1FN0A

Structure of a mutant winged bean chymotrypsin inhibitor protein, n14d.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
177
structure length
177
Chain Sequence
DDDLVDAEGNLVEDGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFANPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOTRYPSIN INHIBITOR 3
publication title The role of Asn14 in the stability and conformation of the reactive-site loop of winged bean chymotrypsin inhibitor: crystal structures of two point mutants Asn14-->Lys and Asn14-->Asp.
pubmed doi rcsb
source organism Psophocarpus tetragonolobus
molecule tags Hydrolase inhibitor
total genus 27
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2000-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1fn0A00
8I1BA 4IHZA 4LO8B 4EEEB 3FJIA 4ISQA 3RTIB 1WBAA 3FJ8A 1M2TB 1FMMS 3FGMA 2DRYA 1ISZA 41BIA 1YXWA 3BX1C 4X3AA 3P6JA 4I4PA 4QKRA 4GAIA 4ZGRB 1FMZA 1EVTA 1PWAA 2Y9GA 3MPPG 1IRAX 3CA3A 3NBDA 1S0DA 3O5WB 4LO1A 3TC2A 4G9NA 4USOA 4YOLA 2K8RA 1T9FA 1BARA 4LO3C 1NUNA 3BAGA 3NBEA 4D8HA 4G1RA 2VSAA 1W3AA 5F8WA 1Q1UA 2YUGA 3VT1A 3AKIA 3WA1A 1JT3A 3CRHA 2FFVA 3PG0A 5D62A 4QKSA 3JUTA 4I3NA 2NP0A 1CE7B 2D22A 1ILR1 4I6IA 3OGFA 4I0YA 4IYBA 1FWUA 2VSEA 3V0AB 4QO3A 4L4HA 4JP0A 2KLLA 1JY0A 1AVAC 1W3FA 1BFFA 1WD4A 4WBCA 5BQUC 1TWMA 3ZC8A 1HKNA 1IJTA 4HJJA 1DFCA 4I4OA 4IZEA 5E24E 1Z2VA 4LO0C 3ZC9A 1F31A 1JT5A 3FJAA 5DZUA 3O44A 1DJSB 4I37A 3FJDA 3FJHA 4LO2C 4HA2A 1AVXB 4JAWA 4QBVA 4J2YA 2ET2A 3K1XA 3WO4A 3QR5A 3WMUA 2NM1A 4ZKTB 1AVUA 4I8MA 4I4YA 5D63A 1WBCA 1QXMA 4I1EA 3N7KA 1YBIA 1SR4A 3S8KA 3AH4A 4L4IA 1GGPB 2HZ9A 1RG8A 4JQ0A 1QQLA 3AH2A 3F1RA 4LO2A 3ZX7A 5FZZA 4ZFWB 2Q3NB 5FNWA 1Z4SA 1FGAA 4XFTA 3KMVA 3O4AA 1QQKA 4LO7C 4ENDA 2ERMA 1N4KA 31BIA 3AKGA 2K43A 1TP0A 2I1BA 4DENA 1HWNB 1BA7A 3NBCA 4I96A 3OJMA 1KNMA 1I1BA 1XG6A 2AFGA 2AXMA 3A23A 4ZLBB 2D7RA 1FQ9A 1IOBA 1V6XA 3RSJA 1NZKA 1AFCA 1PC8B 3CRGA 2D20A 4OWKA 2J3PA 4JKXB 3C9ZA 3P6IA 4LO1C 3CAHA 3WMVA 4FGFA 2D44A 2ZQNA 3ZXDA 3VUOA 1S0FA 2D43A 2NTDA 3IM7A 1AF9A 4I2SA 1W3GA 2HWMA 3BAOA 3Q7YA 1UPSA 5FZYA 3CA1A 4X37A 3UD7A 1Q03A 4Q9GA 1PUUB 3F62B 3UDAA 2DRZA 3HN1A 2M49A 2NZ9A 4Q91A 2MLLB 3AZVA 4EFQA 1PZZA 3O4DA 2WRYA 3AJ5A 4KBBA 3IAGC 1MC9A 4J2KA 2Y9WC 1ISYA 2GZBA 1IT0A 2F2FA 3EF2A 4KC3A 1HWOB 3BAUA 3HBWA 3VWCA 3PMEA 3OJVA 4IZXA 4Q9PA 5HPZA 3O49A 21BIA 4AN7B 1TOOA 3BAHA 3FJ9A 1S0CA 2VU9A 3MALA 7I1BA 3LTQA 3NBNA 2RG9B 5FZUA 2F8XC 1R8NA 1YF8B 1DLLA 3BA7A 3N7JA 5F90A 5DVHA 2XOAA 4EB2B 1G9AA 2FO1A 9ILBA 1JT7A 3BA4A 1HCEA 4H04A 1DQOA 4I4VA 4F34A 3FJJA 4JKQA 4IY9A 6I1BA 3CA4A 1DZCA 1ABRB 1EYLA 3FJFA 3BAQA 2X2TA 5BP5A 4ZOTA 3V0AA 1SR4C 1IHKA 3QYDA 1V6UA 2VXTI 4D0TA 4EKXB 1G9CA 4QD2B 2Z48A 4I1BA 1Q04A 1BLAA 3BAVA 1DIWA 5JMCA 3N7LA 4CJMA 1VCLA 3BRFA 4II0A 1HCDA 1T4QA 4DCKC 2AQZA 5BXTA 3NJ5A 5I1BA 1XZZA 5B2HA 3JRRA 3PHZA 1S0EA 4IONA 4ZA3B 3HSMA 5BXSA 4ZBVB 2HW9A 1XYFA 4AN6A 1RZOB 3BADA 2FGFA 5EG6C 3UJ4A 2P23A 3N7MA 3BB2A 3R4UA 4I7IA 1G9BA 2D1ZA 1V6VA 3AJ6A 3BTAA 4A7KA 1ISWA 2DS0A 4OWJA 1II4A 3UD9A 2LIQA 1FV3A 4JRAA 4J2XA 4I4XA 3VEQA 1WD3A 1L2HA 2LIEA 2R9KB 3BA5A 3UJ0A 4DEPA 3FJKA 2Z49A 4I4SA 4TLPA 2KKIA 1K5UA 2QYIB 5F8YA 3CA0A 3FJBA 4I4UA 3A07A 1M16A 3I29B 2MC2A 2NVHA 3H6RB 4GP3A 3WO3A 3POKA 1ISVA 3O4CA 1K5VA 3HOMA 1TFMB 4XFUA 1TTUA 3UD8A 2ZR1B 4IQPA 3OGGA 4H9WA 3Q7WA 2Q9XA 4OW4A 3RMXA 2BEAA 1JLXA 4QC4A 5EHAA 2Y9XE 1DQGA 2AAIB 4KEJA 2F2FC 3PUBA 5BXRA 1BLDA 2VXRA 3IIRA 2IWTB 5EC5A 1Z0HA 1YYNA 2P39A 3CA6A 4G9MA 3A21A 1MD6A 3VT0A 3AKHA 4I4RA 5G00A 1JQZA 2UUSA 3WINA 2KI4A 4Z8SB 3B9UA 1IILA 1S0BA 1JLYA 4KEIA 4JPZA 2L5XA 4ZFYB 1E0OA 1HIBA 4GOYA 2WBCA 3FUQA 4J2SA 3V79C 4IY8A 2NYYA 4F83A 1TWEA 2VUAA 3HMYA 4USPA 3IM6A 3E8LC 1YTOA 4XFSA 4P6AA 3VSFA 2MIBA 3Q7XA 5BP5C 4OEFA 2FDBM 4EFRA 1EV2A 4ISRA 5BXPA 4P0LA 3BRDA 4QALA 3T8SA 5GAQA 3OBTA 1EPWA 3FUOA 1S0LA 4GP0A 1G82A 2D23A 2X2SA 3BRGC 