1FN4B

Crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
218
structure length
218
Chain Sequence
QVQLLESGPGLVRPSETLSLTCTVSGFSLTSFSVSWVRHPSGKGPEWMGRMWYDGYTAYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTRDLYGGYPLGFWYFDFWGPGTMVTVSSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWSSQAVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY AGAINST ACETYLCHOLINE RECEPTOR
publication title Crystal structure of Fab198, an efficient protector of the acetylcholine receptor against myasthenogenic antibodies.
pubmed doi rcsb
molecule tags Immune system
total genus 25
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fn4B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fn4B01
2Y07H 4RGNE 3HE6A 3UJTL 2KQMA 2H32H 4M3KB 1PY9A 5KSUB 4DOHE 4LAJH 1JGDB 4NZDA 1V5JA 3BZFB 2QEJA 2AJXL 3UYPA 3ARSA 4PJ8A 4JDVA 1P9MA 5KS9A 1JNLH 2JIXA 4CDGC 2FNBA 4KZEH 5EH1A 5GS2D 3LKSA 4PRNA 1X6NA 3F12B 3HZYA 1AC6A 4U0RB 3H3PL 3UPCA 1IE5A 4HF5H 3MXVL 1LILA 4HPOH 3ARFD 4BSWB 4JZOB 4FHBD 4GAJH 2J88L 1ZEAL 4OM0H 4DAGL 2A1WL 1JHKH 2W65A 3PJSB 2P5EE 4F80A 1CGUA 1UWGH 3MV11 5DK0A 2P46B 4S10A 5CJXA 1TXKA 3HUJB 5TFSH 3C60B 3SCMC 3GMRB 4IBLT 1BFVL 2XRAH 1MVUB 2ATKB 4MJIB 4Y4FA 1L7TH 3DIFB 2C1PA 3P0VL 2NY4B 3O2WH 1A0QH 1MCRA 3EYVB 3MR9B 4X83A 5C6TH 2VWEC 1AGCB 4GRWF 5I1GL 3ROLB 3O0RL 4Z7UA 4AT6B 4TNVF 2AS5M 1QFOA 4FXGA 4X7DC 3MJ9H 1JNJA 2ZG3A 1X4ZA 3WIHA 4L4JA 1KYOJ 5CKAA 4KMTL 2R23A 2W1NA 4JJHA 5JDSA 2DI7A 2CD0A 3KPQB 1F90L 1BGXL 4UUJB 2ZNWA 2CIKA 4JLRB 3ARDC 1HXYB 2WUCH 2WBJB 2QHRH 3V7AE 1NANH 4LPXA 1F4WH 4HDIA 4I18B 1U0QA 5AZ2L 5KAQF 2CKBH 2EC9U 1EO7A 2GTWA 1MNUL 2HWZH 2VXTH 4WW1B 1EFXD 4R0LB 4NM8H 3LEYH 3VG0H 1PQZB 2R15A 4GBXD 4WGVB 4WU5A 4AIOA 4U1GC 3P3YA 2Y06H 1WEJH 3RWEA 3I6GA 2ZCHL 3SGJC 5SWZD 1K2DA 4L4TE 4HG4K 2VLRE 2B4CC 1BREA 1INDL 4XPGH 4V1DE 5D7KE 4YPJA 5DR5H 3MCKB 2LQRA 3VGDA 3M07A 5BXFB 5F9AC 1RZIA 3LQAL 3B6SA 5CD5D 4JZJC 2E9BA 2YWYA 1XF2A 1EHXA 2DQDL 1G6RL 3MUY1 1MQKH 1FL5B 5IFJB 5D1ZA 4CVXB 5E70A 2EIBA 1E6OH 4ZPTB 1MFDL 2A6KB 4RSVA 4X6CF 4H0GA 3SGEH 3S37X 3MRMA 1HCFX 1A6TB 5JW4R 4R4BA 8CGTA 4BQCA 2Q3ZA 3IRPX 1T04B 3CFCL 3EJJX 3WNNA 3MOAL 1QSZA 5C08E 2ZNXA 2QQKL 3VWKC 2HH0H 2ESVB 1YQVH 4MAUH 5JW5A 3KWWA 1YQ2A 5BZWA 1RI8A 1NEZA 3E0GA 3R0MA 4PJDE 2P8MA 4LCUB 2CUIA 2NW3B 4Y5XA 3LKNA 1VGEL 4EXPX 1XIWB 5EZJA 2XTJB 1HIML 3TJEL 1MF2H 4IEFB 5IJVB 5GHWL 2MJWA 3ZHLA 2XN9E 4OZ4B 3OR7B 4CRPA 4GG8A 5FHBL 3LKRB 1J1XL 1IAKB 4JPVH 4ZUWA 3VFNA 4ZG1A 1XF1A 4M7JH 4QOKE 4PGJA 3ULVH 5I1DA 3MRIB 2EDYA 1CFNA 2APTA 3WFZA 5KS9F 4PUBH 1CVSC 4I3GA 4UT9L 3D69A 1YPZB 2HRPH 4PJHA 4QTIL 4PJ7B 4Y5VC 4YHZH 1YY9D 3CFKA 3P4NA 3PWVA 1MPAH 4NJ9H 3S36X 1R5IA 3ECBB 5LAXA 1CDBA 3SKJH 3QIWD 3PWUA 5TQ0L 3ZO0A 1PKOA 5JXED 3TBTB 2MOVA 2ZPKL 1XT5A 4PJBA 5C0EA 3D5OF 3HE6D 4XCFH 1QLRA 2WAHA 3CH1A 2NY5H 3TT3L 1JNHA 5TQ2H 5BO1H 3QWOA 4X6DB 2DICA 3G6AB 3U4EA 5HHOA 2X4RA 4F9LC 1E4XH 3BSZH 3M1BA 2GY7B 3LKQB 1YEHH 2HKHL 4PJ8D 1AP2B 2O5YL 1TNMA 2P49B 4XPFH 3HPLB 5ICYB 5JOEA 1B2WH 4LCIH 3JWNC 4K2UH 3JV0A 3G6JA 4XVUD 1TCMA 4NNYB 5EFIA 3ROOB 3BWAB 2DKUA 5JUEH 4KK6C 1A4JA 3RWIA 4O5LH 4EDXB 2OP4L 1PFCA 3CVHL 4CVZA 5I1EL 4UNTA 5E1HB 1OOAA 5DJ2B 1SBBA 3U6RB 1A7QH 1U92B 3QIBC 3L3GA 4P23B 2FR4A 2FRGP 4HUXA 1ZTXH 3MQIA 1J7VR 4OD3H 2X4UB 3QULA 4HKJA 4CU7A 5HD8C 1SJEA 1AH1A 1U3JA 2HLAA 4MQ7B 3MLUL 4HWBA 3W11D 2H2SD 4P2YA 4FOMA 3W2DL 2XACC 3ILPB 5CKGA 4S1RL 1PY4A 5CILL 2EDRA 2XPGA 1HDMA 4KAQL 5IB5B 4YIQA 4X80H 1DP0A 3RI5F 4OGZA 3VFMB 2MPAL 5E6ZA 1FSKB 5C6WH 5H8DA 5I1KL 3VFSB 5FYKH 3LIZL 1ZOXA 5FHAH 4PRPB 4Y19E 5C0AE 4LL9A 4CKVX 5MENE 5AYQA 5C0JA 3QDAA 4TUKL 4N0RA 5C9JB 2HJKB 5EZIH 5IB4B 4OGXH 5IOPB 3ULUF 1SEQL 3QZWB 2R0WL 4ZUSA 3QRFM 1N6VA 5T1KA 2DBLL 4RDQG 2FX9L 3Q48A 4QRRE 4G7YL 4EOWL 3PGDB 3T4YA 1C5BH 1A9BB 2BRQA 3OKKA 2H2PC 3PABA 2FGWL 4JFEA 4P5TC 1MY5A 2EICA 3CPLA 3D25A 3S5LG 3LRHA 4M6OH 4NHCL 4MNGE 4F7PA 5I1AA 4HWUA 1EAPA 1FVCB 2EYSB 3MV9D 2DLFH 1XZ0B 3G6DH 3CFBB 1RZFL 2RIKA 2YEZA 2ITDA 1T7YA 5SWSE 1NC4A 4NQCE 5BZDB 1RY7B 4G7VH 1IGCL 5FOBA 4M43L 5D1QA 3WNOA 5D1ZD 1UEYA 5IB2A 3ULUD 5A1AA 4QXGH 4G9FE 3UPAA 3T0EE 1OF2B 3NGBC 3LRGA 2AK4E 3U4BL 1CZ8L 2BVQB 1CVRA 3TBYA 5A3ID 4XNZB 3EFDL 3I6KB 3BUYB 3KPLA 3P4MB 3JV6B 3VFWA 5GXBB 3NIGE 4PJHF 3HRPA 1P7HL 5DFWH 3DXAA 1NCDH 1EEUA 1F8TH 1YMHB 3W0WE 5F96L 1KFAH 4HKXB 4MAYA 1YYLL 3D3VA 5E7BA 3O8XD 3MLRH 2VDKH 1N5AB 3QNZB 4P4RB 4M1CC 2FIKA 2DQTL 1DUYB 3E6FB 3LH2H 4EN3B 4OLVH 3RVTD 4M3JA 4YHIB 3IJYA 3SDDC 2Q7YB 2HJLA 1G0XA 3A67H 4PD4J 4PJBF 3QUYB 1DQMH 1FYTB 1PZUB 1OP3K 3TFKC 1ZLUK 4HXAH 1ZHLA 3EKCA 4A2MA 2WINA 3FQTA 5E6YA 3QQ9D 1OTUC 1U8NB 1ND0A 3NAAL 1BD2B 1BAFL 1DSFH 1UB6A 5TF1H 4ZO7A 4O2FB 5CLTA 4HGWA 5DVKA 2AKRB 1W0WB 4LHJB 1OP9A 4EQ2A 3G6JF 1NC2B 2W9DL 4BQ8A 4AK1A 2BY3A 4XXCA 4JKPH 4HS8H 2EZ0C 3BDBA 1CFSA 1TZGH 5EO1B 3OB0K 5GRUL 1S7WA 5FKAA 4QHNB 3IXTB 2VDPL 4P2OC 5FGCB 2FD6H 3AS3A 5E5UB 5IQ9B 1WZ1H 5AD0B 3BDXA 4FFYH 1R3IH 5IP4A 1NGWB 2E8YA 5ICXA 3CFEA 5DJDA 4QNPF 1IC5H 2BY1A 2FCBA 3B3IA 5DD5H 4JRXE 1D5BB 4QWWC 3FFDA 1YEJL 5DC9B 5HHOD 3SOBH 4OFIA 1SVCP 2FLBT 3TV3L 3DNKA 