1FNEA

Histocompatibility antigen
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
182
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional consequences of altering a peptide MHC anchor residue.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords PROTEIN (MHC CLASS II I-EK, ALPHA CHAIN)
total genus 38
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fneA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1fneA01
4JFFA 1P4IL 4RFOH 3RAJH 4H8WH 3MLYH 2L7UA 1J05B 3X17A 5F1IA 2VL5A 5BXFA 2IH3B 5B21A 4EI6A 4NZRL 4PP2B 1B2WL 3MRBB 1C5CL 5JW5A 1UCBL 2IADB 3OKMA 4P2CG 5HHQB 3UTSB 4YAQB 4HLJA 5F1IB 1AGBB 3HC4L 3BKJH 2D7OA 1FN4B 1MLBA 4KRMB 2BSED 1IC1A 3NN8B 3FN9A 1XGQB 1LGVA 3GMLA 2HT2D 2PYED 3WNKA 5J3HC 3SGEH 1KENL 2R2BA 4U1HB 1A6VH 4YGVA 1HEZB 1CDIA 4OM0H 1MRCL 1T03L 1XH3B 5D1XA 3OGOE 3WBDA 3ZYIA 2QSQA 4G42A 4WTXA 4CW1A 4ZO8A 1ZHNB 5ADPH 1NEZA 2GAZB 1P7QD 4A6YB 2R4RL 2YRPA 3RNKB 4LCIL 1DSFH 2WM0A 3SE8H 3QFJB 1HI6A 2I9LB 3H9SA 3OKNB 3QUZA 1KTDA 4Q6IB 5SX4I 2F8XC 3D1MC 4N8CH 4LSTL 3AY4A 2YMXH 1MFDL 3HUJA 5IMKA 1CFNB 4LLUA 1IEBB 5TE6H 5D1ZD 4MB5A 4YHMH 5JHDB 4ODXA 3C5ZA 3BIBX 1YEIH 3OKYA 4LGRB 4U6XB 3CSYB 3MRJA 4XPFH 1J9CT 5HYSB 5F7FA 3FAXA 5FK9A 1ZANL 5D6CB 4O2FA 5E2TL 1OP5K 4Z7WB 1SMAA 5I74C 3HUJF 2GJZB 3EGSA 5E2UH 2I07A 1Z5LB 2QTEA 3EHBC 1I8KA 1NL0H 5B38A 4N0UA 4A2MA 2D9CA 1MHCB 2FX8H 5E94B 2DQHL 1OPGH 4I0PA 2A6IB 5DZOA 1U8PA 2R0KH 5E1AA 3IF1B 3EYQC 4PJHB 3RJQB 2HKFL 5BMFL 3QXAA 4MA1B 4UDTB 1XMWA 3VE0B 5EBGA 3S88H 3D39D 3V4UH 5T33L 2C3GA 2EIDA 4OLXL 3QULA 3UZEA 1BVKB 4GLRI 4X7EC 3IFNL 2L4OA 5F9AC 35C8H 4JN1L 1JF1B 5KVMC 1MFNA 4TOYH 5IW6A 2IH1A 5DK2B 4XB7A 5EBWA 1ZAGA 1CT8B 2VWEC 3F65A 4HUXB 1R24A 4DN3L 5IMOB 4KPHL 4X7TA 3MZGB 1CICA 1BM3H 2VXTH 5GJTH 3WIIH 5F6IB 3C8KB 4CUCA 2IEPA 3UEZA 1HQRB 2V5YA 4LPTA 1JYXA 5EA0L 4QRRD 1KG0A 4WW1A 4Z7VB 1CIUA 1FZMA 4WV1A 5HVHB 1I3RB 3EJYC 4G8EB 3LVEA 1JHTB 3BGFB 2IMNA 1OAXL 1G84A 5GHWH 4JG1L 4NJAH 4XCFH 2A6IA 2NXZD 2D3VA 2XZCH 5HGHB 2AXFB 5HPMA 4L9DA 4JDVA 2ATKA 4LPWA 5TDOA 4GXUM 5BJTB 3I6KA 4PP1C 1LO3L 2DTMH 4UT6H 3ZKSD 3LOWA 4UT7H 3ZKNC 4POUB 3TT3L 1T3FA 3VXSE 5ID0B 2IPKB 3QPQD 3MO1B 3FOMA 3IDJA 2VKXA 4H8WC 2ZCHL 4KTDH 4OZHF 4PRHA 5GS0D 4U6XA 2XKNA 1LWRA 1CDBA 4GG6A 5FUOH 5KW9L 5EIQA 1GJIA 2AJ3A 4PYHA 4MVBD 3GHEH 4XMKH 5EO0B 1NCDH 2OS7A 3QQ4B 3WXVH 1BFOB 1C08B 2QSCL 1T2JA 4NN7C 2HLAA 3P77A 3K2MC 4K3EH 2VLLA 2J5LB 3CU7A 1KULA 1QLFA 5FM5O 4QRUB 2EDOA 4ZQKA 3HB3D 5KANG 1YEFL 3MJ9H 5GSRB 1J10A 5EFIB 4QHUB 2VC2L 1NBQA 2V5TA 3BD3A 3P11L 1A5FH 1UKTA 4LDOB 3HI6H 4MDJA 4YDVB 2B4CH 1J0KA 1T66D 2BFVL 4R4ND 3EIFA 4UUJA 3QSKB 2R2BB 1IVLA 3SE3A 1MCEA 3DARA 4D2NA 3BSZH 4X4XA 1EGJL 5DMJB 2BCKA 3RZWA 3WNPA 5JXEC 4CMHB 4MHHI 5D2LA 1H3XA 5DXWA 3QCUL 5E5MB 1CDGA 4DJMA 3ZE1E 4FQQA 1PVHA 3OKEB 2YD5A 1QYGH 1T21B 4YXKH 4O4YH 4P4KA 1T6WA 3B2VL 4IRZL 5DLML 2ZUQB 2AQ1A 3BZFB 5C0DA 3BQUB 4QRSB 2CIKA 2X40A 4U1JA 1UWEH 3DO7A 3SO5A 4WWKD 4ENED 4K8RC 4POZD 4JAMB 4IS6B 3U30C 4ODVL 2DTSA 4HEPG 2UZXB 4N9OB 5KVGL 2CUMA 1UVQB 4F7PB 1RSFA 3O3EB 3PGFL 2VTFA 1JPFB 1YMMB 1NGXB 2E9IA 3E6HB 5L2KA 4PJ9A 3ECBA 4S1DC 4EKXA 1JNHA 1PGRB 2HH0L 1ODAA 5C86A 3RI5K 2J8UA 4P3CH 5D1XB 1D5ZB 5E0QA 1RV6X 4G6FD 5DWUH 3GO1H 4X80H 4Y4HB 3RGVA 1FQ9C 1A6UL 4NM4L 3DI3B 2PTTB 3D2UB 4KI5E 4B7LA 5DT1H 4U6YA 3HC3H 2Q86A 3D5OF 5IK3B 4BUGA 2Y07H 2NZIA 4APQC 2EYSA 3BN3B 3U7WH 5L2JA 1G6RL 4PJBB 3S4SA 2VDML 1UXWA 1FZKB 5DGRA 3E8UL 1ONQA 2J8UB 3NCEB 4UV4L 3SDXB 4IRJB 5I18H 3WV0A 1JE6A 1YYLL 1T1XB 5EFIA 2VLRA 5KVFL 5IEHA 1JZ7A 2QLVB 3RFZC 1RJLB 4GRMB 3RWCB 3VFMA 5C6TL 1UFUA 2ZSVB 3AMKA 3U6RB 2IBZY 2VZTA 3GJFK 1RU9L 4KY1H 4ODXB 1JNJA 3CVHL 1ZA3B 3MLUL 2VLJA 4UNUA 3H9YA 5KVDH 2HRLA 5EPMB 1ONQB 1OD9A 2FL5A 3Q3GB 1WLHA 5E6IC 3OKNA 2KBGA 3MRLB 5FO9A 2YN5A 3OR6A 5FUZL 1QNZH 4KUZH 3LZFH 4K7PY 3VXRE 2APXA 2PTTA 4WO4D 1Z9SA 5SWSD 2MKLC 3H0TB 3VWJD 4OZIB 4H88H 2CK0L 3A67H 3UAJD 4FTVD 1I7TA 2IQ9H 4FFYL 5E00A 2D7QA 2HJFB 4S1RL 5DD0H 5FYJL 3IJYB 1ULVA 3QDMD 1BFVH 1UGNA 4K2UH 4HCRA 4HF5H 1AI1L 4JFOB 2XWJA 2HJLB 4ESKA 3S34L 2VXVH 