1FMLA

Crystal structure of retinol dehydratase in a complex with retinol and pap
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
341
structure length
341
Chain Sequence
LPFPYEFRELNPEEDKLVKANLGAFPTTYVKLGPKGYMVYRPYLKDAANIYNMPLRPTDVFVASYQRSGTTMTQELVWLIENDLNFEAAKTYMSLRYIYLDGFMIYDPEKQEEYNDILPNPENLDMERYLGLLEYSSRPGSSLLAAVPPTEKRFVKTHLPLSLMPPNMLDTVKMVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAWAKRHDPNMLFLFYEDYLKDLPGCIARIADFLGKKLSEEQIQRLCEHLNFEKFKNNGAVNMEDYREIGILADGEHFIRKGKAGCWRDYFDEEMTKQAEKWIKDNLKDTDLRYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A helical lid converts a sulfotransferase to a dehydratase.
pubmed doi rcsb
source organism Spodoptera frugiperda
molecule tags Transferase
molecule keywords RETINOL DEHYDRATASE
total genus 116
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fmlA00
1VYUA 1M1YE 5CITA 2J87A 1G8YA 2J1LA 4KLZA 5KDDA 3GP8A 2CDNA 5LBIA 3KXLA 1BMFD 1G3QA 5L3RA 2YOFA 2WJGA 5J40A 1KNQA 1R6BX 3A4LA 4A92A 4TMTA 4G5OA 2EFHB 2PL3A 4TYWA 3QEJA 3EA5A 4Q4AA 1MRSA 2QGZA 2Z83A 4L9SA 4DLZA 1Q3TA 2I3BA 2EVWX 1BH2A 1QF9A 2ZU6A 4G1UC 4JL6A 2DFLA 4LBWA 4M1YA 2YWGA 2QMEA 5A5GA 2FSGA 2KI5A 3B82A 4JLPA 1NBMA 2CMKA 2IK8A 4KBFA 4PQFA 1YJ5A 4X8MA 1DAIA 3OE7A 1LNZA 1OW3B 4EFMA 3FKSD 2CK3D 2ZUDA 3KJHA 5FTNA 3VMFA 5KPJA 5CLLA 1ZIOA 2C99A 1N0VC 3QEOA 2OESA 1NKSA 4MDEA 2YWEA 5JCZA 3I92A 1VG8A 3KDSE 1U90A 3EZ2A 4II7A 1R4AA 5JRZA 1G8PA 3U4QA 1E9RA 2VP9A 4RJLA 2V1XA 5FL3A 1RW4A 1QVAA 2IYWA 2ZRLA 4JZKA 3ZD7A 1XPOA 3ICEA 2DFKB 4WAUA 3HU1A 1IN5A 4HZUA 1T5IA 2ZREA 5L8VA 1GKYA 1SKYB 2D7DA 1JR3E 1X1RA 2ZETA 4P4UA 1E98A 2KSQA 2W2VA 5JJKA 4Q00A 4QL3A 5BN5A 3R7WB 4NKRA 1E4VA 3RVBA 3TMKA 4MDFA 1TADA 2Z43A 3BB1A 3E2IA 4ZIRA 4CRWB 2FSHA 2NTYC 3GFPA 1UAAA 1BKDR 3NBFA 3H0KA 1VDZA 1R7RA 1GAJA 1OHHA 4F38A 1SHZA 3NC0C 4LV5B 4PPFA 3B6EA 3G5UA 4ZV4A 1DG1G 1U99A 2FEOA 2A78A 2FU5C 3B78A 4UNQA 2EYQA 5GADl 2IHYA 3K09A 2GCNA 1OXSC 1UPTA 5CIQA 4RD3A 4M1KA 2VH5R 2VLIA 3NC1C 4B74A 4ZKDA 3Q85A 3IBYA 4B2IA 2NG1A 4HYYA 1GIAA 1ANKA 2MSCB 1XB2A 1UDXA 1WF3A 2VA8A 4MRRA 2V9PA 3SJZA 3CONA 1IN4A 1SVMA 3VHXA 2XJ9A 5IRCD 5LD2C 1JPJA 4TSFA 3HPQA 1XEWY 4MA4A 2AK2A 2JLWA 4QHTA 3L0SA 3FE2A 3PUWA 4P4SA 1S2MA 1XD9A 2CL6X 2RGNC 5JEEA 4JMPA 4S2EA 2RKOA 4DKXA 4ZO4A 4KO8A 5KUTA 4XVQA 2WSSD 2GCOA 3DMDA 3X1DA 4ZDWA 2G83A 4MGYR 1A2BA 4Q9HA 3KJEA 1O3YA 1QHGA 2W2XA 2CNWD 5HZHA 1CU1A 4EJSA 3VKWA 5A4JA 4G0NA 3QXCA 3GFTA 1KI9A 1U0HC 1OKKA 4TQUS 3R9XA 5FPKA 4PC7A 3TVTA 1W1WA 4PHTA 1AS3A 4LHZA 3ZD6A 1E9DA 5EP2A 4QKQA 2UZ3A 3DO6A 4YMVA 1N5LA 1QG2A 3CX8A 4NBSA 4GMXA 3L2OB 3NEYA 4QGAA 2GWHA 3MAAC 4Q4JB 4XD7A 3A4NA 1P9RA 1KTVA 2JASA 1JAIA 4O2RA 4US1R 3ICQB 2ASEA 2OFXA 3AF1A 4B75A 2XNDA 4NH0A 4FIDA 1Q12A 1U81A 4POAA 3H86A 2YZ2A 2JJ2D 2O8EB 1E2EA 4E22A 1SVKA 2WWHA 3SN6A 1VYTA 3BXZA 5C4MA 2YINC 4R2IA 2FDCA 2YJTD 4LHVA 4Q9JA 2KBFA 2ZSFA 4BRUA 4B3XA 2ZITA 4D4LA 3AB3A 4US0R 3VR6A 2WIBA 1G8HA 3KFVA 1GZSA 3W8RA 1E2DA 2H57A 3P4YA 2ZUCA 1DEKA 2RGBA 2DY1A 5JWRA 5JI3E 2AKAB 1NLFA 3ZZTA 1ZM2A 1UF9A 3MWJA 1ZD8A 3GLGE 3NDBB 1E9EA 3K0EA 2CVHA 1Z47A 1KI6B 1JJ7A 4DLWA 2XZOA 5FOSA 4DLUA 2RGNA 4UNSA 4P33A 4QJ4A 2R6DA 5ANRB 1TQ6A 1KI6A 2IYTA 1RPZA 1PVOA 1OXTA 1J2JA 5J4HA 4HDOB 4GMDA 3D6TB 2VP0A 1XDBA 2J59A 4PSAA 5IF9A 4QJ3A 2AXPA 3R9WA 3SI7A 1W7AA 2XB2A 1NVVR 4S35A 3EPKA 1TQDA 1XFAA 4TYQA 1P75A 2QE7A 3FHOA 4A6PA 4MKFA 3ZZ0A 1FNMA 1FQKA 1ZD9A 3MFYA 4RD1A 1K6MA 2KWIA 2Q9AA 4NYJQ 2H92A 3QENA 1H8HA 4MRPA 4EUNA 3QKTA 4B3GA 4TLAA 1RYHA 1I4LD 3SBDA 5IDVA 3UK6A 5IK2D 4TT3D 3IHWA 3LH5A 3SOPA 5DN6D 4Q1CA 4Z8XA 3EPLA 1E1RA 1KDPA 3GD7A 3WYFA 5FR2A 2CCJA 1W47A 2JLUA 2ZI7A 3TR0A 1S96A 1Z0AA 1XTQA 4PC2A 2J9RA 1IXRC 4MYHA 4Q47A 2P65A 4RY2A 4Z1MA 4A2WA 3CRMA 4WXPA 5FTLA 1MT0A 4D0GA 1N0UA 3BE4A 1JPNA 1GNPA 4B3CA 4N1AA 2OUKA 2EYUA 2KE5A 2CHGA 2NO7A 4C0QC 1W46A 2H16A 2XB4A 4JYCA 3I4LA 4CEIB 1P2UA 1C1YA 3WMFA 2AR7A 2O0HA 2FH5B 4AURA 1IY0A 3SHWA 2GAAA 1TEVA 2H18A 4LC1A 2A2ZA 4NP6A 4BRWA 3U3RA 4GP7A 1RE0A 4PPQA 2J7KA 3T35A 2CL7X 2HUPA 3B85A 3OE7D 4HZIA 2DB3A 1DO0A 1Z0KA 1D6JA 2Q0HA 3CUEF 1Z28A 5CDFA 3AF3A 4KLNA 3ASYA 3AKDA 2XAUA 4HLDA 3WP1B 1DAFA 3Q7PA 4BECA 1N6KA 2RCNA 4P4TA 1KK1A 2ZJZA 1KJWA 1GM5A 1WE2A 3GPLA 3CB4A 4QGGA 5KNCA 1YQTA 3DEFA 2D7CA 1ETUA 1DTSA 1W48A 5EE1A 3AUXA 2CE7A 4NYMR 4PAMA 1G20E 4GSYA 1FOEB 2BBTA 3LX5A 3RRMA 4QGFA 1VIAA 2ZJ8A 1FMLA 1MH1A 3N2IA 4A0RA 1A1VA 1KO7A 1TUEA 4TLEA 1CKEA 2BWJA 2VP4A 3K0SA 1KY2A 3F0TA 4C0SA 4I1OA 4L9WA 1GITA 1I4TD 1RJ9B 4LJ8A 1UBEA 2GZAA 5BN3A 4WOPA 3SFVA 5HR5A 4TZ0A 2IBMA 1ZVQA 3QF4A 4DRZA 1LB1B 2WJVA 2NIPA 3VHLB 3WBJA 5EZ5A 1N6LA 3PENA 2HYDA 3E70C 4CEHA 3LW8A 1US8A 2ZS7A 2JLZA 4ESHA 1YVDA 2YVUA 1E9CA 4GOJA 1LVGA 1M7GA 4IOKA 4JLAA 4MGIR 5EXXA 3R9IA 3SNHA 4AYWA 4D26A 1R0ZA 4V0MA 5JRJA 2DCUA 1XTKA 2FJUA 4HAWA 4XJXA 1H65A 5GJBA 4UXJA 2BJVA 2ZRBA 4TZ6A 4O25A 4KBGA 4LJ5A 3MWLA 1NF3A 4XIGS 4CZ2A 3PUXA 3IQXA 4MRVA 2PLRA 4MGKR 3VNUA 4JKYA 5SZJA 3E1SA 3VU9B 2VHCA 4OYHA 3B9PA 3A4MA 1XPRA 3U5ZB 4TSFD 2F55A 2D2FA 4UXIA 1Q1QA 4Q1FA 4PZZA 4UNPA 1SVSA 4QM6A 1UKEA 3KTAA 4L15A 3W9YA 4DDVA 1WMSA 1P4SA 1OFUX 2R6FA 2W6JA 4BFXA 