2FEDD 1EO5A 1S78C 3KPRA 3BP6A 2IAMD 5AG8A 4A6YH 3H7BA 3BESR 2BXYA 4ZOBA 4FFVC 5MEQA 4KMQA 3TT1L 2I9TA 4ZYKB 1QFWH 3B43A 4AQ1B 1RJLA 5F6HI 2N4IA 2I60L 43CAB 4XNYL 5DJAB 1EXUB 5FB8B 4PGBA 1VEOA 4MDIA 3WL9B 5DDHB 1H9VA 4H5SB 4JFFD 5GS0C 3MLVH 4BZ2L 1I7ZB 1LO4H 4D9LH 3O4OC 1RZKL 1F3DJ 4XMKL 1FCCA 2DQUL 4XCEB 2YD3A 3MV8A 2VAAA 4N0FA 1I3RB 5EWIL 2ZKHL 4GKZB 5C8JB 4WO4C 1TQBB 4ZOAA 4ELMA 3RVUD 4MZ2A 4NZRH 4XVTL 1JWSA 4GW4A 1UZ6F 4OTXL 4XPTH 1GOHA 1ZSDB 2D7NA 3C9NA 1NBQA 1P2CB 4X4XB 2E27L 3M17B 1T1WA 4I0PB 3GMPB 3WE6B 2PTUA 3H9HA 2G60H 4PV9B 1BZ7A 1IEBB 4RWHA 4D9RD 5I18H 2IPUG 4X7SL 3T2NL 1XGRA 5EUOB 4X4MA 1JNNL 5HDBF 1YNLL 4JY4B 4U1LA 1M7DA 1O0VA 2G9HB 5T3XH 5CINL 1KNOB 1NAMA 5EO9A 5CZVH 5JQ6H 3VMPA 2JK5B 5I17B 5CZXC 4XPHL 1I7UA 4KQ4H 3VG9B 3VXTB 2W92A 4OCLC 2H26B 1S9WA 2BNRD 4M8VA 3B2UC 2IPKA 5EOCL 1YEDA 4JFED 3K7UA 5FCSH 3BXNA 1JPFA 4HUNB 3IU4H 5T1MB 4GRWE 4XP6H 1FVDA 4XP9L 3BT2L 5D2NB 4O51B 2OYPA 4KKBD 3HNVL 4PBWD 3GGWA 1P5VA 3QFJA 2K3TA 2VQTA 2FSEB 1XR8B 2YC1A 2CLVA 3HCVB 3GSOB 1BZ9B 4PTTB 3U0TA 1ES0B 3ARUA 5FM8A 4ZS7H 1KYOK 1JIBA 2ARJA 3OKLA 1KLUB 4F37K 2CMRL 4G6FB 1KN4L 2Y5TB 1L0YA 2WM0A 1G9NL 4YJZL 1P4LA 3KPNA 4YPGB 4HIXL 3NFSH 4QRSA 5GGRA 5BRZA 1ORSB 4NO5A 2ARWA 2F5AH 4MAYD 4X6FA 1BVZA 3IFOA 1RZ7H 3D3VD 5GJTH 1MHPL 4OLYH 1J1PL 2AI0L 4FFZH 2Q20A 3THML 2OMBA 4PR5A 3RWGB 3HI5L 3FZUD 3IF1A 5H94B 1O7VA 1RULL 3QDME 1VFMA 2VLJA 2NY4C 5C0DA 1CXHA 3EFFA 5BS0A 4D8PB 1KIRA 1NGPL 3BD5A 2HFGH 4JO2L 1RZKC 4D0DB 1XGYH 1IT9L 2B5IB 4AZ8A 1A1MA 3DI3B 2Z92A 1V3MA 1JBJA 2O93L 3P0YL 1PYWB 3BO8B 2X41A 3QIUB 4TULL 2YUVA 4XPAL 3UTTA 1I8LC 4DWHA 3JZ7A 1CFTB 5B22A 4LU5H 4X6CE 1I7TA 5FYJH 5IM7A 2X7LA 4UOW0 3VFUB 4MCYA 3ULSB 3VXOA 3O3DB 1A6AB 5KJRL 3OX8B 4K94L 1QQDB 4JN2A 4P2RB 5LXGL 2AP2A 2VQUA 4GW5B 2DYPA 5FA3B 1HXMB 1NLDL 5DGQA 3O3AB 3FRPA 1L4IA 5HYSG 4R0LC 4P3DA 1BQLL 2JB5H 3FT2B 1WISA 3CK0L 1CF8L 1L7IH 1Q9LB 2ATPB 3BKYH 3O6ML 3WUWA 1FV1B 1M71B 2PO6B 3KPRD 1EMTL 1P53A 3BZEA 2EYRB 4ELMF 1H3WM 5DMIH 1BLNB 4K3DH 4M62H 4P9HL 4MLIA 5HJ3B 2HRLA 2AXFB 4RX4A 5KS9E 1MIEH 2LU3A 1MHCB 5D7SL 4WDIB 1GOFA 2D31A 1LO0H 2C3VB 4R7NB 4RQQB 4NCDA 1QHPA 2AJYH 5I75B 5C71A 3D2UA 4N68A 3WN5C 3OAYK 4ZMAT 3HS0B 4LCWB 3WFHA 4JQXC 4F7TA 4BFGA 1YYML 4J4PA 5C07A 3IDIB 2NY0D 3MV8D 5H37H 1M4KA 4EI5B 1LO2L 4WU7A 3E6HB 4QHUB 3NFNA 1QBAA 1S9XA 2QBWA 2MKLC 4YAQB 1T83C 3GNMH 3IU3A 3RX8A 5I1IL 2XXCB 4H1LA 5C0RH 3G9AB 3MYZA 3NCMA 4NT6B 3PL6B 5FO9B 1RJCA 3ILQD 3OJDA 4UV4H 1G9NC 3OPZH 4LVOC 1FLRH 4Z7UE 4UIMB 2H41A 1XIWC 5L88H 1I1RA 1BQHA 3CFJA 1CL7L 2BDNH 2I07A 3KDMB 3LS4L 4OCXH 5TH2A 1QSFA 5EU7E 3LN5B 4JVWA 1FO0B 3LKPB 5T1LA 3WFBH 4KDTA 3TM6A 1NSNL 4WY7H 1RZJH 1NCWH 3H2WA 3RL2B 1K8DB 5FO8A 4YZFF 2HMID 4KK9D 2FB4H 1G0YR 1YN7B 2W0LA 4U7MA 4JAMA 5CEYA 4YXHL 4OV5A 4NCC2 4XVJH 2YPKA 3MTRA 2J2ZA 5JIKA 2DWDA 2VR4A 4I2XB 4X99B 5EU5A 2V9TA 3KHQA 4NUGH 3DTXB 5JIHA 1B6UA 1LDPL 5E8NB 4RMQA 1HE7A 4XH2A 5JPMB 4HFWB 1WFOA 2CDEA 5C2UB 3STZA 1CIDA 1HKFA 1DN0A 3DV4B 1JTTA 3CDYA 3QUZC 3X3FL 4AEHH 5DHYB 4KV5F 1R3HA 4QRPA 1SYVA 2Y6SD 2A0LD 2NXZC 4OZGB 3MV9E 3NBNA 4Y1AB 3GSNB 1MRDH 3CZFA 3MRHB 4LRNL 1EO8L 1TETH 1ZLSL 5D7JC 2WP3O 4BQ6A 3IKCA 3WNKA 4Q9RL 3FB7A 5E5MA 1T1YA 3ULUE 2JJWA 5FUZL 5J4MA 4P4KC 3NCFB 1TVDA 4XBGA 2IPUK 1NGYB 3JTTB 4YE4H 2A73B 1KIPA 1H3PH 5BRZD 5ID0B 2DQCH 3I6LD 3NIFF 1MAML 2R69L 5ITFB 4P9HC 1WFUA 4WVRA 3ESUF 3TVMA 3G08B 1OL0A 2H3NB 3MROA 5DO2C 1AIFA 2B1HH 2VLJD 5B4MC 5CEZD 1YEFL 4Y4HD 3SY0A 4N0CD 5L2KD 2APWA 2FO4A 1U3YA 1EVTC 2HFFB 5EORH 2R1XA 4DKFL 5E8EA 2NTFA 5F88B 2QSQA 3LDBB 1DLHA 1RJZB 1T89A 1EDQA 4KKAC 1U8QB 1MRCL 1FFQA 4E0RB 3BP4B 3QP3A 4YXKH 4UDTA 5DEFB 4LLYB 3EDDA 4HJJL 3UTTD 3HAEA 4IM8A 4R97B 3AREA 2RBLA 3FQNA 3AS0A 2PETA 1FH5H 3DGGB 5IVNA 4FQXB 3PP3H 4KUCF 1ZANL 1MIML 5GGTL 4JRYB 1HCVA 5I66B 1EEQA 4YFDB 3Q6FB 2YUWA 1KENH 2I5YL 4IMKC 3MMEA 4NN5C 5CSZB 1F4AA 4LPUA 4PJHE 3BQUC 4MNHA 5ALCL 1Y0LB 2ICWJ 2J12B 2NY3D 2DYPD 3OKEA 1CFQB 1AQKH 1N7ML 2AJVH 4Y4KB 2A9NL 4O4YH 5KVGH 1PKQA 1CLOH 1BIIA 3TPKA 1JK8A 4KPHL 4R4ND 2VXUL 3OL2A 1NLBH 3FTGA 3JWDL 4PJBE 2V7HA 5B3JF 1N64L 4YFLF 5KSAB 2FATL 1LK2A 1IGJA 5HHOE 5IKCA 7FABH 3KPOB 3P9WB 1YN6B 1U36A 4GMSL 4OQTA 1XF5B 2Q1EA 5C9KA 3CXDL 3LB6D 2QADB 1X5GA 1K6QH 1EGJA 4RFOH 3G6JE 3ARBA 3VGAB 2FECI 1X5LA 3DX9B 1QLEL 2B2XH 5INDA 1FIGH 4JCMA 5E2UH 3NCYS 1R5VA 3S3SA 1MFAH 4PP1C 3ZSSA 1FG2A 5C07D 3TIEB 1HHIA 4U1SA 4RMVA 1M7XA 2OJEB 3JV4A 3MRBB 1CT8B 1PJ9A 4EXKA 4QNPE 2UV3A 3MRCB 4O9HH 4JR9L 1U8PA 3BKCL 1MLCB 1T5WA 4ZFFA 1SY6L 2Z91A 1X4XA 4NBZB 1JCKA 1YJDC 5INCA 5EPMB 3BKJH 1FP5A 4BH7B 3QUXA 2D0GA 1J8HB 4U6VH 4HC1L 5FEBA 4WUKH 1OTTC 4YHNB 2MQ3A 3T2QA 1UH3A 3HE7B 5DUBA 1FZOA 3PQYA 1A6VH 5JW4M 4LSPL 5D1XD 3TO4C 5I1HL 2Y4SA 4WRLA 3ZT6A 1NGXA 3O2DA 3Q6GH 1AGDB 4LGSB 4U6YA 3S35H 3ET9F 1I4FB 4HPYH 3FB6A 4AY0A 1GZQA 1QSFD 4OFDA 2J8OA 5IMOA 2C9AA 2C5DC 1SQ2N 3ARTA 1BF2A 2VLLA 1U8LA 3RTQB 4NPYA 4UINL 1RK1A 4LNRB 5J1AA 1XH3A 4MA3B 3L3DA 1WBXB 4D9RE 5F1IA 5F7FA 1CXIA 5B3NA 2GSGB 5HHQA 1JNLL 4KZEL 2FX8H 5CJBA 1I8KA 1KJ2L 2BMKB 3GIVB 4I5BA 4HF5L 3VFOB 1MCQA 4V2BA 1RIVL 3I02A 1TJIL 