3JTTB 1E4XH 1BM3L 2VXTL 2XN9D 1T89C 4NQSB 5DURD 1A7NL 1RZKL 1OAZH 2DQJL 5C07B 3UBXA 3GIZH 4ZTPH 5FCSH 4E9LA 1WFOA 2UVFA 4XP9H 4PRDB 1Q9WA 4U1SA 1BJ1J 4OLWH 3MV7B 1CWVA 2FX7L 1VGEL 4JFYB 1F4HA 1CD8A 1GRWA 4Y1AA 5F8RC 3IU3A 3Q5YA 2Q6WB 5GSRA 3BP5A 1HHIA 4G6KH 4DGIH 5CHNA 4WHTA 5DVMA 4HBCH 3U82B 1DBML 2QEJA 4E5XA 1T7VA 3IJSA 4WDIB 2UY7A 1J12A 1NGZB 1MJJB 2QQNH 2M1KA 5BXFB 1I85C 3HR5A 4NQCD 5FDYA 1FBIH 3VRJB 1CN4A 5C08B 3REVA 1IAMA 2ZKHL 3DBXA 3O6LH 1DTUA 3TYGH 5I1JL 2RIKA 4X4XB 4JY5L 3P4NA 2GJ6B 4LQFL 4H1LG 1M6OA 2HAZA 5J4MA 4JFED 4ZFGH 2FECL 4K8RH 4XXDB 5C0IB 3CLEL 3MNVB 1IAIL 4OIIL 4U7KA 1ZT4A 2G60H 2NX5B 3TBWB 1A6AB 2R56H 5EUOF 4RGMB 5DRZB 2ENYA 4XBEL 2V2TB 2ED9A 4PJ5B 3K4AA 5MEQA 5HDOA 2ZCKH 5CFHA 1EBAA 2VDKH 4MJ4A 4Q6IC 4MHHG 3UZVB 1XF4A 3K8MA 1QFUH 5JPNA 3PP4H 4CVZB 1MJ8H 1I7ZB 4NO0A 1IEAB 2LFGA 5DUPH 1LO4L 4NNPH 5FO7B 3ARZA 3ARBC 4D0CA 4M7ZC 4F57H 3O6MH 1RD6A 2CLZB 4M7LH 5IKCA 5B8CB 3T0VA 1A4JB 5FIEA 4G8EA 3B4NA 5TGBA 2OI9C 4JO2L 5SWQB 1JPTL 5F7NC 5I75B 4TRPL 1I8LA 4WCYL 5F6HJ 2RCSH 4S1QH 1FDLL 2AJXL 3FQUB 3TJEL 3ZKXB 3VG0L 5LQBH 3BN9C 2CLZA 4BQBA 1JHLH 1URLA 3BISA 4P4RA 1A6VL 1DLFH 3CSPA 3VRLF 3VG9B 3VXME 4QY8B 5T3XE 4GRWH 4FG6C 5C0CD 3BIKB 5F9DC 1J0JA 4ZUVA 4ELMF 4U33A 1J8HA 1FGNH 4YFLF 5HHOA 3CVHH 1VEPA 4AH2B 2COQA 1NSNL 2Z31B 1BZ7B 2YHGA 4LPUA 5C08E 1A0QL 1E27B 1KENH 3KLHC 2XIDA 5DJ8B 2O5ZH 3IRPX 1GSMA 2PXYB 1RK1B 1IBGH 4KKLD 4DAGH 1XIWC 4X9HA 1X4ZA 3FONA 3PWPE 4HWBL 1DE4A 2YK1L 1N7ML 3HAEA 2GTWB 5D1QA 4Y19D 3REVB 1X3DA 4NKMB 1C5CH 1YUHB 2NY3B 2CK0H 3A67L 5MERB 4OJFH 1IZKA 2PO6C 2DYPD 2G5BB 2MKWA 4KMTL 2P1YA 2Y5EA 2JCCB 5HTSA 3TO4C 2R8SH 1FV1A 2NY2C 3QFDA 1N2RA 2BVQB 4GUPB 5DJAA 3BZEA 1BIHA 1J5OL 3X14B 1ZOXA 1IQDB 5A40E 1FO0H 4WI9A 3WD5L 2DI9A 4QYOB 1IKFH 5IVZA 5LGKA 1KCVH 4KHTH 1RUMH 1Y18A 2F54E 3DHJA 4X5WB 3BH8A 1JHKH 3BDYL 3T0EB 3QJFB 4Y5XA 2BVYA 1BVLA 3MXVH 2AJVH 4CADA 5HDBF 1FCGA 2O26U 3RZCD 1EHLL 1GC1H 4X6DA 5FYJD 4GG6E 2I07B 5DJ2B 3RUGB 4JPKL 1QEWB 2OTPA 4J3OC 2EE3A 4O5LH 1FG2A 4NFBA 1NCAL 2BJML 2X6MA 3TV3H 4JCLA 2GY5A 3CXHJ 4WNQB 1MCSA 1G6RA 4PB0L 4CADB 5CEXB 1UKQA 2Z92B 3KYKL 3HE6B 4HHAB 1MHPH 3IXTB 4TN9A 1GHFL 3NN8A 5E1HB 4AMKL 4S2SA 5A3IC 4XP6L 4OQTL 1SY6A 1KIQB 5DQDH 5TE4H 3S34H 1QBAA 3GJFB 1GVIA 4XCYA 1Q0YL 4HJ0D 2DRUA 3EYVA 3NFPB 2JKXA 4CGTA 1G6RB 5CEXA 4JFPA 3NH7L 4XPHH 4N5EC 4DUWA 4NRYB 5CKAA 3I84A 3NCMA 1MRDH 4XNMA 3EOTH 3W82A 2GAZA 2A77H 1JUFB 4Z95L 4LLDA 4MXWH 1VERA 4J8RB 3V7AE 2D4FA 2GI7A 4OAWA 1A7PL 1JCKA 2Z31D 3RVXC 3D69B 3V6FA 2R69L 4AENB 2VKWA 1R3JA 2Q3AA 1DE4B 3I3BA 3UTSE 2AXJA 4CMHC 3UPRA 3QIBA 3QQ3B 2JCCE 5C3TA 1S78C 4JZOA 3MRNA 4X5WA 1OOAA 2WQ8A 1WITA 4BSVA 1AGCA 4JHWH 4OBRA 4YZFE 4NJ9H 4XHJD 2BZDA 3CCHA 2IALA 1G0DA 1C7SA 1QPXA 4GRLB 2WNGA 5INCA 3H9HA 3V0VB 4GUPA 5DJAB 3BW9A 2FJFA 2YD6A 3G5VA 2VLKA 4NN6C 4P2QE 4TULL 4X8JB 2W0FA 3HC0B 2YA0A 2DS4A 4D0DB 4LASL 3QRGH 3RI5F 4X0KA 3SEPA 3M1BA 1KCRL 1HE7A 3I9GL 1KJ3L 3VGHA 3MLTB 3S98A 4U0RB 2F5AL 1DFBL 2I27N 1U3YA 1LO0H 3SE4C 3C09C 1GZQA 1Q9OA 1DQTA 3ROOB 2P4AB 2C1PB 1KPRA 1XGYL 2BVPB 2YUZA 1MWAB 5F9WB 3IFOA 5C09D 1KFAL 3O8XD 1TVDA 3BZFA 1E4XI 4NCC2 3OB0H 2Z8WC 4TVPH 5D1XC 2HFFB 3HKFA 4RX4D 2X41A 3MRGB 3OKLB 1XCQB 1H8SA 4TUKL 5EU6B 4F7EB 3P0GB 1Q9KA 4OCRL 5DJ8A 4IHOB 4NQVA 3PP4L 1FFOB 3VD4A 2NXYB 4D0CB 1S7VB 1VPOL 5MEND 3PIQB 4MA3B 3R06A 1ZVSA 1HWHB 1J8HB 1QRNE 5L2JB 4JQVA 3D18B 2IPUG 5EC2A 5EUOB 4P46A 1UCTA 2NR6D 2AXFA 3DXAD 3GSXA 3I2CL 2DQUL 3ARDA 2HFTA 1NC2A 2AEPL 3D9AH 3VXMA 4PGDB 3VFWB 2X4UA 2NTFB 2ZCKL 3QUXD 3G6AB 3T0BA 5MEPA 1N0LA 4XMKL 4RMUA 4YDIH 3KYOB 5H35B 1TTUA 4XVUC 4LHJB 1OTUD 4ZODA 1HSAB 4EXKA 4MD5B 3QWOA 4LARL 5BW7A 2OJZH 2A0LD 5TGBB 4M5YL 1DANT 3WEXB 4I77H 5C08A 3FB5A 1LO2H 5LJYH 2ERJC 3BWAA 3QNYA 1E4JA 4YHOH 2W07A 2NY6B 4NT6B 1NCCH 4M5ZL 4HWBH 4OQTA 5HHNA 5DR5L 2Y72A 4R2GC 1UEYA 1XR9B 1A5FL 3AREA 2FATH 1LD9A 2P8MB 2BNUA 5J11B 1E0OB 4OLVH 3PNWB 4PJFA 4JFYA 2XKNB 5E1AB 5CP7B 3MLXH 2IFFL 2YS4A 4M7LL 4FZEH 4R3SB 4X6EB 5D7SL 3VXRD 5C2BL 5EDXA 1T5WB 4V1DE 5LKNA 5BS0D 4Y1AE 1YEKL 3OPZH 5GISH 4U3HA 1MPAH 