3DHWC 2QGFA 2XNSA 3KLNA 1ZY2A 4EY6A 1U0OC 4OMDA 2QUAA 4I4TA 1VPTA 3AMVA 4KDRA 4MVJM 5T8KC 3UPTA 3UUWA 4QNRA 5HHTA 1AOXA 2AWOA 4NKRA 3GEIA 1DRKA 1LRLA 3GX1A 1F0YA 1M83A 2UVPB 1P6QA 3W2GA 5IJXA 2B2XA 2QW1A 3UAXA 1OYOA 1M3SA 3I53A 4MVYA 3OPXA 4FFDA 1XK6A 2WVAA 3C7TA 1CQZA 2RAUA 4MUEA 1XZGA 5HF8A 5HWSA 3JQ9A 5LKRA 2X9VA 3RARA 1B8NA 1HH4A 3BAFA 1DDOA 4Y2PA 3T35A 2CXOA 2JFZA 2X9GA 3BRCA 4EI7A 5EXTA 1JLMA 3A25A 3KU1A 5B30A 3Q2IA 2FJ0A 1EFVB 2GJ9A 5MN6A 2VAMA 1AQLA 4ZYLA 2R5NA 1R64A 2V7QD 1Q0SA 2UXBB 3Q85A 3T15A 4UU1A 1TNDA 2HF7A 3RBAA 3RRZA 3BB1A 2DFDA 3GOHA 3IL2A 4MTLA 4GRAA 4WDRA 1Y1SA 5A4IS 1TF2A 1T2VA 2X3UA 2J7KA 4JYCA 3L4SO 3NHKA 1GZ6A 3BXZA 4HUQB 5AW2A 5IM4F 2O5EA 1ISHA 3SEZA 1IU9A 1NW4A 1Q21A 3JALA 5U9CA 3LY5A 4O4HB 5CM9C 5BN3A 2EF0A 1PJ3A 1X2EA 2NAFA 2VI5A 1GFIA 3EZXA 3P0EA 4M7WA 5D1NA 3TUJC 2O2JA 4ALLA 3BORA 3O0TA 4RTOA 3FOZA 3WLJA 1P4HA 5JEEA 1U1GA 1XKXA 1EFDN 2NP7A 2L19A 4B6PA 3PEFA 3WNDA 4LXQA 5K3BA 2F1OA 1K63A 2LBPA 3FNRA 4RE5A 2ECPA 2QSZA 1NBAA 5JWRA 2MR5A 1XJ5A 1YZLA 2KW5A 5ARCA 1S4MA 4JCCA 5IBQA 4DBZA 1BH6A 1O3YA 4ZZ0A 1LI7A 2ATXA 1YB2A 3HYRA 1P1BA 4C20A 1HSZA 1Z7YA 2VNKA 3T3PB 4ITUA 3UAZA 5KTTA 1K08A 4X1YB 1W2WB 3INYA 4DKXA 4X6LA 4J0GA 4K6HA 4Y2SA 3HXOA 3PEWA 1R88A 2HU2A 1L3CA 4R1QA 3AHFA 4G5SA 1USVA 3UOAB 4KNWA 2CEAA 4JHXA 2QD5A 5EJIA 3IKVA 2ZR7A 3N8IA 2PBRA 4CL2A 1UBJS 1ESZA 1QKJA 1R6VA 1ZK2A 2CLCX 2FQ1A 5FBLB 4F6RA 3LNTA 1YRYE 4LV5B 2ZS7A 3ZHYA 3KQNA 1TUBA 1RJGA 2HWWA 3DMPA 3N2YA 1L4LA 1NVAA 4BMDA 3LFTA 2G7ZA 3IO3A 3IJEB 1BU8A 2FZGA 4O29A 4Y1GA 4CWAA 3DHYA 3U7QA 4ZQFA 1VG9B 5DX0A 3MBKA 1A9QA 3LC7O 1VFPA 3WYGA 1B8VA 1ZCJA 2CD9A 4KAXA 1JHUA 4CKXA 5DX1A 4YJFA 2QRVB 2XV1A 4LQ4A 1O4WA 1KVRA 2GO1A 2PN1A 2XTMA 1WM1A 1A9OA 4REOA 3FGZA 3KVNA 4PFKA 4TWIA 1LTHR 1JWLA 3UJ8A 4LTNA 5AUNB 2O0JA 3WRVA 3D3KA 3CVWA 4CFYA 2AUNA 3SPXA 3QQPA 4IO1A 3GW8A 3HGTA 3ZHZA 