1CD8A 3DRQB 4GAJL 5GGUB 3MUJA 4PLKC 3BP5A 1BOGB 1JHKL 4JFEE 1MCEA 3BPCA 3TCXA 4A6YB 4WWKD 3T1FB 1UWGL 5DRZB 1H3UA 2DLIA 5MEPB 3DX6A 5TFSL 4UBDD 2W9EH 2HFTA 4WFFD 4JDTL 4O58H 2YA1A 2VDQH 5DFVC 3WBDA 1L7TL 2V2XB 1I1AB 1TTGA 2YN5A 4EI6B 3GRWL 4EDWH 4ODTH 1EBAA 1A0QL 1LE5A 3MCG1 5C6TL 1EZVY 1UWXH 4ZXBC 2EXYD 1BJ1H 3HR5B 4LCYA 3KYKL 2DIBA 3R0NA 4UQ3B 1ZGLM 1TJHH 3UJJH 2A2QT 1RD6A 5F9DC 5A2JH 4KRPB 7CGTA 3VFPA 1JF1B 5DMJB 3NABH 4HSQA 2MCG1 4U7SA 2GW5A 1OGTB 2F8XC 3P77B 5DJ0B 3B9DA 2V9RA 3DXAE 2VITB 3DMMC 4XCNA 1MJ7L 2NR6D 2D7QA 3TVMD 3RY6C 3D3VE 1FL6B 4R7DA 3NOIA 1K8IB 2HT3D 1A9EA 3L5WB 2CKBL 3AM8C 3GSVA 4NM8L 2X44D 3LEYL 3VG0L 2YKLL 4MS8D 4M9OA 4M8QA 1ZHBA 4FTVB 2OR7A 2Y06L 5I8CA 1ZKAA 3LEXB 5FYKU 1Q0XL 1NGQL 5KSVB 5DMYA 3DUUB 2J4WH 4O2EB 1K5NB 1BQSA 5F7UA 5SWQB 3N1QC 4XPGL 1V8HA 2DM7A 2UUDH 5DR5L 5GSRB 5F3BA 1YZZA 4JN1L 2GITA 2FH8A 3PDDA 1HH9A 2FJHB 4HS3B 4LCCC 4PY8J 1S7VA 4XRCA 3SBWC 3QI9C 2X40A 5J11B 1D5ZA 5HPMB 1FL3B 4RA3A 4H8WH 4OCWH 1MQKL 3K3QA 2CPCA 3O3EB 3MLSH 4XMLL 1RK0B 3QG7H 3FRUA 4ZFOL 4WNQA 4APQB 1MELA 1E6OL 1OW0A 1KG0B 1YMMA 1NJ9A 3B8YA 3VRIB 3ZT7A 1H8OA 2YBRA 4G9DA 2IBBA 2XNAA 3NCCB 2AV1B 1FRGH 5D96B 4AG4H 3RNKA 4RGNB 3P73B 4YHMH 5DD6A 4Z77B 1RZGA 4HUVB 4K7PY 4QY8B 2L7JA 1YQVL 3MNVA 4MAUL 1JYWA 3KPRE 1J5OH 1LEGB 2ADIA 1HSBA 5HYEA 4LSSH 4LHUB 5DHVB 3H9ZA 3ARBD 4K7FA 3VD9A 2EE2A 4HV8A 5IBLC 3QEGL 5FUOH 3QFDA 4PJCB 4RIRB 3FN3A 3R06A 1MF2L 4WW2B 3V8OA 2AXGA 3QUMB 3QZWG 3EJZD 4K3HA 2WIIA 5CFHA 3JUZA 2P5EB 3MUGA 4L29B 5DQ9A 2Z93B 2VC2H 4PUBL 3MV8E 1KJVB 2HRPL 3QUXD 1RMFH 2VN7A 1ACYL 3L1OL 5DJXB 1ZXQA 1T0PB 4YHZL 4GKSB 5I30L 1JHTB 1MPAL 5JNYB 3VWJB 5EZLB 4ELME 3PQYD 1XGQA 3BPNC 1MCCA 1S7QB 5I2IA 2O5ZH 1G7MA 2PF6A 5AUMB 5EN2B 3WS6C 1DVFB 2R0ZH 2M2DA 2OMNA 3MRGA 4ISVA 1ZLWH 4XHJD 5BO1L 1NUGA 4M00A 4RFNB 1OSPH 2L7UA 3G5XB 4G3YH 4M48H 4OKVB 4NN6C 5F9OH 1E4XL 1DCLA 3BSZL 5LGKA 5D71L 3QQ4A 4GUPB 4X4ME 1Z0MA 5DYOB 3CDGB 1YNTB 3O81A 1ETZB 1U8HB 4XPFL 1B2WL 4LCIL 4L9LB 4MJ4A 5EC1A 5HBBA 3GMNA 4R2GC 5E2JA 4IRSC 1OTSD 5B8CB 4DGIH 5JUEL 4O5LL 1WZKA 1QG3A 4WI4A 1CI5A 4QXTA 4RBPK 3WIHL 2KDGA 4WFED 5EIVA 3PWNA 4CU8A 2XZZA 3MREB 3MRDB 2ADFH 3C5JA 3UTSD 4L4TB 3EDFA 1H3XA 1ZTXL 4CADA 2VLRB 3RWDA 4V1DB 4XZUB 1KULA 5BOZG 3VFRA 1NMAH 1HWGB 1QPPA 5DJ8B 5IVXA 2HTLC 3GJEB 1MFNA 3NN8A 4GG6A 4HJGB 4YUEH 4AYFA 4BKLB 2CLZA 1LDSA 3BN3B 4PY7A 4YHLH 1BWWA 5JTWA 1AKJA 4M93B 3GKZA 3SE8L 1I1CA 4C83A 2QKIB 4OFKA 3TYFA 5FYKL 1ED3B 4U3XA 3GBLA 1ACZA 5FHAL 5DJ6A 1KPVB 5ACZB 3SQOH 5BRZE 3AMLA 4HAFA 3I6LE 4YXLH 2VIRA 5C08B 3ZTNH 4CVWA 1G1CA 2X5PA 2IH1B 5DRNB 3O6FB 1Z5LB 3QDJA 2ED9A 2N7AA 4H26B 4JPWH 2AJZA 4MQXD 4LSRH 4KV5E 3FO2A 2BERA 2FZ3B 2NY1B 5CEZE 2VLJE 4KK8D 1CBVH 4L3CA 4OCRH 4F7CB 3LKOA 2XWJA 2XWTA 2DQGH 2UYLA 3UXFA 4KHTL 3CVIH 2GAZB 4R90H 4OF3A 3ULVC 2XN9B 1JGEB 4M6OL 1WFTA 3ZKQD 1FFPA 2IALA 3AXLA 5AEAA 2VB5A 4OI7A 3KYNB 5FECA 4FA8A 3PXJA 4OZFH 3UTTE 2I24N 4MQSB 5I8OL 4LVHB 1GGTA 4QOKB 5DD1H 5SX5H 4W68A 1EJOH 1ZA6A 2VDML 1N4XL 1DR9A 2IH3B 1QEWA 3PDOA 2HT4D 2OQJB 4JB9H 1AXSA 5GRZA 3GIZH 3JWOH 4ZAKB 1YMMD 3IDJA 4MX7B 3DX8A 2NY5C 5EOQH 3GMOB 5GSVB 1GSMA 1A6ZB 2QSTA 3HI6L 1FAIL 3D85B 2ERJB 3C6LB 1MWAA 2J5LB 3OKMB 1KFAL 1Y18A 4KK5C 4OGYH 2X4TA 3PWLA 2VDKL 3X13A 1A3LL 2EEDA 5EA0H 5E95B 3MCLH 5B21A 4U1JA 1MOEA 1AR1C 3LH2L 4ZUTB 3RZCB 3RDTA 5DVLA 1IGFH 4OLVL 1C8PA 2IANB 3NFPA 4JDZB 5FA4A 4WENB 4DKEH 4IRJC 1U3HA 3TIDB 3KLAB 4LLDB 2A83A 4ZPVA 4HXAL 1T0MB 4TTGA 4YHYB 1Q38A 4CUCA 1CIUA 3VXRD 1DSFL 3CAFA 5TF1L 5C07E 4PJ9B 5FV1L 3BEVA 1U58B 3S96B 3B9KD 4RFEB 4JM2C 4JKPL 4RAVB 2BHZA 2P5WA 1TZGL 1QZ1A 3I75A 1LEKA 4P3CH 4M7KL 1HWHB 1A02N 4JQIL 3PHOB 1WZ1L 1X5KA 4TVPH 1HI6A 1UVQB 4MLSA 4XC3L 3L3JA 1F00I 4MSWB 4CNIA 5LJYH 1KELH 3VXPA 4TNWK 1S7TB 5AYUL 3WFEH 5DD5L 3VGFA 4I3SL 4XXDB 2KUTA 3LHPH 1QSFE 2EC9T 2VZSA 5ILTH 3SOBL 5IVXF 4MXWL 1Q72H 3HPJA 2V7NB 3N0PB 5I76B 5BQ7B 5J89A 3E2HC 5J13C 4Y19B 5GIRB 5SX4I 1IZKA 4OLXL 4HWBL 5MENB 4C54A 1J0HA 5ID1B 1K4DB 4YK4C 5H35A 4Q9QH 5D70L 3VXMD 1Q8MA 2J6EA 3KNBA 3F7YA 4L4VA 2C4XA 3NA4A 4QRRB 2Z31C 4HEME 4XB7A 5EBLB 3ZYOA 3TA3B 4HZLB 1GCFA 3QEQD 4NKDB 5EZOL 1LO4L 4LIQH 5C0IA 3IAQA 4N9GA 2C7UB 3RPIB 4ODWA 2R8SH 2D4DA 1ZVYA 1FNEB 2NX5A 2ZUWA 2CDFA 4MNGB 5ALBH 3ARGB 3DVGA 3TCLB 4PLJC 4S2SA 1ADQH 2C1OB 5ESQB 5FIEA 4WFFE 3N1GC 4JKWA 4YHOH 1BVKA 3S5LA 2YXFA 4JG1H 3M8OH 5SWSB 4NQCB 2WLZA 3TN0C 1IAIM 3UTQB 3ZKMC 5HGAA 1NPUA 1D9KB 4X6BB 2ZCLH 4G9FB 2DF3A 1WBZB 4HLJA 1IGIH 3HZVB 4IRZL 1OP5K 3T0EB 4ETYA 1CDJA 4RNRB 3V5DB 2AK4B 2CR6A 2XG4A 3MRLB 4F33B 5I1LB 2GJJA 1T3FB 1RHHB 3QWRA 3I9GH 3FCTA 1DDHB 2G60L 4ZSOA 5F9WC 5E4EB 1XCTA 3C2SA 4DFHA 1A5FL 3JBG7 5I18L 5DI8A 5CUSH 5I73C 1MFEH 1T22B 2A74B 3E3QC 3V6FB 3W0WB 3SDCC 2JELH 5CJOH 2IBZY 4M7ZB 3H3KA 5TGBA 4E42A 5T3XL 5BJTB 3EYQC 3MODH 4RWYH 1KV3A 4L8SB 4UMGA 5JQ6L 5A2KH 1NCAH 3J7HA 4HIJA 4NGHL 1KT2A 2DQIH 4JANB 3TF7C 1QRNA 3RNQA 3SGJA 4FXKA 2E8ZA 4IIQC 4WWID 3FQXB 3GJFK 3L3HA 1S9VA 1BBJB 2EXWD 4Y5YB 2N1KA 4MYWB 3HC4L 3RUGE 1A47A 1CICD 4PG9A 1MREH 3IVKA 1ZHKB 12E8H 1TDQA 3BPLB 5J3HD 4XI5C 3HZMA 1YEIL 5HXMA 1KJMB 1DBJH 