4EFPA 1FV2A 2ZQOA 4HR6C 3WO2A 4I4QA 3O4BA 4OUJA 5JLVA 4PC4A 4LO3A 1SZ6B 3H6SE 5DSSB 4QD2C 5BVPI 3AZWA 1PUMB 3AH1A 3LLPA 1BFGA 1ISXA 2HWAA 3FFZA 3W9TA 1JT4A 3CQAA 2ESUA 4G6MA 3ILAA 1BFBA 4P0JA 3FJCA 3I2AA 1V6WA 1OQLB 1JTCA 3O3QA 1RMLA 2E4MC 4J23B 2FFUA 3VT2A 4FVVA 4XKIA 2D7IA 4OWLA 1P63A 3V0BB 4R6UB 3CU1B 3VSZA 5DUYA 3RTJB 3OJ2A 4KEKA 3IM5A 3RMYA 4P0KA 4X38A 3A22A 1TIEA 1RY7A 5BQUA 1J0SA 2BEBA 1G9DA 2E4MA 4OEEA 3CA5A 3V0BA 2DREA 3S8JA 1XHBA 1I1EA 3N0KA 5FNXA 1ITBA 4LO0A 3P53A 4X39A 1HWMB 2VLCA 1AVWB 1FN0A 3FJEA 2GO2A 1DFQA 1FWVA 2Y9FA 4QBCA 2RSTA 1BASA 2K4AB 3AKFA 4G6JA 4GAFA 3SNVA 4A7ZA 2D24A 5D61A 2RQ9A 4GOVA 4LO7B 3CRIA 1ONKB 4D0ZA 5F8SA 1A8DA 2BFHA 5BOWA 3D7WB 2QN4A 3H6QA 1R8OA 4Z9WB 2KI6B 3OBRA 3WINC 1BFCA 3H6RA 3HALA 1HWPB 1DZDA 2IHOA 1CVSA 1IRPA 3O4OA 4A7YA 1AXMA 4OEGA 1D0HA 1S0GA 3R4SA 4ZFUB 3ZXGA 2KH2A 3I2XA
chains in the Genus database with same CATH superfamily
8I1BA 4IHZA 4LO8B 4EEEB 3FJIA 4ISQA 3RTIB 1WBAA 3FJ8A 1M2TB 1FMMS 3FGMA 2DRYA 1ISZA 41BIA 1YXWA 3BX1C 4X3AA 3P6JA 4I4PA 4QKRA 4GAIA 4ZGRB 1FMZA 1EVTA 1PWAA 2Y9GA 3MPPG 1IRAX 3CA3A 3NBDA 1S0DA 3O5WB 4LO1A 3TC2A 4G9NA 4USOA 4YOLA 2K8RA 1T9FA 1BARA 4LO3C 1NUNA 3BAGA 3NBEA 4D8HA 4G1RA 2VSAA 1W3AA 5F8WA 1Q1UA 2YUGA 3VT1A 3AKIA 3WA1A 1JT3A 3CRHA 2FFVA 3PG0A 5D62A 4QKSA 3JUTA 4I3NA 2NP0A 1CE7B 2D22A 1ILR1 4I6IA 4UY4A 3OGFA 4I0YA 4IYBA 1FWUA 2VSEA 3V0AB 4QO3A 4L4HA 4JP0A 2KLLA 1JY0A 1AVAC 1W3FA 1BFFA 1WD4A 4WBCA 5BQUC 2NS2A 1TWMA 3ZC8A 1HKNA 1IJTA 4HJJA 1DFCA 4I4OA 4IZEA 5E24E 1Z2VA 4LO0C 3ZC9A 1F31A 1JT5A 3FJAA 5DZUA 3O44A 1DJSB 4I37A 3FJDA 3FJHA 4LO2C 4HA2A 1AVXB 4JAWA 4QBVA 4J2YA 2ET2A 3K1XA 3WO4A 3QR5A 3WMUA 2NM1A 4ZKTB 1AVUA 4I8MA 4I4YA 5D63A 1WBCA 1QXMA 4I1EA 3N7KA 1YBIA 1SR4A 3S8KA 3AH4A 4L4IA 1GGPB 2HZ9A 1RG8A 4JQ0A 1QQLA 3AH2A 3F1RA 4LO2A 3ZX7A 5FZZA 4ZFWB 2Q3NB 5FNWA 1Z4SA 1FGAA 4XFTA 3KMVA 3O4AA 1QQKA 4LO7C 4ENDA 2ERMA 1N4KA 31BIA 3AKGA 2K43A 1TP0A 2I1BA 4DENA 1HWNB 1BA7A 3NBCA 4I96A 3OJMA 1KNMA 1I1BA 1XG6A 2AFGA 2AXMA 3A23A 4ZLBB 2D7RA 1FQ9A 1IOBA 1V6XA 3RSJA 1NZKA 1AFCA 1PC8B 3CRGA 2D20A 4OWKA 2J3PA 4JKXB 3C9ZA 3P6IA 4LO1C 3CAHA 3WMVA 4FGFA 2D44A 2ZQNA 3ZXDA 3VUOA 1S0FA 2D43A 2NTDA 3IM7A 1AF9A 4I2SA 1W3GA 2HWMA 3BAOA 3Q7YA 1UPSA 5FZYA 3CA1A 4X37A 3UD7A 1Q03A 4Q9GA 1PUUB 3F62B 3UDAA 2DRZA 3HN1A 2M49A 2NZ9A 4Q91A 2MLLB 3AZVA 4EFQA 1PZZA 3O4DA 2WRYA 3AJ5A 4KBBA 3IAGC 1MC9A 4J2KA 2Y9WC 1ISYA 2GZBA 1IT0A 2F2FA 3EF2A 4KC3A 1HWOB 3BAUA 3HBWA 4MZFB 3VWCA 3PMEA 3OJVA 4IZXA 4Q9PA 5HPZA 3O49A 21BIA 4AN7B 1TOOA 3BAHA 3FJ9A 1S0CA 2VU9A 3MALA 7I1BA 3LTQA 3NBNA 2RG9B 5FZUA 2F8XC 1R8NA 1YF8B 1DLLA 3BA7A 3N7JA 5F90A 5DVHA 2XOAA 4EB2B 1G9AA 2FO1A 9ILBA 1JT7A 3BA4A 1HCEA 4H04A 1DQOA 4I4VA 4F34A 3FJJA 4JKQA 4IY9A 6I1BA 3CA4A 1DZCA 1ABRB 1EYLA 3FJFA 3BAQA 2X2TA 5BP5A 4ZOTA 3V0AA 1SR4C 1IHKA 3QYDA 1V6UA 2VXTI 4D0TA 4EKXB 1G9CA 4QD2B 2Z48A 4I1BA 1Q04A 1BLAA 3BAVA 1DIWA 5JMCA 3N7LA 4CJMA 1VCLA 3BRFA 4II0A 1HCDA 1T4QA 4DCKC 2AQZA 5BXTA 3NJ5A 5I1BA 1XZZA 5B2HA 3JRRA 3PHZA 1S0EA 4IONA 4ZA3B 3HSMA 5BXSA 4ZBVB 2HW9A 1XYFA 4AN6A 1RZOB 3BADA 2FGFA 5EG6C 3UJ4A 2P23A 3N7MA 3BB2A 3R4UA 4I7IA 1G9BA 2D1ZA 1V6VA 3AJ6A 3BTAA 4A7KA 1ISWA 2DS0A 4OWJA 1II4A 3UD9A 2LIQA 1FV3A 4JRAA 4MZGB 4J2XA 4I4XA 3VEQA 1WD3A 1L2HA 2LIEA 2R9KB 3BA5A 3UJ0A 4DEPA 3FJKA 2Z49A 4I4SA 4TLPA 2KKIA 1K5UA 2QYIB 5F8YA 3CA0A 3FJBA 4I4UA 3A07A 1M16A 3I29B 2MC2A 2NVHA 3H6RB 4GP3A 3WO3A 3POKA 1ISVA 3O4CA 1K5VA 3HOMA 1TFMB 4XFUA 1TTUA 3UD8A 2ZR1B 4IQPA 3OGGA 4H9WA 3Q7WA 2Q9XA 4OW4A 3RMXA 2BEAA 1JLXA 4QC4A 5EHAA 2Y9XE 1DQGA 2AAIB 4KEJA 2F2FC 3PUBA 5BXRA 1BLDA 2VXRA 3IIRA 2IWTB 5EC5A 1Z0HA 1YYNA 2P39A 3CA6A 4G9MA 3A21A 1MD6A 3VT0A 3AKHA 4I4RA 5G00A 1JQZA 2UUSA 3WINA 2KI4A 4Z8SB 3B9UA 1IILA 1S0BA 1JLYA 4KEIA 4JPZA 2L5XA 4ZFYB 1E0OA 1HIBA 4GOYA 2WBCA 3FUQA 4J2SA 3V79C 4IY8A 2NYYA 4F83A 1TWEA 2VUAA 3HMYA 4USPA 3IM6A 3E8LC 