1FN4B

Crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
218
structure length
218
Chain Sequence
b'QVQLLESGPGLVRPSETLSLTCTVSGFSLTSFSVSWVRHPSGKGPEWMGRMWYDGYTAYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTRDLYGGYPLGFWYFDFWGPGTMVTVSSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWSSQAVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY AGAINST ACETYLCHOLINE RECEPTOR
publication title Crystal structure of Fab198, an efficient protector of the acetylcholine receptor against myasthenogenic antibodies.
pubmed doi rcsb
molecule tags Immune system
total genus 25
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fn4B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fn4B01
1Z9LA 5JMRA 3GBNL 5IHZB 5DHYB 5D1ZA 1IJ9A 3P0YH 5E9DA 1JWUA 3BW9B 3MJ8A 1EZVY 5EUOB 2A77L 4FXGA 1FJ1A 3IKKA 3X3GL 2A1WL 5TDOA 2YPKA 3CCHA 5J9PA 3U9UA 4KRLB 3NMEA 4XMPH 1NLDL 1S9XB 1UWGL 3WIIL 2XG4A 1N0XL 2AEWA 5KS9E 1T89C 4CVXA 2AK4E 2HFTA 3MR9B 5GQBA 3UXFA 1SJEB 5L9DL 1DQLH 1S7WA 3GBMH 3T0EB 4NIKB 1DTUA 1RHFA 3PGDA 3UTPE 3V6ZA 4RZCB 5B39A 3WJJA 2CDFA 4HMCA 3M07A 1FQ9C 1HHIB 3RJQB 5GGUA 3JV0A 1MCLA 4QEGA 4L4TA 2EYSB 3EYUL 2JIXD 3FQNB 2PXYA 4QNPF 3RNQB 4DFIA 4KKLD 5I1GH 1D5XB 4KVCL 1Q1JL 5E5RB 4LDEB 1TITA 3U0WH 1V7MH 2ZUXA 5BCAA 3BPOB 2EYTA 1WTLA 5I17B 2JCCF 4JFFE 1A3RL 5HXMA 3DNKA 4PRPD 4RIRB 3BYYA 3P73B 4ZOAA 5K9QI 5J6GA 3UPRA 4QKXB 4HKZA 4MJ2A 3ZL4H 2R29H 1P7QB 4HXBH 4UIKH 1TNNA 3QO1B 3C6SB 1NUDA 2QTEA 2LVEA 4M8QB 3PABB 3PDDA 1BREA 3GB7A 4M43L 3MYJB 1J12A 4BH7B 3CDYA 5CZXD 1KJVB 1X5GA 2ILLA 5L6YL 2ESVA 2GFBB 3BGFB 4HSQA 4NZUH 5J7CC 2R56L 3VG9C 2DBJA 2GUOB 3U4BH 5ESVA 2X89D 5JA9A 4L4JA 3CPLA 4OLVH 3G08B 1YY8A 2VXUL 1AGEA 3BP4B 4XPAH 5HHME 5M94B 4C56A 2AEIT 1HI6B 4XCYB 2FYYB 2YA0A 1GRWA 4G7VL 2HFEB 2VR5A 2Z31D 3RL2B 5DMYA 4DZ8A 3P9WB 1YDPB 4NWTH 4H20H 2CK0H 3O6LH 3FQRB 1CXIA 4R9HA 1JL8A 3TCLA 2AABH 1C1EH 5I1KH 4PJIE 2CLZA 3MNZA 1FIGL 2RB8A 4KKNA 3KLDA 1AXSB 1VFBA 1CXHA 4G8FA 4ZUTB 2OCFD 3VA2C 3LKSA 3OKEA 3V7AG 5EPMA 1S8DA 3L5HA 3M17A 2CGRH 2EDKA 3RQ3A 4NNYB 1YYML 4ONHA 4JFED 3TYFB 3TH3T 1OSZA 3MCKB 4LEXL 2W91A 3NA4A 3QEHA 3WS3A 3AMLA 3X13A 1IGFH 1JPSH 4MX7B 5D1XC 1UB6B 4P23A 4NM4H 3PDGA 2OL3B 3DXAD 2L0DA 2W0KA 3LQAC 2QSVA 3U46B 2BSSA 4QRPB 1HYRC 5EO9B 2XWBB 3OXSB 4MLSA 5GGVL 1JF6A 2IWGA 3CVHL 4KKCD 4E0RA 1CFTA 2OR9L 4N5EC 3RIFF 1HWHB 1AFVL 1NKRA 3EGSA 4IMLB 2AJUL 4RX4A 2EH8L 3B9KD 2VDML 3MCG1 3SBWC 5JTWA 1QLRB 4H8WL 4I48A 2JELL 3I3EA 5E8EA 1CQKA 1PLGL 5FYLL 3MRCB 4GXVL 4XCFH 5AZEH 5F1IB 1XH3B 1IGJB 3VXUA 5FDWA 2IALA 4PB0L 4L1HA 4URTB 1ZHKB 3F7RA 4NO5B 4Q2ZA 5CLTA 3X11B 2VRAA 5F7EH 3SDDC 3QUXA 1W8OA 4HJGB 1K9TA 3DROA 4RDQF 1AY1H 4N1HB 5CEZL 3SE8L 3QJFB 3MXVL 4GRLB 3O45B 3V4PL 4OQTH 1DZBA 4LVHB 4PRHE 4QRRD 3O9WA 5D70H 5CJQL 4I2XA 4EI6A 4KROB 5DLMH 3EFDH 1AD9B 5GGRY 1PDKA 3RU8L 1N59B 3LQZB 4PJCE 4ZD3L 1J87A 3WFCH 1JHLH 3W5NA 4PJ8C 2C3VA 3RL1A 2AJVL 4DN4H 4QXUH 3DV4A 5KANI 5IFAL 4HWZB 2BMKA 1KJ3L 2AKRA 2AXFB 4R3SB 1ZHNB 1FVEA 3AY4C 1NAMH 1IGIH 4OZIF 3D39E 1IC5L 2WINB 3AROA 3NTCH 2BJMH 1JNNH 2W0FA 1W72B 1OGAA 3B5TA 3QIUA 3U82B 4P5TC 4R97C 1U8JB 4CAGA 1U36A 4CMMB 5F1NB 5F9OL 4JRWA 3U0TA 3BZEB 1BM3H 4X7TB 4YO0A 5JW3L 4GAJL 2JCCA 1F6AA 1CK0H 2R4SH 4YC2B 3VCLB 3O11B 2NXZC 4JFZL 3TBVB 4EUPH 2V2TB 1C12B 1NGPL 3VW3L 1SJHA 4J1UA 4WHTA 2IGFH 3TV3L 4HD9A 1LEGB 1WIUA 1RJCA 2FJGA 1NGQH 1YEFH 4JQIH 4L8DB 3JUYA 1T3FA 2BERA 4LRIA 4BQ9A 4K55A 3HTLX 2V7NA 5IJVA 1G7JB 5DUBB 5BS0B 1OB1A 1I3RA 3O3EA 3VRLF 3GO1L 5MHSE 4YBLC 2BSRA 2J8UB 1ZGLP 4LSSH 1J88A 1EJ6A 3H9HA 4NUJB 2PXYC 5SWSD 4XWGL 1ZGLA 4DCQB 1U3JA 3EOBB 3GM0A 2QBWA 3B3IB 4HH9A 5H94A 4HLZH 2KL6A 1G9EA 3ALWA 2DTMH 3MLWL 4K3EH 5KVEH 4FNLH 1JK8A 5HHOE 3FFCB 5DRZA 3V4UL 3SGDI 3QPXH 2Y07L 1QLFB 3LKOB 1XZ0A 3FT4B 3DETC 1TCMA 4HLJA 5C0CB 2VJXA 3K4AA 3WUWA 3R1GL 1TPXB 2G60H 3OAZK 4TVPL 1A2YB 2V17L 2X7LB 1DQJA 3VGHA 2DLEA 1A7RL 1HINL 4J3SA 2NX5E 1HHKA 2FX7H 4PTUB 2YPLB 4X9FA 3WIFA 3RVXC 2WBKA 5SX4H 4KGLA 1T6VN 5CJXA 4PRNB 4RMWA 3L3OA 5EUOF 2Y6SC 3AXLB 1EFQA 4KQ4L 5CP7B 5IJKA 1FO0H 3ESVF 5GIRB 2IAMD 4FQ1L 5ALCL 2V5MA 1MRDH 4TNWF 4KDVA 4P4KB 5D1XD 3ULVH 4AL8H 1PY9A 2Q20A 4JG1H 1LDPL 2EEBA 2SEBB 1CI5A 3RWCB 1TVDA 1DSFL 2OR8A 5DVNA 4XAKD 4WW2B 3HNTH 2WIIA 2Y72A 1G0DA 4N5ED 1MCBA 1CIDA 3UP1A 5F6HI 3QUZC 3FQUA 4U1HA 1AD0A 2AJZB 3GSVA 2XQBH 3IDIA 2X1QA 1U8PA 3BVNB 5JIPA 4OFKA 1F90L 3KYNB 4MD4B 5CSZB 1MRCH 2P8PA 3F5WA 3ZSTA 4LSPL 1FV1B 3PHOA 4XC3H 3RWDA 2NXYC 1PYWA 3FN0H 2XICA 2C3WA 1K5NA 4QRQA 3LZFL 5HJ3A 4HIHB 4MSWA 4OCSL 1XGTB 5B38B 1AR1C 3SDDD 4NQCB 5ESAB 1K2DA 3QDMB 5ITBH 4DKDC 3MODH 2E6JA 1L7IH 4Y16B 3QH3B 5DK2A 2BXZA 4P2CG 1JZ4A 1XF2A 2QJDA 4X4ME 4YE4L 1IEBB 4OZIA 4XPFH 4F7TA 2QR0A 2H8PA 2PETA 4I3GA 4M62L 3PXJA 3S37H 1ND0A 4NM8L 1LD9A 4EBQH 3OKOB 1TETH 4PJ8D 5BRZE 1DUYA 4M93C 1X7QB 4JG0H 1NDGB 1Q9LB 4P9HH 2FL5B 3ELAT 3RIFK 3E6HA 4D8PB 2D9CA 4HC1A 4ODSH 2B4CC 5JHLL 3FOLB 4P2RA 3PHSA 4F37K 4P5TD 2BHUA 4UZGA 3QHFL 4CVUA 1T4KB 3MX0A 3QRFM 3GSQB 4G7YL 4E41B 1RZKC 2JJVA 4ISVB 5F7FA 1UGNA 1ZEAH 2Y4SA 5E9DD 4U7KA 4JY5H 5LCVL 3ULUH 1JV5B 