4ODVL 2VDOH 3RA7L 1BBDL 5DJYA 4ZS7L 1OAUH 2JKXA 3PIQB 1HYSD 2NXYD 1P4BH 3VXQB 2Y5EA 4QTHA 1R3JB 4LKCA 1OD9A 1PKQE 3DWTA 5JORA 1IGMH 4JKKA 2VXVH 1MSPA 3B8SA 2DD8L 3VWKA 3DVNB 3NFSL 4OZHB 3MNZA 1E4JA 4ZUUB 2F5AL 3QPXH 3QXAB 1RZ7L 5GJTL 3OJMB 5D5MA 5ICZA 3CCHB 1ZVHA 4QT5B 3IT8D 3HA0A 5FK9A 4NKIL 3RWHB 4EUPB 4K3JH 1PG7W 3C5ZC 1LNUA 4KFZC 5FOJA 4OAWB 1N59A 1VACA 4XVSH 2EIEA 3SN6N 4ORZC 2BVPB 2D7MA 5CHNB 2HFGL 3D0LA 1XGYL 1K3ZA 5DEGB 1UXSA 3INUL 3RWJA 1CCZA 4HH9A 4P57A 1DE4A 1X5YA 2X4SB 1IM3B 4WI7A 3ARFB 4O02L 3CDCA 2C3XA 4ELKA 5J7CC 2AJSH 1X7QB 1B0GB 1X5AA 4EIGB 1YEEL 1MFBL 4MD4A 1UYWL 5HGBA 1FZJA 4G8GA 1MJ8H 1KTLB 2VSDA 4RDQF 5IBTH 5BMFH 3PQYE 2UWEE 1LO3L 2XKUA 4UB0H 3SE3C 4LGRB 1L7IL 1WBYB 1KJ2B 4S1SL 1Z2KA 4X7TB 5F97E 4F9LA 1CE6B 3PGFL 3LD8B 4JVPA 3BGMA 5DMIL 4K3DL 3L3IB 1KC5L 4M62L 5D1QC 2V5SA 3IS0X 2XZCH 3X12A 4HS6A 5AZEH 1EH9A 4L4VD 1OHQA 5D2LA 4GQPH 4P5KA 4OD1L 5GS1C 4M61A 1S9YB 4Z7QF 2AJYL 4V2CB 3QIBA 1EEYA 1F3JB 2R9HC 4R9HA 4XC1H 1EFXB 3SCMD 2XKNB 5E8OA 2ADGB 4GBXB 4X5XB 1FDLH 3TJHC 4HD9A 4GRWB 1CDIA 4WFEE 2NX5D 1G6RA 2CLRA 2IADB 3L9RA 4CJ1A 1IL1A 5F7WC 5SWZB 4UTAH 1UJTA 2E7HA 4Z8FH 3KPMB 3GNML 1NH6A 1SJHB 4PGCB 3ZYIA 5C0RL 2R2HB 1S8DA 5CBAA 5LWYH 2DIAA 1WITA 3TP4A 3FJTA 1JMZA 5DUPL 3OPZL 3MLZL 4M5ZL 4X5WA 2ADJB 1G7HB 1INQB 1E4WL 3H7LA 3DX7B 1IAMA 3BIKB 3ARDD 4OCXL 1FZKB 5IHUL 5F7YC 3EOBB 3WUZA 4H88L 1HHJA 1EBPA 1E6JH 1MI5A 3AVEA 3V5HB 3AS1A 5TPWH 1UA6H 4J3WA 1NCWL 2F74B 1RVFH 4AL8H 4YBHA 5C0BA 2FB4L 3Q1SH 1FGVH 5F7DA 1WT5A 2IQAA 3AU1B 4XVJL 3P9MA 1C16A 1TQCC 3CFDA 3UDWA 3OXRA 3VWJC 3WJLA 2F8VA 3DO7B 4JFPA 4TQEL 2VNCA 1F6LL 5D5MF 2CGRH 1MCSA 1OCWL 3MBXH 4WEBH 3NH7H 2BVOB 3REWA 4GRLC 5CIPH 1YEGH 1UJ3C 3EO9H 1Y6MR 4ONHB 1M7IA 1Q9OB 3C2AH 4NQDA 3S34H 5JOPD 5I8KH 1MHHA 5FF6A 4PJEE 1FFOA 3QUKB 1YUHB 3BYTA 1A14H 4L8DA 2R1YA 4HUUB 5HHMD 1S7RB 2Y72A 4ENEC 2C3WA 1YMME 3VWKD 1IC4H 4NDMA 4YE4L 3QIWB 1TPXB 2DQJH 3K8LA 1OLZA 1KJ3L 3S4SG 3TNMA 2DQCL 2X4OB 2JJSC 4JG0L 5TDPA 3BYYA 1MFCL 4LSDA 4FP8L 1D7FA 4MA8H 5HYSA 5DJZA 4Y2DC 1QBBA 4K71C 4O00A 4JHAL 4XCYB 1JE6A 4NQXB 5T3ZH 4TOYH 5ADOH 2WIMA 3CVHA 4HQQH 32C2B 3OXSA 1JFQH 3EOYG 4JFYB 5BCAA 4KUZH 4XTRC 2EDTA 2M26A 2B1HL 1WTLA 4JDVB 4PJ8B 1IEAB 4E5XA 3VRJA 5KS9B 1GXEA 3O3BB 3LKSB 4HIIA 2M1KA 3HZYB 4E41A 1T1ZA 1OY3B 5HGHB 4MB5A 4Z9KB 4ODSL 5C0NC 4JO1H 5FV2A 4FQPA 3RJDA 3G5ZA 5CP3A 2W65B 2ZCKH 4XCCH 1XGPA 1JL8A 2D9CA 1BFTA 2VSCA 3UBXA 4JPKL 4Q9CA 3IAGC 1KENL 5D2LF 4ERSL 4UU9A 1G7QA 1ERNA 3F65A 1J1OL 4HUWA 1C5CL 3HI1A 4G8GD 3F5WA 4UIKL 2YPVH 2W0FA 8FABB 5L6YH 2N56A 3U9PH 1AQKL 3ZHDA 4W81A 2AJVL 3RIFF 1AHWC 4OM1H 4YBLC 4RZCA 4O4YL 5KVGL 3MRFB 2HG5B 1CLOL 3P9LA 2E7LC 4Z7UB 5EDXA 4K8RH 1AY1L 4WV1B 4QRUB 1NLBL 1X5IA 1CG9A 4OIIH 3CLEH 5CP7A 1T7VA 4ODXA 1MRFH 4DN3H 1I1YB 3MBEA 3VDBA 1I9IH 3WSQH 2EIDA 2R23B 3HMWH 4QYOB 7FABL 2D7TH 1JZ7A 4ONGH 4KK6D 1EVUA 3MA7A 4Z7WA 3T0XA 2CIKB 5FDYA 3O9WC 1V7MH 1K6QL 4RFOL 2VE6B 2X10A 5DT1H 5IQ7L 5ANMA 1U3ZA 4X6EA 5ECJE 4HT1H 1KCSH 3QIBD 2AGJH 3VXNA 5HYQA 3KJ4B 2OL3A 2R4SH 3VXUD 2B2XL 4MXVE 2P24A 5E2UL 3RKDC 5HVHB 1MFAL 1RZ8A 5BVPH 5HD8D 4WU5B 3FHAA 4WFGD 1OARL 4DFIA 3CZJA 3SKMA 5E1AB 3I6GB 5GGSA 1NFIA 3U9UA 1T4KA 4WO4A 3QDGA 3BRGC 2Q8AL 4U1MA 2XKSA 1NFDF 1LE9B 1A7BA 1D5XB 2BRRH 5HY9A 4U6VL 1JWUA 3BN9C 5IVXE 4WUKL 3VD7A 3SE9H 1RZIB 3MV9B 4GG6E 5DEZA 3QXTA 5HDLA 2Z35A 5HHVL 1IBGH 1T20A 5F21B 1CFBA 1PSKH 1VEMA 3GI8H 5D1ZB 5GGRY 4BQBA 4YBQC 1C08B 1QBLH 3KLDA 4ESKA 2OTPA 3ARYA 2O5XL 2CK0H 4XX1G 5F1NA 4YHYC 1H3VA 5E6IC 1FPTH 5BV7B 3MRMB 4R4BB 2E5EA 1KPUA 1A2YA 4MA7H 3IJSA 4K07A 5C0BD 4W70A 2LU4A 3NCYP 3JTSA 4HK3N 4ZQKA 5IHZA 4Q0XH 2ICEB 4PGZA 1VERA 4JFDA 2N7BA 4Q58C 4RGOH 3O8XB 5D7IA 3T3MF 2H2PD 3IFPA 4P5TD 2GEEA 2FX8L 4Y5XB 1RUKL 4OLUH 4MWFB 1QO3A 4MNQA 3LKNB 2FX7L 3QCTL 3VXSD 3STLA 4MMZC 1ZHNA 3BPOC 3RP1A 3DO3A 1Z9LA 1JZ3A 1BM3H 5KSUA 1J86A 3N9GH 2DDQH 4DGYH 2I27N 3BZFA 4GG8B 4ZNCD 4NQDD 4UI2A 4DUVA 4ZUWB 3VFNB 4O58L 2VDQL 4P99A 3GHEH 5I6XC 3RVWC 1CFNB 3FO1B 5JZ7C 1JGLH 3D69B 4MJ5B 4YNYA 4EDWL 4ODTL 4PJHB 5FUCE 2X9YA 3U2SA 4NHUA 3JSSA 3GSRB 3DUHA 4TSAL 4ZTOL 1ZGLA 3CFKB 4LVNC 2QQQA 2QSCH 3BDYL 2CXKA 3OAUL 1V7NL 4JZOA 4J4PC 4P48A 5LAXB 4FNLH 4C59B 3CNKA 3PJSA 3NABL 4IDJH 4M1CD 4PJBB 4QCIB 3C60A 1QFWM 1S7XA 3GMLA 4UOW1 5KVFH 3H9SA 1FAKT 1QLRB 5A2IH 4QO1A 4M1DH 1MVUA 5IBUB 3SDDD 5IMLB 5D7LD 4MJIA 4N0YH 3CJJA 3OHXA 2HKFH 5HHOB 2X4RB 1WCBB 2R29H 3SJVD 3MR9A 4OGAC 1I3GL 3KPPA 4KMLB 4C56D 3TFKD 1EK3A 1QLFB 1EHAA 1AGCA 1T5XB 2IAMB 3NACH 2EDDA 2BOCA 4AT6A 4BM7A 1OTUD 1G9ML 4F3FB 1SYSB 3VGEA 1MUJA 1S5IL 5E03A 5DA4A 1QUNA 3BI9X 1A4JB 1L0QA 5LG1A 2V2WA 3RWIB 4GXUN 2J4WL 3V7AG 1MCPH 1HEZA 3MRKA 4RISH 4XMPH 2V6HA 2EZ0D 1C12A 4Z7WF 4JFFB 4JLRA 3W39A 1HXYA 4P2OD 3UAJD 2FR4B 2WBJA 2VABA 4OQTL 2ID5A 2F53D 2CR3A 4PYHA 3QULB 1UM6H 1QKZH 1YY8A 2HLAB 4PJGB 5E99L 1GAFL 4R0LA 4X98A 5LGHH 5ISZD 1PQZA 3LRSA 3MLSL 4QWWD 2FJFA 1URLA 4HHAA 1JF5A 1HDMB 4PJIE 3ARWA 3VFVA 1S78D 5KVDL 4YIQB 5GZNC 3T65A 3DROA 3OZ9L 3IDXH 1FRGL 1CR9H 4FFVD 4YHML 2JE8A 4Y5YC 5BXFA 3V4VH 2X2YA 1J5OL 3VH8B 2WWMC 3IDGB 2CIIB 25C8H 2AEQL 