1JEEA 3Q5DA 3R8FA 4WIAA 3AVXA 3BAFA 4Q21A 1N25A 3W5JA 2QZ4A 1QHYA 4M8NE 3TUIC 2Q3MA 2B92A 3TBKA 1JQJC 5FUVA 3K70B 3U7FB 2ZVPX 4JS0A 2GXUA 4YMUA 2O8CA 3B1XA 1Q1ZA 1S3SA 2JEOA 2WWIA 3DMNA 3LXRA 4H1UA 2C9YA 1AK2A 2ANCA 5EZ6B 3U2QA 1WQ1R 4IOJA 3P26A 1NMZA 4RCZA 3VR3A 4EFNA 4W5JA 4HEJA 4IXMA 4B73A 1YZKA 3AV0B 5G3YA 2VSOA 2PCLA 2HLDD 1GNQA 1O87A 4MYCA 4NMMA 1R0YA 4TTQA 1H8ED 2OXCA 1QBKC 4YMTA 1KO8A 3TW4A 3AKEA 3EARA 1G4AE 1SVIA 3PUVA 5DYGA 3AF0A 1KK0A 3T5GA 2OBMA 4OQLA 3EZ6A 4LSGA 1XMJA 3GJ3A 5SZKB 2BDTA 4BFWA 3M1IA 3THYB 1QHHA 2WWXA 1KKLA 4MYTA 1EESA 4RSGA 4B3FX 4QBFA 2CE2X 2FF7A 3X1XA 5EP1A 3U6BA 2ZRGA 1QHHB 3TSWA 4C9BA 5J4VA 4J0QA 4DCUA 1JALA 1YZLA 1FUKA 2OLKA 3JVUA 3EC2A 2ZR7A 2XX3A 3QE0A 4Q1AA 4FMCF 3DVLA 3Q3JB 4F4JA 3U3JA 3CZPA 3WP0A 1Z0JA 2ZSBA 1OT3A 1RRCA 3I73A 4A6XA 4CVNA 3MMPA 1XP8A 2CXXA 1KI2A 2V7QA 3NH9A 1OYYA 3KTAB 1ZUNB 1EFRA 3VX3A 4K81B 1G1MA 4GL2A 3GLIA 1R5BA 1GNRA 3BGWA 3U61B 3KL4A 4JLKA 4TMKA 3VNVA 1XWIA 3DKVA 4EIWA 2VF8A 4JJKA 3RS0A 1KKMA 1E0SA 3FKSA 1L2TA 1XJCA 2IHBA 2WPDA 4A0GA 3QXSA 2QTVB 5F3WB 2OEPA 3GMTA 4DJTA 1RIFA 2OCBA 4Z51A 1LF0A 2GBLA 4W7SA 4PSKA 4LCBA 1W5SA 3T61A 3NG1A 1YR9A 1T0JB 5DE3A 2BMEA 2O8BA 3F3YA 4URXR 2BM0A 4HUQA 4B47A 2WJHA 4A15A 1U2RA 2J41A 1TAGA 2FV8A 3I62A 3RS4A 1WDTA 2XTZA 3B8HA 5JI2E 3L8ZA 1DELA 1OPXA 3EC1A 1S9DA 4DUGD 3ONWA 1CP2A 2MMCA 2VSFA 5IK2A 3JZMA 3L8YA 2V54A 3ZJYA 1G5PA 2R8RA 1VCIA 3REGA 1E1RD 3BB4A 1MOZA 3K0FA 3KQUA 1NI3A 1T3SA 4B71A 1SXJB 4GBMA 1N6OA 3SC3A 2V1UA 3LLMA 1KSFX 2NO0A 3HWSA 3SDZA 3AF2A 3JVVA 4V0KA 5EUQB 1DO2A 1OFHA 4GPTA 3IILA 3WYAA 2WKRA 5CYOA 3ZVLA 2B7CA 3BFXA 2O8EA 3SJCA 1W2GA 3REFA 3TAHA 5F9HA 2AWOA 4XSHA 2MSDB 3OEED 3QBVA 3ZLJA 3B1YA 4LHWA 1IQPA 3FYHA 4ZPXA 3S1AA 3TNFA 2ZEJA 1ELOA 3V9PA 4HB2A 2ZSEA 3K9LA 2OXRA 1KI1A 1CR0A 1SVOA 1Z6GA 2ZQ5A 3N70A 4WBSA 1UKVY 3A36A 4TL9A 2R65A 1JNYA 1Z3IX 2W58A 5DHFA 3IPXA 2WOOA 2QPAA 4TL6A 5G40A 2YWHA 3LQQA 4DSUA 1VMAA 2J45A 4DLTA 2VSXA 2VEDA 2FSFA 4XTCS 3ND8A 2ORVA 1TUIA 3QVUA 2D74A 2A7QA 3CPEA 4TN1A 2WAXA 4PHFA 1N6PA 1JQLB 3AF4A 3CNLA 3X2SA 4JYBA 5JECA 3E5HA 3EAQA 3PJRA 3FMIA 4LYHA 5B30A 4BLPA 4P4SB 1ZNZA 1VG9B 5FL7A 4DEXA 1OH6A 4TMVA 2ODEA 4G01B 3GQBA 1TF7A 3C15C 2J0VA 4BPBA 4BEJA 5KNBA 1T0HB 1PV4A 3PUYA 1A5TA 3MSXA 1ZU5A 1NG1A 2BJWA 4GDFA 1KSHA 1CR4A 3ZVRA 3HP1A 5FR1A 1YZTA 1IN7A 4LJAA 2ODNA 3GLHB 3KKMA 3QPUA 2XXAB 2C78A 5CB6A 4LX0A 2VP2A 1Z0DA 4FCVA 3LVRE 3RSOA 1N3BA 1RVDA 2OILA 5C4GB 1M2OB 2FNAA 3SBEA 4EPWA 4OQFA 2ERXA 4NYIR 4QM7A 4XD7D 2ATVA 4LBZA 2WJJA 5FOWA 3TQCA 1RRPA 4EJSC 1DAMA 3LXXA 3C5CA 3OHMA 5DISB 5TDHA 3HPRA 2GJ8A 2QP3A 3EXAA 2GETA 4G5RA 5AUOB 4IDOA 4A8JB 3IPYA 3LW7A 4RZXA 4A2QA 4DT1A 2ERYA 2F3TA 3PV0A 4PO1A 1LY1A 3Q72A 2YV5A 4OHZA 5JZVA 1BMFA 4L5BA 1II0A 3TAUA 3FMPB 3PR1A 4U02A 1GKIA 3RWMB 1E79A 4FD2A 3TSOA 4DT1B 4C30A 4TTPA 1D2MA 3QKUA 4ASUD 2IS6A 4B6EA 4QXAA 2ZJOA 3LBNA 2QPTA 1G9XA 4Q4AB 4DCNA 4DLVA 3O8RA 1W36D 4D25A 1U9IA 1OXXK 2IEYA 1IONA 4JT4A 4PSVA 1HQYE 2PZEA 2W6JD 5HCNA 4G3XA 1ZNXA 1E9AA 2WICA 2DPXA 4OHVA 1AA9A 4GNKA 4W5HA 4G5SA 1F2UB 1ZUIA 4PFSA 1Z6AA 1Q21A 1XX6A 4OHXA 4QHSA 2QEQA 1DAEA 3IEUA 3TKLA 5HKKA 3QG1A 4DLYA 3BWDD 4ESVA 1CJMA 4WZ6A 4NCIA 1NBMD 1II9A 1YZUA 1DS6A 2D06A 4YONB 3U7HB 3SQWA 3CPHA 3O8BA 3WBKA 1TU3A 4LOAA 2ZSDA 2IS2A 1COWA 2ZU0C 1XEFA 4RKFA 2ORIA 4BFUA 1KO5A 2C95A 2ZI6A 3QXJA 1GL7A 2OAP1 4BUJA 2QBYB 3RHFA 1P9WA 1NVWQ 3I3SR 4CF7A 2QAGC 3HYTA 4DBLC 2JJ1A 4ZDIA 4Q4HB 3KUDA 4RKEA 2IF2A 4YLGA 2HYIC 5L3SB 3QQ5A 1AKEA 1YZNA 1OXVA 1J99A 2OCAA 1W4BA 2DR3A 1D8TA 4AKEA 1G3IA 1HA3A 4XH9B 2ZTSA 4MKIA 1E32A 2GESA 2WHXA 4Y0VA 1K8RA 4RD4A 1NVVQ 5LPNA 1P9NA 3LY5A 2JCSA 3IGFA 1E2MA 1YHNA 1PJRA 2BMJA 2G0TA 3SE0A 3D3QA 4CEHB 1KO1A 4JIMA 2ZI5A 2RHMA 1OB5A 2PH1A 4Q4LA 2CCGA 4JJZA 3ADDA 3ETLA 1E2HA 1R8SA 3CW2A 1F3OA 2RB4A 1T4GA 3LWNA 5JWHA 2CEAA 3V4FA 5E95A 1W4AA 2YKGA 1XMVA 4CGZA 2DBYA 5EE0A 2VHJA 3I72A 2OM2A 1W44A 1WCV1 2C9CA 4HUTA 1W5TA 2DWPA 5JFGA 4PR0A 4HDCA 5LB2A 3CZQA 1IXZA 1XXHE 4FMDF 5UKDA 2BKUA 1E2IA 1NMYA 1EG7A 2KJQA 4PZLA 4UJ5A 1Q3HA 2WWYA 1EFRD 2WIAA 1N6IA 3LDAA 5FPSA 2REBA 2BCJQ 3AQ4A 1VCMA 1AS2A 1NRJB 4ABYA 3VU9A 4BFZA 1KYIA 1RRFA 4MITA 3NEJA 4LZZA 5JHGB 3DOFA 4C0KA 4KFSA 1OIWA 2CLDX 4JSYA 4DIEA 2D2EA 4KFUA 2NO1A 5FBRB 2WPDD 1GWNA 1E0JA 2BEJA 2Q3HA 1G18A 1NVUQ 1SKYE 1AQUA 1I2DA 2WWGA 1OIXA 2E1RA 2IYZA 4N0EA 5K8TA 3OEHA 1JECA 5CK4A 2JA1A 2GA8A 3NBZC 4HAYA 1OF1A 1P6XA 1Z22A 2P2LA 3EZ9A 2OBNA 1AS0A 1ZBDA 5TXGA 1E6CA 4M9SA 1NNEA 4BZPA 2NOAA 3TGPA 1E99A 2HV8A 3CM0A 3W3AA 2ZJ2A 4Q9KA 2VQSA 4AY2A 3BC1A 4Q7JB 2R6AA 4NONA 3IIKA 4HDQB 3WHKA 1X8LA 1ODFA 2Q6TA 2ZJBA 4IOMA 4JLMA 1IM2A 3UG6A 3RRYA 3U3OA 2ZUBA 2IYVA 2J7PD 1GKUB 2GK7A 3LVQE 1NJGA 4WA7A 1A2KC 1VCNA 2NO9A 1NN1A 2DWQA 1VHLA 4FMBB 1FX0B 4CYMA 2P0EA 1CRQA 2QROA 3OAAD 4I1UA 4NCJA 4BEBA 3GLFA 4BZQA 4IVQA 4M9QA 2FG5A 5AK0A 5F9FA 3K0AA 3OEEA 4AKHA 2JJ2A 2GEUA 3BERA 3VX4A 2RHDA 4TYYA 2PT7A 2OV2A 4GI7A 4C2TA 2IYSA 3B13B 4URZR 1SVWA 3UANA 1L8QA 3N2EA 2IF0A 4O0MA 1F5NA 4OHWA 3T1QA 4NTZA 4Z54A 5JS7A 4LDJA 4PPNA 2ZRHA 3THXB 1XCGB 3B5JA 2RGEA 3EPJA 1QHSA 2FN4A 3QNUA 5G53C 5HPYB 2BHRA 2WSMA 4IVRA 