4K7FA 3SOBL 3NABH 5HYJA 3SDYH 3ULVL 4OLUL 1JGUH 2N1KA 1CFTB 2LVCA 4W68A 5FGBC 3TYFB 1WZLA 2IFGA 4XBGA 3OKOB 4QTHA 4LLQA 3O2WH 4G6JL 4H1LB 2DF3A 3CC5A 4OM1H 4I3RH 3TT3H 2YD8A 1I8LC 4U1SB 4MQ7B 5T3ZH 2EDKA 4L4VD 3MZTA 8FABA 3N50A 4YR6B 1IAOB 5ADPL 4GW5A 2FIRT 2XYCA 4LVOB 3CUPA 3V8OA 1KB5L 3Q0HA 1F3DH 1INQB 3RIAF 5D6DA 4BA8A 1C5BH 4EQ3A 4G42B 2X89A 3U2SB 2OTUA 2IALB 3KPSA 4PB9H 3Q6GH 1NAML 4G8GE 2R0LH 3DV4B 1YEIL 5TQ0L 3QUZD 2X4TA 4X6CA 3SPVA 1MNUH 5FYKD 1JIBA 1YMHB 3O9WD 4GKSB 1A9BB 1ZLWH 2OMNA 5IEKA 4IMKC 4YHZH 1J8KA 5CBEA 4Z7VF 4S1RH 5DD0L 5FYJH 4FN0A 1N5YH 3SDXE 2E7HA 2EXYC 4FQJL 5T1KD 3U79A 3VGEA 5I1AA 4WI6A 2JIXB 3CX2A 4APQB 4K55A 1KPUA 5E2UL 3AFLA 1QLRB 4Q74A 2X4PA 4Y2DB 2CDGB 4QEGA 1MY7A 2PW1B 1DQJB 4YWGH 3B9KB 4JM2D 3MRCB 5FGCE 3WN5C 1HQRA 1KPRB 2YEZB 2PNDA 2A73A 4L8DA 2ZP0T 4EI5C 3TC9A 1HH6B 3C5JB 3HRPA 3FOLB 2NW2B 4L3EE 2P42B 1RZ7L 3D39A 5D7LB 2HT3D 1GCFA 12E8H 3IDYB 4JM2C 2VDMH 1KPVB 4DZ8B 4NM4H 3QXAB 3DTXB 4XPGH 4XZUA 5D2LB 3DX8B 1J0HA 2YXMA 3DMMA 3KS0J 1MRFH 2UZYB 5IB3B 4Y16B 3WXWH 3O41B 5BQ7B 3RVUC 1QSVA 4FXKA 4NQDA 4M03A 3MFFB 3FZUC 3SKOA 2QKIB 1YQVL 3WE6B 1TDQA 5BV7B 3L5JA 4MQTB 3O9WC 4HDIB 1AGEA 2GJ6D 3ME0A 3QUZC 5ALCL 2XFXA 1W72L 4WGVB 4JZJC 4GLRH 4YUEL 3X11A 3UTQA 3KNBB 4ZFFA 4KZEL 1SJEB 3DXAB 4RRPA 5FYKE 2WUCH 3ESUF 4RISH 4P9MH 5I1EH 4PRBA 4HWNA 1BEYH 1YUHA 4IRJA 2XG4A 3F7VB 2OR8A 3QEQB 1S9WA 4JFZH 4P2RB 4JZNA 1Q9LB 5FO8B 2FNBA 3QCUH 2R15A 3G9VA 4CVWA 3GIVB 3CGTA 1C8PA 5EB9A 4RNRA 5C3LD 2DKMA 4H8WL 1QR1A 4KZDL 1T1ZB 1DBBH 1G7LB 3IJHA 2XACC 2C3VA 4R7DA 2FR4B 2VXSH 3BZ4B 5EUKA 1OB1B 3BSZL 4U1LA 1KJ2A 5AZ2L 2FO4A 1KB9K 4UT9H 2BY2A 3MSPA 5DQJB 1BZ9B 1PAMA 1FFRA 1UJ3C 3TNMA 1PYWB 4G9FD 1HDMA 3VXUD 2VDNH 2ZPKH 3QIWD 2R0WL 5HSFA 3MLRH 2AJUH 4I9WD 1ZA6A 2PCPB 5JLZA 2B4CL 4X98B 4WU5B 5SX4H 4OGAC 5D7JA 3RQ3A 3Q6GL 3AU1B 5FDWA 1YECL 4HUUA 2EZ0D 1I1AA 1CTOA 1ZEAH 3ZHDA 2GYSA 4WUUE 4X9GA 4EI5A 2OR9L 5D2NA 2ADIB 4KC3B 2JCCA 3JV6B 3WDJA 2I9TA 3T0XA 1MFAH 1OP5H 3UTTE 1Q9WB 4HLZG 1Y6KR 3ZDYE 5T5FH 2FATL 2P5EB 1H3VA 3FCTA 1AKJD 2GW5A 2CJUL 1TJGH 1C16B 1BX2A 1S9YA 2IAMD 2CUIA 3ULVF 4H1LH 1N59B 1TPXC 4ORZC 3WNOA 3ZKXC 3EFDH 4JGMA 2DLFH 3TPUB 3SGEI 1G7JB 2BRRH 3TO2A 3KPNB 2GT9B 1CZ8H 1Y0LA 1I8MA 4FNLH 3QPXL 1HXMA 2BDNL 4NBYB 4P23C 2A0LC 4QHKJ 4YHKH 3DGGB 5EO9B 4XC1L 2YWYA 3DV4A 4XGZA 3QWRA 5BOPA 3PGCA 4PJ9C 3OL2A 3PNWA 3S37L 1B4JL 1KJ2L 1UG9A 3D0LB 4QHUA 1KJMA 4MAUL 5FV2A 3RL1B 2EC9T 4TUOB 2A1WH 3QEHB 4CDHA 5DMKB 3ZT5A 3QCTH 1BGXL 1IQWH 4S1SL 4X6CE 2O5XL 5CLTA 5DF0A 1TVHA 4U6VL 3TT1L 3QEGL 4TOYL 4BUHA 1BAFH 1F4XL 2QSVA 3SCMA 4I1NB 5T3ZL 2Q6WA 1U3ZA 2W9DH 2UUDK 3O8XC 4NUJA 3LMJH 3MRMB 5DZNA 3B9EA 4EJ1C 2PYFB 5JMOC 4IJ3C 3VD9A 2XKUA 1U8QA 1QSEE 4IOIB 3W0WB 5E94A 4GRWE 2Q86B 1W72A 2P5WD 4M6NH 3ZYJA 1PKQA 1N26A 3IFNH 1DBMH 1DN0B 1FGVH 2VLRD 1QO3A 4NJAL 1ZHLA 4XCFL 4Y7MA 1GIGH 1RZFH 3TZVA 5BJTA 3S88L 1KJ2B 4G7VL 3RWEB 1GZPA 2JJUA 3BHBB 1DBKH 1TCRB 1FFOA 1U91A 3K0WA 1PG7W 1Z6JT 5C0AD 2FHCA 4D9RE 1ORSA 2JB6A 3QDJB 3GMMB 4KV5E 4L3EA 4IIQC 2CLRB 4NO2A 4XHJC 2UZIL 3FOLA 4N0YL 4L8CB 3DVGB 2BERA 4G8FB 5F3BA 5EN2B 1WBZA 3GBNH 2FX7H 1N64H 3ARTA 2VUOA 3S97C 1ACYH 2C1OA 3TCLA 1MF2L 4DKAA 1T22A 2QQKH 1NAMH 1QSFE 2BC4B 3FFCD 4LSRL 3TFKC 3GM8A 4PG9A 3KPOA 3WIFA 4K9EC 1A7RL 2VXVL 5HGDB 1DL7L 4DN4L 5FA3B 3ZDXF 2GUOB 5JDJA 1CLOL 4GMSH 3AXLB 1F02I 1KPUB 2ADFL 3VFGL 3JWDL 2B1HH 2IPTH 3ULSB 3BWUC 4P5MA 3U9PL 3FTGB 2VDKL 4NUGH 2BNRE 5HGAB 1K4DA 4OUUA 4JY5H 4FQXA 3OMZA 2XQBL 4O9HL 3LV3B 2GSGB 3ARGD 4Y2OA 3UTZA 3QFJD 2HFEB 5E7FA 4NRZB 2OK0H 3ABZA 3S3PA 4JE4B 4U6YB 4N0UB 4I2XB 3WUWB 4Y16A 5SV4A 3C2AL 3NPSC 3SQBA 5F7MC 1A8JH 4OLYL 1YNKH 1MHPL 3SKNA 4JR9H 4LNRA 5I1JH 4BH8B 4XBPA 3JV4A 5DUBB 3VFPB 1MVFA 1P9MA 2N7BA 2VR4A 4X5XB 4YQXH 2EECA 1AQDB 3S3JA 1H3PL 2A6JB 2Q8BL 2BXZA 5J6GA 2FO1A 4L8SC 5D72L 3X11B 5F7EL 2Y7QA 4J3TA 4NSKA 2EKSB 1MCKA 4M6MH 4E0RA 2VSCA 1A6WL 4KUCD 3CDFA 4NZRH 4CN6A 1KB5A 5GZOD 5J0BA 1Q0XL 2C1OB 5GS1C 3TCLB 1S7QA 5J8OA 1CE1H 4YXLH 43CAA 3KPQB 1I4FA 4JHBA 3L5HA 3W9DA 4KKNA 4M43L 2F54D 4MAUH 3U6RA 3LS5H 1LMKA 1NMAL 