1YTOA 4XFSA 4P6AA 3VSFA 2MIBA 3Q7XA 5BP5C 4OEFA 2FDBM 4EFRA 1EV2A 4ISRA 5BXPA 4P0LA 3BRDA 4QALA 3T8SA 5GAQA 3OBTA 1EPWA 3FUOA 1S0LA 4GP0A 1G82A 2D23A 2X2SA 3BRGC 4EFPA 1FV2A 2ZQOA 4HR6C 4MZHA 3WO2A 4I4QA 3O4BA 4OUJA 5JLVA 4PC4A 4LO3A 1SZ6B 3H6SE 5DSSB 4QD2C 5BVPI 3AZWA 1PUMB 3AH1A 3LLPA 1BFGA 1ISXA 2HWAA 3FFZA 3W9TA 1JT4A 3CQAA 2ESUA 4G6MA 3ILAA 1BFBA 4P0JA 3FJCA 3I2AA 1V6WA 1OQLB 1JTCA 3O3QA 1RMLA 2E4MC 4J23B 2FFUA 3VT2A 4FVVA 4XKIA 2D7IA 4OWLA 1P63A 3V0BB 4R6UB 3CU1B 3VSZA 4H75A 5DUYA 3RTJB 3OJ2A 4KEKA 3IM5A 3RMYA 4P0KA 4X38A 3A22A 1TIEA 1RY7A 5BQUA 1J0SA 2BEBA 1G9DA 2E4MA 4OEEA 3CA5A 3V0BA 2DREA 3S8JA 1XHBA 1I1EA 3N0KA 5FNXA 1ITBA 4LO0A 3P53A 4X39A 1HWMB 2VLCA 1AVWB 1FN0A 3FJEA 2GO2A 1DFQA 1FWVA 2Y9FA 4QBCA 2RSTA 1BASA 2K4AB 3AKFA 4G6JA 4GAFA 3SNVA 4A7ZA 2D24A 5D61A 2RQ9A 4GOVA 4LO7B 3CRIA 1ONKB 4D0ZA 5F8SA 1A8DA 2BFHA 5BOWA 3D7WB 2QN4A 3H6QA 1R8OA 4Z9WB 2KI6B 3OBRA 3WINC 1BFCA 3H6RA 3HALA 1HWPB 1DZDA 2IHOA 1CVSA 1IRPA 3O4OA 4A7YA 1AXMA 4OEGA 1D0HA 1S0GA 3R4SA 4ZFUB 3ZXGA 2KH2A 3I2XA
chains in the Genus database with same CATH topology
8I1BA 4IHZA 4LO8B 4EEEB 3FJIA 4ISQA 3RTIB 1WBAA 3FJ8A 1M2TB 1FMMS 3FGMA 2DRYA 1ISZA 41BIA 1YXWA 3BX1C 4X3AA 3P6JA 4I4PA 4QKRA 4GAIA 4ZGRB 1FMZA 1EVTA 1PWAA 2Y9GA 3MPPG 1IRAX 3CA3A 3NBDA 1S0DA 3O5WB 4LO1A 3TC2A 4G9NA 4USOA 4YOLA 2K8RA 1T9FA 1BARA 4LO3C 1NUNA 3BAGA 3NBEA 4D8HA 4G1RA 2VSAA 1W3AA 5F8WA 1Q1UA 2YUGA 3VT1A 3AKIA 3WA1A 1JT3A 3CRHA 2FFVA 3PG0A 5D62A 4QKSA 3JUTA 4I3NA 2NP0A 1CE7B 2D22A 1ILR1 4I6IA 4UY4A 3OGFA 4I0YA 4IYBA 1FWUA 2VSEA 3V0AB 4QO3A 4L4HA 4JP0A 2KLLA 1JY0A 1AVAC 1W3FA 1BFFA 1WD4A 4WBCA 5BQUC 2NS2A 1TWMA 3ZC8A 1HKNA 1IJTA 4HJJA 1DFCA 4I4OA 4IZEA 5E24E 1Z2VA 4LO0C 3ZC9A 1F31A 1JT5A 3FJAA 5DZUA 3O44A 1DJSB 4I37A 3FJDA 3FJHA 4LO2C 4HA2A 1AVXB 4JAWA 4QBVA 4J2YA 2ET2A 3K1XA 3WO4A 3QR5A 3WMUA 2NM1A 4ZKTB 1AVUA 4I8MA 4I4YA 5D63A 1WBCA 1QXMA 4I1EA 3N7KA 1YBIA 1SR4A 3S8KA 3AH4A 4L4IA 1GGPB 2HZ9A 1RG8A 4JQ0A 1QQLA 3AH2A 3F1RA 4LO2A 3ZX7A 5FZZA 4ZFWB 2Q3NB 5FNWA 1Z4SA 1FGAA 4XFTA 3KMVA 3O4AA 1QQKA 4LO7C 4ENDA 2ERMA 1N4KA 31BIA 3AKGA 2K43A 1TP0A 2I1BA 4DENA 1HWNB 1BA7A 3NBCA 4I96A 3OJMA 1KNMA 1I1BA 1XG6A 2AFGA 2AXMA 3A23A 4ZLBB 2D7RA 1FQ9A 1IOBA 1V6XA 3RSJA 1NZKA 1AFCA 1PC8B 3CRGA 2D20A 4OWKA 2J3PA 4JKXB 3C9ZA 3P6IA 4LO1C 3CAHA 3WMVA 4FGFA 2D44A 2ZQNA 3ZXDA 3VUOA 1S0FA 2D43A 2NTDA 3IM7A 1AF9A 4I2SA 1W3GA 2HWMA 3BAOA 3Q7YA 1UPSA 5FZYA 3CA1A 4X37A 3UD7A 1Q03A 4Q9GA 1PUUB 3F62B 3UDAA 2DRZA 3HN1A 2M49A 2NZ9A 4Q91A 2MLLB 3AZVA 4EFQA 1PZZA 3O4DA 2WRYA 3AJ5A 4KBBA 3IAGC 1MC9A 4J2KA 2Y9WC 1ISYA 2GZBA 1IT0A 2F2FA 3EF2A 4KC3A 1HWOB 3BAUA 3HBWA 4MZFB 3VWCA 3PMEA 3OJVA 4IZXA 4Q9PA 5HPZA 3O49A 21BIA 4AN7B 1TOOA 3BAHA 3FJ9A 1S0CA 2VU9A 3MALA 7I1BA 3LTQA 3NBNA 2RG9B 5FZUA 2F8XC 1R8NA 1YF8B 1DLLA 3BA7A 3N7JA 5F90A 5DVHA 2XOAA 4EB2B 1G9AA 2FO1A 9ILBA 1JT7A 3BA4A 1HCEA 4H04A 1DQOA 4I4VA 4F34A 3FJJA 4JKQA 4IY9A 6I1BA 3CA4A 1DZCA 1ABRB 1EYLA 3FJFA 3BAQA 2X2TA 5BP5A 4ZOTA 3V0AA 1SR4C 1IHKA 3QYDA 1V6UA 2VXTI 4D0TA 4EKXB 1G9CA 4QD2B 2Z48A 4I1BA 1Q04A 1BLAA 3BAVA 1DIWA 5JMCA 3N7LA 4CJMA 1VCLA 3BRFA 4II0A 1HCDA 1T4QA 4DCKC 2AQZA 5BXTA 3NJ5A 5I1BA 1XZZA 5B2HA 3JRRA 3PHZA 1S0EA 4IONA 4ZA3B 3HSMA 5BXSA 4ZBVB 2HW9A 1XYFA 4AN6A 1RZOB 3BADA 2FGFA 5EG6C 3UJ4A 2P23A 3N7MA 3BB2A 3R4UA 4I7IA 1G9BA 2D1ZA 1V6VA 3AJ6A 3BTAA 4A7KA 1ISWA 2DS0A 4OWJA 1II4A 3UD9A 2LIQA 1FV3A 4JRAA 4MZGB 4J2XA 4I4XA 3VEQA 1WD3A 1L2HA 2LIEA 2R9KB 3BA5A 3UJ0A 4DEPA 3FJKA 2Z49A 4I4SA 4TLPA 2KKIA 1K5UA 2QYIB 5F8YA 3CA0A 3FJBA 4I4UA 3A07A 1M16A 3I29B 2MC2A 2NVHA 3H6RB 4GP3A 3WO3A 3POKA 1ISVA 3O4CA 1K5VA 3HOMA 1TFMB 4XFUA 1TTUA 3UD8A 2ZR1B 4IQPA 3OGGA 4H9WA 3Q7WA 2Q9XA 4OW4A 3RMXA 2BEAA 1JLXA 4QC4A 5EHAA 2Y9XE 1DQGA 2AAIB 4KEJA 2F2FC 3PUBA 5BXRA 1BLDA 2VXRA 3IIRA 2IWTB 5EC5A 1Z0HA 1YYNA 2P39A 3CA6A 4G9MA 3A21A 1MD6A 3VT0A 3AKHA 4I4RA 5G00A 1JQZA 