2R62A 5JWOA 5BN4A 2EWVA 4KYIB 1M74A 1SZPA 2GTPA 4IVPA 2OE2A 2ZRDA 3RDPA 1G8GA 2ZE7A 3CF2A 4MUAA 1OV4A 1M34E 3CRRA 3NWJA 4QG7A 2P6UA 3IIMA 4TLBA 1E2GA 3FOZA 1ZIPA 5IT5A 4X8LA 2GEVA 1FW6A 3GLGA 1DARA 2GRJA 4BASA 3PVSA 5DI3A 3DPUA 2HF8A 1UKYA 2VPPA 4JVSB 4DIDA 1T6NA 1G41A 2IEZA 4KCGA 1NLZA 2AWNA 2P3SA 5FPYA 4URWR 5DI3B 2F6RA 2ODBA 1F48A 3WNBA 3MUFA 3KQKA 1P3JA 4KHZA 3EIHA 4EDHA 4GT1A 4KODA 621PA 4PC3A 5AJVB 4MRNA 1VG0B 2G1JA 3LBHA 2ZS9A 3F5FA 2QP9X 2ZRNA 3CLVA 221PA 4U7DA 1KSJA 4FI3C 2YOHA 1G3UA 1LS6A 1ZNYA 3U3KA 4TMZA 3LQRA 3RS7A 5BXQC 3PQCA 3LX8A 3TH5A 2VIIA 3QXHA 4TLDA 2REXB 1KHTA 3IBGA 3NH6A 4DVGA 4YXWA 1Z5ZA 1KZGB 4TT3A 5D3MA 5FOXA 4HSEA 5DN6A 1K5DA 1XRJA 4NYIQ 1TNDA 4M1TA 1FTNA 2P5TB 2WVJA 4LJYA 2J46A 1VG1A 2REOA 4B76A 1T3LA 3IHLA 1X8JA 3WXMA 1ZM4A 4JBYA 4ITRC 1DAKA 2GF9A 2XOKA 2W6ID 1GDDA 1G64A 4Q1BA 4QRHA 4D4JA 1P61B 4CEIA 1YR6A 4AIIA 1MABA 3AEZA 3NBXX 3A58B 3QKRA 1NSTA 4HAZA 5DLQC 3LO5A 2ONJA 1X86B 2KB0A 1ZM3A 4IRUB 1JJVA 4XVRA 1AZSC 2RGDA 5CB8A 4CEJB 2O8DA 2R9VA 2FFAA 3U7GA 3ZIAA 3RC3A 4V0LA 1E69A 5GVSA 3TUZC 2O8FA 1XEXA 3OFNA 3NHBA 3GLIB 3HDTA 1VIYA 1Q0UA 2PZFA 3FFBA 2O8FB 3X1ZA 3I1FA 2FFQA 5M04A 3AVPA 2AKYA 1R0XA 1G8FA 1U8ZA 2C04A 3PG5A 121PA 1HYQA 3ZZUA 2BMFA 2D3WA 5CYPA 1E2FA 3K1JA 5LD2B 2I1VB 4D0LB 2VRWA 1PLKA 4BLQA 4IFEA 1OB2A 2P5SA 2X1VA 5JEDA 3ZYCA 2C96A 1TX4B 3IKJA 1OH8A 2H1LA 2O8BB 4L16A 3U60B 2J0UB 2H17A 1G3RA 4MRSA 3PCRB 4V03A 3Q7QA 3LRPA 2WJYA 3HR8A 3PFIA 3Q8XB 5TMPA 2PCJA 2GXQA 2K5UA 4B44A 4OL0A 3A1WA 2I1QA 1FFHA 3AGPA 1US8B 1KI8A 1DG3A 2QQ0A 1PLLA 1G17A 1P7CA 4ON9A 4AYTA 1Y3AA 4FCTA 1JXMA 3C7KA 5E7JA 2GNOA 4LV6A 1ZP6A 1NLYA 3QF7A 3L0IB 5HZKA 3GLHE 2WAYA 1RYFA 1MABB 1ZCAA 2XTMA 4ZCMA 1KAOA 3THWA 3WMGA 2PJZA 1TF5A 3BFVA 4X8HA 5FTMA 5J4KA 4F92B 1NG9A 2R2AA 1AN0A 1D9XA 2V6IA 2X77A 2F9LA 3HU3A 3UIEA 5JLJA 2H8KA 2PLFA 4HAUA 4TMXA 3CR7A 2D4HA 2J0SA 3BORA 1TEXA 4NYMQ 2QMUA 2EW1A 2ZPTX 3GJ7A 2A5GA 3FFAA 4RD2A 1HUQA 4F93B 5JJIA 4NCNA 4IHQA 3NHAA 4IW3B 3SU8A 3OZXA 1W0JA 4TYPA 5FOVA 1TQ2A 1UADA 4M1WA 5H1YA 1M6NA 3GJ5A 3K70D 2QGNA 4C0JA 2X2FA 3TUJC 4NYJR 2AHOA 5G3ZA 1KO4A 1J8YF 3KKPA 4B48A 2H5EA 4MH0R 4OI4A 4A8JC 5D3QA 2IX3A 2UKDA 1TF2A 2Z5FA 3MLEA 2MSEB 4Z8YA 2VL7A 4KJZA 4RVCA 5FBQB 3UMRA 2ONKA 1YKSA 4TYNA 4EJSB 1E2NA 4NCKA 1SXJC 3PIRA 4DHEA 2PJRA 4DB2A 1OH5A 1SQ5A 3TQFA 1IHUA 1Q44A 4ARZB 3K0FB 4IDQA 1VHTA 4ERNA 1G5TA 1P2VA 1G6OA 5KSYA 2HLDA 1XXHB 2ANBA 5EXSA 5FTKA 4WZBE 4P32A 4EKDA 4WZAE 4EPTA 2JLVA 4D81A 4LYAA 1QHXA 5EE9A 5EXPA 2JIZA 2QENA 1XXHA 4A36A 2ZIAA 3GEEA 3K53A 4C3ZA 2XZLA 1YZGA 1X1SA 2DYKA 3RS3A 2N42A 3KZ1E 4GOKA 3W3ZB 3B1ZA 4ZIRB 3KQNA 2F1RA 1ZNWA 4LPKA 2V6JA 4XSGA 5K8IA 4NPHA 4PTLA 3QY0A 3AP1A 2BBOA 2AFIE 4ZI2A 3A1TA 4ACAA 1KI4A 3T15A 4HLQB 2Y8EA 1GP2A 2G0NA 2ZRPA 2ZJAA 3HYRA 4RFVA 1X3SA 1MO4A 2QP4A 1LTQA 1CBUA 2YC2C 1IAQA 2N46A 1J90A 2Q9BA 1ZMXA 1AQYA 3C4JA 3BD9A 2IA5A 1E4YA 3OIUA 4L4UA 4UNRA 3AP3A 3BOSA 3NKVA 4V0OA 4ZCIA 2W0MA 4R7ZA 2IT1A 4JLNA 1E1QA 1DADA 2BM1A 3EA0A 2WV9A 1K5GA 1E2QA 3CRVA 5TV2A 1LS1A 4FN5A 4QBGB 3TIFA 2CJWA 2ZRKA 5HKKD 2CBZA 4PHGA 1JI0A 1XEWX 3DHWC 4B2PA 1QG4A 4RZUA 2ZYUX 3KXKA 1COWD 3RABA 2HXSA 4KVAA 4WVFA 1LFDB 1FZQA 1UFQA 2LCFA 5DYIA 1YU9A 2X2EA 2W2TA 2XZPA 1E2PA 2F43B 4U5XA 3ZS8A 4M1OA 2RAPA 1ESNA 4HB3A 4D2IA 1GRRA 3R20A 1YR7A 1ZUHA 5KOYA 4IEIA 3QPWA 1S1CA 1GG2A 3SYLA 5GVRA 1Z6YA 2AN9A 3DZ8A 5B57C 2JLRA 3IIJA 1J70A 4BLSA 1A4RA 3TVDA 3OIVA 1KGDA 4G5QA 5B64A 4KSCA 4IJMA 4PQYA 1R0WA 2GCPA 2EU8A 1MO5A 3ND9A 4JLDA 2ZYWX 3RAPR 3SR0A 3BJIC 1NY5A 1B0UA 2BV3A 2C8VA 4Q4JA 1IJEA 2ZAOA 3GJ4A 2PZGA 1OFIA 3NTUA 4QGHA 5EE5B 5LB4A 5JBQA 3LFUA 2W0SA 2W6IA 4DLXA 1E0AA 3U6KA 3TLXA 3SYNA 2I4IA 2FGJA 4GOXA 5FPTA 1VKJA 2CLSA 3S1AB 4KITB 4V0NA 1T8UA 4BLOA 2ZR0A 3UWOA 2A3RA 4LBVA 4M22A 4JVNA 1G21E 2F3RA 4XWOA 1JEDA 3IO3A 2FEMA 1CJUC 4GP6A 4BZXA 2GJKA 3ZGXA 1Z29A 1XD2B 5FI1B 2IYUA 1P2SA 3BBPA 4TWZA 4KI0A 5JS8A 4C0BA 3GJXC 3LV8A 4DCVA 1FL9A 4P31A 3G0HA 1JB1A 3FPAA 3AVYA 3CH5A 2A30A 2AD5A 5B58C 4OK6A 2BMDA 4M9XA 1II8A 2GZHA 4KYUA 2QNRA 1GILA 1LW7A 2WWWA 2IS4A 5AWFC 1UBGA 4U00A 2XITA 1EXMA 3J81k 3H1TA 3GJ0A 4BFTA 1LF5A 1W0KA 1CR2A 3B60A 2ZRIA 3M4YA 1N6HA 1T8TA 1R5OA 3P20A 5AJZA 2QA5A 2G9NA 4EPVA 2UVQA 3GLHA 4TTRA 1KDTA 5KDOA 1G5RA 2FSIA 2V8OA 3QXXA 5CM9C 3AVUA 1XTJA 3U7EB 1JBKA 4HLCA 2WM9B 1IY1A 2HF9A 1Z07A 1Z6TA 1ZC4A 4ZDJA 1NL3A 2IYYA 4K46A 4EPRA 2O0JA 2CLCX 1PUIA 1OHHD 2OFWA 2A5YB 4LV8B 3AKCA 3H2YA 3CX6A 1VYVA 1Z83A 1JXOA 1YR8A 2FA9A 3FMOB 1VPLA 3M6AA 5FBWB 3CH4B 1RKBA 2N1BA 3CF0A 1T5LA 3T1VA 3IQWA 3LBIA 4QFMA 5AUPB 4B3DA 1S8FA 5H8WA 1DBSA 1U8YA 1L7VC 2CHVA 2A5JA 2FFBA 2QTFA 1VCOA 2BOVA 1D9ZA 3KKOA 2YNMA 2KBEA 2Z4RA 4TL8A 4UQOA 5FTJA 5C18A 3NVAA 4RD6A 3AKYA 2XGJA 1HE8B 2XNSA 3AUYA 4Y0AA 4ZI3A 3FB4A 3T5DA 1OJLA 1UDWA 4FMDB 2G1KA 1LV7A 3SHFA 1E79D 4UXHA 2ZE5A 1T9HA 1XTRA 4Q02A 1MRNA 1XD2A 3ZVNA 3SYKA 2PT5A 3VR1A 2QMHA 2CVFA 1XF9A 5DI9A 4DLSA 1GOTA 3THXA 4CEJA 1G19A 2FFHA 5AUQA 3C8UA 2ZXUA 4NL4H 1E2KA 1GL9B 2XJ4A 1AZTA 5CJ2A 2WMNB 3IDQA 3PEUA 2OT3B 4B6FA 2AX4A 2GILA 5G41A 2C5LA 2XSZD 1AJEA 3TE6A 5CM8B 3TJZA 5FH9A 4W9MC 5K8LA 3ZS9A 2IWRA 4AG6A 