4QGTA 4PJIB 5DHVH 1T21A 5BCAA 3H9ZA 4V2BA 4I0PC 4R97B 3V4PL 1AXIB 3U7YL 5DA4A 5DQDL 5TE4L 4LQ1A 3BPLB 2VNCA 3NCCB 3FQXA 3V5HB 4PFEA 5E70A 5L8JB 1T80A 4NJ9L 2CKBH 3NFNA 3D2UA 3GB7B 3HNTH 4YDVA 4KU1A 4OCXH 2PYFA 3VMNA 1F4WL 4OD3H 5D7IE 5J56B 3V4VL 3V6FB 2GIYA 3MRFA 4WW2A 2XT1B 4YBHA 2D03H 3QXVA 1J87A 7FABH 3KLHD 4X4ME 4OFIA 4NHCH 2D0GA 5E8EA 1I7UB 2X4SA 4I48A 3VFNB 3SGKA 5IMMA 1VA9A 3CXDH 2C3XA 4JFPB 3W9DB 4OCNC 1YECH 4PG9B 4F7PA 4JZJA 4ONHB 4BELD 5HHOD 4PJFF 4JPKH 4XAKE 3IDXH 1OGTB 3IDIB 2WIMA 4H5SA 3WFBH 3RY4A 4PG2C 3BN9D 5DEGA 3X3GL 5GS2H 4NKOB 4L8CA 4JJHA 2R29L 1IAIM 1G9EA 4DVRL 1XR8A 4HJGA 1NKOA 3G08B 1AD0B 1FH5H 5IT2L 1SMOA 4RBPK 2YA2A 4JKMA 4KMTH 4MZ3A 1FSKC 1PG7H 5DT1L 2VMFA 4PBXA 5EU4A 4OJFL 5HJ3A 1OW0C 1EUTA 4MXVE 5D5MF 2AV1B 1I3UA 4KKCD 3P4MA 4LCCC 4OQTH 1KELL 5HXMA 1T1YB 3T4AB 4OKDA 3I6KB 2DYPA 1P9MC 4M3JA 1WEJH 1G7MA 5DDHA 2R1XB 4KVNL 1IRAY 1HZHL 1DDHB 4Q2ZB 3RWDB 3C6LB 1LILA 1KEMH 4R4BB 5DLMH 1PKQE 1E28B 2X7LB 1I3RA 5H94A 2ZCLH 3ZKMC 4JM4L 1IKNC 1YC7A 3O81A 4IDJL 1WCBA 3U83A 4JFEE 4P23D 3P4OB 5L7XL 1QTYT 4Z77A 2DD8L 3U0PA 3FRPA 5HPOA 2C3WA 1OAKL 2ZUXA 1ORQB 3QUZB 1OTSC 1RFDH 2E3VA 5A2IH 4P4KD 1N5AA 3QUYB 4M7JH 3NIFE 4XMLL 1BD2D 2OR7A 4AEFA 3TNMB 2VZ3A 1P4LB 4GXUN 1Z2KA 4PJGE 4WWKA 3U46A 5E9DD 2IF7A 4ODUB 3M07A 5F70A 5KJRH 3MRFB 4PJDE 2HFGH 2YUXA 2H45A 3IGAA 4LEOA 2YD1A 2EZ0C 2QL1A 3EO9H 2DLGA 3MNVA 4XRCB 2Y6SC 7CGTA 2ESVD 1PKOA 5GRVK 4XC3H 1XIWA 5CEYA 4OGAD 1MCIA 2B1HL 1QFWH 2IPTL 1A3LH 4NQEB 5D6DC 4YK4C 2V7NB 3F58L 4G7YH 1JRHL 3MBEA 4I3GA 3KJ4C 1ZLWK 4K23L 1DZBA 5EBMB 3K2UL 1BOGA 6FABL 4F33B 1SJHB 3UBXG 5BZDA 5FKAA 5DD5L 3NTCL 3UTTA 2D7MA 4DK6A 5LGJB 4Z8FH 3MOAL 4M4PA 2AXGA 4WHTB 1A64A 4GS7C 2X4NA 4TSBH 1MF2H 5CIPA 4ODHH 1UA6L 5FYLL 4WJ5B 4M7KH 4XT1C 3I3DA 1IGYB 3VWJC 2IANB 4EIGB 1H15A 1TQCB 2QR0A 4UINH 1RZJC 2A6KB 1B0GB 2LAAA 3SDCB 5IMOA 3VFWA 3WE6A 1N6UA 4XX1G 1RUAL 5GGTA 2DIJA 2V17L 1QQDB 5FO7A 1S5IH 3QEHA 1F3JB 4Z6AT 2CRZA 5DI8B 1SY6L 3EO1B 3QULB 4NYLA 1ZVSB 4K71B 1LEGB 3MREB 3MRPB 3SDDD 1AJ7H 3WLBB 4LSRH 3PUCA 4LLVA 1GGCH 2NY1C 3ZTNL 2C3VB 2QHRH 3MRGA 3OKLA 1UKSA 1AD0A 3T08A 5TDNB 5F97E 5C0IA 1F42A 4NP4H 1OAZL 1EH9A 2DQJH 3Q1SH 4Z78A 1Q38A 2V5RA 2B20A 3MRIA 4K3HA 4LSVH 2R1YB 2IFFH 4APQD 5C09A 5GRJL 2C1PA 9CGTA 1MCBA 4Q9QL 1MREL 3B2UC 4RX4A 3IDMB 1OARH 1YNLH 4WI4A 3IFLL 4Q9CA 1JZ4A 2HVKB 4GRWB 4I4WB 1NGYA 1LNUA 4FQ1H 4PJEF 3SQOH 3HI5L 2AI0H 4GRMA 1RJLA 4IJ3B 4TTDC 4EN3B 4AYFA 1FNSH 4GOSA 5DRNA 2Q7YB 2XY1A 2ILLA 3EFDL 2V9TA 1KIQA 1R3KB 4NFDA 4BQ8A 4YXHH 1NC2D 3CAFA 4PJBA 1RIHH 2H41A 4XNXH 1BMGA 4DUVA 5F3BB 2H32B 3OZ9L 4LASH 3P30H 3AMLA 4GKSA 5BOZG 3DUSA 1JMZA 4LEOB 4Y4HA 3WFZA 3C08H 2G5RA 4FQIH 1YEJH 3KYMB 3OWEA 4HGMA 2DQDL 2OTUB 4XCCH 5FHBH 4OSUL 1FAIH 2CRIA 3S5LB 4IRSB 4JANA 1I7TB 4AIZA 1IC7L 4IOFD 5C07D 1G7LA 1NANH 2VH5H 1M71A 3B2UD 5FYLD 4YGVB 3KPRD 3LKNB 3IXAB 4TUKH 2EDRA 3JZ7A 1PD6A 3OAYH 2D7TH 2UVEA 4NHUA 2NW3A 4P5TA 4IRSD 3HLAB 3QH3A 4QF1B 5FAAA 4R26L 4R4NC 1J88A 3MV9D 1PZUB 4WUUB 5TF0A 2VQUA 1T04A 4XPAL 2Y36L 3ISWA 1CZ8L 3UTPD 3FHQA 2UYLB 1GOGA 2VAAB 3BP7B 3ARYA 3SDDC 1NGYB 2NXYD 4I4WA 4YHPA 2FJGA 5IV2A 4KROB 5BZDB 1EEZA 3PABA 2FJHB 4G5ZL 3V95A 2ZG3A 4OI7A 1K5NB 4KVNH 2QBWA 1HXYA 4M61B 3PP3K 3TLRA 5TE7H 2EE2A 1MRCH 4PJ5A 5CJOL 2W60A 2ZCLL 4JRXA 4U7SA 5AWNH 1KLGB 4MVBC 1HQ4B 3QP3A 1BBJB 5C6PB 1KEGH 4OUUB 1SVCP 4G9FB 5D9SB 5IJKC 4KJPD 1RZKC 1UADC 1WEJL 3WS3A 3QNZB 2BNUB 4ZDHA 2Z8SA 4L4VA 3BX7C 1NBZA 3KPMA 3EJJX 3T2QA 3DI2B 1F97A 1W0WA 5FYKL 3MA7B 3RL2B 1KLFA 3RU8H 3ZKND 2DM3A 1I8IA 2OQJA 5MERA 3WN5B 2DM2A 3GO1L 3HI1A 3FQUA 4J1UA 4X80L 5CHNB 3FO0L 3PGDB 1KJ3H 2Y6SD 2NXZC 3V9FA 3D85B 5GGVL 1A3RL 4EI5B 1VADA 5E5RB 4CVXB 1ZTXL 3STLB 2IQAB 3S35H 2EICA 3EJYD 3O9WA 3LEVL 5GRUH 4B5EA 1IGIH 1I7RA 3VRIB 5BVPH 4JM2B 2ZUSA 2CDEA 4PJ7B 5DD3H 4WY7H 4R2GD 3TV3L 3QXWA 4RQQA 5LWYL 5JUEL 1BECA 1PY9A 4YFEA 1M7XA 3VA2C 3LKQA 3GBNL 3UJTL 4P9ML 3RGVC 4P4KC 5CD3A 3CFKA 3HRZB 4NWTH 3R06B 4U6TA 1YPZA 4O5LL 4JFFD 4LSSH 2GSIA 2ATPB 5IQ9A 4QRTA 1NLDL 3GUTA 4K3EL 4MB4A 1K8IA 4JM2A 1INEH 1G7QB 3RY6A 