4RMTA 5J1SC 2LTQC 5IFJA 2X70B 3WN5A 1NBZB 4CVXA 2MFNA 2R1WB 5FUOL 4ZUSB 4GXVH 3V6OA 4L4VE 4EVNB 2QLVB 3CC5B 3X14B 2WW8A 2B0SL 2BNRB 2AABH 2VDRL 3GK8H 3T4YB 2PTVA 3OKKB 3PABB 2B7DT 1KCVH 4JFEB 4WO4D 4FABH 5L2JB 1T83A 4AEIH 2ESVA 3CPLB 4DN4H 2VC2L 5D7IF 2NX5E 5I1AB 3VE0A 1U91B 1EAPB 4TUJA 4WTWA 2VWEE 3ARRA 2CRYA 4OCYH 4Z6AT 4WHDA 2DLTA 2R2EA 2Y1VA 1XIWA 2ITDB 3T0VA 5HVFB 3T1WA 2F54A 2NY2C 1CD9B 4YDLB 3QHZH 1U8KA 5FOBB 4NQVB 1UM4L 4NC2B 5IB2B 4Y16C 5C2BH 3AREC 3OR7A 4H20H 4OSUL 5IEKA 1Z9SA 2R0ZL 3Q5TA 4LFHG 1LO5B 4Z7QE 1T0NB 4ZSOE 1OSPL 4G3YL 4M48L 3KPLB 5TE6L 3QJHA 5A40E 3KR3H 3VFWB 1CQKA 5CZXD 3SO5A 1WICA 3VJ6B 1F45A 4MAYB 4JFDD 1AO7A 3D3VB 1N0XH 5J12C 3B2UD 3FO0H 1IFHH 1G9MC 3ECBA 1TVBA 1GZPB 2FIKB 4MNQD 1MLBB 5BW7C 4X9IA 3PHSA 4JFQA 3TBTA 3IJYB 3QRGH 1WGOA 3S88H 3WCYA 2OI9B 2PNDA 3QUZA 5L7XH 4ZOEA 4LPWA 2O61B 6CGTA 2YRZA 3WXWH 1ZHLB 4LRIC 1YDPA 2ADFL 3GMQA 4C4KT 1T2QL 2WINB 1AP2A 2IGFH 1ND0B 1QD0A 1KB5H 3NTCL 4KJWC 1X9QA 3WLBA 5K93A 4HGWB 1NMAL 2HP4A 4PP2A 1AI1H 5E8PB 4NNYA 5JOPE 2OXHA 5KBNC 1NMCB 2V17L 4P4KA 1CFSB 4PG2A 1S7WB 1MY7A 3LS5L 1ZE3C 1TCRA 1Q9KA 4KI1A 5EO0A 2AEPH 4UNUA 4YHLL 4FMFA 3O11A 5DJ2A 5EU4B 1VEPA 3TBWA 4AM0A 1FE8L 3VA2C 5HHME 1T7XA 2ICWA 5ICXB 3CFEB 5DJDB 4LLMA 2MCPH 3L5XH 2Y25A 4HFUL 3H9SD 2X4UA 3B3IB 3SQOL 2V5YA 2P42B 3FFDB 4MQ7A 5D5ME 4YXLL 1CU4L 3LN4A 2WBKA 1QOKA 2NY4D 3FQRA 2AJUL 3OG6B 3KPRB 4RGMB 3BP6B 3ILPA 1DQQB 1IC1A 3H7BB 4LSRL 5IB5A 35C8H 2I9TB 4NZJA 2VYRE 1PD6A 4MD5B 2D7OA 1KLGA 4DUXA 1RJLB 4PRIA 1CBVL 1R24A 4OCRL 3GSXB 3MACH 4MDIB 5JXAH 3VI4F 4R90L 1R3LB 4YX2H 4PRPA 2YD7A 1G6VK 3CIQA 2DM4A 4U0QB 4IMKA 2YR3A 4J6RH 2D2OA 4HBCL 4N5EC 4KDWA 1HQRA 1MH5A 5DD1L 3MLYH 1BQUA 2ZOKB 3QZWA 2NY0B 3MV8B 4N0FB 1TNNA 2VO5A 5E00A 2VQ1A 1KBGH 4EBQH 5D6DC 3REVB 1UKTA 1OPGH 4JB9L 2GJZA 4YGVB 3H9YA 4G8GE 4HMDA 3PGDA 4IJ3C 4ELMB 5F6IB 3JWOL 1A9BA 2UZXB 4B7IA 1BHGA 3ALPA 5EOQL 4U2ZA 2Z8SA 4U33A 1JWSB 2KKQA 1M1SA 3B2VL 3P30H 3ZYJA 3C9NB 5A2LH 1B0WA 5J6HB 2BSTA 1FVCA 1T1WB 2EYSA 3V52L 3GBMH 1XZ0A 4JFXB 2OJZH 2EE3A 1BZ7B 1E28A 5EA0L 5BZDA 4RMWA 3MCLL 1T7WA 4GOSA 5K9JH 2QHLA 4HXBL 5SX4H 4NRXB 3NCJH 4DCQA 1MCHA 4LEXH 3GSQB 1IGFL 2HLFC 4YDJA 5EB9A 3UTZA 4U1LB 2KZWA 4DKEL 1M7DB 3ABZA 1NAMB 1KN2H 1BPVA 1I7UB 5IMKB 1T80A 3I6KA 2HVKA 3BUYA 3EO0A 3JV6A 4KI5C 3V5KB 3BXNB 1CXKA 4GS7C 5HPOA 1FVDB 1JJUA 3QNZA 5JXEC 1FBIL 3OKDA 4P4RA 3E6FA 3SDAC 1HHGA 3B4NA 4F15C 4EN3A 1YA5A 4P3CL 1XIWD 4KJPD 3CMOH 4ZOCA 2F54D 1BZQK 2YC1B 2CLVB 3QUYA 1LP9A 3T4AA 5HI3C 4OUOA 4G6KL 3U0TB 3GJFA 5KSBB 4TVPL 1JZ2A 2PXYC 3ZTJG 1KELL 4UT6H 4YQXH 4PGEB 3BWUC 3MPCA 2ARJB 2BNQA 2GT9B 3SKNB 3WFEL 2Q86B 4CU6A 1BD2A 4FQHA 4WI6A 5DUMH 4G42A 4O2FA 5FCUH 5GQBA 2HT2C 2AKRA 1W0WA 3CX5J 1Q72L 1NC2A 3P0GB 4QRSB 1KTKE 3R1GH 4I13B 5GGRB 4DZ8A 2CSPA 3NZ8B 1LGVA 5BRZB 4X6FB 3IFOB 1AO7D 4S1QH 4S0TD 5EO1A 2VR5A 3HR6A 3C09C 5C0BE 5A2FA 2AERT 2VXQH 2F15A 3EYSH 5IQ9A 1OW0C 1FGNH 1GGYA 4OT1H 4ODHH 1HSAA 3IF1B 3TEUA 5GGTA 5ABDE 2VLJB 4EUPG 5C0DB 3EFFB 4Y4HB 3QUZD 4LVEA 3WHXA 5L2KB 1KIRB 1VGKB 3VXSE 5JIIA 4LIQL 5K9OB 2VR9A 2NXZD 1QSED 2VTFA 2X09A 1A1MB 3D0VB 1YNKH 2Z92B 4YDVA 4OLWH 1OSZB 5D7JD 2I25N 5ALBL 1RFDH 3UTTB 4PLNC 4ZXBA 2NY6C 1X44A 2YZ8A 4NQDE 3L95A 4ZD3H 2X7LB 4YHOL 3BE1H 4P4KD 3JWOC 5CLWA 1EV2E 3M8OL 1RUPH 1J0JA 3F7QA 3QB7C 4AEFA 1EXUA 5I9QB 3VXOB 1X5ZA 5TE7L 1WWAX 5EU3A 1UACL 3K80A 5DDHA 1Z6JT 4KTDH 4MMXC 1NCBH 1WAAA 3A6BH 2NY3B 2DYPB 2FDBP 3T3ME 4Z7VA 1SMOA 1B4RA 4P3DB 4KKLC 5JQHC 3AMKA 3GFUA 3PGCB 1I3RA 2BFVL 4UT7H 3U7YH 5DO2D 3ZE1E 3WUWB 4QF1A 5B4MD 1MFEL 4JGUA 3KYOB 4LPVA 5IV2A 5MP6H 5ERWA 1JV5B 5D7LE 3MODL 4F8TA 5HHXL 4NQEA 3GDBA 4KKAD 5DC0A 4PRID 3FOLB 2ZUXA 1UT9A 1XGTA 2BVYA 2D31B 4R3SB 2WQRA 3GMPA 3WE6A 4E41E 4P9MH 1TJGL 1ZT7A 2UY7A 2D03H 1MWAL 2X89D 4ZUVA 3BQUD 4NRZB 3WFHB 3QI9A 3G5VB 1MREL 4JEGB 5EUOA 3V6ZB 3VRLF 5C07B 3HLAB 4JY4A 1UC6A 2G9HA 1H0DA 1RUQH 4WU7B 3I50H 2FBJL 3ZKXC 3NFNB 2RCSL 1EEZA 2C3HA 5GGVY 4XNQB 1RU9H 2H26A 1MCOH 3IU3B 4DUWA 2J8UA 2NYYD 2ZUYA 1P4BL 2H32A 5ISZE 1QPXA 1H5BB 2KH2B 2AEIT 2EIZA 4KRNA 2X1OA 2X4NA 1IGML 2VXVL 5TDOA 5D2NA 3PP3K 1BQHB 3HB3C 5D1XB 4D94A 4LQFL 3QPXL 2I07B 4Y89A 5TH2B 1QP1A 1QSFB 2FSEA 1T1XA 1XR8A 2RJMA 3DGCR 4JHWH 4YWGH 1LP9F 1D6VH 2WBWB 3U4AA 4PTTA 1ES0A 2DI8A 2R39A 4K3JL 1QVOA 4KY1L 4Z7WE 3PXHA 5FO8B 3UEZA 2GQHA 3U79A 1TLKA 4PP1D 5C0AD 4GW1A 4XVSL 1SMAA 5CEYB 5KN5A 4OV5B 5ANME 3VU2A 4NCC1 2DWDB 5D4QA 4HWEH 5EU5B 1BJ8A 2JF1A 2NLJA 3E1F1 3A0OA 4NNPH 5CSGA 2BVUA 3CSBA 4XH2B 5DSCA 2CDEB 3LPWA 1ZT1A 5B39B 3STZB 1C5DA 5LCVL 2OM5A 4G8EA 4HIHA 2AJSL 3L7FA 3QDGE 4HW6A 4WWKB 1NGZA 5EBGA 1YECH 3T04D 2R0KH 3MJ9A 5TE4L 5JHLH 3TO4D 2XZAL 1SYVB 2H8PA 1TZIA 2H1PH 1IAOB 4D8PA 3WS6A 4NC1C 2NQCA 3CZFB 3WHE1 4D0DA 4LSQH 5IBTL 5BMFL 4KVNH 3I3DA 2BNQD 3A6CH 3IKCB 4UB0L 3FB7B 1T1YB 4F57L 2WQ8A 5E2VH 4PJFA 2CKBA 4XBGB 4FFWC 5FUCC 1A7OL 3QNYA 3ULSA 3VD4A 4XAWH 3BFOA 1HQ4A 4IRSA 2XZCL 3GM8A 3WYRA 3WIIH 3DUSB 5AZEL 1WAAF 3TVMB 3GSWB 4GW5A 1IAIH 3NCBB 4JFDE 5ELIA 1HXMA 4PLKD 1ZVSA 5D7IE 3PWPD 4Z7VF 5I71B 4M9PA 4WHTA 3U48A 1KIQA 2GY5A 4FQJH 3SGDI 4MNQE 2WUBH 