4CG2A 5IXYA 3UAWA 4Q16A 3OLYA 3C1OA 3L7DA 5A7HA 4B47A 5B7PA 3NVDA 4NBTA 2ERCA 1O6ZA 1IY9A 1CUJA 4E51A 1M2KA 4E88A 1QG6A 4GUAA 2AGVA 1Y89A 1ZM4A 1XQ9A 2A84A 4HEHA 5HBGA 5F98A 3MWGA 1U8TA 1JQLB 3KIPA 1HG0A 1FP2A 1PT9A 2FPIA 2QVGA 2JLQA 3I6ZA 5EMKA 3ZD9A 1EWQA 1A82A 3BDVA 3LY8A 3U6BA 4EGSA 1VCOA 1GAQA 1XGKA 1BDHA 1VLQA 4NDAA 4E5NA 4QEDA 1ZAYA 1GFZA 2VF2A 2XVMA 2F3SA 4HNGA 1QK5A 2WF9A 2Y66A 5KOHA 5AQ1A 4RTSA 1Y3BE 3PLRA 3REGA 1CFJA 4ON9A 2ZYSA 4TXHA 3M70A 3PXUA 3R2JA 1M34A 1T34A 2H52A 3QSGA 4TN1A 3ZLBA 2PRSA 5KNDH 1QQBA 3SR3A 3KDSE 2HX1A 5DHRA 4PYOA 3I32A 1MA0A 2X0RA 3BFXA 3A9TA 3NYIA 2IUYA 1SCKA 2GR9A 1A4IA 2X5NA 1OZFA 1ADBA 2CJWA 3WWZA 1RYZA 3EF0A 3MXOA 2UYYA 2W22A 4ZDWA 1N2SA 4AMGA 3KPJA 1O1YA 2EFCB 5FOUA 2OXRA 2IYPA 1GG8A 4EZIA 1A8QA 1RLMA 2OCXA 2NZWA 2H1HA 4GLOA 4PHFA 3C74A 5AICA 3QMVA 1U2TA 1XX6A 3DW3X 4JYBA 2P9JA 3SYNA 1PEAA 4TM8A 4OJNA 4EP1A 1SCUB 4G97A 4ZVRA 1H42A 4D4MA 1I0LA 2LR0A 4DEVA 2OESA 4BO7A 1BIFA 1A4RA 2PMKA 1KMHA 3OQ1A 1AKNA 2ZRBA 4QYWA 4F5ZA 1M0SA 3FTEA 1RHUA 2P3QA 1Y8QB 3EWAA 1U2QA 5J3JA 4BLRA 2ZUBA 3GBSA 3CZCA 4GM0A 2C96A 2RGYA 4OJMX 5EWJA 3W04A 3ZIDA 5BUQA 2ZRGA 3A3YA 3RSGA 1N3IA 3ZVLA 1ZCZA 2RK3A 4A8JB 3AKZA 3CO0S 4ZDIA 1N0VC 2TRSB 1KFJB 4OOFA 3WTBA 2O7QA 4FCCA 1ZM3A 1YNOA 5JNLA 2RGNC 3DOEA 4JZYA 4MJ3A 3SQXA 4BU0A 3DE7X 4OHPA 4XJXA 2F3UA 2WZDA 1UZMA 4QE3A 1JQEA 1XCOA 4BO1A 3WSWA 1SZDA 1G21E 2GH1A 3QLVC 4BQSA 1GNLA 3GIWA 4KJXA 3LPNA 4IZOA 2YWXA 4HZGA 4WBNA 1WXGA 3CE9A 1FNDA 4H7KA 1FDRA 3D3WB 4LBVA 3QJGA 3EOZA 3HN2A 2ZE7A 2QB5A 3LT4A 3P27A 2AFHA 4Y0NA 3OWHA 3LP8A 3WMEA 1L2TA 4ERXA 3T7SA 2V6MA 4IOKA 4P83A 3ID6C 5KNCH 4Q05A 1Y5RA 2Z1MA 2PZLA 4W9RA 3VKUA 4OA5A 5EJ7A 3HBAA 5KYGA 3AW8A 1W75A 4IYRA 1VMKA 2E4AA 5GADl 4NYMR 1ACLA 1XTKA 2X6QA 3EH1A 3M33A 3AUXA 4BB6A 4LECA 5EJ9A 5TLSA 3IEMA 1H65A 4YT8A 4CVNA 1U28C 1MJFA 1QH9A 2A5GA 1UP7A 1PX0A 1JQKA