2EDYA 4G43B 3V4UL 5EU6A 3VD5A 1T0PB 4UMGA 5BZWB 4HK0A 1NCDL 1TNNA 3EYQD 2WWKO 2H6PB 5EZOL 4XVUD 4XNXL 1HHJA 3ILQC 3NA9H 3TVMA 1HILA 4M3KB 4PRIA 1ZXQA 2DOCA 2AK1L 3DWTA 5TF1H 3FQRA 4L4TE 5ALCH 1AXTL 1D5XA 4UB0L 1JFQL 1FFNB 5E56A 3HNSH 4D0BB 1KIRA 1M05B 1ND0B 4QHLB 4CU7A 1S9VB 3MJ9L 3TA3D 1A3QA 4LF3A 2W9EL 2ADFH 3GNMH 3VFGH 4I18A 4HUVB 3K3QA 1RUKH 4KKCC 3M1BB 1YDPB 2LU3A 5I9QB 4U3XA 3VFTB 1CR9L 1KTLA 3GGWA 4KFZC 1I7UA 2X4SB 5GRJH 2DTML 2J8HA 3LKSB 1EFQA 1XGTA 4Q9QH 4YBLB 2XFXB 4OIBA 1WF5A 5D1XD 3D0VB 3CVHA 4MMXC 5JORA 2X7LA 4YQXL 5DK0B 3ES6B 1AY1H 2VITB 1P7QA 4F2MB 5J1AA 1AGFB 3T2NH 3IAGC 4MNHA 4LDLB 3LKNA 1UWEL 3FB7A 3REWB 4U6VH 2GJ6A 3P4NB 3CDYA 5E8PB 1NAMB 5FKPA 3O45A 4FQXB 3O6FB 4UBDD 2ZUWA 3PG2A 1SYSB 1IL1B 3OX8A 1D5ZA 4PJGF 2P43B 3BP4A 4YXHL 3LDBB 3MC0A 4O2CB 4KAQL 4LLAA 4X99B 4QCIB 1RZJH 1ZWIA 4XAWL 3P9LA 5D1ZA 2V17H 5JW3H 2OM5A 4HFUH 5GSVB 2VAAA 4Z7QE 4JLRB 4M6NL 5I1LB 5C92A 3NFPA 1KNOA 2IWGA 3VFUA 1TNMA 4QF1A 1CDUA 5J3HD 1A7OH 3F7YA 3P11H 4HIHB 3EDKA 2Y5TA 1OF2B 1VB9A 4R8WH 3W2DH 3NCJH 1EAPA 3SY0B 1GH7A 1JNNL 4R0LA 2X4PB 2ZSWA 3LN5A 4EZMA 1DQMH 1WZ1H 4I0PD 1FVEA 4RMTA 4JFOA 3FO1B 2CJUH 3MX0A 3L3DB 1MAJA 4TVPD 4G9FA 4U7MA 4HXBL 2O5YH 5DJ2A 3N1MC 5SWZE 5DUMH 4EDWL 1IMHC 4D9QD 1ZEAL 5F1OB 4WUKL 5IK3A 5EU3A 1A3RH 5EUOA 2B2XH 3QJHA 4G6AD 3EOBA 3QO0A 3MLSH 3MGTA 5IVXA 2DI8A 3F7RA 1K4DB 1FFPB 5FB8B 5L6YL 4Z7WA 2WP3O 3EDJA 3NOIA 1KYOJ 4EN3A 3O3BB 2BDNH 3R1GH 3TBSA 5I17A 1ADQA 3DXAA 5DJ6A 1OL0A 4Y4FB 2IAMA 4Y88A 3VXMD 5ACZA 4I18B 4NQUA 4W4OC 1UM6L 4LMQE 4OLZL 5LXGL 3MJGX 3MROA 4U1GC 4IDJH 4OZGE 4KQ4H 1BLNA 4NKMA 1GPOL 4G6AC 5B8CC 4HS6B 1FVDB 1LP9E 1OT1A 1T22B 4OZHE 3UYPA 3PV6B 3O8XB 2OTWA 1XCTB 4JY4A 3ARGC 1FNLA 2DLEA 4OLVL 4JJ5A 3GIZL 4PRPD 2Y06H 4ZXBB 4XPTL 5A16A 5D1ZB 1G7QA 1KELH 2WSKA 2CPCA 3KR3L 2NY2D 4LMQI 1S7UA 3HG1E 5DWUL 3TO4D 4RA3A 5M7QA 4P46C 4LPYA 4WI3A 1F6FB 2OMBA 3CMOH 4DW2L 3ARED 1QRNB 4W81A 4XP9L 1CLZL 2Y07L 2VABA 1FSKB 1U3HB 4RDQG 1AR2A 5T3ZD 1FP5A 3TESA 2A74B 5FGRA 4DGYH 4YO0B 4IIQB 1JPFA 2J3SA 4Z76A 5DS8A 4FXLA 1D5MB 3GHBH 1KCKA 4BFIA 4JHAH 1MCFA 3ROLA 1U8NA 3CZFB 2VITA 3S7GA 2D4DA 5IVZB 2R4RH 4HC1L 1FL6B 3VMPA 3WFBL 3QI9A 3WJJC 4HKXB 3KLSA 5E8DH 2ID5A 1D5BB 5LCVL 2X70A 5JW4M 1FNGB 5B3NA 2WWKT 3PWVB 4HFWA 5EOCH 4DKEH 2IBBA 4XPGL 3SE9L 4UBDC 4PRPE 2IH1B 5DK2A 2F74A 3OB8A 3DRQA 4M48H 3GI8H 1NH6A 3S3SA 1G7IB 1UEMA 3LEVH 4CVZA 1FFQA 5F7EH 3VDBA 3S9DB 2H3NA 5DSCB 4L5FL 2R4SL 1EZVY 3T04D 3WJJA 4EUPH 3SJVD 5IF0A 1NBYB 5DRZA 4RWYL 5C0RL 5CINH 1A1MA 5C0EB 3MJ8A 5FA4A 3R4DA 3TBWA 3QO1B 1W72H 4C56A 5K9KA 4HAGA 1K8DB 1ZT7B 2ZUYA 3KPRB 4MDIB 4DOHE 3FQWB 1UYWL 3QIBC 1M6OB 1U2CA 5I1HH 1V3JA 3HUJE 1ZGLM 3AUVA 3TA3C 3X3GH 1K85A 1GGBL 2WQRA 3IFLH 4NGHL 1DBAL 2ICES 2HYMA 4XP1H 3BJLA 5E2JA 3PWNA 4OGXH 2W0PA 5B3JF 4G9DA 5JXAL 4NCC1 3OR7B 1OAUL 4TPRL 3ILQD 4LSVL 2PKDA 4PJ9D 2PW2A 4FQXD 2Y23A 5DEGB 5T1DH 2X1WL 3OKOA 1RZ7H 1WC7A 5IBTL 1W0YT 5KSBB 3TM6A 3VGFA 1HHHA 4NHUB 2V9QA 4X5LA 5D7LE 4BFGA 5HHPA 2A9MH 3VW3H 5JLZB 1HHGA 1N8ZA 3RGVD 1B4RA 4IDLA 5L0QC 1HDMB 1T6VN 2QSTA 4Z7VE 1CLCA 1ACZA 4WFGE 2W0FB 5JPNB 2Q8AL 1W0VB 1FE8H 3FFDA 2IGFL 2PO6A 1K2DA 3KGRA 1F4YH 2W65B 3VFRB 3QR2A 4U1LB 5HBBA 5KSUB 4HKBA 4NOFA 4DEPB 4CBPA 4DOHB 5AD0A 3QDJE 4OFYD 1TJIH 4I3SL 1RUPL 4G8GB 4KHXH 5T1MB 2H9GA 1L9NA 1VFAA 2F54B 2G9HA 2YD3A 2C26A 4ODUA 1J11A 5IG7A 4NQXB 1D6VH 4HPOL 2EIBA 1OSZB 1V05A 3R8BB 2J6EH 4D8PA 2E27L 4OZFB 1FVDA 4LSPL 1C16A 4M4RA 4MD0B 5CS7A 4J6RL 4NKIL 4EUPG 3WNNA 1YEKH 4KQ3L 1MLCA 3GMOB 4KJPC 4ZPVA 1SJEA 4UILH 5J9PB 3UAJC 2CSPA 3NIGF 1HOCA 4Z7WE 4OSUH 5KAQF 3L3JA 5D1QC 1JNNH 3MRQA 5IBUB 2VDOL 4EIZC 4I2XE 2B1AH 3BEWB 3UBXB 1IGCH 3GRWA 3OG6B 4IIQA 5LXGH 2DICA 1PYWA 1JN6B 1QKZH 4HG4K 3G04A 3R1GL 1V7NH 4YHNA 4LRIC 3WLBA 2NXYC 2Z9TA 3AAZB 1MEXH 1SJVA 4NZDA 3LS4L 3HMXA 5JQ6H 5F1NB 3S8WA 2OZ4L 3MRRA 1YQ2A 5L2KB 2R8SL 5E99H 4IRSC 1UVQA 1X5AA 3ORJA 2DL2A 5BRZA 5IM7B 4YGAB 5TQ0H 4HIJB 3BMWA 4PJAB 2XQYG 1MFBL 3FTGA 4UDUB 3AC0A 4IOFC 1TZHA 4LP5A 1X5FA 5DJZB 3CFDA 1FNEA 2EE9A 1TMCB 2X4NB 5J6GB 3EO9L 1J0YA 6FABH 4X6BA 