1H8NA 1DJSA 1FDLH 1P5UA 3CC5A 5IB4B 4Z95L 1FC1A 3RDTA 3LEYH 1A7BA 1FNEA 1I7RA 3KHQA 5TQ0H 1OAKL 1ZLVH 3DVGA 3LIZL 5J4MA 5HYJA 2ITCA 1EGJL 2P47B 1G7MB 4GLRH 3AB0B 4LPVA 1I9JH 2CDGB 4LMQE 4MJIB 4P99A 1DVFA 4Z0BL 5TE6H 4JZOA 1QRNA 3Q3GB 5E5MB 3BISA 1MIML 1T0NB 2DRUA 5IB2A 5JHDB 1JGLH 4M7LT 4QTHA 2PXYD 3O8XA 4NZTH 1KFAH 5DD6B 3GKWL 1MQKH 2VDOH 4OF7A 5IB3A 5L2JB 3WN5B 5GS0L 3KHOA 5T33H 1QBAA 2AQ2A 4D0BB 3QUYB 4YAQB 5H2BB 3IFNH 3DUUB 3DBXA 2GIYA 3T0BA 4CU8A 2XFXB 2NNAB 1TVBA 3S36L 3NIDF 4PRPE 1YYLL 1G6RB 1N64L 3DETD 5IHZA 5DHYA 5EZLB 5D9SB 1QKZL 1OQOA 2DQCL 3BW9A 4HK0B 4KC3B 5EUOA 4PRBB 1JVKA 4UBDC 3QZWB 4Q9RH 3LEXA 5C2UB 2HRPL 2YD8A 3SO3C 2R1XB 2K7PA 5ID1B 3T65B 2ESVD 3RVXD 1I1YB 4RFNB 1S9XA 5IVXB 2FX8L 5EU5B 4Y4KB 1MWAL 1AGBB 3MR9A 5EU6E 2CDEB 1HYSC 1SJEA 3O41B 2Y6SD 3ZKNC 3ZKSD 4YDJB 4E9LA 4C56D 4ELMB 1U8HB 2MSPA 1NFIB 1HHIA 3I3BA 2EYSA 1A02N 3FQNA 1KCSH 1B2WL 4L1DA 4P46B 2DBLL 1IFHL 2CKNA 3RVTC 3UMTA 4Y5YC 3MV9D 3MGTB 2VLJA 3R0NA 1QNZL 5CJXC 4AEIL 4YPGB 5I17A 4RIRA 3P73A 4NCC1 4R7DA 4S1QL 1P7QA 3QUZD 2Q87A 3QO1A 3C6SA 1NCDL 4MA7L 4P2OB 1M7DB 4RA3A 4M8QA 1U2HA 4ONFH 3MRGB 2JB6B 4DVRH 4YHLH 4JFEE 4KY1L 3WO4B 3PWLB 1KJVA 5FK9B 3U1SL 1SM3L 2GFBA 1KENL 2GUOA 2NXYD 5A3IC 3NVQA 4JM4L 3VFWB 4K94H 1AR1D 3BP4A 3UTSD 4DGVH 1OARH 3PGCB 1HI6A 1JPGB 4XCYA 2R0ZH 2COQA 4LSVH 3H9SB 5F9JB 2HFEA 2X4SB 4I0PB 3RL2A 3MNVB 1MFBH 3QDGD 2ZOKB 1H5BB 5FA4A 5GZOC 4JPKL 4TNWK 1MAKA 1BVLB 2F54E 3FQRA 3HMXH 5IFHH 1NBVH 2H32B 4L9LC 1UXSB 5E1AA 5TDPA 1AXSA 2X9WA 5GZNC 3QPQC 4HUMB 4ZUTA 3S8WA 1I9EA 3VRIB 5DJZB 1GPOL 5FKAB 2FB4L 3BP6B 5IMOB 5DRWB 3FQWB 1FG9C 4OI7A 5F3BB 3F8UB 4PRDB 3OZ9H 2N7BA 3GK8H 3P0YL 4NNYA 1E4XI 4FQXB 4ZXBB 4JRYA 5ELIA 4CVZB 3TYFA 1ED3A 3LN4B 3FT2A 2GI7A 3MCKA 5IV2B 4U4BA 3IDXH 4HBCH 1MRFH 3BH9B 4X9BA 1FL5B 2D3VA 4MX7A 3O6KH 3KPMB 3HS0B 4NDMB 4QRRE 1J8HD 4XMPL 1EXUB 3DX7A 4BFBD 3VD3A 2DYPB 4RAUB 2D0FA 2OL3A 1QFPA 4BFEA 3PDOB 2I9TB 4QRPA 1ODAA 5EO9A 3AAZB 2XWBA 1DQLL 3BDYH 1QRKA 4MQSB 4L3CB 3BPLC 5FUCC 3W5MA 1QSEB 3AMKA 2ZKHL 4YQXH 1KCRH 4NNPH 2PKDA 1IT9H 4JKPH 1OGAD 2FO4B 4JHWH 5I1GL 4KK9C 4NQEE 3PQYA 4I5BB 1KYOJ 1U42A 1ADQH 5GJTH 5AG8A 3U0WL 1V7ML 3MRCA 5KSAB 2XKSA 5F1IA 1XH3A 2OYPA 3KXFB 2XA8H 3WSQH 5JW4Q 1ZHKA 2FJFB 4NO5A 3I6KB 3ZTJG 3X11A 2GK2A 5IVZB 4BQ6A 3GUTB 4GBXB 3ZL4L 2R29L 4HXBL 4IJ3B 2YA1A 4UIKL 5FGCE 4PY7A 2MFNA 5GGTH 3HZMB 2YUVA 3QJFA 2A83B 1JMZA 1Y6KR 4GRLA 3O45A 5ANME 5CHNB 1LE5B 4KV5E 3CNKA 4NZUL 1WITA 3QEQD 1AD9A 4XNMB 3U4BL 1N59A 5E2UH 3LQZA 3MRMB 3O8XC 5C8JA 4OLVL 2BP3A 4U31A 2Q1EA 4UAOC 3H8NA 5SWSE 4XPAL 4HWZA 4MXWH 4R3SA 5CS7A 1ZHNA 5IB1B 1ZHLB 3KPSB 1NCWH 5EZJB 5INCB 5LQBH 1YY9C 5I1DB 2FR4B 2BY1A 2BNQE 1W72A 4NWTL 1HYSD 2WIMA 5CILH 4Z6AT 3QXDB 4H20L 3MACH 4WUUB 1U8JA 2CK0L 3O6LL 5TDNB 2P8MB 3JWDC 3ZKND 2AABL 2VUOA 1C1EL 2ZUVA 2PTTB 5I1KL 2I25N 4NKIH 1Z9OA 2DJ4A 4X7TA 1CICC 1EAPB 3BPNC 2YWYA 1ZVYA 5GS3A 3H7LA 1T66C 4KUZH 3TBTB 4JO2H 2V2TA 3TBVA 2CGRL 5HGBB 3RVTD 4L29B 3MV8B 2HN7A 5EC2B 2EIDA 4FFVC 3T2OA 3T3ME 4UDUB 3LKNA 1KB5H 4PIRF 1MCEA 4GRWB 4NRYB 4L8DA 1HE7A 4M1DH 2DKSA 1IGFL 1JPSL 2HJKB 1G7JA 4C55A 5DUBA 4NM4L 4IMKA 2R1WA 4IRJB 4OCNC 4JEGB 5BVJA 4H26B 1KN2H 4DCQA 1CLCA 4LVNB 3UPAA 3EOBA 3B3IA 2DMCA 3MBEB 4QHKJ 4ODTH 5FYJE 3K80A 4F33B 1HHHB 4JFOB 2NZIA 5A3ID 4PREB 2YBRB 3ARQA 2M8XA 3BKCH 5HD8C 3QULB 4XAKE 1QLFA 3LKOA 3IF1B 3FT4A 4HFWA 2Z92B 4XCFL 5AZEL 4ETQA 2EC9T 3T2NH 1FCGA 1A2YA 1G9MC 4BFGA 2X7LA 1P69B 3VDBA 5GZOD 4X6DB 5F7EL 2F8OA 4PTUA 2YPLA 3VI3F 4XXCA 1H3TA 1AY1L 4Y4HC 5GZND 3U30B 1SEBB 3QPQD 3ARDC 1QQDB 1HH9B 1I8IA 2VQTA 4JKWA 1QPXA 5D70L 4MNQA 1AO7D 3H42H 1CG9B 3HG1D 2X1PA 3AXLA 5CP7A 5DLML 3EFDL 4M7ZC 2R8SH 2R0LL 3MZGB 2X70B 2CD0A 5DGRA 3WFCL 5GIRA 1JHLL 2GTZB 3IETB 3KNBB 5IVXF 5C7XH 1A6WH 5L8KB 4TVSa 4DN4L 4QXUL 5JNYB 1YC7A 5IMLA 4CUCA 3BJ91 4P4KA 5E6YA 5DMKB 4BKLB 1R3IH 3PHQB 4X6EA 1NAML 1IGIL 2YHGA 4LKCA 3R06A 2SEBA 3NTCL 3ZDYE 4ELMF 2BJML 4LHQB 1JNNL 3QXTA 3RWCA 4LLVA 2FGWH 4WW2A 5C6PB 4GKZB 3NGBB 2YD3A 1BM3L 4Y1AB 5LVEA 5A16B 2AJZA 2FEEI 2R4SL 1CK0L 2QHRH 5CEXB 2A0LC 3BVNA 5IMKA 4KK9D 5HHXH 2R9HC 5IIEB 3ARRA 2IGFL 4YR6B 1EUUA 4MD4A 5CSZA 2P43B 3SCMB 1YPZB 1FV1A 3QDHA 1ZA3B 4F15B 1YEFL 4JQIL 4OCMC 3G5YB 4LSUH 1HHGB 2Y5TB 5E9DE 1Y6NR 1DL7H 2Q7YB 4BH8B 4PJDB 5B38A 4MJ5A 5ESAA 3QDMA 4J2XA 1A6VH 4LSSL 1BZ9B 2X40A 2AV7A 4YHIB 3QH3A 3ULSB 4J3UA 3K8KA 1CDHA 1QTYT 3QXAB 1HEZB 1KXTB 3KPNB 4JDTH 2AXJA 3AREC 5EFIB 4NC1C 4RMRA 2FBOJ 4OI8A 1QRND 3BYTA 2DTML 5J89A 4K3EL 1JCKA 4M6MH 5KVEL 5DFVC 4WV1C 4FNLL 2FHFA 3O8XD 1WFNA 1TVHB 3OKOA 4LSRH 4RWHA 4L4TE 1T04B 1X7QA 4GRMA 3QPXL 1Q9LA 2MPAH 3WXWH 2FL5A 1JWMB 4OLZH 2KPNA 3NCJH 3O6FA 4UILH 1MCHA 1CLZH 1YY9D 2G60L 1BVZA 2Q3AA 4Q9CA 1CL7L 3BPCB 4KDTA 1FP5A 3OR7B 4Z9KB 3GSQA 1IM9D 4E41A 3K7UA 4MA1B 1CICD 4PRIB 4LHUG 1T66D 3PWPD 2DWDA 3GFUA 1JV5A 4OZGB 2IMMA 1I9RH 3RZCB 4LOUC 1B88A 2H2PC 3OAUH 5DC4B 5IB4A 4HEPG 3FQTB 5DA0B 3C5SB 4RMVA 1PKQB 4FFVD 1FO0L 1G7MA 4LGRB 3O2DA 2ESVE 2IANB 4NN6B 4MXVE 1J0HA 3TLRA 2CDGA 4J3VA 2VLRB 1MRDL 1FNLA 3ULVL 4AL8L 4I18C 4JG1L 5CFHA 3RVWC 3Q3GA 5DVOA 4ZUVB 