4Q5IA 5IHPA 2NPFA 1XD8A 4MUBA 2FZ4A 1CJTC 2TMKA 4I81A 2ZRMA 1ZC3A 4QC2A 3KB1A 2B6HA 1Z06A 3W34A 1U0LA 2X19A 2WWFA 1GVNB 1XJQA 1X8KA 3AVQA 2QRNA 1KNXA 2IUSA 1DVRA 1YRAA 2J0UA 3QF4B 4IEEA 2WKQA 3BH7A 2AD1A 3CBQA 3FVQA 1W49A 5KU1A 2NZJA 1ZM7A 1XZQA 3IEVA 3QJYA 2B21A 4DUGA 2IYLD 4I99A 3AM1A 1BS1A 4Q19A 1KI3A 1HY3A 3PUZA 3V4RA 2MMGA 4JBWA 3B1VA 1E9FA 2IWHA 4PC1A 1N5IA 3THYA 3SJAA 1KOFA 1WBBA 3PEVA 1DAGA 3M0EA 2QRZA 1EX7A 3FKQA 1BOFA 2P6NA 4V02A 3D31A 2PMDA 1ZW6A 3JZAA 5DSZA 5JSZA 4IFBA 1GL6A 4US2R 3CNOA 5C2JB 4LC0A 2RMKA 4XWAA 4CDGA 1HV8A 3UWKA 4QHYA 4LPSA 3HR7A 4QJ5A 4D4MA 2ZRFA 3QSYA 2NQ2C 1N2CE 1T91A 3MCAA 4JL8A 4EFLA 3ZIAD 2ZI9A 2QSYA 1XTIA 2JLYA 1R8QA 1TQ4A 2QAJA 5CDFE 3THOA 2O8DB 1S3GA 1HH4A 2IXFA 2JDIA 3NIBA 3ADCA 3MJHA 3HU2A 3TW8B 1TTTA 1AIPA 1S1MA 2VO1A 2OZEA 2O8CB 3MG9A 4D4KA 1PZNA 3AGQA 3U3MA 1E2JA 2ZRCA 5L3QB 4DDWA 3K9NA 1ZD1A 3OEHD 2Q21A 5KNDA 2QE7D 2ZE6A 4AK9A 1N6NA 1L4YA 1UEJA 1FMJA 3NDPA 4HATA 3KX2A 4DB4A 2O0KA 4PZYA 4ACBA 2V4ZA 4KFTA 2AK3A 4B33A 2IW3A 1KDOA 2FMXA 3CNNA 1H8HD 2OCYC 2ZAMA 2VBCA 4O2LA 2EFCB 2VP6A 2GK6A 2ZE8A 2ZM5A 3K09C 1A7JA 1RJ9A 3R8CA 3EASA 2A5DA 2BBSA 2OG2A 4DDUA 3LNCA 2F7SA 1J7KA 3X1YA 3UPUA 2JJ8A 3KQLA 4OJQA 1E9SA 2PX0A 4IDHA 5FUXA 2CHQA 3CRQA 3P1JA 2L0XA 5D3MB 5FBLB 2ZROA 2RGCA 2JGNA 4FCWA 1GRNA 1ZYUA 3NXSA 4C0AC 1FX0A 1HURA 5LDDC 2QAGA 4YMWA 2D62A 4O3MA 3RWOA 4PO9A 1B23P 1SXJA 1E94E 5KDLA 4K8OA 1KJYA 3K0AB 4YMSA 1QVRA 1Z2CA 2BC9A 3TSZA 4LHYA 3ZH9B 4MKGA 1D2NA 1CEEA 2PEYA 3BK7A 5KSPA 2G88A 1HT2E 1NBME 4GZMA 3ZVMA 5J47A 2HCJB 3EIEA 1E96A 2R6CA 4D0NA 1TPZA 3UMFA 5BW8A 3ADBA 2WOJA 4JLOA 3BH0A 5HE9A 3VR2A 1WP9A 2BVNA 2OLJA 1ZRHA 2CL0X 1GTVA 3N5CA 4JSTA 2FX3A 3O47A 1EFTA 1HE1C 2QM7A 2QORA 2VHQA 3UKDA 4BWYA 4R71A 5CK5A 4Q18A 3WY9A 2QSZA 4L8GA 3ZDQA 5KTYA 2GXSA 3T34A 1KIMA 1Q1BA 1XTSA 3PEYA 2QQEA 2PX3A 4E07A 2P67A 4W5WA 1G16A 3O8DA 1W0JD 4WXRA 3D8BA 4LRWA 2QM8A 4Q7MB 3PEWA 2W83A 3IUYA 3GFOA 2QUZA 3A1UA 2VP5A 4NHOA 3MD0A 1G7CA 1KK2A 1MKYA 2YYZA 1Z63A 1L4UA 1U98A 4DSOA 1RFLA 4NU0A 5F98A 3EW9A 3P4XA 1I4DD 2ZANA 4M0LA 1NY6A 4I1SA 3RSLA 1U9IC 4F91B 1NN0A 3ZQ6A 4DLRA 4M9ZA 2QMOA 5E7IA 2IYRA 5AUNB 5J5CA 1P60A 4YDHB 1OE0A 3GLIE 3K8YA 1XZPA 2QT0A 3B7GA 3GJ6A 4IXNA 3WMEA 4KXFB 2XXAA 2A5FA 4MGZR 2HXYA 821PA 1WBDA 4Q1EA 3K9GA 521PA 4HZUB 4JBXA 2JIZD 1SKQA 1YRBA 3WHLA 1IOZA 5AJYA 3FTQA 5AR1A 2XNDD 1F2TA 1J8MF 3V00A 1M7BA 1Z08A 2RGAA 4LY6A 5C1BA 3EX7C 1RRGA 4RD0A 1P5ZB 1KJZA 3WNDA 3MRSA 1UEIA 1NJFA 3RANA 3I5XA 2LWIA 4LGMA 1G7RA 2WKPA 3W5IA 4OHYA 4OQNA 1IN6A 3CPJB 3L82B 2JATA 4RZ3A 8OHMA 3IO5A 2BBWA 5KSOA 5KYKA 4HB4A 4HLUA 1EFCA 3A1VA 3W90A 3SQXA 3QKSA 4NE2A 3T06B 4IOLA 2O5VA 4LI0A 4OI2A 5TY0A 4C7OB 2EFGA 2Q3FA 1AGRA 4A2PA 1P2TA 1C4OA 5J4YA 1WA5A 3ASZA 1FPMA 4FW9A 1G7TA 2WZQA 1KSGA 4LYFA 2ZJ5A 4M53A 1E1QD 3B9QA 4AI6A 1IN8A 1WRBA 4DCTA 1CF4A 1RC8A 1OSNA 2A9KA 4LYJA 4MQBA 2JAQA 4DCSA 5BYJA 1F2UA 3A37A 2XSZA 2ZRJA 4HAVA 1FTSA 2DFNA 5FOUA 1JR3D 2GAOA 3B1WA 1OLOA 4V0ME 1CIPA 2ZRAA 4A0HA 4FMCB 4JKIA 1Q1EA 5CJPA 1D2EA 2IYXA 3AP2A 1C9KA 1CTQA 1MR3F 2PEZA 3VKGA 3ECCA 2IS1A 3KJGA 2RGXA 2EWWA 1BIFA 5KPDA 4HLUC 5HCIA 1HEIA 3KUCA 4PPGA 1DAHA 1XMIA 4UNNA 3TRFA 4BFYA 5FPHA 1PUJA 3OF5A 3KKQA 3T12A 3FGNA 2F43A 3FMFA 2GJ9A 1U0JA 1ZAKA 4XWKA 4PQRA 2BIFA 4C0LA 1G3MA 4PANA 4Q4HA 1R2QA 3DL0A 4HAXA 4LK2A 5C46F 5L3SA 4OBEA 1N5JA 2F1JA 2XTNA 5B2ZA 1UM8A 5EUMA 4TLCA 1FP7A 4PC6A 4UJ3A 3R7WA 2IXGA 1A82A 4E5UA 1OIVA 2RH5A 3DZDA 1TU4A 4XOIA 2AXNA 5P21A 5DHAA 5BQ5A 2GHIA 4TQ9A 4TQAA 1KMHB 1NMXA 1TL7C 3WRXC 4MYUA 4Q01A 5EP3A 1IJFA 1OYWA 1W4RA 3MJRA 4HB0A 1BYUA 2RGGA 4DC9A 4C4PA 4R9UC 4AD8A 3ADKA 5JHHB 3RC8A 3L43A 5KHOC 3CR8A 3RS5A 3EIQA 4AKIA 3T1TA 1Q22A 3CIOA 2V7QD 3FDIA 1S0UA 3KJIA 4GRAA 3DM5A 2J3EA 3WRYC 5BYKA 2OCPA 4A8JA 2ODWA 3H4MA 1V43A 2BCGY 4OK5A 4RZ2A 5TB5A 3A6PC 2F1HA 2C03A 3W6OA 3WNCA 3ZQJA 4LJ4A 5E4FA 2GBLC 4G5GA 3K9HA 3DDCA 2GJSA 3BS4A 4OI1A 4CIDA 3HJNA 1ONBA 1FP6A 1P72A 2P6RA 3A8TA 4LWZA 5EP4A 421PA 4LJ6A 2AL7A 2B8TA 1W36C 1WXQA 2OBLA 4DWJA 4QOSA 2IUUA 1F6BA 1FNNA 2G77B 2YOGA 3BIFA 3KB2A 3I8SA 1ZM9A 4KVGA 2QG6A 2GXAA 1QRAA 1AGPA 4D82A 3QVVA 5FUWA 5EQTA 1DOAA 2C98A 2QBYA 1SXJE 1ZCBA 4PAQA 2FPKA 4OQXA 1M8PA 4H1VA 3KFXA 2FE4A 4F4IA 3CWQA 3T1OA 1AM4D 2CNWA 2YWFA 3U4QB 5ELXA 3B2EA 4CT5A 2OHFA 4JVLA 3GJ8A 4Q9LA 3EZ7A 3Q9LA 5FFMA 5GJCA 4OI0A 5F2EA 1G4UR 1Z8FA 1OKKD 1QZXA 3RRZA 3LA6A 3SS8A 3F8TA 3SZRA 2VHUA 4NCHA 4M1MA 4ARZA 2HDNB 4KSBA 4LJ7A 4UKDA 1BO6A 1RZ3A 3EWAA 4B2LA 1KK3A 2WJIA 5EXTA 3PXGA 1X6VA 2GJAA 2HT1A 1F60A 2NGRA 1MO6A 2V3CC 2BEKA 4JVMA 1KMQA 1KMHA 3P27A 4M1SA 3CRW1 4JT2A 1G291 1GUAA 4P0TA 3RS2A 4YXWD 1KI7A 4GFDA 4XTRA 3X1WA 1UKZA 1HQCA 4NZYA 1NN3A 2HEIA 2QL6A 4ZKEA 1D5CA 3MGCA 1CLUA 1EFUA 2ZJYA 1EWQA 1XPUA 3RYTC 2YHSA 4EAQA 3DOEA 3WYGA 2F1IA 3LLUA 4IDNA 3PITA 1E3MA 3QG5A 4NDZA 1ZJ6A 4BE7B 4JLVA 5EJEA 1EX6A 2CCKA 4FINA 4D6PA 1OH7A 2ZI4A 2XOKD 3C41J 4Q66C 3QUSA 2FOLA 3RNLA 4MKHA 4JL5A 4OJKA 5KO2A 2NMVA 2OO7A 1FUUA 3C5HA 1M7HA 2G6BA 1R5NA 3BFKA 1CR1A 2QTHA 4DDTA 2GDJA 1XMSA 3AH8A 4E09A 2OFOA 4LUCA 3GCGA 3D7MA 1NIPA 4M2LA 3BH6A 3DM9B 2CJWB 4BLTA 1CXZA 2GKSA 2Z0MA 4YDSA 