2RQ8A 4KRPC 3D25A 3TIDB 1MFCL 3PWPD 4Z7QF 3O3BA 5T1LD 2HT3C 2GJ6E 2XNAB 5INCB 4GW1A 3HZMA 1GOFA 5EBMA 2W91A 2FD6H 3SKMA 1FO0A 5TDPA 4MJIA 1G9MC 4EI5D 1XZ0B 4OM0L 3CIQA 5J11C 4YEEA 4NO0D 2KQMA 3T4YB 5JOFA 1CFQB 2H26A 2VDRH 4LCYB 3UYRL 2C4FU 4OLXH 1UT9A 3CDGB 4ENEC 4TULH 4HG4J 4QRRB 4JVUA 1AKJA 2B0SL 3JVGC 4TTDD 3O6LL 1EA9C 1KIPA 3NA9L 3UMTA 4NC2B 1EJ6A 1C1EL 4F8QA 3EDDA 1V5JA 3VRLE 1RIVL 4D9RD 1FVEB 4JFHD 3L7FB 4PUBL 3U30B 4JRYE 4CJ0A 5C9JB 1BAFL 5FFLA 4QHNB 5C6TH 3WJLC 2BMKB 5I6XC 1VGEH 5DJZA 5A2LH 1CL7I 1QA9B 1S8DA 2VIRB 2IGFH 4YLQT 5B39A 1N0XL 3BEWA 1IKNA 3O2DL 4LCWB 1A7QH 4GG8B 3AY4C 4YC2B 1D5XB 3SO3C 5IWLA 3DECA 3L5WA 4HIJA 3MUY1 2WUCL 2APTA 4RISL 3HMWH 2K1MA 5EPMA 3MRKB 2EDXA 1P2CB 5D2LF 3IETB 2JJSC 2GITB 3C9NA 1GGCL 2NY1D 5E6IA 1RUQH 1A7NH 4ZSOA 1NFKA 4HC1A 4XBGB 3DX6B 2G75A 3BPLC 1OAQH 2EEBA 3MACH 5ICXA 3T09A 4NQDE 4FQQB 1TENA 2DMBA 5DEFA 4CKVX 3H6JA 4TSAH 3JV0A 4RA0C 2RB8A 4V1DA 2P8PA 2K7PA 5DC9B 3PJSB 1NMAH 5DJDB 2AK1H 1CL7H 2UWEF 4UIMA 4OGXL 4M5YH 1MVUA 5EO1A 4PGZA 3PHQB 1NBVL 3IDGB 4YDJA 4CNIA 4N5UA 3D3VD 2E6JA 1O7SA 3LV3A 3RGVB 3KPTA 3BVNB 1FZJB 3OAZH 4NQCE 4HIEA 2Q8AH 5GS0C 4UTAH 4JPIA 3TZVD 1U8MA 2QQQA 1X9QA 5J6HB 3VFTA 1BOYA 4FQHA 4EXPX 1H3WM 5H8DA 3CFCH 2AV7B 5DMIH 2F5BH 2YUVA 4GRWF 4IEFB 2DM7A 3RIFF 1UCBH 1PZ5B 3CNKA 5IFJA 1ADQL 3BGAA 4F9LA 5C0GA 3RZCA 4X83A 2FJFB 3U1SL 2RFXB 4OCXL 4RIRA 2YWZA 2JJWA 4HK0B 1KTRL 3HI6L 4LVHB 2CKNA 3SBWA 3LHPH 2IC2A 3CFJB 5JOFB 5E5MA 3U9UB 2GEEA 1T3FB 4K7FB 5D71L 4IOSD 5FYJE 3LKRB 1ZVYA 3OJDA 3DJ9A 3P0VH 1XT5A 4NZUH 4DQOL 1YY8B 1WFTA 1CD1A 1PX4A 1OTSD 3EYOA 5J7CC 4Q0XH 4U49A 3HZMB 3UP1A 3TWCL 2NZ9C 4RMWA 4L29A 4BKLB 1DBJL 3FT4A 2AK4E 5JXEA 2VH5L 1RULH 3ARGA 4P9HL 3MCLL 4PB0H 1S7WA 4RAUB 1OTUC 2DWEA 1EHLH 4MX7B 1CE1L 3DX6A 2M2DA 3ZKMD 1OAYH 4WTZA 1XR8B 3RY5A 1KB5H 3LDBC 3O6KL 4HAFA 4WV1B 4Y8DC 2XG5A 1KLUA 5JHDA 3RX5A 3QUXC 3UZQA 2APFA 5CJQL 2NR6C 1NFIB 3EHBD 4AT6B 3VG0H 3R0MA 5HY9B 2X42A 3MROB 1A1NB 2GY7B 2VR5A 1QA9A 1S8DB 1TQBC 1C12B 2BXYA 2V5SA 3UPCA 4TUOA 5EO0A 1N5YL 3D48R 4L4VB 2F15A 3CMOL 4DW2H 4ZAKB 4BSWB 1U93A 4PV9B 1JHLL 2MFNA 3OV6A 2XI9A 3KPRA 4M8VA 5EU5A 2MCG1 2EKJA 3PGCB 3MMEA 5ICYA 3SKNB 4LIQE 4E41D 3WO3B 4O2EB 2LV4A 4KJQC 3U4EA 2VLKD 4HIXH 1QR4A 4XPAH 1TJHH 4OKVA 1Z9MA 3TPUA 4F7MB 5ID1A 1EO8L 2XTLA 1HXYB 3H7BB 2I26N 2DMCA 1SEQL 2DQCH 3DVFA 5F9OL 5IHBA 2P5EA 3ARRA 4QGYA 4NHCL 1B90A 1MCOL 3FMGL 1Q72H 4R8WL 5JHLL 4KDVA 1U8LA 5K9QG 3VH8A 2G5BA 2DQFA 5B39G 4WW1B 5BS0E 2P24A 4PLOB 1YEGH 1TLKA 5CWSA 1INDH 3RX8A 1QP1A 5LVEA 1X5IA 1LDSA 1PLGH 3MRHA 1F90L 4PJCF 1TZIA 5T1KB 4Y5VA 3VXTB 5EBWB 4XAWH 3ARBA 1NAKH 2PW1A 2Z31C 3RVXD 1JNLL 3NCYS 4UIKH 4JREC 1A7QL 2D7NA 1AQDA 3D85D 5JMRA 4F57L 1U91B 3GSVB 3QIUA 4QCIA 3VG9C 3O11A 5H2BA 1XGPB 4WHYG 4G7YL 4PLJC 1MJ8L 4FHBD 1CK0L 1QUNA 2C9AA 1CLOH 4MGXA 1QSFA 3TT1H 5MI0B 1R5IB 5IJVA 4M1GH 3VXUB 3PWUB 3MXWL 1QBLL 4YHIA 3RUGF 1A9BA 5GZOC 1QSEB 3W0WE 1TETH 3I75B 1V3MA 4KXZI 2R2HA 5F44A 4GG6F 1HHHB 4JN1H 1CF8H 3SDAA 1AGBA 5DVLA 4OAWB 1JUFA 1SY6H 4S1QL 2CRYA 2YD2A 3HFML 4PGJA 1FGVL 3CLEH 1CTNA 2DLHA 4ELME 1CGWA 4U1MA 3LQAL 2GJJA 4PP2A 1RUAH 5IMLB 4QRQB 4RWHA 1AJ7L 4H26B 2NX5E 1Q8MA 1TZHB 4PJXE 3ULUC 1WAAF 3OXSB 5MENE 1AGEB 2R2EB 2Q20A 3HI5H 1JI1A 2EDWA 4MJ5A 5GHWL 5D7JC 1L7IL 3FRUB 4S2SB 3VXNB 2UY6A 5DUPL 3QJHB 1DEDA 3QUYC 5EU6D 2WZPD 4OFKA 3FQWA 3AB0B 1YY9C 4JLRA 1EXUA 2X1QA 3H3PL 4X6CB 2J12B 3TVMD 5HGBB 1BD2A 1TCRA 1T5XA 3TH4T 4P2RD 5IJKA 1DVFC 5IF0B 3WO4B 2EDNA 2VDLL 3HG1D 3NMEA 1P4BL 1CD1B 5JZ7D 3O4LB 3TFKD 3ECBB 1S7XB 1MI5A 1PKQB 2NLJA 1FYTE 1SM3L 4FZEL 2YPKB 1CFVL 5HPMB 4KQ3H 4Y5VB 3VXTA 4U2ZA 1XAUA 1B0GA 1MQ8A 3SDCA 2XQYK 3AS1A 5LWYH 3BEVA 1RY7B 1XIWD 2K3TA 4KKLC 3VFUB 1FZMB 3O4LD 4IMLA 3ESVF 1VADB 1IGYA 1K9TA 4F37K 1CI5A 3EOAA 2J6EA 4UINL 4G8IA 1U8HA 1GAFH 3SDXF 2AK4A 4J4PA 3CZFA 3IU4H 3BAEH 1FL5A 3GSOA 1N3NA 3VWJB 2EYTA 4BKLA 4X4ZA 4XNUH 4L5FH 5C0BA 4ALAH 1KTKE 3DX9A 1IGJB 2VISA 2Y25A 1YN7A 1MCOH 2Q7NA 5DQ9B 3VFSA 1RHHA 3EYFA 4JFFB 3V5KB 4P5TC 1NAMA 5FKPB 1HIML 3MLUH 3HE7B 4MD5A 1ZGLA 1JGEA 3QNZA 4X4MA 