4U1JB 5E5MA 3KYMB 4C56E 5I0DA 1QEWA 4UINH 3HUJB 1I8KB 4H25B 3BH8B 3RGVB 3HNTL 5CJ5A 5DD6A 2AJYL 2XQBL 3WIHH 1INDH 2VLJD 1T7XA 4YHYB 1C16B 5HSFA 4D0BA 3QUYA 5BQ7B 4ODWB 4YAQA 5H2BA 5E2TH 1QSFB 4FXLA 1LQSR 1X5KA 3DUUA 3L3JB 5C0AB 1B90A 2NNAA 4U2YA 1MRCL 5HD8D 2X4RB 5TH2B 1G6RA 3UEZA 1P7HL 2C26A 3C60C 5EZLA 5D9SA 2EXWC 3FN0L 1OL0A 4NYLB 4DKFL 3W2DH 4PRBA 1GZQB 3EJZC 5BV7B 3QZWA 4EKXA 2RHEA 3CSPA 2R1XA 1U8IB 5F88A 5ID1A 1RZGB 3T65A 1LO5A 5ITBL 1I1YA 4Y4HD 5J1TC 3WJLC 5T1KD 3MODL 5IVXA 5EU5A 3ARDD 4Y4KA 1RULH 4QO1A 2OL3L 3QAZB 1AGBA 1CDYA 2CDEA 3JV6B 3O41A 1N5AB 1ZTXH 4XPFL 1V7NH 1RK0B 1SHMA 1TIUA 2X10A 3LD8C 3QDJB 3J7HA 5D2NA 3BQUC 1CBVH 4ELMA 1U8HA 1NFIA 3UTSE 3MJGX 3D87B 3P9LB 4YH6A 3S37L 1RUMH 1Z3GH 2VC2H 4EBQL 1TETL 2XWJB 3CFBB 4JG0L 5D1QB 4P46A 4NZRH 4P9HL 5I8OH 5I2IB 2WBJB 4JRXB 3MGTA 4YFLI 1I3UA 2G9HB 4XXCC 3RI5K 5C09D 4ODSL 4YPGA 1MREH 3OB8A 3BKMH 1KEGH 4H8WC 4OKDA 2VSCA 3AGVA 2VN4A 4RISH 1ZEAL 3S37X 4JRYD 4P2OA 1M7DA 2A0LD 4JY5L 5DURD 4ONGH 1CFVH 4V1DD 2NTFB 3ULUL 1FGNH 4LIQH 1FDLL 1C5BH 3ZYOA 4GRWF 1KTDB 5FCUH 2R9HD 3PWLA 3TO4A 3P4MA 2GTWA 3LEYL 5TQ0L 4I2XE 1J8HE 1I9JL 2ARJB 5J1SC 5C0FB 1L9NA 3VFWA 5I71B 1BF2A 5TE6L 1PG7H 2ZCHH 5DMIH 4XBEH 1JPGA 2W60B 1PQZB 1OSPH 4GXUM 2DKMA 1JGLL 3CFKB 3H9SA 5F9JA 2X4SA 4I0PA 5T5FH 3QWRD 4NZTL 2E7LA 1AIFB 2ZOKA 4QNPE 1MLCB 1KFAL 3PQYD 4JGMA 4R7NB 1BVLA 1OGAE 3ARED 1MQKL 2VDOL 3CXHK 2H32A 1UXSA 5T33L 3RUGF 5M7QA 5DI8B 3VRIA 5DFVD 4UDTB 5DJZA 3L3DB 1ORSA 1WJ3A 2JCCE 4HAFA 3C6LC 2HFGH 3BP6A 1IAMA 5F9WC 5IMOA 5DRWA 5F3BA 4PRDA 3N06B 4ZXBA 2D31B 1KPRA 4FQXA 4CVZA 2PNDA 5BXFB 1FZOA 3LN4A 4MHHI 5IESH 1W0YT 5IV2A 4Q9RL 3UDWA 1MFNA 1MCRA 4AM0B 3BH9A 1FL5A 4QRUB 3P11H 3KPMA 3HS0A 4NDMA 3UAJC 2Q6WB 1NFDB 3WFBH 1EXUA 2XTLA 2DYPA 4RAUA 4ZUUB 3EOTH 4H1LH 2FZ3B 2EIZB 4LOUD 2H2PD 2JJTC 5EO0B 3V0VB 4Y8AA 1HOCB 3RNKB 4D9QD 4L3CA 1HDMB 4PGJA 1JI1A 1QSEA 3HE6B 5F9DC 3O6FC 1KCSL 3OGCB 4I8DA 3D85D 4QYOB 3BD3A 4ODVH 1OLLA 2FO4A 3PWNB 4KDTC 5HY9B 3OKLB 5EOQH 3LRSA 1SJXA 4Z77A 3MRKB 3RVWD 4UQ2B 2ZUUA 3KXFA 5JIKA 2FJFA 4TPRH 1JGUH 5IVZA 4GBXA 5D93C 2ZOLB 2Y23A 3HZMA 1ZVHA 4ONFL 2A83A 5F6IB 1BJ1J 4DVRL 4YHLL 1U58B 3FB5B 3K2MC 3NFNB 3QFDB 5CHNA 1LE5A 3RKDC 3W11C 3QQ3B 3C60D 4PJDF 3HZYB 4XCEB 4XNMA 3E0GA 3UYOD 3EOYG 4LLWB 5HYEA 3GJEB 3EJZD 3IAPA 2VO5A 1FLRH 3MRMA 3CMOH 4K94L 4Z7VE 1OARL 4W6YB 1KIQB 3F58H 5IB1A 3M45A 1IEAB 2R0ZL 1ZHLA 4NKOB 3KPSA 4LSVL 5INCA 5I1DA 1MFBL 2B2XH 2FR4A 2DICA 4LLYB 2H6PB 4WUUA 1DCLA 4OLEA 5F3HA 4N1EA 2P8MA 3HMXL 1UH3A 4JHAH 5TDNA 5IFHL 1NBVL 2PTTA 1Y18A 3IDMB 3WIHA 1GYAA 3BQUD 4JZJB 1EAPA 4CVWA 3UZQA 1OPGH 5IF0B 4QRTB 1WGOA 3TBTA 3V6FB 1A47A 3P40A 3TZVA 5HGBA 5TGBB 4N5UA 4L29A 3MV8A 1BLNA 3OZ9L 2YPLD 3GSXA 3GK8L 5EC2A 1NANH 2DM4A 4GOSA 2FRGP 4TSBH 2G75A 3DMMB 2VDQH 3PJSB 4UDUA 1YJDH 2OZ4A 3IDXL 1QG3A 1MRFL 2A9MH 5F7DB 1J1PH 4MNQD 4NQUA 4XVUC 3O6KL 5KS9B 5EOCJ 3GMPB 2UWEF 1IAKB 1OP3H 1T1YB 5D2NC 2YS4A 4ZSOE 5K33A 2GYSA 3P9MB 4IRJA 1GGCH 5I1IH 3O6MH 2OXGA 3EUUA 3SDCB 5ADOH 4J12A 3UO1H 5IK3B 1HNFA 5A1AA 4RGMC 3W0WB 4RAHA 3S3JA 1CE6B 3MBEA 4NQXA 4OZIE 5B22A 4F33A 4YQXL 1KCRL 4NNPL 1HHHA 1IT9L 3K81A 4JKPL 4JFOA 4PREA 1ZT1B 2YBRA 4JHWL 5IEHA 2F53B 5D6CA 4ZQKB 3HUJF 5F21B 1ADQL 4JFFB 5GJTL 3RUGA 2CXKA 3QULA 1H3WM 3IF1A 5HVWA 2Z92A 1YN7B 4HIEB 4S2SA 3U0PB 5ABDE 3ARPA 5FUCE 4NHUB 1RURH 2XA8L 3WSQL 5CZKA 4JREB 3OJDB 3TO4C 3F7YB 4X6DA 4P2RE 4UT6H 1UWXH 3QT2A 3LS4H 1MFDH 1R5IB 4Y2DC 5GGTL 4U1LB 4JJ5B 1SEBA 3DO3A 1U0QA 1QQDA 1HH9A 4OUUB 4G42B 1N7MH 4YFEA 3OQ3B 3C6LD 5D7LB 4ZG1A 4WWKC 1KV3A 1YQVH 1ULVA 5F7WC 1PZ5B 3GSRA 3VRLE 4I0KA 1MCOH 2BNUB 2X70A 5KJRH 5E2UL 5HHMB 3ARBB 2GTZA 2KKQA 3IETA 3KNBA 2E7LC 1B4JH 2FATH 5JNYA 5HDOA 1H9VA 4AEEA 5DMKA 4D0CB 3SGKA 3DRTA 3GIVB 1A7NH 2Q86B 3UAJD 1NCWL 4WW1B 5LQBL 3WDJA 3BUTA 4PJIB 1CE1H 4HIJB 1QRNE 5CILL 2YEZB 3MACL 1G0YR 2F5BH 1KLGB 1REIA 1CGUA 3TH2T 4NKIL 4Y1AA 5A16A 3O6FD 4AQ1B 5CEXA 1CZ8H 3BESR 3NCYS 2CR6A 4KUZL 4JO2L 2P24B 3UDWC 2FX9L 1P4IL 4MDIB 3JWOH 4B41A 3BIKB 4G6JH 4YR6A 3ROLB 5EU7E 4G9DB 4E41D 4POUB 5E7FA 1JFQH 3GMQB 2X1XR 4KH2A 2UV3A 3SCMA 3TVMB 2FD6H 1KB5L 1JNHA 1ZA3A 1FFPB 5DFWH 5K9QG 1GL4B 3G5YA 4M1DL 3TBSB 3LPFA 3PXHA 5JIHA 3W9EB 1RZJH 3PWPE 5EUOE 2Q7YA 4BSVB 2X44D 4BH8A 4PJDA 1BEYL 1JWSA 2OM5A 3PL6A 4DQOH 1WBXB 4KTEH 4NC0B 1OVZA 3TWCH 5DHVH 4IDJH 5AEAA 4YHIA 3O3AB 5C0EB 1WFTA 1JZ7A 3QXAA 2X6MA 1KN2L 1HEZA 4M3KB 3KPNA 2GJJA 3RKDD 3IS1X 3W11D 4WDIB 5EFIA 2DMKA 4WFFE 4XZUA 1UJTA 4ODTL 4E5XB 2K7QA 2NW2B 1MPAH 1TVHA 1ZT7B 2HJLB 4MZ2A 1T04A 2B1AH 4DUXA 2YMXL 2ZUQC 4YIQB 3Q6GH 3QUMB 4IJ3C 2ATKB 3WLBB 4UTBH 3CFEA 4OFYA 3T2NL 4XP1H 2VLJE 5MP6H 4XP6H 5C0NC 3OR7A 5C0JB 4KGJA 3RP1A 2EE9A 4KZEH 4PRIA 4M5ZH 5BMFH 3B4NA 1U3HC 3MOBL 4HGWB 4KRMB 2DDQH 2QQKH 3H42L 1N26A 3FQTA 3OL2A 2WWKT 3LS5H 2R8SL 1SJVA 2CQVA 2Q8AH 4RGNC 2A6KB 4MA8H 3IU4H 1NFDF 2IANA 4JY4B 4F3FB 5C7XL 4F7EB 1A6WL 5AZ2H 5TQ2H 5DJYB 3DVFA 3T4YB 3JTSA 1G7LB 4XVUD 2VLRA 3B9EA 1JIBA 2JB5H 5DQJB 1N4XL 1CU4H 2P49B 1R3IL 4IIQC 5GS1A 4U1JA 3KYMA 1O7VA 2VABB 3HUJA 3OV6A 1I8KA 4H25A 3G5XB 2FGWL 3BH8A 3RGVA 4LSTH 5F1OB 