2UUSA 3WINA 2KI4A 4Z8SB 3B9UA 1IILA 1S0BA 1JLYA 4KEIA 4JPZA 2L5XA 4ZFYB 1E0OA 1HIBA 4GOYA 2WBCA 3FUQA 4J2SA 3V79C 4IY8A 2NYYA 4F83A 1TWEA 2VUAA 3HMYA 4USPA 3IM6A 3E8LC 1YTOA 4XFSA 4P6AA 3VSFA 2MIBA 3Q7XA 5BP5C 4OEFA 2FDBM 4EFRA 1EV2A 4ISRA 5BXPA 4P0LA 3BRDA 4QALA 3T8SA 5GAQA 3OBTA 1EPWA 3FUOA 1S0LA 4GP0A 1G82A 2D23A 2X2SA 3BRGC 4EFPA 1FV2A 2ZQOA 4HR6C 4MZHA 3WO2A 4I4QA 3O4BA 4OUJA 5JLVA 4PC4A 4LO3A 1SZ6B 3H6SE 5DSSB 4QD2C 5BVPI 3AZWA 1PUMB 3AH1A 3LLPA 1BFGA 1ISXA 2HWAA 3FFZA 3W9TA 1JT4A 3CQAA 2ESUA 4G6MA 3ILAA 1BFBA 4P0JA 3FJCA 3I2AA 1V6WA 1OQLB 1JTCA 3O3QA 1RMLA 2E4MC 4J23B 2FFUA 3VT2A 4FVVA 4XKIA 2D7IA 4OWLA 1P63A 3V0BB 4R6UB 3CU1B 3VSZA 4H75A 5DUYA 3RTJB 3OJ2A 4KEKA 3IM5A 3RMYA 4P0KA 4X38A 3A22A 1TIEA 1RY7A 5BQUA 1J0SA 2BEBA 1G9DA 2E4MA 4OEEA 3CA5A 3V0BA 2DREA 3S8JA 1XHBA 1I1EA 3N0KA 5FNXA 1ITBA 4LO0A 3P53A 4X39A 1HWMB 2VLCA 1AVWB 1FN0A 3FJEA 2GO2A 1DFQA 1FWVA 2Y9FA 4QBCA 2RSTA 1BASA 2K4AB 3AKFA 4G6JA 4GAFA 3SNVA 4A7ZA 2D24A 5D61A 2RQ9A 4GOVA 4LO7B 3CRIA 1ONKB 4D0ZA 5F8SA 1A8DA 2BFHA 5BOWA 3D7WB 2QN4A 3H6QA 1R8OA 4Z9WB 2KI6B 3OBRA 3WINC 1BFCA 3H6RA 3HALA 1HWPB 1DZDA 2IHOA 1CVSA 1IRPA 3O4OA 4A7YA 1AXMA 4OEGA 1D0HA 1S0GA 3R4SA 4ZFUB 3ZXGA 2KH2A 3I2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8I1B A;  4IHZ A;  4LO8 B;  4EEE B;  3FJI A;  4ISQ A;  3RTI B;  1WBA A;  3FJ8 A;  1M2T B;  1FMM S;  3FGM A;  2DRY A;  1ISZ A;  41BI A;  1YXW A;  3BX1 C;  4X3A A;  3P6J A;  4I4P A;  4QKR A;  4GAI A;  4ZGR B;  1FMZ A;  1EVT A;  1PWA A;  2Y9G A;  3MPP G;  1IRA X;  3CA3 A;  3NBD A;  1S0D A;  3O5W B;  4LO1 A;  3TC2 A;  4G9N A;  4USO A;  4YOL A;  2K8R A;  1T9F A;  1BAR A;  4LO3 C;  1NUN A;  3BAG A;  3NBE A;  4D8H A;  4G1R A;  2VSA A;  1W3A A;  5F8W A;  1Q1U A;  2YUG A;  3VT1 A;  3AKI A;  3WA1 A;  1JT3 A;  3CRH A;  2FFV A;  3PG0 A;  5D62 A;  4QKS A;  3JUT A;  4I3N A;  2NP0 A;  1CE7 B;  2D22 A;  1ILR 1;  4I6I A;  3OGF A;  4I0Y A;  4IYB A;  1FWU A;  2VSE A;  3V0A B;  4QO3 A;  4L4H A;  4JP0 A;  2KLL A;  1JY0 A;  1AVA C;  1W3F A;  1BFF A;  1WD4 A;  4WBC A;  5BQU C;  1TWM A;  3ZC8 A;  1HKN A;  1IJT A;  4HJJ A;  1DFC A;  4I4O A;  4IZE A;  5E24 E;  1Z2V A;  4LO0 C;  3ZC9 A;  1F31 A;  1JT5 A;  3FJA A;  5DZU A;  3O44 A;  1DJS B;  4I37 A;  3FJD A;  3FJH A;  4LO2 C;  4HA2 A;  1AVX B;  4JAW A;  4QBV A;  4J2Y A;  2ET2 A;  3K1X A;  3WO4 A;  3QR5 A;  3WMU A;  2NM1 A;  4ZKT B;  1AVU A;  4I8M A;  4I4Y A;  5D63 A;  1WBC A;  1QXM A;  4I1E A;  3N7K A;  1YBI A;  1SR4 A;  3S8K A;  3AH4 A;  4L4I A;  1GGP B;  2HZ9 A;  1RG8 A;  4JQ0 A;  1QQL A;  3AH2 A;  3F1R A;  4LO2 A;  3ZX7 A;  5FZZ A;  4ZFW B;  2Q3N B;  5FNW A;  1Z4S A;  1FGA A;  4XFT A;  3KMV A;  3O4A A;  1QQK A;  4LO7 C;  4END A;  2ERM A;  1N4K A;  31BI A;  3AKG A;  2K43 A;  1TP0 A;  2I1B A;  4DEN A;  1HWN B;  1BA7 A;  3NBC A;  4I96 A;  3OJM A;  1KNM A;  1I1B A;  1XG6 A;  2AFG A;  2AXM A;  3A23 A;  4ZLB B;  2D7R A;  1FQ9 A;  1IOB A;  1V6X A;  3RSJ A;  1NZK A;  1AFC A;  1PC8 B;  3CRG A;  2D20 A;  4OWK A;  2J3P A;  4JKX B;  3C9Z A;  3P6I A;  4LO1 C;  3CAH A;  3WMV A;  4FGF A;  2D44 A;  2ZQN A;  3ZXD A;  3VUO A;  1S0F A;  2D43 A;  2NTD A;  3IM7 A;  1AF9 A;  4I2S A;  1W3G A;  2HWM A;  3BAO A;  3Q7Y A;  1UPS A;  5FZY A;  3CA1 A;  4X37 A;  3UD7 A;  1Q03 A;  4Q9G A;  1PUU B;  3F62 B;  3UDA A;  2DRZ A;  3HN1 A;  2M49 A;  2NZ9 A;  4Q91 A;  2MLL B;  3AZV A;  4EFQ A;  1PZZ A;  3O4D A;  2WRY A;  3AJ5 A;  4KBB A;  3IAG C;  1MC9 A;  4J2K A;  2Y9W C;  1ISY A;  2GZB A;  1IT0 A;  2F2F A;  3EF2 A;  4KC3 A;  1HWO B;  3BAU A;  3HBW A;  3VWC A;  3PME A;  3OJV A;  4IZX A;  4Q9P A;  5HPZ A;  3O49 A;  21BI A;  4AN7 B;  1TOO A;  3BAH A;  3FJ9 A;  1S0C A;  2VU9 A;  3MAL A;  7I1B A;  3LTQ A;  3NBN A;  2RG9 B;  5FZU A;  2F8X C;  1R8N A;  1YF8 B;  1DLL A;  3BA7 A;  3N7J A;  5F90 A;  5DVH A;  2XOA A;  4EB2 B;  1G9A A;  2FO1 A;  9ILB