3FONB 2Z8RA 1XGUB 1NMCB 4GMTH 5IGXL 1FPTH 4ODVH 1MFDH 1R5VA 4F9LC 1D6VL 3IJHB 4HPOH 2VZ1A 4PY7B 1OAUH 3WKMH 1NC2B 1BZ7A 3NIDF 4M1DH 3VFRA 1XGTB 1II4E 3HE7A 3DOSA 5CD3B 1CFSA 4ODSH 3KPRE 4RMVA 2PXYC 5HD8C 1JTOA 3B9KC 1OWWA 5C1MB 4MZ2A 1IARB 1BQUA 3P73A 4GJTB 3GMPA 3IS0X 3LHPL 5CIPH 1MCNA 5DC4B 3QNXA 5IFAL 1MAKA 2AEQH 3MYJB 4NCDA 3EO0B 1EHNA 4LLYA 3UJJH 1RQ5A 1DUZA 4YFDB 2IBGA 4QTHB 2ORBH 4I5BA 4WJ5A 1F4YL 4GKOA 4JGJA 1NCAH 3DRTB 4M62H 5F96H 4AIXA 4HIEB 2BVPA 2HH0H 1E28A 4KK9D 3G5XB 2V5MA 1R3LB 5H37G 5I18L 3U36B 1EHAA 2Q1EA 3L95B 5EU3B 4P46B 2IAMC 3MA7A 4ZS7L 3FQXB 1GPOH 4Q6YA 4AM0B 3TCXA 3DTXA 1S7VA 3PWJA 3QBTB 3OKDA 4BK5A 4TSCL 2C7UA 4ETYA 4K9EL 4D9LL 2HVJB 4FOMA 3RX7A 4YIQB 5IWLC 3O9WB 5GRZA 1OY3B 4JRYB 4U1HA 3T77B 4JHAL 3C9NB 5GRXG 3NACL 4HIIA 1Q94B 5C9KA 3C5SA 3VDCA 1Z0NA 5CSZA 3HS0B 2JIXD 5GRVL 3RVWC 3QIWC 4MJ5B 1CLZH 4JFXB 4LDEB 1GZQB 5CWSB 2IBZX 4EDWH 2Y7QB 3GK8L 4OTXH 1QSED 3TO4A 5GSVA 3FKUS 4CN1A 1AP2B 4PGBB 3GSRA 4R0LC 4AQ1B 4ONGH 3VXSB 4MCYB 4FQ2L 1AXSA 3H42L 3QUMA 4K94H 4U1KA 5GS0L 5C71A 2AQ2A 3HMWL 1C5BL 4HDIA 4L4TD 4JQIL 3MPCA 1YN6A 4OV5B 4F37F 1SYSA 3JTSA 5K9JL 3MJ7B 3WL9B 4NNXB 1F11B 1MHCA 4OCYL 3RWHA 4YWGL 5FM5M 4LRIA 3VXUA 4LOUC 1BBDH 3TPKA 4E42B 3RWGB 4DKEL 4XBEH 1FO0B 4O51B 4KQ4L 4X4YB 1GAFL 5C0FA 1H3PH 3JUYA 4KTEL 4L8BB 5F3HB 5GQBA 2XZQH 3N9GH 3BGMB 4PTUA 3L3DA 1WTGT 4Y19B 3D87B 5L8LB 1MCQA 2ARJA 5IHUL 1LP9B 3EKCA 4I77L 1FORL 3TIDA 1NGWB 1FVCA 4LLMA 4PJ5D 5LBSL 4RAVA 1M1SA 4YEFA 5F7LB 1CBVH 4ZXBA 4P57A 4LQFH 1BHGA 4QRUA 2CMRL 5I19H 3C5JA 3IETA 5IQ7H 1OARL 2VN4A 4Y4KA 3FZUD 3MRQB 2EDHA 4UV7H 1HK6A 5EC1B 4JQXC 3RVUD 1WIPA 4DFHA 4PS4H 3WIHH 3QHTC 3PWPB 3G5YA 5D96B 3OAUH 3A6CH 4U31A 4DGIL 5FXCH 3HE6A 1AY1L 4PJ8D 3NABL 1MREH 4RAHA 1RZIA 4PRNB 2HVJA 1RJYA 4YPJA 2VLKB 1GXEA 4L29B 5DUBA 1T1WB 1LEKA 3SDXA 3KHQA 4Z8FL 3TZVB 5DVNA 2CUHA 1VHPA 1AGCB 3QG7H 4NKIH 5EZJA 3MRIB 1T4KA 2CLVB 4QXUL 4Z0XB 5C7XL 2OL3L 2WIIA 4TYUA 5ANMB 3BH9A 1EMTL 5C0CB 1AXTH 1YYMH 5I15H 1D7FA 3MR9A 3MCKA 3QDGA 5J12C 4AENA 3SKMB 3OZ9H 2HMIC 4OF0A 3C6SA 5KSBF 4Y5YB 3PQYD 2W65A 4KI1A 5KN5A 2J88H 4Z18A 2NNAA 3LKSA 4HWUA 3SCMD 3E2HC 5DD1L 5L6YH 5HHMB 5JA8B 4PJEB 5AG9A 1FNEB 5I8EB 3M8OH 2EXYD 4ZO6A 3N0PB 3P73B 4K7PL 1S9VA 5IW6B 3BWAB 4L4TB 2YBRA 5GGRA 5DUML 1WGOA 1REIA 1U3JA 5D1QB 2P5WA 4Y2DC 1T66C 3HS0A 4FTVB 3CVIH 1QD0A 4PRID 3RL1A 1CVRA 1I9RL 5DO2C 3TN0C 4FABL 4ZO9A 4LSPH 5DD6A 2VXUH 3NZ8A 2DQFB 3TWCH 2WLZA 3G6JE 2PXYA 4LRNH 5CIPB 4TNWF 4R2GB 4HUMB 4Z0BH 3OR7A 4J6RH 1U3HC 1G9ML 4HZLA 2NPLX 3HB3C 5INDA 4F58L 1F4XH 1BOGB 4LFHG 4YHNB 1F6LL 5SV3A 3FQTA 1ZHLB 5CJBA 5TFSH 4CDGC 2OJZL 2ZG2A 5E8PA 1T0MB 3ZDXE 5IOPB 4ZD3H 1NANI 2WV3A 5TPWH 1IGJA 1P84K 2VISB 4BK4A 4F80A 4X8XA 3TBVB 1G7PB 4QRPE 4QY8A 4I3RL 2BVOB 3B8YA 5EU4B 4WHDA 5F7HA 5HHXH 4WTWA 1IC5H 1IAKB 2OJEB 2DD8H 3C5ZB 3IDXL 3CH1A 4YDLB 5DJYA 4MCYA 3MRKA 1V7MH 3P4LA 1NCUA 4KMLB 2MWCA 4HUUB 1FYTD 1KEGL 4P9HC 1KTLB 3ZZ1A 3SGJA 2E6QA 5ERWA 3HZYB 1T83C 4YNYB 2HP4A 4WVRA 2EO9A 4JZJB 1LK3L 1KIRB 1M05A 4NPYB 5JIKA 3QFJA 1S5HB 3W11D 1S7XA 1T20A 4M02A 5D93C 1OSZA 1U8MB 4X8JA 4P99A 3T0AA 3T2OA 1SYVA 4L4VE 3KPSE 3QHZL 5T5FL 3ZE1F 2H6PA 2XPGB 4XP5H 4EVNB 1XGYH 1KCVL 2KH2B 1A3LL 3CK0L 3GK8H 1CCZA 1KN4H 3CDGA 5B4MC 3S35L 1UB6B 2DQGH 3MOBL 4QRTB 4Z76B 5I66A 5SWSB 3GSQA 2P7TA 3S37H 5EC2B 5GXBB 1W8NA 2CK2A 3ULVE 1W0VA 3HN3A 4YHKL 3KXFD 2FLBT 3EOTL 3MRDB 5DRWB 2ESVB 5D6CA 2RGSA 1LEKB 4F9PA 2OI9B 3ILPA 1S9XB 1EEZB 1N5AB 3QUYA 2X44D 3IJSB 3TBTA 2W9LA 4PJIA 3KNBA 3FN3A 1F4AA 3O2DH 5IW3A 4MJID 5MHSE 4AMKH 2W0LA 5IB4B 3W81A 3GJFA 1BVZA 4PJHF 4GXVH 4HXAH 4FRWA 4PJBE 2YA1A 4PUBH 3L3OA 2OP4L 4HS8H 4JDZB 3WN5A 2CKBB 2Y9RT 1AE6H 5I8OH 4GXVL 2DWDB 2QHLA 4OI9A 1P7KA 3KPMB 1CG9A 5EBLA 4A6YH 3D2UD 5I1KH 4UQ3A 5F88A 3O0RH 3G5VB 2UWEA 1WSST 4HIXL 1A14H 3C6SB 4F3FA 3BZ4A 1QFHA 5M95B 3IF1A 5F3HA 1TPXB 4FQPA 3N85L 5D1ZC 5DFVD 3TH2T 2FWOA 4WU7A 4G6ML 2XWBB 1QBBA 3DUSB 1UB5A 3ZL4H 4IMKA 5GJSH 3MCG1 3I50L 4FA8A 1LP9F 1O5DT 5ILTL 3MLVL 2YUWA 2YBRB 3Q48A 4FQ1L 5GGRB 3SQOL 2NYYD 3DRQB 1YEEH 3DHMA 4BH7A 3S36H 