2LKDA 1CULC 2IC5A 3K70C 2QN6A 4A82A 2IL1A 3OFND 4B43A 3K0CC 2GCOB 3L0OA 5L3QA 4BGDA 4Q48A 2ZYTX 4BFVA 3C16C 3I8XA 4ZDKA 3CWZA 3U44A 4QNMA 1CJKC 3KQHA 4Q7LA 2VF7A 2CK3A 1NVXQ 3CKLA 3GLFE 1Z0IA 3AVTA 4URUR 4E03A 2QI9C 2ATXA 3LD9A 2IXEA 5TVKA 4EQ6B 2NZ8A 2XEXA 3EWSA 5HE8A 1T3HA 3QOFA 4DSNA 2ZVQX 1EWRA 2C2HA 2R44A 5CIWA 3H84A 4EPYA 1H8EA 3OIYA 1TMKA 721PA 3UATA 3FHCB 2UZIR 4R98A 5EE3A 2GZDA 4IDPA 1DE0A 3QPVA 5BWMA 1XNJA 2WBLC 5GJWC 1EK0A 2E87A 5DIFA 4Q7KA 2ORWA 1N6RA 3LAWA 3FHTA 4PAOA 2F9MA 5H70A 2JLXA 4F7WA 1NIJA 5JJLA 3GLFB 4X8OA 3QBTA 2EQBA 4OQMA 3BB3A 1AKYA 1BYIA 2FPLA 2QAGB 1HTWA 2VHTA 1GSIA 4I4LA 3UG7A 4Q1DA 1YE8A 6Q21A 4QBIA 2ZI3A 1IXSB 4P3YA 2JLQA 4Z1MD 4D80A 3SEAA 3SFZA 3NBYC 2WTUA 3W6NA 4OK3A 2OSBA 4ASUA 2GF0A 1CRPA 2SHKA 1OXUA 4I1VA 4BLRA 3UMSA 1QHNA 1SHKA 2B8WA 3RRNA 1U94A 5SZIA 1MV5A 4URVR 2HT6A 1W36B 1GRQA 4DEYA 3MWYW 1QHIA 4C2UA 2J0QA 4KU4A 2ZYVX 4ZCLA 4BFSA 4BQSA 2Q9CA 2E9SA 3QKRB 1UBFA 1XJ0A 1EGAA 2DHRA 3QIAA 4QNRA 4N0DA 4B32A 1XCPA 5GJVC 2O52A 5JCPA 4A1FA 3VR4A 5AJXA 4M21A 5FUYA 2HCBA 2JDID 1MO3A 1WB9A 3GLGB 1HT1E 4WW0A 2W00A 1JR3A 1N0WA 3W6PA 3I5YA 5J4LA 2PMKA 3C14C 4FXPA 4R2HA 1II8B 1UBCA 2QY9A 3L0PA 4PX9A 3SJBA 5L3VA 3RLFA 2Z6VA 3U44B 3EPHA 1E9BA 2JLSA 2LKCA 1Q57A 1KZ7B 2JJ1D 3OIWA 4TL7A 4EQ6A 2NO6A 4N3NA 1JR6A 1JAHA 2WSSA 2V55B 1XCMA 2Z4SA 1W0KD 3VAAA 2ZSAA 2GVZC 1SGWA 4YC7A 5A0FA 1G7SA 5H68A 5DO9A 4AC9A 3MWKA 2FZLA 3VR5A 3KXIA 2BKEA 2YC4C 3DKPA 3W8NA 3EZFA 1UJ2A 4LJ9A 4IKEA 4DSTA 1ESMA 1V5WA 3AVWA 3FWYA 4FWIB 4LBYA 4YQFA 1XU4A 3EG5A 4C0HA 4A9AA 4ILEA 2GVDC 1KY3A 4QBHA 2FGKA 1SXJD 3CO5A 3VFDA 1F2TB 4M4SA 4AKGA 1XBTA 2R6GA 3CX7A 4URYR 2EFEB 5FBVB 1SULA 2DFTA 4DZZA 2B7BA 4TMWA 3AVVA 5AJWA 5DGXA 2HJGA 5JSZB 4B34A 1R10A 2AFHE 3I32A 4Q03A 2C9OA 4AYXA 1CJVC 1I2MA 1IY2A 2WMOB 3BRWD 1E0KA 4CW7A 5JMTA 3QI2A 1S4QA 4PHHA 2EFDB 4PXAA 1Z6XA 2X8AA 1W4CA 3TR5A 1G6HA 3QKSB 2FWRA 3THWB 5E7MA 4KAXA 4F4CA 4RCYA 1P62B 2OAQ1 5E3HA 4C7OA 4A4DA 5DH9A 1N5KA 2GEDA 1DPFA 1P73A 1EFHA 2J5XA 5CLQA 4GZLA 3VKHA 2ZS8A 4B35A 4CT4B 1Z0FA 3K0CA 4H9GA 5K8UA 3AVOA 3GEHA 1NN5A 5FOTA 1ZU4A 1XEXB 3UXMA 4JLBA 4LHXA 2FPMA 5FL7D 2VYFA 3TK1A 1PLJA 1NSFA 1Q20A 3A1SA 4KV9A 5DNYB 1IBRA 5SZHB 3VTKA 4XVUA 1GFIA 1W2HA 2G3YA 4PO8A 1Y63A 2QT1A 4A0FA 4FWTA 2HJVA 1S9HA 1NKTA 4EPXA 4RFSA 1KDRA 1OFTA 1U8AA 1Z2AA 1NP6A 1VECA 1ZINA 3Q5EA 2J7PA 4DXAA 4HUQB 1SVLA 3I61A 4RFSB 2PBRA 2IUTA 4HI0E 4Q9IA 5FI0B 1E2LA 3O8CA 3CF6R 2ZR9A 5TARA 5KSZA 3GEIA 4KFRA 3OAAA 3KKNA 3OESA 2QU8A 4B3BA 2ECKA 2DWOA 2QPOA 2IYQA 4AG5A 2NPIA 2C77A 1QDEA 2H7VA 1VTKA 3VQTA 3P32A 1YZQA 4OKSA 1CS4C 2VTKA 5HTKA 1FQJA 4JLJA 4AWXA 1KAGA 3G82C
chains in the Genus database with same CATH superfamily
3MMXA 4HP8A 1M1YE 1NA5A 4A16A 3C3DA 1PL8A 5EA2A 2ZZNA 3AERA 4V0SA 5LBIA 1KZYC 3PT5A 3L5OA 3TN7A 4NNOA 4E2XA 3DZJA 4QECA 2AEMA 4L0MA 3CS3A 1M73E 5FADA 2OYCA 3TLJA 3SF0A 4N7BA 2P2GA 2WJWA 3OO1A 3EQ8A 2OSVA 4JJ6A 1KR5A 3QMMA 4QBTA 4BGUA 3KYCA 4I9FA 2E5FA 3KOMA 3IOEA 4RM2A 1RQ7A 2D4AA 1JJAA 1LVUA 2QL5A 1LQTA 2ICAA 2Z83A 5I01A 4G4SO 4HG2A 5HCUA 2ZU6A 5KYUB 4JL6A 4QXOA 3DYVA 4J6FA 3WMWA 4ZYTA 1MGPA 1Y3BE 2A4KA 4IJVA 3UO8B 4EB6B 1I0LA 1PGPA 2B20A 1PWZA 3LUKA 3U4HA 4BQNA 4AS1A 1LLDA 1YXMA 4GGOA 1XA3A 2HXGA 1NBMA 4GBJA 5JXHA 1K2WA 1DRJA 3O4JA 1OW3B 3EISA 3FKSD 5JCXA 2ZUDA 4AJPA 3I6ZA 1NW5A 2W8ZA 3ETDA 5KPJA 4GAEA 1ZIOA 2J3HA 3HWWA 1U1IA 1PHRA 1KH2A 4CKCA 3GVCA 4XCQA 3ZIDA 4RHCA 4ZJYA 4II7A 5BWOA 1I7NA 1V4NA 2ZIGA 4EUHA 1YZHA 5JRZA 2HUNA 3EXEB 5G0VA 3N2KA 3AFHA 4JGBA 1ZRSA 2JH9A 4RGYA 3PLNA 2YRXA 3EEOA 4JBGA 1NVKA 1IYZA 3E05A 4MLCA 2IJGX 4MWBA 4MQFB 1U2DC 3HU1A 1DKNA 1Z2DA 1KQNA 4HZUA 4NZNA 3EF1A 3IUPA 2GASA 4CFSA 2K4MA 1SKYB 5AT1A 2D7DA 3DBOB 3HYSA 4C4YA 2ZETA 3TMYA 3WDKA 1LDYA 1E98A 1XQYA 2C7BA 2P8SA 4QOGA 5IZ4A 5HIJA 3O31A 1U6KA 1Z15A 2X8JB 5FPQA 3RBXA 5BN5A 1D2RA 2R6ZA 3D3EA 3KYIB 2KM1A 2WTAA 3PNSA 3TOXA 3HG7A 1Z8NA 2GZSA 4QRDA 2FW6A 4LYDA 2HRQA 3WL5A 3NBFA 3J7TA 3H0KA 1LBEA 1R7RA 4AJ2A 4AT1A 5FDFA 4NEGA 1OI2A 5JZMA 2HSDA 1BVUA 4JBIA 3FYTA 4TRJA 4TKVB 4ZO7A 4L3VA 5DHUA 3W3AH 2GWRA 3CZMA 3UVEA 2A78A 2FU5C 2P2NA 3FWZA 5AOVA 4B6PA 4E70A 3DKRA 4J4TA 1YB6A 1C9MA 1F0PA 2GCNA 4OG2A 1RMYA 5JYBA 3PT9A 1OXSC 3FGZA 3OTQA 5D5PA 5DGTA 2QIOA 4B82A 3WLMA 1FK8A 3DLAA 1O94C 4NXMB 2CDCA 4ZKDA 1RCUA 3IBYA 3DE6X 4EY8A 1N2BA 2H11A 1GIAA 2GERA 3LL7A 4X5OA 4QASA 3V4OA 1OQAA 1WF3A 3CH6A 3RVKA 3IOCA 3R7LA 3WK5A 2I34A 2GD2A 3CONA 3UT5A 4B7UA 1ZR4A 3BRQA 1B0AA 2MSLA 3VHXA 1PJ4A 1MEEA 1A5BB 2O7QA 4BU1A 1M1ZA 5CTAA 4O4IA 4ZT2A 1DG9A 1XEWY 4MA4A 4Y30A 4D56A 4F9EA 5B7NA 5IAAA 2XB6A 4J3FA 4LNUA 1Z88A 1ADCA 5LJLA 1WWKA 2Q9UA 3I23A 3LDFA 1R18A 2CL6X 3FG9A 4N6OA 1YOVA 4GVXA 4BMOB 1IB6A 4BO6A 1GSHA 5JDIC 4W5OA 4DKXA 3QQPA 2WSSD 3GGOA 4LTMA 2O8NA 3X1DA 4ADSG 1USWA 2G83A 3LY9A 4MGYR 5IS2A 1BCSA 4Q9HA 1O3YA 3UGTA 1K3FA 1ZIDA 4PSDA 1Y8QB 1QHGA 2I62A 2W2XA 4BV9A 4B4WA 3QM1A 3VR6H 1YDGA 1E62A 3FCYA 3GLUA 4J7XA 2GB4A 1Q11A 1UCFA 1VSUA 3BT7A 1GAWA 3QXCA 1KI9A 4UCQA 1U0HC 3I12A 1WXWA 1YS9A 2YV4A 2BFMA 2FETA 4S12A 3LZDA 1M2EA 3TVTA 4Y2VA 5EMHA 4ZV4A 3J7AC 5IYZF 3K1AA 1E9DA 1SELA 4E13A 1RBMA 