1CL7I 3ETBF 1S5HB 4R8WH 1J87A 2DWEA 1J18A 2FO4B 1Q9LA 2P8LA 3LQZB 4XC1L 1FORH 5DD0H 4AIXA 4TSBH 3O6KH 1M71A 2PO6A 2R1XB 3MZTA 5AWNH 2NTFB 1R5WB 5ITBH 1P7QD 1DLHB 1CXEA 5DFVD 1WIUA 2ZUQB 2EYRA 3FO9A 4UDTB 5IFHH 3UJIH 3RUGB 4IS6B 3RDTC 3HAEB 4QHMA 4ZXBD 4LF3B 1GHFH 4UTAL 3FQNB 5LQBH 3WFDH 1EJ6A 4J3SA 4Z8FL 2EH8L 1U3HC 1Z3GL 1VPOH 2C4FU 4FQQB 2OTUA 1MHCA 5FKPA 2GYSA 3CMGA 3GM0A 3MMEB 3PE9A 2C3VA 3QQ3B 5LBSL 5LWYL 2RFXB 1QBMH 2EDEA 4HCRA 3RL1A 1H15A 2GFBA 5T1DL 4PRAA 3UO1L 1C7SA 4U1NB 4OJFH 3NPSB 4UAOB 2B4CL 4L3ED 2V5TA 3CLFH 1IKNC 4HWZA 3MOQA 4WTZG 3DMMD 5EUOF 3X3GH 1QSVA 3IDIA 2OR9H 2EEBA 1BIIB 4CMHB 4X4ZA 4J3UA 4LLUA 3RGVC 3L3OA 3VDAA 2VJXA 3VI3F 1NBVH 1M05A 3E6HA 2V7HB 2DOCA 5TPWL 3H9SE 5E9DD 1UA6L 3FONB 4YAQA 4B53A 4LOUC 4KTEH 1UWXK 4JRXD 1IGJB 2J8UF 4NQED 5E4IA 2PYED 3Q1SL 1FGVL 4KKBC 4W4NA 1GC1H 1JPTH 5T33L 4G6AC 4G5ZH 5DGRA 1OQOA 3FQWA 3OGOE 4MA1B 3ARBB 2AJ3A 3KDMA 2AQ3A 2CGRL 2DQEH 4HULB 3LN5A 2ZSWB 3NH7L 1FO0A 3LKPA 2YOCA 3QI9D 4HIEA 4HBQA 4YO0A 1R5VB 2OXGA 2Q3AA 1N26A 3EO9L 1FG2B 3S9DB 1HHIB 4U1SB 1VFBA 3EOTL 2Q87A 3B9AA 4WUUA 3SO3B 3VGGA 3CX2A 3UTPD 4ZFFB 5IW3A 4R96B 5INCB 2PCPA 2KZ1B 4JRWA 2OBGA 4KHXL 4G8FA 3QH3A 5IR1A 3DURA 3QUXB 4X99A 2YD1A 3QAZB 3MO1A 1A14L 5IF0B 3DTXA 1WUNT 5DUBB 1FZOB 4LDEB 3T09A 3PQYB 1G7JB 1KB5B 3MRRB 3V0WH 1IC4L 2UWEB 2UUDK 5HYJA 4YR6A 2DQJL 1NGXB 4U6YB 2IQ9H 2IFFL 1GZQB 5IMOB 4MA8L 1FFRA 1SJVA 3TC9A 3VI4E 2VLLB 4OZGA 4TOYL 3DYMA 5IBLD 4HQQL 3GSNA 3MRHA 1IM9A 1JFQL 4IRJA 4Z0BH 1RK1B 4MJ6A 4MJ2A 3U7WL 5J1AB 3T0DA 1XH3B 4KUZL 2VL5A 4P46C 5F1IB 4JO3L 4M6AA 5K9KA 2OK0H 5HHQB 1J05B 5M94B 3MLPA 3V6OE 3EOAB 3Q3GB 4PJFF 3DYPA 4X9FA 1I8KB 2DM3A 2YD9A 3MA9L 2W60B 4IOSD 5ID0A 4PGDB 4JO1L 1IZJA 4I5BB 4YC2B 3RU8H 4NO2B 1CD0A 4IHOB 1U8MA 3I02B 2XG5A 5DXWA 4JM2A 4MD0B 3BP5B 3OTTA 4JFZL 4PY8I 1G7IA 2ZCKL 3BPCB 4XCCL 3UJTH 1FNLA 5DTFA 4LPCA 3G08A 4HAGA 3DX6B 2EYTA 3UTSB 2AJXH 5I8EA 4K3EH 2DM2A 1Q9WA 1XGUB 1KUMA 5DURD 3DVFA 3WO4B 1PZ5A 1AJ7H 4XT1C 5L6YL 2XZQH 5DC4B 2F54E 2HFFA 3GI9H 4KRMB 3OQ3B 5F88A 1YEKH 1KPRA 1RJZA 4XNMA 4Q6YA 2RGSA 4LCYB 1JPGB 3TYGH 4K8RL 1DQDL 3MXVH 5DEFA 1T7ZA 4TTDC 2J88H 3CLEL 1I8MB 4DAGH 1MRFL 1QNZH 3BMWA 1JVKA 4DN3L 3WSQL 3HMWL 1B3JA 3Q6FA 4R2GD 4C4KO 2D7TL 2GK2A 4IRSD 4I77H 3AFLA 4ONGL 4L8BB 2OR8A 4WCYH 4M7LH 1AO7E 1V7ML 3DSFL 4R7DB 3T77B 4GXUM 1CFQA 1A9EB 1F4YH 2Z31A 4HCRH 2QR0A 5DT1L 3BRFA 3PWJB 2E6QA 2LV4A 5JW4N 4QXWA 5F1KC 5IBUG 4HT1L 3O0RH 4NRYA 2AGJL 3MRNB 3GSVB 1ZLWK 2R4SL 4P49A 5DS8B 4D0CA 2ORBH 1MJUH 2BCKA 1ZHBB 2X1XR 4M8QB 5KSAA 3QDMD 2WP3T 1CXFA 5KTEH 2JJTC 2HTLD 4AMKH 1BVLA 3KPOA 2OZ4A 1E0OB 1YN6A 1QSEE 1F90H 4OCMC 4U3HA 3DPBA 2BRRL 3IRZA 5F3BB 3TN0A 1O7SA 3ULVF 1S7VB 3SE9L 3DX9A 3BVNA 3I2CH 1CLCA 4PJEB 2F5BH 4KGJA 5I1CH 1MNUH 1D5ZB 3FB8A 3C8HA 4FXLA 1IBGL 4KROC 3CX5K 4ETQA 4NFDA 3GI8L 3AS2A 4MVBC 2EECA 3TIEA 2W0PA 1QBLL 3FRUB 2OJEA 1CT8A 4LKXB 1FO0H 1YMMB 1NJ9B 3IGAA 2YBRB 3SDCA 1TTUA 5D6CA 4G9DB 4IDLA 3HRZA 1MLCA 2XNAB 2BP3A 2C26A 3ZZ1A 5DJCB 3T2PA 5EPMA 5DD6B 4BH7A 3RVVC 1J8HA 1DJSA 2P8PA 1FC2D 3KJ6H 3LQAH 3F58H 4Q0XL 4BJLA 3S4SA 1J0KA 5EBWA 4RGOL 2ADIB 1HSBB 4IIQA 3ULVD 4KKNA 3OKNA 3BP7B 4OLUL 4TUOA 3AROA 5ENWB 4K7FB 2FGZA 3VH8G 1I4FA 4WI8A 4U6XB 4HV8B 4PRIE 1DZBA 3LSOB 3QFDB 1MFDH 3R06B 2JIXD 5HYIA 1BM3L 2AXGB 4OZGF 5L9DH 2HFEA 3N9GL 4GLRI 2DDQL 4DGYL 4LNRA 4MA3A 2WIIB 1WBXA 3MOAH 4WUUD 5D93B 5HHPA 4ZDHA 2NPLX 2WV3A 3GSNH 4LLQA 3VXRB 5DQ9B 4N1HB 1TTFA 3GHEL 1A4KB 1U8JA 1JGLL 2IFGA 3B9KB 3G9VA 1N3NA 3MJ7A 2BMKA 3QXUA 4K8RC 1WF5A 3DRQA 4JM2F 4Y4FD 4FNLL 1BOGA 5I2IB 5HYJD 1G7MB 4A6YA 4KK5D 4U6HA 4D3CH 3T1FA 4U1KA 2ZOLA 1B6DA 5SX5K 4IDJL 1CGXA 1AR1D 3O6LL 1J1XH 5KVFL 3T2OA 3K0WA 3C5ZA 4M1DL 4KWUA 1QR1A 4M02A 1IM9D 2HKFL 4IRJD 1I1AA 1JI1A 2R29L 3OKOA 2GCYB 1N5YL 4QTIH 2NCMA 2DI9A 2CKNA 4UQ3A 2P1YA 3PV7A 3GMNB 5EIQA 3VXMB 5TQ0H 1N0LA 2NW2B 2ZPKH 3IDNA 3NA9H 4HH8A 4JREB 1UWEL 3W5MA 4JM2D 4I3RH 2CXGA 4RISL 1LVEA 2ZUUA 3GO1H 3GEWB 1JGUL 3KLSA 2ZUTA 3TT3H 3PWNB 3QEQB 1FYHB 4LDLB 4N90D 1FL6A 5IHLB 1WT5C 4AH2B 3C5JB 5JR1H 2HKHH 4PS4H 4Q6IC 3K1DA 1EA9C 3RWDB 1RUMH 3T8XB 1UM6L 2I26N 3UDWC 2DQHH 3CUPA 1CN4A 3UYRH 5FYKD 3WJLC 1DBAL 5LGHL 4OZIB 4JCLA 5IVOA 3S98A 1DANU 4N8CH 1LP9E 3NN8B 5GS0L 4GG6B 5CGTA 3SE3A 1DQLH 2OL3L 4M6ML 2OCFD 4PB9L 4JY5H 3DUUA 4EZMA 4WEUD 4PY7B 2BNQE 5FGSA 2IMMA 3LZFH 5IK3B 3IDXL 1BD2E 1Z9MA 5I74B 1ITCA 3TNNB 5GSRA 5HI4D 3AGVA 4C83B 2OZ4H 4KXZI 3U30C 4RAUB 3V4VL 3MRPA 3MC0A 4X7CC 25C8L 5HPMA 1FL3A 5GS1A 2Z31D 3O3EA 3EJYC 1KACB 3W2DH 1QFUH 1RK0A 4APQA 1W72B 2AJZB 3VRIA 3WMSA 4KAQH 3PWPE 1R0AH 4Z7NF 1H5BC 3EO1B 3ARXA 5C70A 2MPAH 2AV1A 5T5FL 3GK8L 3LKOB 2XWJB 3V4UH 3P73A 4Z77A 4NWTL 4PLJD 2UYLB 3G5YB 2XV6B 1KCVL 1GH7A 3QXWA 4WFHD 5CMAB 2D3VA 3LIZH 4QY8A 4HUKB 4DN4L 4U49A 1LEGA 1F4XL 1P6FA 3AXLB 1KXTB 3I85A 3TN0D 3AB0C 5FECB 3WD5H 3ZKMD 1CICB 1RURH 4MHHG 4FZEH 2BHUA 4J8RA 4UDUA 3TPUA 1WIOA 1CWVA 1ZA6B 5CBEA 5HHNA 1KIUA 4PJCA 3QHZL 1QEWB 5F9JA 4G7YH 4EOWH 3QUMA 4XBPB 4OF7A 5C2BL 1AXSB 2XY1A 4HGKC 2NXYB 3TZVC 4XPBH 3W9DB 3IDJB 4Z7VE 2FGWH 4L3EE 3SDCD 4L29A 2DKMA 3EYQD 4DQOL 4NHCH 