3TZVC 4WFHD 4ODXB 4I0CC 1ZVSA 2QHRL 4K3DL 2NY1D 1C16A 2AGJL 4NO2B 3UJTH 4YHOH 4XRCB 5BQ7A 4ODWA 4P49A 3WXVH 1QSFA 4PJBB 3LVEA 3L3JA 5C0AA 1EEUA 2DS4A 3LOWA 3TN0B 1PW3A 3ALXA 2G2RB 4KJPC 5TH2A 1G1YA 3GMOB 4NYLA 3HAEH 1FN4B 3QNZB 4LHUB 2E27H 1GZQA 4LSUL 4JRYE 1DL7L 3TO4D 3S7GA 1AHWC 2C4FU 6FABH 4FQHB 1RZGA 4Y2DD 4XP4H 1F4WH 1HH6B 4LCWB 1A6VL 1GGTA 4BZ2H 2XZCH 4U6VH 3I50H 4WI4A 4GKOA 1CFSB 1I75A 1HKLH 4MA3B 4JDTL 1N5AA 4LL9A 4WWKD 5JORB 4QRPE 3TIDB 1RK0A 2CRZA 4J6RH 5HHOB 3V2AR 1WCBB 4S1SH 1UZ8B 5T5NG 5SWQB 3P9LA 4M6ML 3VXMD 5KANG 4LSRL 4MJ4A 2XWJA 3CFBA 4U1MB 5L2KB 3RTQC 2MPAL 4X5XA 3WXWL 5C6WH 5I2IA 1U8MB 3C2AH 4OLZL 1MJUH 1AQDA 1BFOB 3NCJL 4UILL 3PQYE 4LPWA 1BBJA 5DD5H 5LXGH 1CLZL 3TH4T 4ELKB 3U6RB 1DQQB 1NAKL 4O2FB 4XI5C 1FAIH 2BSED 3BKJH 4B7LA 3NIDE 4BM7A 3MUJA 4PRAB 3DPBA 3EJJX 2NTFA 1BFSA 1I9RL 4G3YH 3OAUL 3C8HA 3BEWB 3HI5H 3SGKC 5KS9F 3QG6B 4FTVB 3O4LB 4PJHE 3L5WB 4ZAKB 3P4OA 4M1CC 2HRLA 5J06A 2EECA 5E8NB 5C0FA 3OR6B 5E6IB 4CL7A 4OCWH 3MREB 1H8SA 1D5ZB 3LPWA 2ADJB 3PGFH 4OZ4B 2W60A 3CAFA 5C07B 4JCMA 3VXPB 3FO0H 5EZOH 1FVCB 1J0JA 1XGYH 4UINL 2AEQH 1AIFA 1MLCA 2HFFB 3E3QE 5D7JC 3V5HB 2VL5B 4R7NA 3WIHL 1INDL 4FFYH 3SCMC 3H3PH 3HKFA 2R2EB 5DI8A 4NO3B 4UDTA 5E2TL 3L3DA 4MB3A 2P5WB 1VEMA 2YN3A 4PJ7B 4TRPL 5CBEA 3LV3B 3SY0B 3PL6C 1LO3H 2NZ9C 2D31A 3JVGA 3VXSD 3ECBA 4UQ3B 5BXFA 3W2DL 4TOYH 2PW1B 2CRMA 4NO0B 5C0ND 4AM0A 4DZBB 4QRUA 4J3WA 3IJSA 2Y1VA 1RVFH 1OP9A 4FQ2H 1AQKH 3WE6B 1NFDA 1FFNB 1YN6B 1TLKA 1RULL 1U3HD 5HYSG 5AUMB 3ARFC 3VFOA 2FZ3A 2EIZA 2H3NB 1K4DB 1P6AB 3V0VA 1ZTXL 5I6XC 1FFQA 4HT1H 3STBA 3W82A 1V7NL 5BRZB 3RNKA 3E2HB 1HDMA 1CBVL 5GGVY 1N6VA 4RGND 3HE6A 4X4YB 5C0GB 5GRVL 1RUML 1Z3GL 4OZFG 2VC2L 5JR1H 4K71B 2VDNH 2MKLC 3CH8A 1U91A 3ILQC 1KJ2H 1AKJB 1VA9A 1YEIH 4QYOA 3JV4A 4LF3A 4NZRL 4WUUD 5I8OL 1TQCC 1Z6JT 4M6OH 4M61B 2VXQH 2DQTH 3MRKA 1J8KA 4UQ2A 1RSFA 1SYSB 1PAMA 5JDSB 1MREL 3T2PA 3BKML 3KG5A 3UZEA 5IQ9B 1KEGL 1RIUH 4FQQB 3TZVD 2Z91B 3GI9H 3RHWF 2ZOLA 3IJYB 2DQGL 4RISL 1MQ8A 4ONGL 2C1PB 1CFVL 2YPLE 1I3GH 1FGNL 4LIQL 5F96H 4NOFA 1OAYH 1C5BL 1U58A 5FCUL 3FB5A 3ARVA 3REWB 1CXEA 2PYFB 4FS0A 3NFNA 3QFDA 4OLUH 1N5YH 3NZ8A 4KJPD 1YEDB 4QHNB 4MNQE 3MV11 2F5AH 3QQ3A 4DEPC 3BIAX 3HZYA 1GHFH 3GM8A 1PFCA 5GS1C 4LLWA 3GJEA 5A2KH 3MLUH 1A3LH 1X5HA 1R5WB 4Y4FC 3SKNB 1GGBL 4LP5A 4XVTH 5GSVB 2C3GA 1PG7L 2Z93B 2ZCHL 5DMIL 4XBEL 2OI9C 2JIXB 1IEAA 4JVUA 4NKOA 1OSPL 4O00A 4NNXB 4FXKB 4NKQB 1RMFH 1UWEH 3QR2A 3QYCA 1FE8L 4LLYA 2UY6A 3SE3C 3MRLB 3K2UH 2ZG3A 1JGVH 5IBLC 5ITFB 4JZJA 5JOFB 3SDYH 3GRWA 4PRPB 5IF0A 4QRTA 1OM3H 1PKOA 2D4DA 2W59A 3GJFH 3MGAA 2HFGL 3RTQD 2D7PA 1PG7X 4U6XA 5TGBA 4CNIB 4YXLH 3AUVA 3BP7B 3T4AB 3DMMA 2JLLA 1CN4A 1X5ZA 5IESL 4KK5C 4WI7A 1EJOL 4X6BB 5BJTB 4XI5D 5F7DA 3P11L 5KS9A 1EEZA 3NCCB 3GMPA 5DZLA 2CLRB 1IAKA 1CGSH 3RGHA 3C87A 3OXRB 4WRLA 3EOTL 4G80A 1MFAH 1LILA 1U95B 2NW3A 1F6LL 4HUXB 4D94A 4X0KB 3OKNB 2XZZA 2Z31B 3W0WA 3ZKMC 1CE6A 2BVTA 3BEVB 5BVPH 3TA3C 3WKNA 2DM3A 4M1CD 3Q5YA 1ZT1A 4ODVL 5IR1B 2F53A 3BMWA 3WDHA 5EOQL 4JFFA 4HIEA 3U0PA 5IWLA 2UUDH 4WO4C 5IOPA 2AXGB 1A22B 4NHUA 4CADB 2ICWI 4TPRL 4HEME 3OMZA 1IBGH 5D7JD 3OJDA 4DWHA 4RSVA 3MV7D 4PJBF 4JFEB 1CGTA 2ZP0T 4KI1A 4XPTH 1R5IA 3WNLA 4GS7B 3SKUD 3KDMB 1ZLVK 4E41E 2WUCH 3QQ9C 1A1MB 1CL7I 4Y5VB 4RBPK 3UTZB 1A1NA 4G42A 1M05B 5D7LA 4EIZC 5SX4I 2IH1B 5F7UA 1PZ5A 3DXAB 4NKDB 3PL6D 1I85A 2NZ9D 1UH4A 2BNUA 4PG9B 3ARBA 4EN3C 1FLRL 3CMOL 5DJ6B 4PP2B 3OAYK 2J1KA 2GEEA 4HWBA 1A14H 3FKUS 1CR9H 5B4MC 3F58L 4P57B 1J10A 4D0CA 3B9KB 2W9EH 3GIVA 2Q86A 1M71B 1YEKH 3DX6B 4WW1A 4XMKH 5J12C 3VWKC 1LVEA 2B2XL 3ARFD 2X09A 2YEZA 4CKVX 4WEMB 3ULVC 1KLGA 4L8SB 2QSCL 1NCBH 1XIWC 4HUKB 3A6CH 1OPGL 3JVGC 4LLUB 4OFYD 1HCVA 3T09A 2X42A 5HHVH 3ILQD 4XH2A 2P24A 1CVSC 3V5DA 3WDIA 4O58H 4PJFF 1UFUA 3BIKA 3VD9A 4G9DA 3GMQA 2V5TA 4TSBL 3VI3E 2VDQL 3S4SB 3TVMA 1YJDL 3VXRA 4QRRB 1FFPA 5BZWB 2DN7A 3RY6A 2A9ML 5EC1A 3W9EA 1J1PL 2LTQC 5JQHC 1ZLWK 1G7HB 4EDWH 5K59F 3QXVA 1IGCL 4BK4A 3TT1H 1PX3A 1WBXA 1KGCE 2NMSA 1F4XH 2XKUA 1GGCL 3O3UN 5I1IL 3O3AA 2UZIH 3QA3B 4M7LH 3KPQB 5C0EA 3G04B 5IVXE 5ADOL 3L6FB 3UO1L 3VH8B 3D5OF 3PV6B 4Z18A 4WDIA 3WHXB 1U93B 5LAXB 2AVGA 4U0RC 4HG4K 3ZTNH 4E5XA 4HQQH 5D2NE 3SDXE 3ZDXF 2DJUA 4ELME 5JZ7C 5HHNB 1EBPA 4Y5XC 2NW2A 4UTAH 4Y4FD 1ZT7A 2GK0A 2YD9A 5A2LH 4JFDD 2IADA 4PGEB 5ADPH 2GJZA 4YIQA 3F62A 4KDWA 1XR9B 1F3JB 3QUMA 4WHYH 3BAEH 1VGEH 2ATKA 5F7NC 4GAYA 5FGCB 1RURL 1TMCB 4NJAH 5EUKA 3PG2A 5F7LB 3T04D 3IFPB 1CLOH 5C0JA 4UT6L 3LS4L 1MFDL 4PJ7F 5ANMB 2FWOA 2LU7A 3MLXH 1KIRB 1ZSDA 4WFGD 2NY4C 4GW1B 4HGWA 1KCLA 4Y89A 4N0RA 5J56B 4WHCA 3RHWK 4IOFD 4P5MB 2YUZA 3GMNB 1MCOL 5KJRL 5SWSB 2A6KA 4KK5D 3ULUC 3IDYB 1IGTA 3CSYB 3DHMA 1IGYB 4JY4A 4F3FA 1B4JL 4F7EA 2FATL 5DJYA 5HHQB 4LAJH 2R0KH 1G7LA 1S7QB 3RPIB 3VG9B 5DQJA 4YLQT 3EZJB 1GZPB 1A7NL 4LFHG 4GLRI 4LLDB 4NQDA 5CIPB 5GGRA 4LAQL 1CE1L 5LKNA 3IT8D 4Q7DA 3G5XA 2F5BL 3VXME 4C83B 5I18L 1UM5H 1H3UA 3D69B 4LNRB 2ZNWA 3LDBC 3ZKMD 5ACZA 4PJ5A 4JPVH 1CZ8L 3DMMC 3TA3D 3GGWB 4NO2A 4MS8C 2NLJB 4XRCA 1A9EB 4PJBA 3JWOL 4ZO7A 2J2ZA 3TN0A 2HT2C 4G6JL 3EOAB 