5EP2A 3DO6A 3R9XB 1R0KA 1N5LA 1FS6A 1QG2A 1X1AA 2JHPA 2A0YA 3OECA 4N9QA 4PX3A 5ALRA 3HBJA 2JA2A 5KAMA 3Q41A 4QGAA 1UMCB 5U4QA 4GMFA 2OORC 3VYUB 2B4KA 1JB9A 3MAAC 4P81A 5EVCA 3GL9A 5ADWA 4GYWA 3A4NA 1P9RA 2RBKA 2JASA 2PT9A 4US1R 2G40A 1PNVA 3HMQA 2ASEA 1HEUA 4WCFA 2OFXA 5FWYB 1WCYA 4X60A 5KVQA 4FHGA 4YP5A 3LSYA 3EGOA 2HB6A 3A1FA 5DP1A 5IAEA 2O2HA 1KVTA 3ZJ4A 1WVGA 4RF4A 5CDHA 5IJ0A 3AKZA 1C4XA 1VI5A 2JJ2D 4ND8A 1J20A 4V2UA 1ZOIA 5FLKA 1Y8CA 1MT3A 2WWHA 4BEWA 2C0PA 4H3KB 2H29A 2CNOA 2CBXA 1MRZA 4CIYA 1CLEA 3GYGA 3L18A 1XMPA 4J90A 3LIPA 4NQZA 3KT6A 5EEGA 4DM4A 3AJAA 1M34A 5CA1A 2Q6OA 2ZSFA 1R6TA 2J9ZB 2Z9CA 3HDQA 3Q3CA 4B3XA 3AB3A 2COEA 1LSUA 4US0R 1G8HA 3KFVA 3AC0A 5EJ9A 4P9NA 1JUDA 4RF3A 2AUTA 3DAYA 1JQEA 3IDFA 4MQEB 2Y1CA 1Q0PA 2AC4A 3F2VA 3U7IA 3KAJA 3DZKA 3C8HA 4XUGB 4CM5A 1N36B 4PCUA 5JI3E 4R69A 3H8JA 3ZZTA 5LP1A 4LF7B 4FE3A 4ZXFA 3GLGE 2R8YA 3ZCPA 3W1VA 3IALA 4CG0A 5CDYA 2GD6A 1LC3A 4GPZA 2DM6A 1Z47A 1NONA 4YRIA 8ABPA 1KI6B 1DOHA 5AW4A 2PRZA 3PNMA 4RVUA 1O94D 4DCJA 3A4YA 5ES4B 1V39A 3QK7A 4P54A 2XZOA 3LLSA 4DLUA 5AM5A 1RXVA 2FE1A 3DB1A 2C4HA 3R5KA 2R6DA 3MINB 1TQ6A 3MXOA 4WGFA 4L0QA 5ANRB 2PUEA 3DE1X 1OXTA 1J2JA 4S1NA 4KPYA 4HDOB 3D6TB 3TQTA 1XDBA 3IVAA 3LM8A 4QPNA 4S0ZA 2AXPA 3R7BA 2GPBA 3R9WA 2H54A 5J59A 1NVVR 2QUIA 1OX4B 4H7EA 4S35A 1OC4A 1VE9A 4Y6PA 4AJNA 3BF7A 2HWKA 4G81A 4NY1A 3QLUA 2QUBA 2NNLD 3EFOA 3EPPA 3ZZ0A 5JISA 4UHBA 1VIMA 1KYVA 3K1AB 1Z7GA 4OGFA 5E8JA 1EWVA 3WB0A 4KR0A 1S7CA 3RVQA 4G41A 1W93A 1H8HA 2I7TA 2YS7A 5F1KA 2DMRA 1ZOSA 3GFBA 5IDVA 2WMYA 1FEZA 5HUJA 5IKOA 3M6LA 1R4MA 4Q1CA 3KJZA 4TMFA 1KDPA 1SEVA 3L1UA 3IP8A 3P9PA 3GT3A 3IQDB 2SKDA 1W47A 2I4RA 3QVOA 3W9UA 1UMKA 2JRCA 1S96A 4D8VA 5JYDA 2QLBA 1U0EA 3CRNA 3ELUA 4ND2A 5IVKA 5AKGA 2NYRA 4NC9A 4FS3A 3BGOS 3VBEA 3WLPA 1KKUA 4FFOA 2I66A 3IA2A 4RY2A 5K09A 2VC2B 1ZVJA 2VQ6A 3EZGA 3MLBA 4X6LA 2IP4A 3CRMA 4IX9A 4WK4B 1IMJA 1MT0A 5KOJB 3C4VA 3RKRA 4N1AA 2AI1A 2CHGA 2CXHA 1YDMA 4UTVA 2GN8A 1W46A 2IOHA 3IBCA 3KLBA 4C0QC 5ADVA 1Q3KA 3M6XA 4NX2A 4CL8A 4N5LA 1TW2A 2BFFA 3FVTA 2P9FA 4KDEA 4F2GA 1VJ1A 4D0SA 3PF8A 1MC5A 2E4ZA 1CUYA 4O4LA 2FH5B 1UMBB 1MH9A 3JU3A 4FEGA 4KR9A 4DG5A 1YRLA 1WSDA 3GO4A 3ES9A 4JQZA 4EAAA 2OP0A 3LT5A 2P9CA 4MIKA 5KB3A 4HADA 3GOHA 4BRWA 4TKUA 2DUNA 4RWZA 2PM8A 2SCUA 4RF2A 2HUPA 3OE7D 2DB3A 1Z0KA 1DBVO 1E89A 3KQWA 3AF3A 3TTWA 3ASYA 3AKDA 2XAUA 2HSGA 3AU8A 1XUOA 1UAGA 3EXHB 1R6DA 2ONCA 3PWSA 4M7WA 1JHRA 1OWPA 2RCNA 1DGQA 1OREA 1IUPA 1E6WA 2H1CA 1N1MA 5JXIA 3M5CA 4KOAA 2O6HA 1W48A 4LY3A 2CE7A 3EVBA 4RH0A 4F9FA 1B42A 1K8QA 1V26A 4IUCS 4KIGA 3TQIA 4C43A 2C5AA 3RRMA 4QGFA 3L05A 3L93A 2C4KA 4HGNA 4K1LA 4IICA 4YPFA 5K8CA 4EF6A 2CC2A 3BN3A 5C37A 3RU7A 2VJOA 4DMRA 1A1VA 1TUEA 1RHUA 3B5EA 4J91A 1B41A 1PYOA 1WB6A 4L9WA 3I4FA 1RXUA 3IAS1 1RJ9B 1WZEA 4Q3EA 4LJ8A 2QX7A 1SNYA 5IDYA 1UBEA 2Y76A 3BMNB 2GNAA 4PNHA 1U5CA 5CR9A 4LI3X 2P2CA 2IBMA 4RY8A 4UAVA 1DRVA 2WSLA 2DHCA 4RJKA 3VHLB 1H9CA 1SCUA 1V5IA 2WTNA 2XRYA 4RQAA 4MIYA 3H1BA 2HYDA 1B3RA 4LNAA 1CY6A 1DWUA 4EATA 2O8CB 3RCBA 4HNAA 1E9CA 2QRPA 2YY5A 3VTAA 2EAUA 5DGDA 2O1XA 2OGTA 3SNHA 2P75A 1HQKA 4Q3DA 2FPOA 3ZEIA 4AJ4A 4O5OA 1C3XA 1XTKA 2QRGA 3HI6A 2ZWAA 4UBMA 1XCJA 1M2WA 3T41A 2BFFB 1GPWB 1GZ5A 3VOSA 4C7BA 4RNDB 1MG5A 3R40A 4O25A 5KTKA 3TB6A 1T43A 1UAYA 3TSAA 2NXWA 4ILKA 1L9XA 2M6KA 4DR3B 4P4NA 4UTRA 2I6FA 5H83A 4MRVA 3DXXA 4MYDA 2VUHB 4JKYA 5SZJA 4W5QA 3DFIA 1X7WB 4MP3A 4OYHA 3A4MA 1XPRA 1RRMA 2XT9A 4Q1FA 4UE3S 3CLUD 4NAHA 3B1FA 3G1TA 5MFPA 3W9YA 3UGJA 4HDSA 3CN9A 4KGZA 4V39A 1WMSA 3HKDA 2R6FA 4BFXA 1NWCA 1JEEA 1S2DA 3G9XA 3Q5DA 3LX4A 4WIAA 3AVXA 2HU8A 4Q21A 5K05A 4DIMA 4F8EA 2WWRA 2QSUA 3THSA 4DV7B 4EY6A 2K6GA 1HT0A 1QAMA 1O97D 5LMUB 2VXYA 1SBYA 3E1KA 2N75A 3ESXA 2Q2QA 1ZSYA 1Y9DA 5DCUA 1V7QA 2OXFA 1ICIA 1FDRA 2JEOA 2C5HA 1YJCA 2WWIA 3JXEA 4NARA 3DMNA 2V65A 4H1UA 4P0PB 4OQDA 4JJ4A 4IOJA 2P6OA 4PYKA 3VR3A 3IRVA 1DNPA 4PPYA 1IZ9A 1F0NA 3MJCA 1ZOLA 4B73A 5JYEA 4LX8A 3UJ8A 1U3CA 4AL4A 3ODPA 1XROA 4JQSA 4CG2A 4TTQA 4MYCA 4R2XA 5I7UA 2Q5HA 1L4MA 2EEPA 5ALSA 1JT9A 2PV0A 1KO8A 5MN4A 1O4WA 2CMDA 1UOPA 2I3DA 4FI3F 1G4AE 5DN9A 1IFXA 1UJ4A 4JOCA 5LQJA 1L7NA 1RWXA 5KJCA 3T5GA 1PUXA 2C2BA 3VPBA 5SZKB 1DHTA 3R0VA 2BDTA 3M1IA 4R9SA 2AJBA 3B70A 1QHHA 4D43A 1RBZA 3SQMA 4RPHA 1KKLA 5DNAA 4INJA 4ZEWA 2BRUA 2FF7A 2IZOA 3X1XA 3F9IA 5C7LO 3U6BA 4MMYB 4EITA 3UPTA 3LGSA 1P45A 4DCUA 4N48A 1YZLA 1FUKA 2OLKA 1E92A 4D1YA 1Z17A 2ZAIA 4QUHA 4UDYX 2IYFA 5DYYA 3TZKA 4ETIA 4XFJA 4QELA 1T26A 1UZNA 3OJEA 1A96A 2M6LA 1VLVA 3CZPA 5DXJA 1PAUA 3QX8A 4HDRB 1RRCA 1GYPA 3I73A 4XDZA 5BW4A 5DXAA 4A6XA 3TWOA 1KI2A 5AXBA 1JLKA 2P9BA 1L4NA 2YHIB 3TSCA 3WC4A 3R0JA 5KTRA 1OYYA 4N03A 1ZUNB 4BJ5A 1CY4A 1FVXA 3ELWA 2HBZA 3HU5A 2RAUA 4HYEA 1J22A 5C5IA 1NM5A 3PR3A 1JLLB 4FHEA 1R5BA 2NVUB 3T52A 1GNRA 3DLCA 4Y6SA 5HXAA 4KQKA 5BR1A 3ZNQA 3L8CA 3AJEA 3F6BX 4LOKA 2XODA 1EK6A 1C1DB 4BKRA 3NIWA 3DKVA 4RANA 4EIWA 1XZDA 1YR2A 3T7DA 7AT1A 3DE7X 2WPDA 4PHCA 5ALZA 3U62A 4BB9A 2QTVB 3T3OA 2OEPA 4C22A 1OROA 2GBPA 3GMTA 3LA8A 1VL5A 3HI4A 4LFCB 1RFGE 3DE2X 2WVAA 3L7MA 2B5WA 1R0RE 3HRKA 3TRKA 5AVRA 3KVRA 4KQWA 1DIHA 