A;  1JT7 A;  3BA4 A;  1HCE A;  4H04 A;  1DQO A;  4I4V A;  4F34 A;  3FJJ A;  4JKQ A;  4IY9 A;  6I1B A;  3CA4 A;  1DZC A;  1ABR B;  1EYL A;  3FJF A;  3BAQ A;  2X2T A;  5BP5 A;  4ZOT A;  3V0A A;  1SR4 C;  1IHK A;  3QYD A;  1V6U A;  2VXT I;  4D0T A;  4EKX B;  1G9C A;  4QD2 B;  2Z48 A;  4I1B A;  1Q04 A;  1BLA A;  3BAV A;  1DIW A;  5JMC A;  3N7L A;  4CJM A;  1VCL A;  3BRF A;  4II0 A;  1HCD A;  1T4Q A;  4DCK C;  2AQZ A;  5BXT A;  3NJ5 A;  5I1B A;  1XZZ A;  5B2H A;  3JRR A;  3PHZ A;  1S0E A;  4ION A;  4ZA3 B;  3HSM A;  5BXS A;  4ZBV B;  2HW9 A;  1XYF A;  4AN6 A;  1RZO B;  3BAD A;  2FGF A;  5EG6 C;  3UJ4 A;  2P23 A;  3N7M A;  3BB2 A;  3R4U A;  4I7I A;  1G9B A;  2D1Z A;  1V6V A;  3AJ6 A;  3BTA A;  4A7K A;  1ISW A;  2DS0 A;  4OWJ A;  1II4 A;  3UD9 A;  2LIQ A;  1FV3 A;  4JRA A;  4J2X A;  4I4X A;  3VEQ A;  1WD3 A;  1L2H A;  2LIE A;  2R9K B;  3BA5 A;  3UJ0 A;  4DEP A;  3FJK A;  2Z49 A;  4I4S A;  4TLP A;  2KKI A;  1K5U A;  2QYI B;  5F8Y A;  3CA0 A;  3FJB A;  4I4U A;  3A07 A;  1M16 A;  3I29 B;  2MC2 A;  2NVH A;  3H6R B;  4GP3 A;  3WO3 A;  3POK A;  1ISV A;  3O4C A;  1K5V A;  3HOM A;  1TFM B;  4XFU A;  1TTU A;  3UD8 A;  2ZR1 B;  4IQP A;  3OGG A;  4H9W A;  3Q7W A;  2Q9X A;  4OW4 A;  3RMX A;  2BEA A;  1JLX A;  4QC4 A;  5EHA A;  2Y9X E;  1DQG A;  2AAI B;  4KEJ A;  2F2F C;  3PUB A;  5BXR A;  1BLD A;  2VXR A;  3IIR A;  2IWT B;  5EC5 A;  1Z0H A;  1YYN A;  2P39 A;  3CA6 A;  4G9M A;  3A21 A;  1MD6 A;  3VT0 A;  3AKH A;  4I4R A;  5G00 A;  1JQZ A;  2UUS A;  3WIN A;  2KI4 A;  4Z8S B;  3B9U A;  1IIL A;  1S0B A;  1JLY A;  4KEI A;  4JPZ A;  2L5X A;  4ZFY B;  1E0O A;  1HIB A;  4GOY A;  2WBC A;  3FUQ A;  4J2S A;  3V79 C;  4IY8 A;  2NYY A;  4F83 A;  1TWE A;  2VUA A;  3HMY A;  4USP A;  3IM6 A;  3E8L C;  1YTO A;  4XFS A;  4P6A A;  3VSF A;  2MIB A;  3Q7X A;  5BP5 C;  4OEF A;  2FDB M;  4EFR A;  1EV2 A;  4ISR A;  5BXP A;  4P0L A;  3BRD A;  4QAL A;  3T8S A;  5GAQ A;  3OBT A;  1EPW A;  3FUO A;  1S0L A;  4GP0 A;  1G82 A;  2D23 A;  2X2S A;  3BRG C;  4EFP A;  1FV2 A;  2ZQO A;  4HR6 C;  3WO2 A;  4I4Q A;  3O4B A;  4OUJ A;  5JLV A;  4PC4 A;  4LO3 A;  1SZ6 B;  3H6S E;  5DSS B;  4QD2 C;  5BVP I;  3AZW A;  1PUM B;  3AH1 A;  3LLP A;  1BFG A;  1ISX A;  2HWA A;  3FFZ A;  3W9T A;  1JT4 A;  3CQA A;  2ESU A;  4G6M A;  3ILA A;  1BFB A;  4P0J A;  3FJC A;  3I2A A;  1V6W A;  1OQL B;  1JTC A;  3O3Q A;  1RML A;  2E4M C;  4J23 B;  2FFU A;  3VT2 A;  4FVV A;  4XKI A;  2D7I A;  4OWL A;  1P63 A;  3V0B B;  4R6U B;  3CU1 B;  3VSZ A;  5DUY A;  3RTJ B;  3OJ2 A;  4KEK A;  3IM5 A;  3RMY A;  4P0K A;  4X38 A;  3A22 A;  1TIE A;  1RY7 A;  5BQU A;  1J0S A;  2BEB A;  1G9D A;  2E4M A;  4OEE A;  3CA5 A;  3V0B A;  2DRE A;  3S8J A;  1XHB A;  1I1E A;  3N0K A;  5FNX A;  1ITB A;  4LO0 A;  3P53 A;  4X39 A;  1HWM B;  2VLC A;  1AVW B;  1FN0 A;  3FJE A;  2GO2 A;  1DFQ A;  1FWV A;  2Y9F A;  4QBC A;  2RST A;  1BAS A;  2K4A B;  3AKF A;  4G6J A;  4GAF A;  3SNV A;  4A7Z A;  2D24 A;  5D61 A;  2RQ9 A;  4GOV A;  4LO7 B;  3CRI A;  1ONK B;  4D0Z A;  5F8S A;  1A8D A;  2BFH A;  5BOW A;  3D7W B;  2QN4 A;  3H6Q A;  1R8O A;  4Z9W B;  2KI6 B;  3OBR A;  3WIN C;  1BFC A;  3H6R A;  3HAL A;  1HWP B;  1DZD A;  2IHO A;  1CVS A;  1IRP A;  3O4O A;  4A7Y A;  1AXM A;  4OEG A;  1D0H A;  1S0G A;  3R4S A;  4ZFU B;  3ZXG A;  2KH2 A;  3I2X A; 
#chains in the Genus database with same CATH topology