2G2RA 1D7FA 1JFQL 3I75B 1TTFA 3DX9B 3GMOA 3D25B 2FD6L 4HUUB 1V5JA 4WO4D 4JAMB 1FN4A 3QNZA 1FNHA 4LHUA 3LHPH 1RZJL 1O0VA 2BDNH 2XG5A 3L7EB 1A6AA 4DQOL 4KTEL 1I7UA 2IAMB 3VGBA 3HA0A 1HH6A 5TF0A 4LCWA 3TWCL 1MVUB 4IDJL 5KN5A 1A6PA 3C09C 5D1XB 5D7KD 1CFSA 3ZMRA 4MA3A 1KTLB 2Y36H 5JORA 3TIDA 3S5LG 4UUJB 1Z9MA 1WCBA 5E1HB 1UZ8A 3BGMB 3IFOB 4WVRA 2NR6C 1XCTA 4EN3D 2APBA 2XY1A 1QSEE 4EXKA 1Q1JH 4U1MA 4GG8B 5L2KA 5DZNA 2B1AL 3MV01 3QIBC 1JTTA 3Q6GL 5B4MD 1U8MA 5HYFA 1K8IB 2E7MA 4UTBL 1R3HB 5CWSA 3VWKD 4XP1L 1ZK9A 4MB4A 3VMOA 4KJWC 5FECB 3U6RA 4ELKA 4PJFA 2PUQT 2OSLB 5MP6L 4XP6L 3MLRH 2N4IA 3KXFE 4O2FA 3DWTA 1D9KA 3ULVD 1FFOA 3P77B 3MLTB 4LLQA 4FQLH 3V7AE 1XIWD 4KZEL 3HZVB 3V4VH 4EQ3A 1CWVA 4M5ZL 3S35H 1NCUA 1KCUH 3ARBC 2EDXA 3VXSE 3SDDB 2DDQL 2QQKL 5BW7A 3FZUC 2GQHA 3LS5L 3D48R 4QWWC 2Q8AL 3QG6A 4FTVA 4OF6A 4I3RH 3PV7A 3TNNB 4MA8L 3O4LA 3L5WA 4ZAKA 3IU4L 2VDLH 2ITDB 1Q9WB 5AZ2L 1IC4H 5E8NA 1G0XA 1NEZB 3OR6A 3MREA 2JB5L 3DIFA 1CU4L 1D5ZA 4G7VH 2RAMA 4OZ4A 4PJ8B 5C07A 3VXPA 1FVCA 4RGNE 2P8LA 4KMLB 3MUGA 3KPSE 1J0YA 1OHQA 4LSTL 2HFFA 1V3MA 2Z0BA 4K94C 3STLB 3V5HA 3MRBA 3I2CH 5ISZD 4U33A 4WUUE 4R4NC 4QGYA 1XAUA 4P5TB 4R97B 2R2EA 4YHOL 5JZ7D 5TPWH 3WXVL 2W1NA 3RJDA 2P5WA 1T6WA 3G5VB 1RUPH 3QP3A 4PJ7A 4MVBC 4PY8I 5IHLB 5E9DB 1JWUB 4NC2B 3LV3A 3SY0A 4HCRA 5E8PB 1IM3A 4LEXH 1FJ1B 1J1XH 2IC2A 3MV8E 5FGRA 2E27L 2PW1A 3MC0A 4J4PC 4NO0A 1KNOB 4MNHA 4DZBA 4WHYG 4GRWE 1N0LA 3NZHH 4LDOB 4TUKH 6FABL 5HI3C 4MD0B 4XP4L 1ERNA 3NA9H 1F4WL 5DD1H 1FFNA 2NY4D 1YN6A 2XZCL 4NBYB 4U6VL 3I50L 5AUMA 2H3NA 5SWZD 1HKLL 1K4DA 3V6ZB 4D3CH 4HH8A 4YBLB 1C08B 4NN7C 2X5PA 4J6RL 2NCMA 3Q6FB 1BOYA 1QVOB 5C0GA 3C5ZD 1GOFA 3ULUD 5EN2B 3I84A 4W6WB 3Q2CA 1AKJA 2P48B 2WLZA 3C2AL 2EYTB 1MJUL 3OKYA 4K9EH 3W81A 3RWHB 4M61A 4LCYB 5DD5L 2H41A 4U3XA 4PB0H 3RUGE 5DJXB 1SYSA 1YECH 5HTSA 3IYLW 2DLGA 4HKZB 4YWGH 1TZGL 1FAIL 1YA5A 3BKJL 4KHXH 3N50A 4HX1B 4YPJA 2Z91A 3IJYA 4WGWB 5SX5H 3SE8H 3GB7B 3VE0B 1BJ1H 1QACA 1YEJH 2N56A 3HMWH 1QHOA 4MS8D 1ZLUK 2EH7H 1YNKH 2QQQA 4BJLA 2DQJH 5I74C 5CJQH 3EDJA 1Z5LB 2ESVB 2HT2D 3REWA 2PYFA 2AXHA 2EO9A 3HI5L 1YEDA 4QHNA 5ESVB 5HDQH 3MROB 1FNSH 4IBLT 4JDVB 1F13A 4BUHA 1R5WA 3QNYB 4HMDA 1PSKH 4OCWL 3SKNA 5IBUG 5LGHH 4C56B 5GSVA 12E8H 4I77H 4XPBL 2GT9A 2Z93A 3PGFL 1E4WL 4I13B 1WISA 2JIXA 5IFJB 2D7TH 1CXFA 2VITB 4OB5H 3FO0L 5EZOL 2VSDA 1XGYL 2AEQL 1TQBB 2P5ED 1UZ6F 3MV9B 3MRLA 1IAIM 4HHAB 3TN0C 3AC0A 4F2MA 4NRXB 4F58H 4JR9H 4FFYL 3OKEB 2VLKD 5ITFA 3H3PL 1EHLH 1DDHA 2QKIB 4CJ0A 4DKEH 5JOFA 1S7RB 5E4IA 4PRPA 1S5IH 4Y1AE 4S11A 1OP5K 5C70A 3M17B 3BJLA 4PTTA 1LEKB 3QUZB 3QIBD 2FH8A 4UIMB 3BRGC 2BY0A 1LO3L 4OFVA 3MV7E 3MFFB 4KJWD 4HAGA 3X13B 4X6BA 1AXIB 2VOTA 3MRQB 4MD5A 3O3DA 1JP5A 5C2BL 2NXYB 1I9IH 1RVFL 2CLRA 4FQ2L 2X89A 4PP1C 4PJDE 4I9WD 1N6QH 2J7LA 5FV2A 5TFSH 1VFMA 3UTSB 5FGSA 1CFTB 1U95A 4E0RB 1FYHB 4HUXA 4HT1L 5FYJH 1EMTH 2NY3C 1MELA 5T3XE 4QWWD 2Z31A 1WSST 3LQAH 3QDGB 4HKXA 3BEVA 5JR1L 4J3OC 2VDNL 1AXTH 1ES0B 1CQYA 3WO3B 1KJ2L 1YEIL 1UB5B 4CN4A 3TC9A 4XTRC 3V8OA 3JV5A 1PG7W 1D9KC 4M6OL 2VXQL 3LAFA 1VFOA 4TVPH 4JLRB 4M4PA 3NCFB 1F8TH 3UYRH 4B50A 1VEOA 2PO6C 1KT2B 1QHPA 2BY2A 3IDJB 4WCYH 1RIUL 5I8CA 2A6IB 5BW7C 3GI9L 3T3MF 4JFEA 4R4ND 2LABA 4JQXC 3VXRD 1I3GL 1A1MA 4ZAKC 4Y5VA 1HN1A 2B20A 5J3HC 3UTZA 1OAYL 1MCSA 2IFFH 4PRIE 3SO5A 3P0GB 1J8HB 1M05A 3EO1B 4XT1C 5FO7B 4MVBD 4OLUL 1N5YL 4JY6B 2IH1A 2F5AL 3DXAA 4NKDA 2UWEE 1GHFL 1FYTD 5DJAB 4PG9A 1UACH 4MQXC 3MLUL 4J4PD 1A3LL 1QBBA 3DV4B 5DJ6A 5EULV 2AKRB 4XVTL 2IANE 4KHTL 2DLIA 5HI3D 4P57A 3T77A 3B9KA 4EZMA 1M71A 1OGAB 1MCFA 3DX6A 1G7QB 1RMFL 1UWEL 3U0TB 3JXAA 4G5ZH 1OCWH 3K2UL 4UMGA 3VD5A 3ET9F 3C5JB 1JGVL 2JCCB 3F12A 4L8SA 2E3VA 3EDDA 5IM7B 4OGXH 5BO1H 3SDYL 1GOGA 4LLUA 5DJDA 1OM3L 1EHAA 5J8OA 2EO1A 1MF2H 3Q0HA 3VGAC 4LRNH 4YXLL 4LDLB 3BE1H 5C0AE 3QIWC 4OF3A 1MAMH 5F7HA 4MDJB 4QRRA 1K85A 5BZWA 2V7NB 5GRJH 4WFGE 1OB1B 5HBBA 5FYKD 1X6NA 3QEQB 4U3CA 1G7HA 2XZAH 4X6FB 1CGSL 1EX0A 4K2UH 4XCNB 1MJ7H 3VMNA 3RRQA 4HGMA 1CVRA 1RV6X 1MFAL 3SO3B 4K71C 3QA3A 3KPQA 1IE5A 3G04A 5I9QC 3L6FA 3VH8A 1KB9K 4YUEH 2VLLB 3PV6A 3CXHJ 3WHXA 1JZ3A 1U93A 1T89A 3D3VD 4Q6IC 1HIMH 3QWQB 4NQDD 5BVPL 1JK8B 5GRYA 2ARJQ 1EFXD 5HHNA 4X9HA 4Q6YA 1II4E 1XZ0B 3EYSL 5T5NF 1DBJH 2L7JA 4PGEA 3L3KB 3V6OA 3M8OH 2Z8WC 3WUWB 1BZ7B 2BK8A 3GSNA 4PJ5D 4DUWA 5HVHC 1T20B 1HHKB 5MEPB 4Y5YB 1S9KC 2ARWA 3WIFB 4XPTL 5J11C 1F3DJ 5ANMA 4NQSB 1CIUA 3UTQA 1I7ZB 1KIRA 2WUCL 1MH5B 4PFEA 4GW1A 2EEDA 2IBZX 2OTUB 2QSTA 5HDBF 4O4YH 5IEKB 3C9NA 1WFUA 3UCRA 4MHHG 4P5MA 3GMNA 4IOSD 4Z7VB 3DI2B 5SWSA 3PP3K 2P4AB 3CSYA 1IGYA 2KQNA 2XWTB 1A14L 3ZZ1A 1GAFH 5EO1B 2I5YH 3RPIA 1NSNH 4F9LC 5D7KE 1GZPA 2W9EL 3HC0B 3L1OH 4LLDA 5A43C 4PP1D 1A9BB 2GY7B 1YEKL 2VQ1B 5CIPA 4G8GD 3TM6A 1VCAA 2CUIA 3ROOB 3VXTA 4YEEA 3FO9B 2O61B 3DYPA 1AD0B 3ZYIA 2NY3D 3SPVB 1PX4A 3D69A 4LNRA 4XP9L 3A6CL 5IQ7H 5DUML 2IG2H 4LCUB 1M7IA 5FO8B 3GGWA 5HHVL 2NY2C 3RA7H 3SJVD 3KPRD 4Z7OE 4HWEH 2GJ6B 1A9EA 4O58L 4L9LB 4LSDA 4XTRD 4XPHH 4GKNB 1D9KD 4M00A 4OCXH 5T3ZD 3EOAA 3RWDB 3TIEB 3DX9A 5F71A 3MUHL 4QRQB 1R5VB 3D25A 4HUUA 4JAMA 1AO7B 