4EQZA 1VXRA 2H5LA 1Z36A 2XTAA 3G68A 4HS9A 3VNRA 3MB8A 4LCBA 4AN4A 1RXWA 3HN6A 3F3YA 1QFJA 2HGSA 1C29B 1K4MA 4H6WA 1U2RA 2J41A 4P2BA 4PXYA 4AKSA 1SIBE 2FV8A 1WDTA 1WQ4A 1K27A 2XTZA 2XUAA 1YV9A 3E48A 3T5CA 3RYIA 2MMCA 2RHGB 2VSFA 4R3WA 1MB2A 4KQ9A 3WGQA 3OX1A 5BR8B 2R8RA 2OHGA 3REGA 1MJ5A 1W85B 1CV2A 1E1RD 4GE3A 5FOQA 5IUKC 2R0QC 3STTA 3KTDA 4MVJM 2NSLA 4GKVA 1G2PA 1MOZA 1UP7A 2E4UA 2HM7A 3BIWA 4B71A 2R00A 3PKJA 3PD0A 4HDAA 4KSYA 4TTJA 5KAPA 1N6OA 2CHUA 2HPVA 5DHTA 5IZCC 2H1RA 1KSFX 4W8OA 3A14A 3TNDA 4NZ9A 2NO0A 3L6EA 3HWSA 3A9SA 4EGAA 4WINA 1DO2A 4MHTA 4GPTA 4OHCA 4WRRA 1ZHOA 3WYAA 2F3SA 5CYOA 4M9RA 2VJKA 3KOZA 3PGXA 4AWBA 4CM7A 3BFXA 1APBA 3PWKA 1W2GA 2V8BA 5TT0A 1F4VA 2AWOA 3ID6C 3D6VA 4C5AA 4XSHA 1UZUA 4MWSA 3VYRB 1B26A 4AP9A 4AMYA 1WXHA 2MSDB 5C8ZA 1BEUB 3KCNA 2Y4OA 3B1YA 3BTSA 1N2OA 2QJRA 3WDMA 2BF4A 2Q2WA 1GSOA 4WBSA 2OXRA 1KI1A 3N70A 2NT3A 2NVBA 1UKVY 3BXPA 3GAFA 1Z3IX 2CUZA 1GZ6A 3GBPA 1IK4A 3SDSA 1B0ZA 4EB8A 2Y68A 5IW8A 3LQQA 3PGA1 3ZDFA 1O03A 4ARBA 2VEDA 2C7GA 3A9TA 2DBVO 2LUOA 4CM3A 5KHAA 4BP8A 1Y1QA 4OBXA 4ZI7A 3CT4A 4CTOA 5LIRA 3QVUA 2D74A 1ISGA 4TN1A 2WAXA 1N6PA 2Q07A 1HE3A 1NBIA 3H6HA 3IHKA 3DFZA 3UCEA 4OLAA 2X86A 5B6JA 1QR6A 2XRFA 4LRQA 3N7AA 2C0CA 4H2DA 3WR5A 4JYBA 5DTIA 4KRXA 3ZXYA 1YMQA 1MDBA 5PGMA 5JECA 1UBRS 5BQXA 1I4EB 2OENG 1V3UA 4P1ZA 5B30A 4X95A 3GT7A 3ECSA 1VG9B 5FL7A 2I4LA 2P4HX 1TIPA 1QOQB 4YAUA 2ODEA 2NUPB 3PNLA 4G01B 1A77A 1HLDA 2YXPX 4J7AA 1TF7A 4WERA 5B3LA 5IABA 2J0VA 3FAKA 3PIDA 5EIAA 1JFRA 3UQYS 1DWQA 2PR2A 4LF5B 1WSAA 4OQZA 2FW7A 3CLTC 3HDVA 3ZCQA 2LNDA 3H19A 1M0WA 2ORYA 1YZTA 1V6SA 4HAOA 5IVIA 3GUZA 4DTCA 1MAUA 2ODNA 1VPEA 3GLHB 3QPUA 1FJHA 3ZH2A 4C6HA 2XXAB 2O23A 3NYWA 4OJTA 2O48X 3S44A 3L0CA 2MYTA 3RSOA 3LVRE 1KFKB 4YT4A 1N3BA 1O8CA 2GFQA 1YQGA 2IOQA 2PVPA 4AJIA 4EYQA 2HO5A 3SBEA 1J21A 4LOHA 2HNAA 3UKOA 4JUDX 4XD7D 2DPGA 2ZWMA 1Z74A 2H63A 3GRZA 5HSGA 3AR3A 3THRA 2WJJA 4NFLA 3U9TA 4B6RA 2J9FB 3TECE 3TQCA 4O08A 4X41A 3OHMA 1XVLA 2I3GA 3HPRA 5IFKA 1T3GA 1U2GA 2GJ8A 4M1QA 4C4AA 2QP3A 2R7MA 4XGIA 5KTMA 1VBMA 2BKVA 2I03A 2K87A 4HZGA 5SY6A 3TI9A 3DBVO 2VPQA 4KE8A 4I5DA 3RREA 4BBZA 4OEHA 5BV7A 1CRWG 2ERYA 4PF1A 4MS3A 3Q72A 4RL4A 2YV5A 1VE7A 4ENWA 5JZVA 5CCXA 1ZCZA 4KWIA 1BFUA 1I3KA 4L5BA 3G7UA 3PR1A 3TAUA 3NHYA 4BTVA 1E79A 4FD2A 4RK7A 5C5EA 1D2MA 2DX7A 3H5OA 4HRXA 3V7NA 3CSDA 4DLVA 2QPTA 1W36D 1ZNQO 3SS9X 4D25A 1XKXA 2OK7A 1OXXK 2HIMA 3IP3A 1A9PA 4GYYA 1KC1A 4JT4A 1HNWB 1I30A 3WIBA 1E9AA 5BW6B 2G8NA 1C1HA 1ZD2P 3IQZA 4W5HA 5B3AA 1ZUIA 4P38A 4YRGA 5BSRA 1QNLA 2Q6LA 3HRHA 3BWMA 2D0OB 3DVAB 4I50F 5KQMA 3ZE7A 3UAXA 5DM0A 4FR2A 3IEUA 1MEJA 4OLBA 2QZSA 3CKMA 4D9FA 4ESVA 3U7HB 1JLSA 4NCIA 4YONB 2YYSA 1A5SB 4CF4A 3GA5A 3O8BA 5DNDA 2C7OA 4HFJA 3NVMB 4LOAA 4G07A 4LMPA 1T1RA 4RKFA 4BFUA 3PGJA 1Z16A 5CVDA 4MPJA 1N32B 3HFSA 4XB1A 3CZAA 4ZO9A 1NVWQ 3I3SR 2QAGC 4DBLC 3BZWA 1IZZA 3KPVA 1PT5A 5K9ZA 2Q5OA 2X3YA 2VCYA 3KUDA 4YLGA 4DG8A 4PLTA 1AKEA 4W1QA 2JFGA 1OXVA 4IMIB 4F4FA 1E3QA 1E20A 1YIOA 3Q15C 3PPXA 4DIOA 5JBNA 4AKEA 1L1RA 1KAHA 5K6RA 1BDHA 1J06A 2J3MA 2ZJ1A 4MKIA 1QFMA 2WNSA 4HR7A 4D8YA 1K7YA 2GESA 3AHFA 1R9GA 1K8RA 1SB9A 1DBRA 5MGBA 5CT9A 6PFKA 3M5WA 2R97A 2OTCA 4U6SA 3DUFA 4QVGA 2NTEA 1Z26A 3IVGA 4CI0B 5K6AA 2G0TA 3MZ0A 5TQ0A 3ML1A 3C74A 4FKBA 2P2YA 4EGQA 3QX3A 2YWBA 2ZI5A 1G4HA 1C30A 1KL7A 2E89A 4C2AA 5BORA 2J6BA 1OB5A 1JU4A 2DSTA 4ZVVA 2AZXA 2EL9A 3UB4A 1E2HA 1R8SA 2V7PA 2RB4A 2QRJA 3FTCA 2AW5A 2XYGA 4KAAA 1Z8DA 2DBYA 3RYCA 2XGGA 4HQKA 1G0OA 2C9CA 2OCIA 2PX4A 3N5KA 2MCFA 4MV1A 1I4OA 3KAPA 4U7WA 4CIVA 5JFGA 5JNUA 5KX5F 4FMDF 1QU2A 1U7WA 1LWOA 2BGJA 1Q6ZA 2X9GA 4KWTA 4IY1A 3KZXA 1CC1S 1EG7A 3G3EA 1Q3HA 3FFXA 5CFMA 1FLVA 1N6IA 1XIVA 3LDAA 2BCJQ 3RF6A 4O2BA 2HMUA 5HRUA 2JAPA 1RLOA 2P9YA 3GA0A 4I4TB 4BFZA 3IE1A 1P7VA 4DDMA 5JNWA 1RRFA 3OTGA 5JHGB 3DOFA 1QV7A 3R1IA 1ZGGA 1EFAA 2CLDX 2O9JA 4RA6B 1HZZA 3PHLA 4QFBA 3AJDA 4KFUA 1K4YA 2L19A 2NO1A 1GWNA 1E0JA 4H59A 4QUEA 4HJRA 1GLVA 5F2NA 4NCBA 2AZ4A 3K6KA 3T7SA 1NQOA 1E61A 4LRYA 3OEHA 1JFSA 1P2FA 2B37A 2WUVA 1MW9X 5IVHA 4G0WA 1F20A 3Q3IA 1P6XA 3QKIA 2OBNA 4J2HA 1AS0A 1E63A 1T4BA 1ZBDA 3W05A 2BEWB 3TJRA 3DA8A 2BGLA 4M9SA 5BMVF 1N2ZA 4JC8A 4KAJA 5TQ2A 2NOAA 3MAGA 3TGPA 3S8MA 3R7NA 5JS6A 3CM0A 1RADA 2ZJ2A 2RH9B 3W3AA 3OE5A 5LUAA 4QULA 5JC8A 3BC1A 4NONA 5IM4A 3IIKA 3JSXA 4RVSA 3AIKA 3G2MA 2O0LA 3WHKA 1M5UA 4OBWA 2Q6TA 1LJUA 1TO1E 3ZKWA 3OTIA 2ORED 5AXDA 1B6GA 2WVHA 2ZUBA 1CVRA 1GKUB 2CKDA 4ISBA 2P9ZA 3ZHCA 2O2IA 1ILEA 4D3FA 1NJGA 1ZGCA 4WA7A 1OYOA 3QW2A 4X7PA 3ANLA 2NO9A 4KXYA 2DWQA 2PSDA 1R8XA 4FMBB 3WFZA 4CYMA 5BMVB 4F9GA 1AVTA 4A27A 1GJRA 2WVGA 5IFLA 2CMGA 4MVJG 1DQSA 1QC5B 2G82A 3AR5A 4FYYA 4NCJA 4HNGA 2IS2A 3WGZA 1WSBA 1ZITA 3WWCA 1YT5A 2LR0A 3BQMB 1KEZA 1M76A 5F9FA 3BE6A 4XQGA 5F1PA 1OI7A 2PS1A 2Y1LA 4MX8A 1L7RA 2W8BA 1EFVA 2PT7A 2DAPA 2OV2A 3MW8A 2QVGA 5FHRA 5DNWA 4GI7A 4M8KA 1U11A 1QIIA 5CB4F 1Z2EA 3H0EA 4L3OA 5DYNA 1VZ2A 1KXZA 1L8QA 1OWOA 3N2EA 4B7XA 4E5SA 4RK4A 3JQAD 3V46A 3A6HA 2G07A 2W43A 4J3NA 3WGIA 1AB5A 3D8UA 2VDKB 2PH5A 4O4HA 2XD4A 1BHQ1 5CEJA 2EATA 3M5DA 2FN4A 4ROSA 4YQYA 3OFJA 2WSMA 3BICA 