 8I1B A;  4IHZ A;  4LO8 B;  4EEE B;  3FJI A;  4ISQ A;  3RTI B;  1WBA A;  3FJ8 A;  1M2T B;  1FMM S;  3FGM A;  2DRY A;  1ISZ A;  41BI A;  1YXW A;  3BX1 C;  4X3A A;  3P6J A;  4I4P A;  4QKR A;  4GAI A;  4ZGR B;  1FMZ A;  1EVT A;  1PWA A;  2Y9G A;  3MPP G;  1IRA X;  3CA3 A;  3NBD A;  1S0D A;  3O5W B;  4LO1 A;  3TC2 A;  4G9N A;  4USO A;  4YOL A;  2K8R A;  1T9F A;  1BAR A;  4LO3 C;  1NUN A;  3BAG A;  3NBE A;  4D8H A;  4G1R A;  2VSA A;  1W3A A;  5F8W A;  1Q1U A;  2YUG A;  3VT1 A;  3AKI A;  3WA1 A;  1JT3 A;  3CRH A;  2FFV A;  3PG0 A;  5D62 A;  4QKS A;  3JUT A;  4I3N A;  2NP0 A;  1CE7 B;  2D22 A;  1ILR 1;  4I6I A;  4UY4 A;  3OGF A;  4I0Y A;  4IYB A;  1FWU A;  2VSE A;  3V0A B;  4QO3 A;  4L4H A;  4JP0 A;  2KLL A;  1JY0 A;  1AVA C;  1W3F A;  1BFF A;  1WD4 A;  4WBC A;  5BQU C;  2NS2 A;  1TWM A;  3ZC8 A;  1HKN A;  1IJT A;  4HJJ A;  1DFC A;  4I4O A;  4IZE A;  5E24 E;  1Z2V A;  4LO0 C;  3ZC9 A;  1F31 A;  1JT5 A;  3FJA A;  5DZU A;  3O44 A;  1DJS B;  4I37 A;  3FJD A;  3FJH A;  4LO2 C;  4HA2 A;  1AVX B;  4JAW A;  4QBV A;  4J2Y A;  2ET2 A;  3K1X A;  3WO4 A;  3QR5 A;  3WMU A;  2NM1 A;  4ZKT B;  1AVU A;  4I8M A;  4I4Y A;  5D63 A;  1WBC A;  1QXM A;  4I1E A;  3N7K A;  1YBI A;  1SR4 A;  3S8K A;  3AH4 A;  4L4I A;  1GGP B;  2HZ9 A;  1RG8 A;  4JQ0 A;  1QQL A;  3AH2 A;  3F1R A;  4LO2 A;  3ZX7 A;  5FZZ A;  4ZFW B;  2Q3N B;  5FNW A;  1Z4S A;  1FGA A;  4XFT A;  3KMV A;  3O4A A;  1QQK A;  4LO7 C;  4END A;  2ERM A;  1N4K A;  31BI A;  3AKG A;  2K43 A;  1TP0 A;  2I1B A;  4DEN A;  1HWN B;  1BA7 A;  3NBC A;  4I96 A;  3OJM A;  1KNM A;  1I1B A;  1XG6 A;  2AFG A;  2AXM A;  3A23 A;  4ZLB B;  2D7R A;  1FQ9 A;  1IOB A;  1V6X A;  3RSJ A;  1NZK A;  1AFC A;  1PC8 B;  3CRG A;  2D20 A;  4OWK A;  2J3P A;  4JKX B;  3C9Z A;  3P6I A;  4LO1 C;  3CAH A;  3WMV A;  4FGF A;  2D44 A;  2ZQN A;  3ZXD A;  3VUO A;  1S0F A;  2D43 A;  2NTD A;  3IM7 A;  1AF9 A;  4I2S A;  1W3G A;  2HWM A;  3BAO A;  3Q7Y A;  1UPS A;  5FZY A;  3CA1 A;  4X37 A;  3UD7 A;  1Q03 A;  4Q9G A;  1PUU B;  3F62 B;  3UDA A;  2DRZ A;  3HN1 A;  2M49 A;  2NZ9 A;  4Q91 A;  2MLL B;  3AZV A;  4EFQ A;  1PZZ A;  3O4D A;  2WRY A;  3AJ5 A;  4KBB A;  3IAG C;  1MC9 A;  4J2K A;  2Y9W C;  1ISY A;  2GZB A;  1IT0 A;  2F2F A;  3EF2 A;  4KC3 A;  1HWO B;  3BAU A;  3HBW A;  4MZF B;  3VWC A;  3PME A;  3OJV A;  4IZX A;  4Q9P A;  5HPZ A;  3O49 A;  21BI A;  4AN7 B;  1TOO A;  3BAH A;  3FJ9 A;  1S0C A;  2VU9 A;  3MAL A;  7I1B A;  3LTQ A;  3NBN A;  2RG9 B;  5FZU A;  2F8X C;  1R8N A;  1YF8 B;  1DLL A;  3BA7 A;  3N7J A;  5F90 A;  5DVH A;  2XOA A;  4EB2 B;  1G9A A;  2FO1 A;  9ILB A;  1JT7 A;  3BA4 A;  1HCE A;  4H04 A;  1DQO A;  4I4V A;  4F34 A;  3FJJ A;  4JKQ A;  4IY9 A;  6I1B A;  3CA4 A;  1DZC A;  1ABR B;  1EYL A;  3FJF A;  3BAQ A;  2X2T A;  5BP5 A;  4ZOT A;  3V0A A;  1SR4 C;  1IHK A;  3QYD A;  1V6U A;  2VXT I;  4D0T A;  4EKX B;  1G9C A;  4QD2 B;  2Z48 A;  4I1B A;  1Q04 A;  1BLA A;  3BAV A;  1DIW A;  5JMC A;  3N7L A;  4CJM A;  1VCL A;  3BRF A;  4II0 A;  1HCD A;  1T4Q A;  4DCK C;  2AQZ A;  5BXT A;  3NJ5 A;  5I1B A;  1XZZ A;  5B2H A;  3JRR A;  3PHZ A;  1S0E A;  4ION A;  4ZA3 B;  3HSM A;  5BXS A;  4ZBV B;  2HW9 A;  1XYF A;  4AN6 A;  1RZO B;  3BAD A;  2FGF A;  5EG6 C;  3UJ4 A;  2P23 A;  3N7M A;  3BB2 A;  3R4U A;  4I7I A;  1G9B A;  2D1Z A;  1V6V A;  3AJ6 A;  3BTA A;  4A7K A;  1ISW A;  2DS0 A;  4OWJ A;  1II4 A;  3UD9 A;  2LIQ A;  1FV3 A;  4JRA A;  4MZG B;  4J2X A;  4I4X A;  3VEQ A;  1WD3 A;  1L2H A;  2LIE A;  2R9K B;  3BA5 A;  3UJ0 A;  4DEP A;  3FJK A;  2Z49 A;  4I4S A;  4TLP A;  2KKI A;  1K5U A;  2QYI B;  5F8Y A;  3CA0 A;  3FJB A;  4I4U A;  3A07 A;  1M16 A;  3I29 B;  2MC2 A;  2NVH A;  3H6R B;  4GP3 A;  3WO3 A;  3POK A;  1ISV A;  3O4C A;  1K5V A;  3HOM A;  1TFM B;  4XFU A;  1TTU A;  3UD8 A;  2ZR1 B;  4IQP A;  3OGG A;  4H9W A;  3Q7W A;  2Q9X A;  4OW4 A;  3RMX A;  2BEA A;  1JLX A;  4QC4 A;  5EHA A;  2Y9X E;  1DQG A;  2AAI B;  4KEJ A;  2F2F C;  3PUB A;  5BXR A;  1BLD A;  2VXR A;  3IIR A;  2IWT B;  5EC5 A;  1Z0H A;  1YYN A;  2P39 A;  3CA6 A;  4G9M A;  3A21 A;  1MD6 A;  3VT0 A;  3AKH A;  4I4R A;  5G00 A;  1JQZ A;  2UUS A;  3WIN A;  2KI4 A;  4Z8S B;  3B9U A;  1IIL A;  1S0B A;  1JLY A;  4KEI A;  4JPZ A;  2L5X A;  4ZFY B;  1E0O A;  1HIB A;  4GOY A;  2WBC A;  3FUQ A;  4J2S A;  3V79 C;  4IY8 A;  2NYY A;  