4R0LC 2PO6D 1EVUA 4ZSOB 3HG1B 5DD0H 1K2DB 3L7EA 4Q9BA 4EDWL 2QLVB 3TT1L 3ZO0A 3VFNB 2HYMA 3ARGC 2IAMA 4YJZL 3O4LD 1F4XL 4ZOCA 1MVUA 1XF2B 2UZIL 4M7LL 4DGIH 2HJFA 3L9RB 4P9MH 3RVUC 3QCUH 5AG9A 3B9VA 2H8PB 1KTLA 5E56A 5EG6C 4DUVA 4UUJA 2BFVH 4X83A 1IAOB 3BGMA 3IFOA 1LD9B 1ZOXA 4HQQL 1RJLA 1B2WH 4MQXD 2GSIA 2ZSWA 2GKIA 1A64A 4PJGB 4GG8A 3BPLB 1J1OH 5ADPL 3BAEL 1VGEL 2QADC 1K8IA 4ENEC 3SBWA 2WK2A 3VWJA 1FORH 4K8RH 5FECA 2BNRD 1CDGA 4X4XB 2OSLA 3CX5K 1CLOL 1E6OH 3NAAH 1UEMA 3P77A 5F7KC 3TBYB 3MLTA 1CGXA 4G9FD 3VFGH 2NY5L 1WTGT 3HZVA 3MLXL 1UENA 1Z9SA 2B4CH 3CC5B 2I27N 4AYFA 1FNEB 1SM3H 4Z78B 1RZKH 3MJ9A 1ACYH 2PCPB 2P46B 1U2CA 2YD7A 3QIWD 3FQXB 2RFXA 2ITDA 1Q9WA 3GMLB 1T1ZB 3Q5OA 2DM2A 2R0KL 1IKNC 2IF7A 1QRNB 4TUOA 5IB2B 1UJ3C 3OAZH 4ZOEA 3O8XB 1MSPA 4PJ8A 1IRAY 2HKHH 4UAOB 4WTXA 4PPTA 2J6EA 3OJMB 5IVOA 4ORZC 1WBZA 3TJEH 3L5IA 3V8CA 2CKBA 3ULUE 1UM5L 3AY4A 4JKLA 3STLA 3WCYA 2NY0C 4UV7H 4MQTB 3R4DA 1F4YL 3FO2B 4JPVL 1TXKA 1B3JA 4AZ8A 5F7YC 5EBGA 4OTXH 1TVBB 1IM9B 2EKSA 3G5VA 1YEHL 1CICB 3BPNB 2WWKO 1ZMYA 4CMHC 2VKWA 3PWPB 4KZDH 2YOCA 5E8PA 1OP3K 3G5ZB 4XAWH 3LEXB 3LRGA 3QUKA 1WWCA 3LHPL 3MA7B 2BDNL 1U9KA 4KRNA 1KNOA 2OJEB 3ZE1E 2UY7A 1QP1A 4HKBB 3HR5B 4MD0A 4DK6A 2A6JA 1C5CH 2EE2A 4AK1A 3ZSSA 3NFPB 2EICA 4KKAC 4U1NB 3A0OA 2Y36L 4PJXB 2E7CA 1C08A 1TJHH 2VISB 3CH1B 3V6OC 3Q6FA 2ZKHH 2ED9A 5SV4A 4WNQB 5BOZG 3C8KB 1QVOA 4ZTPL 1MEXH 3A6BH 2IPKB 5EN2A 3W0WE 2CUMA 1ZLSH 2IEPA 3QHTC 2VLJB 1U8KB 4KI5C 3RWHA 2F53E 2W9DH 4LCYA 2EDLA 3B5HA 4M02A 3CFIC 5DJXA 4NP4H 2VLKE 2JJUA 1KTKE 3MLRL 4R7DB 3GSWB 4HX1A 4BSJA 2WQRA 4FQLL 5DVLA 4D2NA 4YX2H 3V4VL 3VE0A 3S35L 2NY2D 3CFJB 1KCUL 5F97E 3IDYC 3VU2A 5MEOB 2XY2A 3DOSA 5CMAA 2D4FA 4NUGH 4L5FH 1Z5LA 2UVEA 1R6VA 4Y4HB 5T1KB 3CK0H 3ARDB 5D7LE 2ZWLT 4WEUD 4I3RL 3MROA 4YEFA 4JDVA 3FB7B 1BQLH 2VDLL 3VGEA 1I7TB 1YEEH 1IC4L 1SY6A 3QNYA 4I9WE 5C3TA 5HYSA 4M7ZB 3TT3H 4NBZB 5DEZA 4LPTA 2BRQA 3ARGD 3MOAH 5IFJA 1BD2D 2VITA 3S35X 4FFWC 5FA4B 3MBXH 4GXUN 1F00I 2MCPH 4OZFA 3RVUD 4QOKD 3MV9A 1HHJB 2FJHB 3I2CL 2FCBA 4HHAA 5E1AB 4JHBA 5TDPB 4NRXA 5C09B 5FUZH 2CIKB 3M1BB 1KLUB 2QKIA 4GQ9H 3X14A 1S7RA 2C3XA 1N8ZB 3P4LA 4S0SD 5TPWL 2XN9D 1AJ7H 1RUPL 1LEKA 8CGTA 3QUZA 4UIMA 2AJSH 3S97C 4JRYB 5DURB 2R2CA 4V1DB 1AGCB 1ED3B 2QADD 3FT2B 4N1CA 4ENED 3RIAF 1MI5D 2EDOA 1J1XL 1A7PH 2IAMC 2BZDA 3AVEA 2D7MA 1BBDH 3MFFA 2A73B 1KN4H 5IP4A 2YC1B 3VXRE 3MRQA 3NZHL 4Y19D 5I16A 4TUKL 1NANI 2ED8A 2WWMC 1IAIH 3DX7B 3JWNC 4PGCB 2DI7A 3FB6A 5CEYB 3NA9L 5DD1L 1YJDC 1DEDA 4PR5B 3TYGH 4CU6A 4Z7VF 1DLFH 1FYTE 3DUHA 3UTSA 5KVDH 4D3CL 4RFOH 4KFZC 3STZB 3BN9C 5IBUB 5DJ0B 2QQLH 3WNPA 4JE4B 3QDGA 2C9AA 1YMMD 2VZOA 3VWJC 3VG0H 4F37F 1UKTA 4NHCH 1ES0A 3PQYB 4OCLC 3IDUA 3AREB 4YK4C 1UB5A 3ARSA 2O5ZL 1VADB 3MPCA 4K9EL 8FABA 1MCIA 5DC9B 4X98B 4HC1H 4WV1B 2LU3A 3KYAA 3W9DA 3MRDA 4JLRA 1YQ2A 1YECL 5FO9B 1KT2A 4YWGL 3HNSH 3IDJA 4KHXL 4C59B 4PY7B 2A6IA 2NY0D 3WEXB 3VMPA 3ARWA 4DN3H 1YEJL 1BF8A 2APXA 2EDYA 1FGVL 1GOHA 3HMWL 2EH7L 1YNKL 3CD4A 2DQJL 1J5OH 4PJHB 1FHGA 1J8HA 3EO1A 3N85H 5FO7A 3HZKB 1IMHC 4JY6A 1T7VA 4FG6C 4KRPD 5D7IB 2R0LH 5FYKE 5HDQL 3P0VH 1FNSL 3LKQA 5DJAA 1CYGA 5C8JB 3MXWH 1PSKL 5D5ME 5LGHL 12E8L 4I77L 3F7QA 1JGEB 3L7FA 1XGQA 2D7TL 3PWVB 4OB5L 2JTDA 3D85B 3WNNA 4LP4A 1FAKT 1G7QA 3K0WA 3D3VE 1FFRA 4NQDE 4KKAD 5E94B 2HT3D 4I18B 5I8KH 1YEGH 3VFVB 1K8DA 5JQ6H 1KSRA 2HLAB 1EO5A 1MUJB 1L6XA 4PJGF 3C5JA 3CSGA 2M1KA 4F58L 1RD6A 4JR9L 1EHLL 2CUHA 4DKEL 5IM7A 4LPUA 4Q0XH 2HWZH 1S5IL 4A6YB 4UT9H 1P6FA 3MRHB 3T3PE 4PJ5E 3WFEH 3CSBA 3GSUA 3JWDH 4ESKA 2HN7B 3C8DA 1MCQA 4TUJA 1OTTC 5GRUH 1O5DT 1MHPH 4KI5D 3LKNB 2RJMA 5C9KA 4PJBE 4M03A 5E4EC 1T83C 3CFDA 4K7PH 4MDJA 3TO2A 4L3ED 3LSOB 1IQDA 3BFOA 1F97A 3AS0A 1UYWH 1WFOA 1J0KA 3C60B 3QEQA 4YHMH 2BOBB 4X6FA 1I9IL 2R1WB 5IROC 4XCNA 5BVJB 1N6QL 1C5DB 5TFSL 4XNXH 2VZUA 4LCWE 2ZCLH 5FYJL 1EMTL 4JZNB 2VLLA 1P4LA 4Z7WF 3LQAL 3D0LB 1IZKA 1D5BB 1AXTL 1KPVB 2FEDC 4X9GA 3LD8B 4PS4L 1T2QH 3BQUB 4G8GE 4HFWB 2B5IC 3MUZ1 2FO1A 3L3KA 3K3QA 4ETQB 4F7PB 2ZUTA 1BZ7A 5L2KE 3BDXA 4FFWD 4PJAF 1CL7H 1F8TL 3UYRL 1T20A 3LY6A 4WCYL 5MEPA 1OAZH 4Y5YA 1DN0B 3GMMB 3SJVE 3GKZA 4PJFE 3RBSA 3DYOA 1QO3A 5E08H 2WNGA 4NQSA 1I8IB 4LPXA 5T3ZE 1I7ZA 1RFDH 3KLAB 5FHBH 5J1AA 1G9MH 1MH5A 4MNQB 1UADC 2OTUA 2IFFL 5IVNA 2D0HA 4NGHH 4ZO9A 5IEKA 2ICWJ 2Y7QB 3TFKD 3O4OC 4U0QB 4O5LH 5K59E 2X4QB 1AGFB 4Z7VA 3HHRB 2CO7B 2ICEB 1UACL 1ZE3C 2WQ8A 1H3VA 1I1RA 2C5DC 4XPGH 4FTVE 1OW0A 1IZJA 1FL6B 5IMLB 1NH6A 2XWTA 3O4LE 1TQBC 1BHGA 4JKMA 5EIIA 4X6EB 5EO1A 2WWMD 2EC9U 4ERSH 1JMXA 3QQ4B 4LKCB 3R06B 3INUH 5D7SH 5KVMC 4QHMA 3HC0A 4PJXF 2MCG1 2A6DB 1A9BA 4LLVB 4JPWH 5EZIH 3ZKQD 2VQ1A 1S78C 3ZDXE 3ROOA 1A1OB 4WJ5B 2J6EL 4G5ZL 5C07E 1OCWL 1FLTX 1QYGH 2AJYH 3FO9A 2O61A 2J8HA 3BN9D 3SPVA 3MJ6A 4J3XA 3HRPA 3EFFB 4OGXL 5BO1L 4LCUA 3VWJD 1ZKAA 5IMKB 3GHBH 4D0DB 5FO8A 5C0BD 1VPOH 4JHZA 2ATPA 1MF2L 2GJ6A 1FCCA 3VFMB 3WMSA 4L9LA 2BNRE 4LRNL 4GKNA 1XFPA 4HZAA 2C4FT 2P5WE 3LKRB 3TIEA 3BE1L 4DKFH 4PJ7E 1MAML 1R5VA 1QOKA 3C6LB 4G9FE 5MEND 1AO7A 5GRJL 5F9WB 5ALBH 4ZSOA 5JXEA 3HG1A 2E5EA 4MJ5B 3S3SA 3MLSH 