3TLYA 3OPNA 3TXYA 4KYIB 1M74A 4IVPA 4UOEA 3ONDA 1G8GA 1OV4A 2ZIEA 3CRRA 2P6UA 2WYIA 1BA3A 3IIMA 3QWAA 2QTZA 5KX5A 4N4AA 2WD7B 1JA1A 1YB5A 1RWNA 3F7OA 3GLGA 5BUQA 4BASA 1U7PA 3W2EA 1FW6A 2W6CX 3KXDA 1JXQA 2HF8A 3DPUA 2X5JO 4TM8A 1QMGA 3TLBA 4A8PA 4TVBA 5C9ZA 4EF4A 1ZVMA 3OJ0A 2ODPA 3W7VA 4KCGA 1NLZA 2P3SA 4H7DA 2X4IA 4MVJE 5JVDA 1N5MA 3OPYI 5DI3B 3WAKA 2X4GA 1F48A 2AXQA 3U4AA 1ZGZA 1IY8A 1JDJA 3WNBA 1N3IA 2VZEA 4CM8B 1LX6A 1ESCA 1O9BA 1Z4MA 2M6RA 1M8FA 4KODA 1RXSA 3TD9A 3WGYA 4PC3A 2VJAA 621PA 1RLTA 5AJVB 3IP7A 4DLPA 1U1DA 4JJIA 4ZK2A 3MRVA 2JCXA 2QRVB 3QVJA 4LYEA 2AG8A 2ZS9A 1UFRA 2ZRNA 3RAGA 2RIRA 221PA 1A9XA 5IVDA 1KSJA 2YOHA 2PUVA 5AVXA 5L9AA 5ECGC 1LS6A 2A4MA 4X7RA 2G25A 5ED0A 3BMQA 4IQ0A 1DEXA 5TF4A 3WNVA 1ZNYA 4ZC1A 3DD5A 3U3KA 2A67A 3FPLA 2I4TA 3LX8A 4OXKA 1B74A 2VIIA 5BSGA 4YJGA 2REXB 1KHTA 5JBIA 4Y2YA 4YXWA 3JQQA 1TFRA 1YIDA 4BFCA 5T57A 1Z5UA 1JSZA 4TT3A 4YHHB 4R83A 1Z3CA 1HG1A 4LKOA 3EVTA 4A10A 5I7SA 1SG6A 2Y1WA 2GDZA 2JAXA 5F4ZA 4AFNA 1K9VF 1Z35A 3GBSA 1TNDA 3O1HB 1BXGA 3ETEA 1D6NA 3DBHA 2XRMA 3TE7A 4OTZA 3E0QA 3D02A 4C04A 1L7MA 4MVWA 5JAIA 3PTZA 5E9AA 2OZPA 5LZ7A 1J0EA 3CVYA 1PK7A 1DBQA 1GPH1 4UHJA 4DCPA 2XOKA 2V9CA 1GDDA 3IEPA 1BKSB 1OFGA 7REQA 2AYXA 3H1AA 3DV2A 2BGRA 2YJ5A 4RVNA 1QAOA 5B1DA 4BP3A 1GT6A 4FGJA 5ICFA 4Q3AA 1CPYA 3I58A 3DT6A 4CMEC 1Y80A 5KYNA 2KB0A 2ZSKA 1ONOA 4IRUB 1JJVA 1AZSC 2RGDA 3I01A 5AO9A 1Z6ZA 1X7GA 2FMHA 2XADA 3RC3A 2Y0BA 4E30A 1E69A 2JGDB 3O90A 2PZMA 3G8BA 3RHZA 3C48A 2O8FA 3AOGA 1XJ5A 4Z2AA 4CCSA 1H2XA 1DKOA 3NJRA 2XCTB 1L8OA 3OC0A 3GLIB 1Q92A 3IV7A 1ZHHA 2PZFA 4HEA6 2Z3WA 4DWVA 3BWBA 2WMDA 3X1ZA 2P1RA 3I1FA 4R81A 2GX6A 2LE0A 3AVPA 3OX3A 3F6YA 2OC9A 3OOJA 1WZUA 121PA 2ECPA 2XR1A 2BONA 1XAGA 2D3WA 5ESXA 3DEKA 3CINA 5TPZA 5BNWA 2HC9A 3QWHA 2FQWA 4DQLA 2CYBA 2XVZA 4X94A 4IIJF 3EAFA 4D0LB 4R8MA 2W6NA 4O2AB 4BLQA 4LCJA 1CDDA 4WJZA 3ZYCA 1G8JA 1TCCA 4COKA 1AXGA 1OH8A 1K4KA 2EP7A 4FILA 2G09A 2Q5QA 1PDVA 1TIKA 4L16A 1Y4DE 4EBBA 1FJXA 4JI5B 2FP4A 2PXXA 3UAZA 3HK2A 3JAWA 2IUYA 1G3RA 3PHGA 5KQRA 2EXXA 2FTKE 3D3WA 2RJ3A 2WF5A 4MVYA 3KZNA 2ZTVA 4NFYA 5AFSA 2X9LA 1TJ5A 4O4JB 3ZV4A 4C4RA 5TMPA 2B4RO 1M54A 4URHA 5ALPA 4B44A 5JJBA 2YZ7A 3AGPA 1US8B 2BP7A 4NI5A 1ULUA 5FQNA 1WF6A 3HQ4O 3WISA 1JFFB 4KQ1A 4I9UA 5KKCA 2ZIVB 1M1UA 1A76A 2QX6A 5DWVA 5DTJA 5IN4A 4ON9A 3F8SA 1I7QB 4FCTA 3C6BA 3C7KA 3IJEB 2P1ZA 5E7JA 4RGQA 1H9BA 4LV6A 3HCRA 3MVEA 4PG5A 5LZ8A 4Z4CA 1TQHA 2J5BA 5I9TA 3HCOA 5K6TA 3HO6A 1EDEA 2Y0CA 3W0LB 4EG5A 1JLRA 2Y0DA 3TCNA 4ZOLA 3AOEA 3L6UA 3NEAA 3RM3A 1I8TA 3JRNA 3THWA 4TSRA 2HU7A 2PJZA 3V7WA 4B0PA 1UBTS 4BDTA 3BFVA 4X8HA 5FTMA 1WUHS 3LUHA 5J4KA 1HOXA 4DADA 1D9XA 3HU3A 4OOEA 3PJDA 4RJ2A 4B3HA 4XEHA 1VE5A 1C41A 4RKYA 1CFZA 4GVPA 2QMUA 2EW1A 3GJ7A 4HNSA 3FFAA 1HUQA 4F93B 2HQOA 2JEYA 1U7ZA 2C7VA 4K86A 1N1DA 1PJTA 5CBPB 3GFVA 1ZOPA 4A03A 1U0RA 5LQUA 2FWIA 2NYVA 1CD5A 3GAMA 2YWDA 5FEMA 1W0JA 2H6EA 4TYPA 3RUFA 5EEHA 4CMKA 1QX3A 3NV9A 1M6NA 1BXRA 3GGPA 4FUQA 3T3MB 3ORRA 3A70A 3FD8A 4KMSA 2UAGA 2D3TA 2V7UA 4LDAA 5E2IA 3IB6A 1B8NA 1U65A 2PN1A 3O95A 3WG9A 5HF6A 5JMPA 3NTXA 4KPGA 2H5EA 4OI4A 4A8JC 3F1KA 1T8SA 2IX3A 1AK1A 3AETB 4FYXA 4WSOA 4J0IA 2R8PA 1UK9A 4L6CA 4MK4A 2G36A 4LWPA 4F45A 4Z8YA 5FBQB 2CVQA 2W90A 5JIBA 1LLQA 4R1TA 3DHVA 4DQUA 3ITNA 3KT8A 3QMPA 2Q5JA 3R3UA 1E2NA 1Q16A 4XQCA 4AS2A 1U1CA 2IV2X 3PFCA 1OH5A 1AUOA 2C97A 3KBOA 4W5RA 1DFGA 1DP4A 3TQFA 3V1YA 4EW2A 4XB6B 4ERNA 1G6OA 2HLDA 3ADPA 1XXHB 2ANBA 1RM4A 3AUTA 5EXSA 2EGUA 4WZBE 4P32A 4EKDA 4EPTA 4RSHA 3GJYA 3VC7A 5JNTA 1QHXA 2VYND 1O0CA 2TSYB 2JIZA 4MB6A 1KU6A 1FXSA 2CJXA 4FFNA 2DUWA 4YRTA 3GEEA 3K53A 3E2PA 4PU0A 2C84A 2D59A 2FK7A 2PY6A 3VO8A 1ZUD1 4F0JA 1YZGA 1X1SA 5E1OA 2VJQA 4N8DA 3U56A 1RPAA 1DCMA 2G9RA 4YPOA 1Z25A 3ITEA 3W3ZB 1RAHA 2IZ6A 4MB2A 2D54A 4D96A 1ZNWA 3G2LA 3NT2A 1QDLB 4LPKA 3KQYA 3T3GA 1S01A 3LPAA 4RHUA 5K8IA 1JEQB 3L9WA 4PTLA 4ETNA 1T5DX 2I6TA 3LRTA 5LN1A 2XYRA 2PMEA 3P9QA 3A1TA 3GDWA 1CRLA 1KI4A 3T15A 2G9ZA 2Y8EA 2BGMA 3HYRA 2O3RA 3QXGA 3KWJA 4MS3B 5DK4A 1O6GA 5EIBC 2GZ1A 2A84A 2OKGA 5DNVA 4HVLA 3H9UA 3ZHXA 1J90A 1XI2A 1ZMXA 1PE0A 3X44A 3C4QA 3H2SA 2IA5A 4CGZA 1ZR2A 2I0FA 2PWAA 4ZA2A 1WW3A 5I8PA 2W0MA 4W82A 5HRCA 1BC5A 4JLNA 3S7ZA 1RI4A 3PSAA 3ZDBA 1RKQA 5T5QA 2RDMA 3EA0A 3NNNA 4I4NA 1E2QA 2P2SA 4RW0A 2P5UA 4RZHA 5TV2A 1YH3A 4MVJP 1WDLA 5ENDA 4OQQA 5BNIA 5MDHA 2ZRKA 4MGHA 4FC7A 4G8JA 4K0RA 5LLSA 1INLA 5HKAA 3CGWA 3DHWC 3IPAA 5J63A 1QG4A 1B6TA 5EKDA 3RTBA 1KIAA 1MJNA 2DJIA 1CQJA 3LMKA 3W06A 4AJ1A 5GINE 2A5LA 2HXSA 2IYPA 2JKYA 3DYBA 4LKRA 4MDHA 5ALGA 5DYIA 3UHPA 4R1UA 3K0KA 4FB4A 3FNGA 3UAOA 3TNYA 6CHYA 2XZPA 1GNTA 1E2PA 2IPLA 3ZS8A 2WY2D 4FTWA 4G1VA 2OCKA 2XHEA 1GRRA 3F9CA 5AKHA 2MJLA 3X43A 1JFLA 5TEWA 1WSWA 4F11A 2R8ZA 3PBKA 3QPWA 2Z95A 2ZIUB 1S1CA 5IHXA 5LZ9A 4F21A 1Y6GA 4U3JB 3CSSA 1AY0A 1FBTA 5GVRA 3IEMA 1Z6YA 2PMBA 2NUTA 4GQIA 1JG2A 3IIJA 3C3XA 1T4CA 5E3IA 4N65A 4O59O 3TVDA 4D3XA 3P9XA 4UD6A 3EWIA 4YLYA 3I5AA 5E4TA 3MXTA 4CQJA 4JLDA 1QIFA 1RWWA 3GAAA 5BQ3A 1XA0A 3NTOA 3EFHA 5KIAA 1B0UA 1TUGA 3WMXA 2F00A 4G9BA 3EQ2A 4P8RA 1OFIA 4AG3A 1B7GO 1LK0A 1T4MA 1ZL0A 3A4V