4F83 A;  1TWE A;  2VUA A;  3HMY A;  4USP A;  3IM6 A;  3E8L C;  1YTO A;  4XFS A;  4P6A A;  3VSF A;  2MIB A;  3Q7X A;  5BP5 C;  4OEF A;  2FDB M;  4EFR A;  1EV2 A;  4ISR A;  5BXP A;  4P0L A;  3BRD A;  4QAL A;  3T8S A;  5GAQ A;  3OBT A;  1EPW A;  3FUO A;  1S0L A;  4GP0 A;  1G82 A;  2D23 A;  2X2S A;  3BRG C;  4EFP A;  1FV2 A;  2ZQO A;  4HR6 C;  4MZH A;  3WO2 A;  4I4Q A;  3O4B A;  4OUJ A;  5JLV A;  4PC4 A;  4LO3 A;  1SZ6 B;  3H6S E;  5DSS B;  4QD2 C;  5BVP I;  3AZW A;  1PUM B;  3AH1 A;  3LLP A;  1BFG A;  1ISX A;  2HWA A;  3FFZ A;  3W9T A;  1JT4 A;  3CQA A;  2ESU A;  4G6M A;  3ILA A;  1BFB A;  4P0J A;  3FJC A;  3I2A A;  1V6W A;  1OQL B;  1JTC A;  3O3Q A;  1RML A;  2E4M C;  4J23 B;  2FFU A;  3VT2 A;  4FVV A;  4XKI A;  2D7I A;  4OWL A;  1P63 A;  3V0B B;  4R6U B;  3CU1 B;  3VSZ A;  4H75 A;  5DUY A;  3RTJ B;  3OJ2 A;  4KEK A;  3IM5 A;  3RMY A;  4P0K A;  4X38 A;  3A22 A;  1TIE A;  1RY7 A;  5BQU A;  1J0S A;  2BEB A;  1G9D A;  2E4M A;  4OEE A;  3CA5 A;  3V0B A;  2DRE A;  3S8J A;  1XHB A;  1I1E A;  3N0K A;  5FNX A;  1ITB A;  4LO0 A;  3P53 A;  4X39 A;  1HWM B;  2VLC A;  1AVW B;  1FN0 A;  3FJE A;  2GO2 A;  1DFQ A;  1FWV A;  2Y9F A;  4QBC A;  2RST A;  1BAS A;  2K4A B;  3AKF A;  4G6J A;  4GAF A;  3SNV A;  4A7Z A;  2D24 A;  5D61 A;  2RQ9 A;  4GOV A;  4LO7 B;  3CRI A;  1ONK B;  4D0Z A;  5F8S A;  1A8D A;  2BFH A;  5BOW A;  3D7W B;  2QN4 A;  3H6Q A;  1R8O A;  4Z9W B;  2KI6 B;  3OBR A;  3WIN C;  1BFC A;  3H6R A;  3HAL A;  1HWP B;  1DZD A;  2IHO A;  1CVS A;  1IRP A;  3O4O A;  4A7Y A;  1AXM A;  4OEG A;  1D0H A;  1S0G A;  3R4S A;  4ZFU B;  3ZXG A;  2KH2 A;  3I2X A; 
#chains in the Genus database with same CATH homology
 8I1B A;  4IHZ A;  4LO8 B;  4EEE B;  3FJI A;  4ISQ A;  3RTI B;  1WBA A;  3FJ8 A;  1M2T B;  1FMM S;  3FGM A;  2DRY A;  1ISZ A;  41BI A;  1YXW A;  3BX1 C;  4X3A A;  3P6J A;  4I4P A;  4QKR A;  4GAI A;  4ZGR B;  1FMZ A;  1EVT A;  1PWA A;  2Y9G A;  3MPP G;  1IRA X;  3CA3 A;  3NBD A;  1S0D A;  3O5W B;  4LO1 A;  3TC2 A;  4G9N A;  4USO A;  4YOL A;  2K8R A;  1T9F A;  1BAR A;  4LO3 C;  1NUN A;  3BAG A;  3NBE A;  4D8H A;  4G1R A;  2VSA A;  1W3A A;  5F8W A;  1Q1U A;  2YUG A;  3VT1 A;  3AKI A;  3WA1 A;  1JT3 A;  3CRH A;  2FFV A;  3PG0 A;  5D62 A;  4QKS A;  3JUT A;  4I3N A;  2NP0 A;  1CE7 B;  2D22 A;  1ILR 1;  4I6I A;  4UY4 A;  3OGF A;  4I0Y A;  4IYB A;  1FWU A;  2VSE A;  3V0A B;  4QO3 A;  4L4H A;  4JP0 A;  2KLL A;  1JY0 A;  1AVA C;  1W3F A;  1BFF A;  1WD4 A;  4WBC A;  5BQU C;  2NS2 A;  1TWM A;  3ZC8 A;  1HKN A;  1IJT A;  4HJJ A;  1DFC A;  4I4O A;  4IZE A;  5E24 E;  1Z2V A;  4LO0 C;  3ZC9 A;  1F31 A;  1JT5 A;  3FJA A;  5DZU A;  3O44 A;  1DJS B;  4I37 A;  3FJD A;  3FJH A;  4LO2 C;  4HA2 A;  1AVX B;  4JAW A;  4QBV A;  4J2Y A;  2ET2 A;  3K1X A;  3WO4 A;  3QR5 A;  3WMU A;  2NM1 A;  4ZKT B;  1AVU A;  4I8M A;  4I4Y A;  5D63 A;  1WBC A;  1QXM A;  4I1E A;  3N7K A;  1YBI A;  1SR4 A;  3S8K A;  3AH4 A;  4L4I A;  1GGP B;  2HZ9 A;  1RG8 A;  4JQ0 A;  1QQL A;  3AH2 A;  3F1R A;  4LO2 A;  3ZX7 A;  5FZZ A;  4ZFW B;  2Q3N B;  5FNW A;  1Z4S A;  1FGA A;  4XFT A;  3KMV A;  3O4A A;  1QQK A;  4LO7 C;  4END A;  2ERM A;  1N4K A;  31BI A;  3AKG A;  2K43 A;  1TP0 A;  2I1B A;  4DEN A;  1HWN B;  1BA7 A;  3NBC A;  4I96 A;  3OJM A;  1KNM A;  1I1B A;  1XG6 A;  2AFG A;  2AXM A;  3A23 A;  4ZLB B;  2D7R A;  1FQ9 A;  1IOB A;  1V6X A;  3RSJ A;  1NZK A;  1AFC A;  1PC8 B;  3CRG A;  2D20 A;  4OWK A;  2J3P A;  4JKX B;  3C9Z A;  3P6I A;  4LO1 C;  3CAH A;  3WMV A;  4FGF A;  2D44 A;  2ZQN A;  3ZXD A;  3VUO A;  1S0F A;  2D43 A;  2NTD A;  3IM7 A;  1AF9 A;  4I2S A;  1W3G A;  2HWM A;  3BAO A;  3Q7Y A;  1UPS A;  5FZY A;  3CA1 A;  4X37 A;  3UD7 A;  1Q03 A;  4Q9G A;  1PUU B;  3F62 B;  3UDA A;  2DRZ A;  3HN1 A;  2M49 A;  2NZ9 A;  4Q91 A;  2MLL B;  3AZV A;  4EFQ A;  1PZZ A;  3O4D A;  2WRY A;  3AJ5 