2XZAL 4K2UL 1MJ7L 2AV7B 3RIAK 3VFNA 3G6AB 2OL3H 3ZKXC 5FYJU 3QFJA 4L4VD 1NC4D 3L9RA 1JE6A 5GPRA 3ZT6A 5MEQA 4YUEL 4FG6D 1BQHG 2FBJH 1HIML 3KYKH 3T1FA 4MAYD 1IAOA 4UNTA 4X7SH 3KS0J 1P2CB 1D6EB 4RQQA 3V9FA 4GRMB 3QJHA 1X4XA 3IDGA 4UU9B 4PJGA 2BHZA 1DBJL 4YDIH 3DX8B 1F5WA 3O6FB 3M8OL 3GEWB 4JM2F 4OM1H 5H37H 4POZC 1ORQB 4FOMA 2D03H 3HE7C 1FH5H 3RAJH 2NY7L 3VRJB 3SE4C 1J7VR 1JN6B 4X4XA 4V2CB 2CMRH 2KQMA 5ECJE 3TBYA 5TF1L 5DVKA 3K1DA 2DWDB 1UVQB 2DAVA 5E03A 3T0AA 1D5MB 1NPUA 5D93B 4O4YL 1OTTD 4Z78A 2I24N 2OP4H 3RWJB 1DR9A 4EUPG 2PCPA 2FSEB 3I6LD 4X80H 1T5XB 1JYWA 2F8XC 1T0PB 3FQXA 4LBEA 1MCWW 2OBGA 3F7PC 3GMLA 1T1ZA 1CGVA 5I8EA 1GAFL 1X5JA 4YHPB 2I5YL 4Z7WA 1NSNL 2LE9A 1I1FA 3L1OL 4NZDA 5HGAA 1QEWB 1GGUA 3S5LA 1TJIH 4BQCA 1SEQL 1W72H 4HXAH 1T2XA 1UKSA 3DO7B 3HRZB 3BHBB 1PGRB 5I73C 4PV8A 4P2QD 2RGSA 4PJAA 4RNRB 5DGQA 2F19L 3FO2A 5IQ7L 1FNGB 2IG2L 3GI8H 4KKBC 4I4WA 3RWEB 1QFWM 2FEDD 1VFUA 3RA7L 3SDAC 3L3IA 4A6YH 4HLZG 4XNZC 3DVIA 4HWEL 1IM9A 1OTSC 1JPTH 4NRZB 4ONOA 4XPHL 1CICA 4OCXL 3IVKB 1OAXH 4RRPG 2ENSA 5GS2D 1U6AH 6CGTA 3PWPA 3BSZH 1ZS8B 3G5ZA 2M2DA 4M7KH 1WIPA 5DD0L 1S7UB 3MA7A 3KYOA 5F88B 3NFSH 1LO5B 3ZT5A 2OJEA 3BX7C 4HKBA 1WC7B 2IPTH 3MCLH 3HR5A 3CZFB 4PJHF 2A9NH 1WV7T 4UOJA 5D7IF 2DMBA 3QI9D 1BECA 4OQ1A 5ETUB 4DGIL 4GAGH 2YA2A 3B83A 3NFPA 4P9ML 3QCUL 4U1IB 4U1NA 4XC1H 3MRJB 5D2NB 3SDXB 4PJXA 3FT3B 2XTJC 2LAAA 2VISA 3CH1A 2BFVL 4WNQA 2IJ0C 3C8KA 2UUDK 2IPKA 3N1FC 5I1CH 1SMOA 4RGMB 3O81A 2F74B 1S7TB 3V6BR 1J1OL 1RZ8B 4P3DA 2CSPA 2NY1B 1U8KA 4WGVB 5ACMA 1NJ9A 4ZTOL 2VXSH 3IKCB 2MKWA 5CP3A 4TULH 1FORL 2JE8A 4K8RL 1S78D 4PJEB 2J8OA 4F80A 3U7YH 4Y7MA 3GSWA 5E95B 3CX2A 1E6OL 1MJJB 3NAAL 4HV8B 1P53A 4JVPA 2EDEA 3VFGL 2B4CL 1MOEA 4U1GC 3CFJA 3GBLA 3TO4B 3FAWA 5MEOA 1MI5E 3IJHB 3P4MB 3QBTB 5I1LA 2GTWB 1OW0C 5FKPB 1RZKL 4Y2DB 4PUBH 4Y4HA 1ACYL 5T1KA 5LWYL 3LB6C 3ARDA 4HG4J 1J86A 4Y19E 4APQC 4P3CH 4WUKH 1DEEB 4HWUA 3FB7A 4OFIA 4AEFA 3DXAE 1I7TA 1T22B 4WWKB 2ZJSH 3NCMA 5FHAH 3THMH 3WS6C 4EI5C 1K3IA 1RZFH 2BVOB 4DVBB 3VXMB 5IG7A 5HPMB 4HIIA 3BOVA 2HKHL 5I76B 1I4FB 1TTGA 4HGKC 3TJEL 1YMME 4KJYB 5F89B 4ZFOA 1HHJA 4UV7L 5DJ8B 2FJHA 2AK4D 5C09A 3UTOA 2CIKA 3M1BA 2XKNB 1KLUA 1ORSB 2WP3O 4U6TA 1N8ZA 1HXYB 4OTXL 4BFIB 3IXTB 5JXEC 4IRSC 3MLZH 5FFLA 4PLOB 1PEZA 1JTOA 5LGKA 1KPRB 4X4ZA 4POZD 4V1DA 1P9MA 1AGCA 1FZOB 4KZDL 1GGYA 3HE7D 4XAWL 4HUWB 4ZYKA 1DUZB 3HC4H 2A73A 2M26A 2YC1A 5H37G 3RX7A 3DVNB 4W4OC 3L5XH 1I1AD 4PGCA 4FRWA 2WBWB 5CEYA 1C5CL 4PR5A 2EIBA 5L8LB 3SGEH 2NTSP 1H8OA 1YNLH 3D2UA 5IHBA 5DO2C 3MLVH 3S98A 3STZA 1TJHL 1H3PH 2CO6B 5DJ0A 2ZZUT 4ZDHB 3R8QA 4MXQC 3QWRA 4YDKH 3IB4A 1MEXL 3A6BL 4HULB 3LRSB 3AREA 4QHKI 4WTWA 3NPZB 5ERWB 1ZLSL 4Z77B 1UZ6E 4OLYH 1VADA 3D18B 2W9DL 1MWAB 2GY5A 4X98A 2G5BB 4WV1A 3V6OE 1OGTA 4NP4L 3S9DB 1L9MA 1MHHB 2ZUQB 5FO9A 5J13B 5GSRB 5I30H 3WEXA 3VXSB 4Z7QE 4YX2L 4UB0H 4KKBD 3SKOB 3ZLQC 4KI5E 3SDAD 1QSZA 3CMGA 3B6SB 3SKJH 1OTSD 1B0RA 1DBAH 4NUGL 4PJHA 4X7CC 4L5FL 5JW4N 4LVOC 3HZKA 3DURB 3CK0L 5D7IA 1U3HB 2BC4B 3O2DH 2DQHH 3HI1B 3VD7A 2KH2B 1BQLL 4QCIB 1A7QH 1YEEL 5KZCD 5DS8B 1R3LA 3EDEA 3TT3L 4EJ1C 1WF5A 4RGNB 2UYLA 4ZNEA 1JGEA 4EXPX 3MOAL 2VR4A 3PWVA 4HS8H 3D85A 1A3QA 3MBXL 4KAQH 3OHXB 5F3HB 2MCPL 5E94A 3WKMH 4I18A 3VFVA 1Y18B 2HLAA 4IIQB 3P30L 2XTJD 1MUJA 5FUZL 2J12B 4M1GH 5ICXB 4GQ9L 5JXAH 4A6YA 4C57C 4GKSB 3OG6B 2FX9H 1P4IH 1AJ7L 1WAAF 2DL2A 1CDUA 3MRHA 3TZVB 1DN2A 4FA8A 2PYEA 1BLNB 3HI6H 2AJSL 3GSXB 2Z8RA 1AP2B 2G75B 1G6RH 3QCVH 2KBGA 4ACPA 3A67H 1A7PL 1OWRM 2D7QA 2O5XH 1BBDL 4MLIA 4Z8FL 4N90D 4AENB 1KN4L 3IGAB 1ETZA 3LSOA 1CFQB 3K8LA 1BEYH 1SBSH 3C60A 1IAIL 2BOBA 4GUPB 5EBMB 1UCBH 5HDLA 3WYRA 4HFUH 3TYGL 1B6UA 1C5DA 2ZUWA 1AHWB 5AD0B 2YK1H 1DLFL 5KVDL 4ZFFB 3G6DH 2IQAB 2KUTA 4RFOL 4QT5A 1UM4H 3WJLA 4JZNA 4NQXB 3LB6D 3RI5F 5FM5O 2QQLL 3FRUB 3ZE0F 4APQD 4PRHD 4MWFB 1U92A 3D0LA 3VG0L 5C9JA 5IEHB 1D5BA 1KPVA 4NHCL 5D6CB 4EI5D 1W0VB 1TJGH 4X5WB 2YMXH 3RUGB 2R1YB 3BQUA 4S2SB 4F7PA 1NBYB 2AAVA 4HC1L 1N2RB 5I1EH 4QLRA 2VZ1A 3RTQB 4FQPA 2E6PA 4FN0A 5IHUH 5FB8A 2B0SH 3HNSL 2GJ6D 1F3DH 1DN0A 3D39D 3GMMA 3U83A 1W0WB 4IDLA 4DN3L 1WT5C 2YRZA 2X2YA 3MOBH 3KLAA 2ADGB 5KSUB 4JCLA 5E8OA 4PG2C 1J5OL 5JXED 4IRSD 3VI4F 4L8CA 2Y06H 3GNMH 1LK3H 1TDQA 5IW1A 3N85L 5MENE 3GSRB 4TYUA 5AYQA 2Y7QA 5F1KC 1HNGA 4QGTA 1EO7A 2X4QA 1AGFA 3P0VL 3CIQA 1SVCP 1E0OB 2ICEA 1X5AA 3B8SA 4FZ8H 3QFJD 4RMTA 3MXWL 1AC0A 2DIBA 3DTXA 1FL6A 4JPIA 4U2ZA 4U1SA 1N4XH 4JM2C 3DRTB 4YXKL 2OR7A 5B3NA 4LMQI 1H15A 3QQ4A 3SDXF 2A6DA 3ZHLA 4LFHD 5K93A 4WENB 3U9PH 5I8KL 1A1OA 1YEGL 4WJ5A 1NC2D 5DO2D 5JQ6L 5MHSD 4LCIH 1KIUA 2H32H 1VESA 3FOMB 2GSGB 4K3DH 2AI0L 2AGJH 3EFFA 1P9MC 4MXQD 4Q0XL 2HWZL 5I66B 4D0DA 2V9RA 1WIOA 4UT9L 5D7JB 2OTWB 3WFEL 3JWDL 3MV7B 1K6QH 5GRUL 3VFMA 2ENYA 3LCYA 3MA9H 5J0BA 1TZIA 1MHPL 4PJEF 1G9NC 1JNHB 3LKRA 1EPFA 2J5LB 4A2LA 3AFLA 4K7PL 1B9ZA 4K07A 3C6LA 5TE4H 2C1OA 4XWOC 5HDBE 1JWSB 1UYWL 3PL6B 1I8LC 4YHML 1HSBA 3RZWA 1SQ2N 1DFBH 1OD7A 1IQWH 4ZFGH 3G6AA 1CTNA 1UCTA 1NGZB 2NX5D 2JF1A 1WQVT 4XNXL 4FABH 3E1F1 1XT5A 5F8QC 2ZCLL 2V9TA 3REVB 4XZUB 5EBWB 2LFGA 5ICZB 