3LVEA 3KR3L 2DLHA 3TWCL 4QRTA 2OX5A 5E9DE 2X4TB 1N0XL 3VWJA 5EZLA 3X13B 4X4YA 2XYCA 4NQEE 2FYYB 2PYEE 4U1JB 5K33A 4M43H 4LSVH 3PUCA 4LLVB 4PJAA 1VESA 5EN2A 3NFPB 3QRGL 2CH8A 5EIIA 3S88L 4GRLA 3MBEC 1ZT4A 1UJ3A 4XI5D 1CZ8H 3WKNA 3RHWF 3N50A 4U1HB 1HHKB 2IGFL 2AXHA 3QG6A 5EUOE 4GUPA 4GMTH 1ZS8A 2VZ1A 3MLWH 1YYLH 4CN1A 3BEVB 1U8HA 1ITBB 5F93C 1S7UB 4L9LA 1AI1L 1CTNA 1W2KT 1NCCH 3UTPE 4J12A 5E8DL 5F1OB 3I3EA 2AEPL 2J8UE 1MCIA 3RPKA 4XBEL 1VA9A 2JJSA 1WC7B 3N85H 1HI6B 5EUKB 3VFTA 3QEUB 4CNIB 4PJIB 4YDKH 5CWSA 2ZWLT 3VXPB 4Y2DA 3RY4A 3L5XL 2NY7H 2DTMH 3NAAH 2R2BA 3C5ZD 1BAFH 4XZUA 3DOSA 4U4BA 1BEYL 1NBYB 3HPJB 4P5MB 3MYJA 1A6WL 5IWLA 4BFIA 2D7PA 2XA8H 5H35B 3KNBB 3F7YB 5IB1B 1UKSA 1RPQA 2PW2A 4L4VB 1KF9B 3MACL 1P7KB 1S9KC 5T1KD 2EDNA 2XI9A 4YX2L 1KPVA 5ACZA 5IW6B 3JXAA 4M1GH 5JW4Q 4UZGA 5C0IB 3SCMB 4N9GB 3TV3H 3MLYL 2IH1A 5DRNA 3O6FA 3GBNL 1JUFA 2NX5B 1AGBA 2CDFB 2F19H 5GRYA 1KBGL 1AHWA 3DVGB 2FZ3A 4S2SB 1OPGL 2Q6WA 2E7LA 2A77H 3S5LB 1A7PH 5EC2A 3AY4A 3KAAA 4XNYH 3QJFA 1I85A 4Q2ZB 1NC4D 1CD1A 3UTOA 5T3XD 1JGEA 3EGSA 1HNFA 4JPIA 1GPOL 4HZAA 1NQBA 5D1QD 4BZ2H 3OBAA 4PJFE 4QOKA 3GBML 1VFAA 3ARDB 2OJZL 3O9WA 4RCAA 3FCTB 4C58B 2HA1A 1XCTB 4PJCF 3L7EA 5DHVH 2IH3A 1CXLA 3QO1A 5DI8B 5K9JL 3L6FA 4U0RC 4WW2F 2OQJA 1X4YA 2ZKHH 4LEXL 1P84K 5F89B 2R9HD 3DXAD 5TGBB 3EHBC 3WUWG 1KN2L 4MX7A 3TJHD 4U1GB 3GMOA 3QUMH 4N8VG 1OAQH 4HIJB 5GSVA 2A6DB 4B0MM 4EQ3A 4OTXH 3RNQB 3C60C 2JTDA 1IQWH 4FXKB 5EOTB 3L3HB 1S9VB 3L3KA 1FFNA 2YSSA 4G8IB 4PG9B 4X7SH 3T2NH 3IVKB 3IXAB 4JZJB 4ZUTA 1HINH 1JNNH 4N0UA 5FGBA 1YNLH 4PJAF 2IANA 4JDZA 1F6AB 5LVEA 4S11A 3IB4A 2GTZA 1P1ZA 4PJXB 3KLAA 4LLDA 1UZ8B 4XPHH 3OB8A 1G7PB 5DJYB 4YQXL 4UT6L 1T0MA 2XTLA 5E6IA 5EOCH 1T03L 4QTHB 4LKCB 5TDNA 2ZSVA 5HHMB 1S7SA 5DUML 5JORB 2WBJC 4KKCC 1BX2B 4KJYA 3BISA 4I18C 4Q7DA 4LARH 3VWKB 3RVXC 3R1GL 3U46A 4ONOA 4RAVA 5C7XH 4YDIH 5ICZB 3VWJD 1A8JH 1BQHG 5FK9B 4JHZA 2IG2L 2VXQL 2W0KA 3VMNA 4JJ5A 1FGNL 1FQ9C 1MCLA 4ODHL 5FYJD 3MRQA 4GRLD 1VACB 3ULVE 2DKSA 2IF7A 1KN4H 3KLHC 4XXDA 5DK2A 1I75A 3JVGC 4HWNA 5ESAA 4HIXH 3VFGL 1UXSB 5F8QC 1YNKL 3S6CA 5BQ7A 4OLWL 2XOTA 3DI2B 4Y19A 3RWJB 4HH9B 5MENA 1JRHL 5ID1A 5IW1B 2APFA 4ELKB 4BK5A 4Y5VB 4WUUE 2KPNA 4ZD3L 4PRHA 4PREA 3BE1L 3V6OC 4ENED 1RUPL 2PUQT 1HHHB 2G2RA 5B39G 4LSTH 5IIEB 3TH2T 3TO2A 1FNFA 5JOFB 4MD4B 4KTDL 2EDBA 1NCBL 5HGBB 3TA3A 1FZJB 3A6BL 4G8GB 1ZGLP 2XWBA 4NKDA 2XFXB 4Y2DD 1IT9H 1F3RB 2EDHA 2EKSB 4PV8A 2C7UA 3RPIA 2Z0BA 5HYJE 5C1MB 1L9MA 1FNEA 1EHNA 2H9GA 3P0YH 4KK8C 2DQFB 4UT7L 3WJJC 4TULH 4XTRD 5FM5M 3VGHA 1MCFA 2BJML 5D72H 3TH4T 3MUHL 5L8LB 2C1OA 1EX0A 1GVIA 3D18A 2XTJC 2WWKO 2RR3A 4OZGE 5KVMC 5HTSA 2IBGA 4K94H 4EJ1C 3MJ8A 5C0ND 3X12B 1D9KA 4G9FA 5LXGH 2C3GA 3Q0HA 4RNRA 1NLDH 5C0FA 3PP4L 1FNAA 4U1IA 5I1LA 4M61B 4HK0A 1BQLH 4P9ML 4CW1A 3QIBB 1CF8H 1EEYB 5K59F 2D03L 3NMEA 3WS3A 1FG9C 4HKZA 3TBVA 3VXUB 1OAKH 4DJMA 5E8OB 3V6FA 1G6RB 2CLRB 4N90E 3L9RB 1CLZH 3RWCA 2ZZUT 3I50L 1IL1B 3O4LA 4GKOA 4Z5RB 1RU9L 2RB8A 1MCOL 3QFJD 3B5GA 5FYKE 5HSFA 1KCLA 3HAEG 3FN0H 3FQXA 4NWUL 1S8DB 5CBAB 1D3CA 1BBJA 1U8OA 4Y5YA 3FB5A 1NDGB 2IC2A 1YJDL 2EE9A 3O9WD 4XNUH 4JHWL 5DRWA 1FLTX 1KTDA 4YWGL 4UOJA 1D6VL 1HHJB 3ES6B 4D0BA 1DLFH 3FHQA 4LFHD 4PG2C 3BW9A 5KOVC 4GAYB 3RKDD 1VDGA 4HEPG 5C0BB 5F7DB 5I16A 1R3JA 2DJSA 3RIFK 4NKOB 4MHHI 4P23C 1NDMA 2A9ML 3J8F7 1NMBL 3P9MB 3CFDB 4HWEL 4P5TB 3WDJA 1CDGA 3DVNA 3SGDH 4OZHA 1AGEA 3ARQA 3G04A 4OFVA 3U36A 3VXSB 2JJVA 2K9UA 3LS4H 3QXAA 4LSUL 2ICCA 2HJFB 5BS0D 5EU6A 3BN9D 1HILA 2FWOA 3QEHA 4EIZC 4P59H 3REWB 4QHKJ 1G7LB 2VXSL 1Q94A 3HG1A 4WFHE 4EUPA 3VCLA 3IDYB 4I4WA 3MLTA 5FYLH 1YECL 4M5YL 1M7IB 4OAWA 2E7MA 4NQDB 3P40A 2FJGB 2H1PL 3EYOA 3GHBL 3RKPA 4Y16A 1FSKC 4YBQD 4YXHH 1ZLVH 1MHHB 2YUXA 5K9QI 2BVPA 1SVZA 3E8UH 5DZNA 3NGBB 4OI8A 1AFVH 3A6CL 1RIUH 5DEGA 5E6ID 3FFCA 4YGAB 2Q76A 5KVEL 3V0VA 3BHBA 4L8DB 2R1YB 4NNXA 1LDPH 2FHBA 2X4SA 3DV6A 4S0SD 3ARFA 2SEBA 6FABH 5E2VL 4Y2OA 3UZVB 3E3QE 4NDMB 3SDYH 2AVGA 3T0BA 3TNMB 4ACPA 1WFNA 3X3FH 3CXHJ 1TMCB 3P11L 3QR2A 3MFFB 1J8HE 1N8ZA 1UQSB 2DB8A 5BW7A 2VH5L 1U2CA 3WIIL 4WHYH 3SDDB 3CVHB 5D7LB 1IAIL 1EO8H 3MJGX 4LHQB 1ZLSH 5DQJB 5GS3A 3OGCA 2BC4B 2X1WL 5E94B 3SJVB 2DRUA 2VLKA 2BNUA 3QNXB 4C56B 4FQJL 4J2XA 2WUBL 4R8WL 1WBYA 4LRIA 2YD4A 3U83A 4GAFB 5FUZH 1FORL 5ADPL 5DD0L 4HIIB 4RX4D 2APXA 4KUCD 5IROC 1CE6A 4NBXB 5HYFA 1KSRA 2ZP0T 5ITBL 1T1ZB 3RVWD 1GGUA 3DRTA 4KC3B 5JZ7D 3H8NA 5IFHL 1ZA3A 3UJIL 4M03A 3D2UD 1CGTA 2R56H 5F8RC 3G5ZB 5KANI 1L0XA 1GHFL 4OLEA 5LQBL 2DL9A 4M4PA 3WFDL 1XGPB 4PRHD 1V3KA 3CSYA 1X5XA 4J4PD 3UBXB 3WXVH 3SDXA 4P2OB 1U41A 4UU9B 1QBML 2F53B 1S9YA 4XNZC 2GJ6A 4CL7A 4HUWB 1LK3L 3UPRB 1YEFH 4XAKD 3HI1B 2GI7A 3LCYA 1F3JA 3F5WB 3F8UB 4PBVC 2W0FB 1EFXA 3WIFB 5ISZB 3CLFL 1X5JA 4HJ0C 4DKFH 3X3GL 4ORGB 2BSRA 3HC0B 4GBXA 4X5XA 2K7PA 1OB1A 3P9LB 1IC7H 1MRCH 2BSED 5SV4A 4OGAD 1NBVL 3CFIC 2E6PA 4EN3C 5SWZA 4ODXB 1VFUA 3QUYC 4KTEL 1SJHA 4JO4H 4PGCA 3OR6A 4L3AA 5A16A 2R2HA 1DTUA 3QCUH 2Y07L 5T1LD 4Z7WB 1MCWM 5F7HA 1JPTL 5J3HC 1UENA 1T2XA 3KS0J 5FGRA 4G5ZL 4Z76A 3OAZH 1G7HA 1INQA 2WZPD 3WNPA 3BIKA 4NKMA 