A;  4KBB A;  3IAG C;  1MC9 A;  4J2K A;  2Y9W C;  1ISY A;  2GZB A;  1IT0 A;  2F2F A;  3EF2 A;  4KC3 A;  1HWO B;  3BAU A;  3HBW A;  4MZF B;  3VWC A;  3PME A;  3OJV A;  4IZX A;  4Q9P A;  5HPZ A;  3O49 A;  21BI A;  4AN7 B;  1TOO A;  3BAH A;  3FJ9 A;  1S0C A;  2VU9 A;  3MAL A;  7I1B A;  3LTQ A;  3NBN A;  2RG9 B;  5FZU A;  2F8X C;  1R8N A;  1YF8 B;  1DLL A;  3BA7 A;  3N7J A;  5F90 A;  5DVH A;  2XOA A;  4EB2 B;  1G9A A;  2FO1 A;  9ILB A;  1JT7 A;  3BA4 A;  1HCE A;  4H04 A;  1DQO A;  4I4V A;  4F34 A;  3FJJ A;  4JKQ A;  4IY9 A;  6I1B A;  3CA4 A;  1DZC A;  1ABR B;  1EYL A;  3FJF A;  3BAQ A;  2X2T A;  5BP5 A;  4ZOT A;  3V0A A;  1SR4 C;  1IHK A;  3QYD A;  1V6U A;  2VXT I;  4D0T A;  4EKX B;  1G9C A;  4QD2 B;  2Z48 A;  4I1B A;  1Q04 A;  1BLA A;  3BAV A;  1DIW A;  5JMC A;  3N7L A;  4CJM A;  1VCL A;  3BRF A;  4II0 A;  1HCD A;  1T4Q A;  4DCK C;  2AQZ A;  5BXT A;  3NJ5 A;  5I1B A;  1XZZ A;  5B2H A;  3JRR A;  3PHZ A;  1S0E A;  4ION A;  4ZA3 B;  3HSM A;  5BXS A;  4ZBV B;  2HW9 A;  1XYF A;  4AN6 A;  1RZO B;  3BAD A;  2FGF A;  5EG6 C;  3UJ4 A;  2P23 A;  3N7M A;  3BB2 A;  3R4U A;  4I7I A;  1G9B A;  2D1Z A;  1V6V A;  3AJ6 A;  3BTA A;  4A7K A;  1ISW A;  2DS0 A;  4OWJ A;  1II4 A;  3UD9 A;  2LIQ A;  1FV3 A;  4JRA A;  4MZG B;  4J2X A;  4I4X A;  3VEQ A;  1WD3 A;  1L2H A;  2LIE A;  2R9K B;  3BA5 A;  3UJ0 A;  4DEP A;  3FJK A;  2Z49 A;  4I4S A;  4TLP A;  2KKI A;  1K5U A;  2QYI B;  5F8Y A;  3CA0 A;  3FJB A;  4I4U A;  3A07 A;  1M16 A;  3I29 B;  2MC2 A;  2NVH A;  3H6R B;  4GP3 A;  3WO3 A;  3POK A;  1ISV A;  3O4C A;  1K5V A;  3HOM A;  1TFM B;  4XFU A;  1TTU A;  3UD8 A;  2ZR1 B;  4IQP A;  3OGG A;  4H9W A;  3Q7W A;  2Q9X A;  4OW4 A;  3RMX A;  2BEA A;  1JLX A;  4QC4 A;  5EHA A;  2Y9X E;  1DQG A;  2AAI B;  4KEJ A;  2F2F C;  3PUB A;  5BXR A;  1BLD A;  2VXR A;  3IIR A;  2IWT B;  5EC5 A;  1Z0H A;  1YYN A;  2P39 A;  3CA6 A;  4G9M A;  3A21 A;  1MD6 A;  3VT0 A;  3AKH A;  4I4R A;  5G00 A;  1JQZ A;  2UUS A;  3WIN A;  2KI4 A;  4Z8S B;  3B9U A;  1IIL A;  1S0B A;  1JLY A;  4KEI A;  4JPZ A;  2L5X A;  4ZFY B;  1E0O A;  1HIB A;  4GOY A;  2WBC A;  3FUQ A;  4J2S A;  3V79 C;  4IY8 A;  2NYY A;  4F83 A;  1TWE A;  2VUA A;  3HMY A;  4USP A;  3IM6 A;  3E8L C;  1YTO A;  4XFS A;  4P6A A;  3VSF A;  2MIB A;  3Q7X A;  5BP5 C;  4OEF A;  2FDB M;  4EFR A;  1EV2 A;  4ISR A;  5BXP A;  4P0L A;  3BRD A;  4QAL A;  3T8S A;  5GAQ A;  3OBT A;  1EPW A;  3FUO A;  1S0L A;  4GP0 A;  1G82 A;  2D23 A;  2X2S A;  3BRG C;  4EFP A;  1FV2 A;  2ZQO A;  4HR6 C;  4MZH A;  3WO2 A;  4I4Q A;  3O4B A;  4OUJ A;  5JLV A;  4PC4 A;  4LO3 A;  1SZ6 B;  3H6S E;  5DSS B;  4QD2 C;  5BVP I;  3AZW A;  1PUM B;  3AH1 A;  3LLP A;  1BFG A;  1ISX A;  2HWA A;  3FFZ A;  3W9T A;  1JT4 A;  3CQA A;  2ESU A;  4G6M A;  3ILA A;  1BFB A;  4P0J A;  3FJC A;  3I2A A;  1V6W A;  1OQL B;  1JTC A;  3O3Q A;  1RML A;  2E4M C;  4J23 B;  2FFU A;  3VT2 A;  4FVV A;  4XKI A;  2D7I A;  4OWL A;  1P63 A;  3V0B B;  4R6U B;  3CU1 B;  3VSZ A;  4H75 A;  5DUY A;  3RTJ B;  3OJ2 A;  4KEK A;  3IM5 A;  3RMY A;  4P0K A;  4X38 A;  3A22 A;  1TIE A;  1RY7 A;  5BQU A;  1J0S A;  2BEB A;  1G9D A;  2E4M A;  4OEE A;  3CA5 A;  3V0B A;  2DRE A;  3S8J A;  1XHB A;  1I1E A;  3N0K A;  5FNX A;  1ITB A;  4LO0 A;  3P53 A;  4X39 A;  1HWM B;  2VLC A;  1AVW B;  1FN0 A;  3FJE A;  2GO2 A;  1DFQ A;  1FWV A;  2Y9F A;  4QBC A;  2RST A;  1BAS A;  2K4A B;  3AKF A;  4G6J A;  4GAF A;  3SNV A;  4A7Z A;  2D24 A;  5D61 A;  2RQ9 A;  4GOV A;  4LO7 B;  3CRI A;  1ONK B;  4D0Z A;  5F8S A;  1A8D A;  2BFH A;  5BOW A;  3D7W B;  2QN4 A;  3H6Q A;  1R8O A;  4Z9W B;  2KI6 B;  3OBR A;  3WIN C;  1BFC A;  3H6R A;  3HAL A;  1HWP B;  1DZD A;  2IHO A;  1CVS A;  1IRP A;  3O4O A;  4A7Y A;  1AXM A;  4OEG A;  1D0H A;  1S0G A;  3R4S A;  4ZFU B;  3ZXG A;  2KH2 A;  3I2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...