1ZANH 4MGXA 5C1MB 4K7PX 3ARFB 2BVYA 4WU7B 2H9GB 2JJTA 4WU5B 1P2CA 1D6EA 4Q74A 5I6XB 3MRRB 1IEHA 4Y8DC 1JF5A 4MCZB 3LH2H 4UU9A 5D71H 1T2QL 1RUAH 3DX8A 3CFEB 1ORQA 4ZO8A 4R6UA 3MRIA 1E6JL 1WAAA 2XNAB 4GG6F 3L3GB 4P2QE 3VRJA 1QR1B 1NAKH 1TQCB 2BOCA 1UM6L 1JN6A 2IMNA 1OAZL 4JFPB 3WFHA 2CJUH 5E08L 3QQNA 5C0DB 4X9IA 4R2GC 1RFDL 4IS6A 1UVQA 5FHBL 4JO1H 1G9ML 2V2XB 5E2WH 1D5MA 2UWEB 1X5YA 4CDGC 4NGHL 1S3KH 1LE9B 3SGJA 4NJ9L 3RWJA 5CBAA 4O5LL 2FSEA 4AG4H 1DE4A 1T5XA 2IBBA 3JTSB 4XPGL 4WWID 5I15H 2XYCA 3DJ9A 4OIIH 2V2WB 4DEPB 4YHPA 1VFAB 2EXYC 2MQ0A 4ERSL 5D7SL 1RZIB 5GS1B 3INUL 3QSKB 3JUZA 2QL1A 3QZWG 4MMXC 4JPWL 1BQHB 1YNTB 4OIBA 4RMQA 4Y4FB 5EZIL 4DOHE 3NIGF 2IFGA 4JFDB 4HK3N 3DO7A 3HRZA 4N8PA 5HGHA 4AT6B 3BHBA 1QYGL 2OI9B 4F8TA 3QB7C 1ZVSB 4RNRA 3N1MC 3MV9E 1FNGA 2BSTB 2D7OA 4DW2H 2V9QA 3GHBL 3RWEA 5JDJA 2YXFA 2YUWA 3UROR 1VPOL 4TRPH 4OZHB 3CGTA 1NAMB 3EO9H 4NRZA 3IVKA 4X8XA 3BIBX 1TCRB 3VGDA 2AS5M 1F2XK 4ZMAT 1ZS8A 3MQIA 4GRWH 5IW6B 2OZ4H 5ALBL 1S7UA 1WBYB 1QFUH 1Z0NA 3MLSL 2APTA 4JFHD 1OOAA 1WC7A 1EHNA 3CZFA 1JZ8A 1X3DA 4EOWH 3PWUA 2W9LA 2RBLA 1BVKB 4PD4K 1QFWH 5ETUA 5HI4C 4U1IA 1L0YA 3MRJA 3SDXA 2DF3A 3FT3A 2FBJL 3KYKL 3KJ4C 4X7SL 4LCCA 2MWCA 4GJTB 1VEPA 4X5XB 3QDGE 4ORGA 4JM2D 2F74A 1S7TA 4LQ1A 1AQDB 4YDIL 1RZ8A 4O2CB 4OM1L 1BBJB 2RCSH 3TA3B 1LO0H 2D03L 1FH5L 3RAJL 3IKCA 1X9QA 4CJ1A 3MYZA 4PJEA 2CMRL 1MJJA 2CR3A 4HV8A 2DQGH 1QFOA 4WO4B 5DT1L 4K9EC 4RMSA 4YHNB 2ICWB 1Q0YH 3BO8B 3IJHA 3VFTB 5FKPA 1KB9J 4Y2DA 2OP4L 1JNJA 5LBSH 2C7UB 4X80L 3FAXA 1RZ7H 4XNYH 3P4OB 4BSWB 5DJ2B 1DEEA 1XR8B 4JQVC 5KVGH 5HVGB 1GGBH 1T22A 4WWKA 1E4JA 4XWOD 3D2UD 4ZODA 4JFXA 4WI8A 2BVOA 4DVBA 3VXMA 4EN3B 3UBXG 1WWBX 4K7FB 5HPMA 3EAKA 3QXUA 4U6YB 1TJIL 2JJSA 5I76A 3IFLL 1W72L 1FE8H 4HXAL 1I4FA 4LPCA 2RR3A 4KJYA 5F89A 5DJ8A 1FO0B 1EGJA 4GG6A 3VWKB 4YDLC 5EU6D 4WY7H 5J12B 1OAQH 1XMWA 2DLTA 3GI8L 1MCDA 2B7DT 2WW8A 2XKNA 3OF6A 4PJ9C 5CZVH 1HXYA 4A6YL 4BFIA 1XCQB 3IXTA 4G6FD 4JDZB 3A6OA 1JPTL 5CBEB 1XIWB 1E4KC 3NPSC 1OAXL 3L5JA 1U6AL 3ECBB 3BSZL 2DQEL 1EJOH 3KAAA 2WAHA 4HUWA 2MOVA 4M7KL 5MI0C 4OF5A 1DUZA 4J23A 1OTUC 1S7XB 3IJSB 3NFSL 3DVNA 1SBBA 5CJOH 1KPUB 1KELL 3BZFB 1KF9B 2IPTL 3MCLL 1LHZA 5T1LA 2A9NL 2JKXA 4R2GD 3QEQE 3VFOB 5FOBB 2LTQB 1PZUB 4PLJC 4GAGL 1XF3B 3Q1SL 5T3XH 4XC1L 3E6FA 4D9LH 3OWEA 1XEDA 2O5YH 1BP3B 2EE3A 5F8RC 4ZDHA 3UTTD 1U91B 4X6CF 3HN3A 2XA3A 2AQ1A 3JV4B 4LF3B 3RPKA 5I1CL 5DWUH 3R0MA 3NABH 5ERWA 5ISZB 1A6TB 1E28B 2EXYD 4U0RB 3D18A 5H35B 5MERB 4OKVB 1MWAA 2VXSL 1RK1B 2G5BA 4NPYB 2XTJE 4Y5XB 4TULL 1V8HA 3MUY1 1MHHA 3U7YL 2PYED 3SGJC 5GSRA 3VXSA 5HYQB 3U7AA 4YNYA 1RUQH 3SKOA 5C08A 1JHKH 2F54D 1NUFA 3B6SA 3P2TA 1MCKA 3NZ8B 4N90E 4HS6B 2AEPL 4PUBL 2EE6A 3DURA 1ROWA 2NY4B 1U3HA 2PR4H 4P3CL 1NCNA 4Z7UE 2YUXA 5D2LE 4WUKL 2BC4A 5ENWB 1INEH 3HI1A 4MYWB 5E8DH 5SWZB 4QXTB 4QCIA 5ID0B 2LV4A 5DS8A 2ZJSL 1QLEH 5FHAL 3THML 4HIXH 3HLAA 3NCEB 1RZFL 3C5ZB 5CUSH 2V5YA 5B8CA 2CXGA 1I8MB 4TSAH 1LEIA 1BJMA 1IC1A 3CX5J 1RHHA 3OHXA 5HI4D 4YDVB 5KG9B 3B9DA 3IS0X 5IUSA 3SN6N 3ZYZA 3AS2A 4IIQA 5D96C 2QSCH 1NLBL 1FSKC 4N0FB 5ICXA 2R2BB 5E99H 3P4NB 4GKSA 7FABH 4U6XB 4KTDH 1F45A 3CDFA 1HCFX 3MLZL 3LDBB 3BUYB 1AP2A 2GJ6E 2A74A 4HPYH 4N8CH 3TP4A 2MQ3A 4NQED 1NUGA 3HC4L 1WWAX 1VGKB 4XCCH 5BV7H 4AENA 3IGAA 1EEZB 4AY0A 1CFQA 3PIQA 5FYLD 1AO7E 3L5XL 1IGCH 3HG1E 5D1ZC 4GUPA 5EBMA 4G80B 1FBIH 3HFMH 3L95B 4Z7NF 2NW3B 5JIIA 4LCCC 1AHWA 1F4AA 1YNLL 5AD0A 4ZFFA 1TZHB 2IQAA 3QFJE 2P44B 1I3VA 2EEAA 3MLVL 1XGUB 4FQIH 1H3PL 4N68A 4IM8A 3FRUA 2NY1C 5CEZD 4MWFA 4YDKL 3C09B 2P5EB 4K23H 3UZVB 2Q7NA 2VKXA 3SE9H 1U3YA 4LSQH 4NBXB 2FNBA 1W0VA 4P4RB 4OT1H 4PV9A 4X5WA 2R1YA 4OLYL 2VLKB 3B2VH 3EO0B 3WJJC 2YWZA 5IOPB 2IBZY 4PJGE 1NBYA 1N2RA 2D7NA 1FZKB 3RTQA 3QIBB 3GDBA 4LK4A 3V0WH 1QFHA 2YKLH 4L8BB 4K3JH 3FHQA 5I30L 5C71A 4QTIH 2O26U 1W0WA 4LLAA 2BNQD 4OZHF 1A4JB 1E27B 4UB0L 4XHQA 3N1QC 1RIHH 1DP0A 1W2KT 1A1NB 4PJ9D 4N0CC 2ADGA 5KSUA 3DLQR 3SKJL 1DBAL 3F6LA 4Z5RB 5B21A 5KSBE 4KPHH 3OGOE 5DMGC 5B3JE 1T21A 1Q0XH 3BMVA 1JGDB 3O2DL 2DQHL 3CUPA 2D0GA 1A7QL 2JJSC 5JUEH 2HKFH 1OTUD 3C2SA 2Q8BH 4EDXB 1LO2H 2XI9A 4R90H 4C4KT 1KOAA 1HILA 4X6CA 2CH8A 5LGJB 2XIDA 5FAAA 4H5SA 1MCWM 4Z7WE 2APVA 4HS8L 4POYA 1DLHB 4LAQH 4GAFB 5FCSH 4PLJD 2Z35A 3FHAA 2MTPA 4KAQL 2I26N 2ORBH 5I18H 3WKML 2L7UA 4H1LG 3FOMA 2GSGA 4M1GL 3WLWC 4JGJA 1JYXA 3PP4H 1EEYB 3EDKA 4U6HA 4XH2B 5JXAL 5I66A 1BOGB 4PJAE 5CKGA 5D7JA 3V5DB 2OTWA 3MV7A 3HI6L 4JB9H 5FYJD 1UQSB 3T0DA 1BIIB 2P42B 1G6RL 3UJJH 5GS0C 3QCVL 3VXRB 3A67L 2EKJA 2O5XL 9CGTA 5EC1B 3O2WH 4FQCL 1NFKA 3WNMA 1SBSL 4J8RB 4NN5C 1G7PA 1FYTB 3ETBF 4GW4B 1UCBL 4OBSA 4HFUL 1WVZA 4CDHA 4TVPD 3R8BB 1NGZA 4Y2OA 2YK1L 4R4BB 3G6DL 1CDIA 3LEVH 3REVA 1UM4L 5EBWA 2VAJA 4P23C 5ICZA 3KS0H 5CD5C 1B6DA 1V3LA 3ARFA 2MHAA 4PJXE 4WU7A 2H9GA 4WU5A 2GK0B 2IBGA 3MRRA 2IADB 4N8VG 3DSFH 1TJGL 4MCZA 2GJZB 4NN7B 5J13C 3QNXA 4GAYB 3AU1B 5I1EL 4Z7OF 2XNAA 3L3GA 5EUKB 2XPGA 1QR1A 4YGVB 3U36B 2EDNA 5IHUL 2B0SL 3OKKB 4RAVA 4JFPA 2FWOB 3ULVF 5C0IA 3F7VB 1ZSDB 3BXNA 4K3HA 1YMHB 4WEBH 3WD5H 5C0DA 5GXBB 3S3PA 1BWMA 1MIEH 2V2XA 4K8RC