1FZKA 4PPTA 2DQEL 3O4OB 1UB5B 3VXNB 5HYQB 2OL3B 3EOBA 5DLMH 3DJ9A 2P24B 3JWDH 2NMSA 3V5HA 1RZ8B 2VKWA 5I19H 1TZHB 4YHPA 15C8H 3ZTJH 5D6DA 3U9UB 4PJ5A 1T4KB 1NCNA 4WO4B 4HPOL 4N1EA 1D5MA 5DD3H 1IGTA 3O4LD 4OM0L 3W82A 3CXDH 2XICA 1QA9B 5GZND 2BX5A 1JWUB 4BZ1H 1FJ1B 1UZ6E 4OZHF 4G80A 3DO7A 4QRPD 4OB5H 2EO9A 2VLMD 2GUOA 2XRAL 4I8DA 3V0WL 2BVOA 3V7MA 3O45A 1T66C 2WWMD 1C1EH 2IQ9L 2ITCA 3O2WL 4LAQH 5T3XE 4ONHA 1Q9OA 4PTUA 5CJQH 4JZNA 4G43A 5DMKB 5HDBE 4JR9H 4EUPH 3MJ9L 4DK6A 4Z0BL 1KPUB 1A2YB 4K7PH 3OKYA 3HMXH 3IJSB 4XX1E 3CDFA 1YUHA 3MGTB 4ZQKB 5IHZB 3LPGA 2OK0L 4JFDB 5GS2H 1S7RA 1W0VA 1BMGA 3IFPB 3BIAX 3QIWA 2WUCL 1QO3B 5LKNA 2QHRL 3ZKSD 1IQDA 1UCTA 3RU8L 1F4WL 5JXEA 2X4OA 5IEHA 1DL7H 3STLB 3Q2CA 1ZHNB 1D6EA 3F7RA 5EU6D 1TQBC 2HWZL 2VXTL 3U0PA 1XF4A 3SDAA 1JHLH 4GSDH 3NIDF 3HG1D 4XCYA 4NQXA 4YFLI 3ZDXF 3WDIA 1GYAA 3IS1X 2DLEA 32C2A 1LMKA 2NY2D 2EDLA 4UINH 1I1FB 4JFYA 4AJ0A 2BHYA 1WEJL 1J12A 2I9LA 4K3EL 3BEWA 2PTTA 2PXYA 4Y16D 3WEXA 2P48B 1IEAA 3ARED 1D5IH 3U0WH 3P4OA 1AJ7L 4DVRH 2XZQL 3O3BA 4I0PC 2H45A 2P44B 4TSCH 4PJCE 4YNYB 3EYFB 3GI9L 3FFCD 3U2SB 4NHUB 1YEKL 5HGHA 1ZGLB 1KJ2H 5IJKC 1Q1JH 3TYGL 4R4FH 2ZG1A 1RIVH 3N1MC 1TJIH 5E08H 1QNZL 4OFPA 3C8KA 5JIPA 3W81A 3DHMA 3EDEA 4MXQC 3SDXF 1P6AB 3OV6A 1YC7A 3VG9C 5EBMA 3EDKA 1S7XB 4I77L 3GMLB 4WTZA 3H9SB 1GC1C 3FQUA 5D9SA 4JDTH 4WCYL 3K4DA 4M7LL 1XF3A 2BOBB 2Z4QB 4RMSA 3OHXB 8FABA 3SPVB 2YD6A 1PAMA 1F4YL 3GRWH 4WGWB 4HCRL 3V95A 2VLKD 3B5HA 3KPPB 4ODBD 4PLOB 5FDWB 3MRFA 2HG5A 4QRQA 2HN7A 5D2NC 4OZFA 2HH0L 3KYKH 4O2CB 2BOCB 4PJAE 1EAJA 4DOHB 4WV1A 5CD3B 4YEEA 4QRUA 5FYJE 1S3KH 2ORBL 4KJWD 1AC0A 4GRWH 1MJUL 1I1YA 1MUJB 1A6PA 5KTEL 2G75A 1OQXA 4GQ9H 2V2WB 4UQ2A 3IJHA 4QYOA 1KB9J 4LBEB 4AMKL 3WLWC 1HEZB 3MRKB 3GKWH 4GLRH 1C12B 1MJ7H 3W39B 4Z78B 1BFOB 3BD3A 3RWFA 3PG2A 1ORQB 1JYVA 3K46A 2VABB 2VE6A 5GRXG 5FO7A 2GJ6D 3I2CL 4JPVL 5I1CL 2F5BL 4M7JL 1YY8B 3ULVL 1WZLA 4X98B 3MNWB 2YKLH 1CGYA 2X4PB 3LRSB 5IB3A 5KW9H 2FJFB 4HHAB 4XWOC 2UVFA 1XCQA 1FO0L 2F58H 5E1AA 1Q0XH 1NGQH 3VFVB 1DBMH 2VKXA 1VHPA 4NJ9L 3T65B 3DROB 3W9EA 1A64A 1K9TA 1QRKA 3BAEH 3SKJL 1LE9A 4KZDH 4LQ1A 4H25B 1D5XA 1P5UA 4JN1H 3OWEA 1HKLH 1KCRH 4HX1A 3KJ6L 1IGYA 3F58L 3MV9A 4L8CB 4Y7MA 2B5IC 4XCFL 4AENB 2YMXH 2NY5L 3BH9A 2W59A 2J7LA 5TQ2L 3VD3A 4DZBA 3QIUC 2EH7H 3WN5B 2LU7A 4XMLH 1YEHL 1C08A 1N2RA 4N5ED 4I9WD 3BOVA 1DQJA 3GSUB 4IOIA 4AIZB 5HDOA 5MHSD 5L9DL 4K2UL 4TPRH 4PJ5D 2AV7A 2EDKA 3GSNL 1AXTH 2ICEA 1AQDA 4MGXA 3O8XA 4KI5F 5BVJA 4KDVA 1GIGH 1A7QL 3VE0B 5JO5B 1U93B 4TUJB 4MWFA 5IHBA 2DMBA 4LVOB 2R2EB 3LV3B 3QEGH 1I9JH 2PO6C 4OD3L 2F54B 3QFJE 3SGKC 1DUZA 3DHJA 4URTB 4JHBA 1U8KB 2BY0A 4D3CL 4NYLA 4TRPH 3DLQR 1Y6NR 2BSSA 2PW1A 4G6JH 5IEKB 1INEH 2HLFD 3IDMA 4YZFE 3IETA 4X80L 5B38B 3FO1A 5K59E 4KXZH 4MJ5A 3QJHB 5I75C 1ACYH 2K7QA 3GSRA 3L1OH 2COQA 4WI3A 5I30H 1AO7B 4KI5D 3ELAT 2FO1A 1TVBB 4F7MA 2BZDA 4EI5C 5MERB 4DTGH 4QGYA 4JFQB 5EZIL 3R8BB 4OGXL 4ZFZA 1ADQA 2YZ1A 3NA9L 2GSIA 1BOYA 4QCIA 4I3RL 4PJDB 1X3DA 2C4FT 5IGXH 3SDAD 2A6IA 3GO1L 3QUZB 3GB7B 3QXDA 5IMLA 4OCSH 3D6GA 5BS0E 3PL6C 1WCBA 1YDPB 5HI3D 4QKXB 4NQTA 5JR1L 1SM3H 3GMQB 1A3RH 2NXZB 4OF0A 1QSEB 1C5BL 4PS4L 5D71H 2PXYD 1QLFA 1RUML 3R8QA 1T5XA 2IAMA 2DQHL 4Z7UF 5D7JB 3UYRL 4N0UE 2ZUVA 3WLBB 2IANE 2B20A 2X4QA 4PRBA 4N8CL 4F3FA 4PP2B 1SYSA 4IOFC 1K3IA 1MHEA 1REIA 4P4KB 1DQLL 2HT2D 4JY5L 2D4FA 2DLFL 1UG9A 3UZEA 2CRZA 5I15H 3TLRA 5A43C 3G6DL 1TCRB 1Q9KB 3DYOA 5EO0B 3BX7C 3O11B 4J3VA 3NIFE 3WIHH 3LZFL 3TBWB 4G7VL 4JFFA 5ESVA 4AM0B 2ICWB 1UCBH 4LLMB 4DKAA 4QXGL 2OZ4L 3D9AH 1KEMH 2L0DA 1HH6A 1K4CA 3LQAC 1A3QA 3V4PH 2EO1A 4PJGA 5FYLE 3LN4B 3FQRB 4F2MB 2Q8BH 1QFUL 4MB4A 1NCDL 1F8TL 2OSLB 5GGQH 4F58H 5LGJA 1VKXA 4OKDA 3QQNA 3MLRL 3KXFA 1R0AL 2DMCA 1KLGB 4PRIB 1R24B 4QEGA 1GJIA 1GRWA 3SE8H 3DVIA 3V4UL 2NY6D 4U05A 4JKLA 3A67L 1DBBH 3PV6A 3VH8A 3PNWB 1DQML 2Y7QB 3T08A 1DBKH 1ROWA 3IDGA 2CIIA 5HGGS 1VADA 4XNXH 4NN5B 5M7QA 5AG9A 3WD5L 1T21A 3BQUB 1HQRB 1JZ8A 1MAJA 1RURL 1MH5B 4KJQC 4FZEL 2JJUA 2X70A 3F6IA 1NBZA 4PRHE 2R1WA 4L1HA 2VZUA 2F9BT 4JKMA 4C55A 1IKNA 2VQ1B 1MJJA 5E00B 4X8JB 4EVNA 4KKLD 4KTYA 3CC5A 3X14A 3ULUH 2GJZB 2XQYG 3RGVA 4XAKE 5T5NG 2BNRA 3ZHKA 4HS8L 5B3JE 3CXHK 5C6PB 4XPBL 4KHTH 5BV7H 4KQ3H 1ULVA 2G5BA 3OG4B 5L2JA 3U1SH 3RAJH 4NM4H 2FD6L 5JLZB 3GUTB 4K9EH 4FFYL 1R3IL 4DW2H 1U91A 4BZYA 2BSTB 1IC5L 5I8OH 1V3JA 1NKRA 4QHLB 1VENA 3GMMB 3FT3B 3IDYC 2VDMH 3ESVF 1N4XH 3EDJA 1E28B 4BUHA 3LDBC 1DN2A 1FVEA 5FYJU 4DCQB 4NQVA 4OI9A 4LSVL 2EDQA 43C9A 2PYFB 4YDJB 4R97C 3UTZB 5C09A 5IVZA 5FFLA 3O41A 5C0AB 4A6YL 2GK0A 4FQXC 1LO5A 3ZSTA 2X9WA 1QFWL 1MCDA 3HI6H 2YWZA 1T0NA 1FAIH 2CJUH 2HVKB 4Q9BA 1V05A 3EO0B 1EPFA 4TVPD 1QFHA 3RIAK 3VJ6A 1CDCA 2W38A 4GMTL 1HOCB 3MLWL 2QTEA 1B90A 2UZYB 4Y4KC 1A3LH 1WLHA 3FT4A 3OKDB 1GZPA 3MLVL 4D9LL 2NNAA 2A6JA 1MLBA 4BSVA 3O4LE 1HHGB 3BD4A 1NCCL 3DETC 1PG7H 3B9VA 3HB3D 3TO4B 5KSAC 1LP9B 3T4AB 4J23A 4EKXA 4POUB 3GJFB 2DAVA 2VOTA 3N85L 3OMZA 4QRPE 2VLME 4IMLA 2O61A 4YDKL 1A1OA 5DWUH 5J6GA 2BNQB 2NY7L 1T6VN 2DTML 2QADC 4FQHB 4HKBA 4NZRL 4G42B 1AKJD 4P46A 3VGAC 4XPTL 5E8PA 4DZ8B