2VUYA 4PJCA 3ULSA 2XRAH 1AXSB 5D5ME 5IV2B 1R5WB 5SWSE 3U4AA 2YPVL 4U1NB 2P48B 5EU7C 1QSZA 4N1HB 32C2A 4JDTH 5I73B 1AIFB 3ZDZE 3O3EA 4GMSL 4IMLB 1NGQL 3OQ3B 3V6OA 1X7QA 3ARFB 2DMKA 4PJIF 2G60L 1RIVH 1CGTA 5FF6A 1KB5B 4DAGL 1S78D 5K33A 4P48A 1MJUL 1I1FB 4ORGB 1EBPA 1YEHL 3L1OL 1CU4L 4UTBL 1Q94A 2Q8BH 5CBEB 3T8XB 3BAEL 2OK0L 1JF5A 5F71A 1T2XA 2E9BA 3U7YH 5EZJB 4FFZH 4QXGL 2EH7H 1YQVH 4CN4A 2PR4L 2W92A 1ETZB 4ZOBA 2DQEL 5FM8A 4N5ED 4PV8A 1QEWA 2B2XL 1A02N 2PYEA 4MA8L 4HJ0C 2AJZA 3U1SH 4OLUH 4P23A 5KS9B 3BJ91 3MACL 3OR6B 4M7LT 3UXFA 2W9DL 2HFEA 5CSBA 1WBYA 4WCYH 5A3ID 15C8L 1QZ1A 1YNLL 3LKPA 1FN4A 3G5XA 4LRNL 1I85A 4GW1B 3K74B 3IVKA 4U1JB 2G2RA 2IADA 3BIAX 3OKMB 4X7SL 2XXMB 2W38A 4QRPA 2XY2A 3EDFA 1JMXA 4M6ML 2EO1A 4RZCA 1IJ9A 4HMDA 4YHOL 5EUOE 3U0WL 1MWAL 3DROA 5JQ6L 2VXQH 3RZCC 4ZUWA 5F21B 2EYRA 1RUPH 2OSLB 1XF4B 2EYSB 3QHFL 2ADJA 4HCRL 5CGTA 4KRNA 4N8VA 1QPPA 5IROA 2A2QT 4ZS6C 4Q9RL 3RWJB 4HWZB 1EEYB 5J13C 1OGAD 1ZHKA 3ALPA 1TXKA 2EH8L 2FCBA 1A1MB 3UTTD 2B7DT 3D0VA 1HN1A 3MYZA 4PRIE 4U0RC 4ZUTB 1L7TH 1ZS8B 4HWEL 2PO6D 4NDMA 2EIZA 3KJ6L 1WT5A 5GISL 1KEML 1EK3A 2CH8A 3LN5B 2Z35A 1X4YA 4N8CL 3FMGH 4JG1H 4P4RB 4E41B 3C6LD 1J0IA 4GAGL 3KDMA 4Z7NE 2X05A 2ICEB 1NDGA 4O58L 3UJIH 4QRSA 3FQNB 5EORH 1DBKL 3BKML 3SDDA 1S7SB 2J8OA 3C8KA 3ARFD 1EGJA 1S7WB 1RK0A 3MV8A 5DJCA 4ZFOA 1NAKL 4Q2ZA 5D96C 1P4IH 3OKKB 2Q76A 3MA9H 1S9XA 1GZPB 3G6DL 4XCEB 3F5WB 5FYLH 4ZFGL 4J3UA 5GGUB 2BRRL 2HFGL 4FG6D 1OT2A 5IUSA 1BVKA 5T33H 4FNLL 4N0CD 5C6WH 1FH5L 5IT2H 3PJSA 3W5MA 1F2QA 1PLGL 3FB6B 1LQSR 3RIFK 5EZOH 3MLZH 1INDL 3G6JF 2VOTA 5HGBA 3HZKB 1HQ4A 1N4XL 4L9LA 5AD0B 3LN9A 1U8OA 2FX9L 1IEHA 2OL3A 1YEHH 2VR9A 1G7JA 3TO2B 1JGDB 3JVGA 3DNKA 1NDGB 4S1SH 5I16B 2DKUA 5ESQA 3R0NA 3L5WB 3ARBD 3TNNA 1CGYA 2EYRB 2EDJA 1VEMA 4TVSa 3QNXB 3D3VE 3PE9A 3QEGH 5JR1H 4AT6A 1B2WH 3QNYB 4LEXL 2F53D 3E2HB 3L3OB 5GJSL 3MV11 3QZWB 3LPWA 2ORBL 4NGHH 3RWCA 3VFMB 1BEYL 4RBPH 1EO8H 1KT2B 4H1LA 4PBWD 4LCIH 4ZDHB 1QSFD 4Y4HD 3TH3T 4LPCA 2E5EA 2BVTA 3KLAA 1CFNA 2J8UE 4JKLA 3WIHL 5JOPD 2BHYA 5KTEL 2YXFA 1RJZA 4LCUB 3S4SB 1CFTA 4PGDA 3NFSL 1YEDA 3E3QE 5KS9A 4I0KA 2A74A 1XF3A 2WUBL 3QRGL 2B8OT 1A6WH 3JTSB 3B83A 2GJZA 3ZMRA 3DX8A 3JBG7 4IRSA 3S5LG 2VDPL 2XNAA 4JFZL 1K8DA 1OM3L 3V7MA 3AXLA 1I7RB 3WLWC 4GKNA 4GH7B 1S7SA 4JRYD 4YUEH 1DQLL 3CDCA 1RULL 3N1FC 5IMKB 2FSEB 1PG7L 5FOBB 5EULV 3PHSA 4L4JA 4GG8A 1S5HA 1BPVA 4LSQL 2R29H 4G8GD 4E0RB 1A6ZB 2PYEE 5DGQA 3V6ZB 2ADGB 1UYWH 4MXVF 3P0VL 5ITFA 2Z35B 3T77A 2IPUK 5HHVH 5I1LA 1U8LB 3MRBA 5GGQL 1UWGL 1ZE3C 1T7XA 4Y4KC 1WBXB 2R0WH 3HG1A 4X5XA 4ALAL 1T1XA 5L88L 3PHOA 1NLBL 5HI4C 2VC2H 1F8TH 1QLEH 4WO4C 3Q5TA 4S0TD 2MNUA 5ISZE 1AKJB 1IAKA 1DCLA 1EHXA 4M1CD 3F62A 1U8NB 5E6ID 3MFFA 2APWA 2HWZL 4FQIL 1MUJA 2CO6B 4N8VB 3L3GA 1U36A 3IDGA 4JZOB 1YEDB 4MA1C 3CFBA 4OBSA 1DBBL 5AUMB 2VQTA 5ETUB 1U92A 4JZNB 4OV5A 1MAML 2ZNWA 1JZ5A 3VW3L 4XZUB 1M7IA 4J8RA 2IMMA 3P0YH 4M6OH 5D2LE 4XNZB 4BSWA 4ZUSA 3LY6A 1DQDL 2WBJD 5D72H 2QADC 1D5IH 4ACPA 1T0NA 1TVHB 1C5DA 5ESVA 5C0BD 1UWXK 1FRGL 1LVEA 1IGMH 5IESH 4WI5A 2AEWA 3ARBB 3EYVB 5ABDE 1S3KH 4XTRD 5DD6B 43CAB 3DV6B 1X44A 5JIIA 4DZBA 4M6AA 2UWEE 3SDAB 3H3KA 1V7ML 1X5XA 3KHOA 3B43A 1VDGA 2YD7A 3L3KB 5GRYA 2NY5L 2FYYA 3LSOA 3X3FL 4NNYB 1VFAB 1G7HA 4Z5RB 3JWNC 4NO2B 5I75C 2IAMB 3F7QA 3IDUA 4P5KA 3FB8B 2AJSL 1R5IA 5IJVB 4PJEE 1ITCA 1FO0L 1FNHA 5TFSL 2EEAA 2GTZB 3ZDZF 2ARJB 3ILPB 4S1DD 3VI3F 1KGCD 5I1AB 1RZ8A 2Z4QA 4AM0A 3CZJA 3O3DA 4X9FA 5BV7C 4X7SH 4MB3A 1L0QA 4KDTC 3CSBA 2W0KA 5D5MA 5ANMA 4P2OD 4QOKA 3RWFB 5SWSA 3L95A 5CZKA 3VWJA 1HCVA 3SPVB 4K8RD 4POZC 4WWKC 4ORGA 1BQHB 1RZGA 4HK3N 4M48L 5GIRB 2A6KA 4HWEH 5TDPB 4OF3A 1UZ6E 5KANI 1XF2A 1IC7H 3V6OE 5HGAA 3ET9F 4EVNA 3QDMA 1ES0A 1MCLA 2VJXA 1TETL 4HUWA 5D2NB 4R7NA 4CMMB 1AD9A 3CVIL 4G6JH 5J06A 1RPQA 2HN7A 1AIFA 1JK8A 1J1PL 1A9EA 4MJIE 5HYEA 3TGXA 5IVNA 4F8TA 2XN9A 3I6GB 4JR9L 2XKSA 1IAIH 2WWMC 3C5ZC 3CPLA 2NY3C 5JXED 4EI6B 3PL6D 5SWZB 1SJHA 8FABB 5I15L 3QUXB 3HFMH 1PY4A 4JM2F 4MLSA 1OAQL 4L3CA 5IHLB 4K23H 2AP2A 5DMGC 5CEYB 5I66B 1KLUB 2FHFA 3G6DH 2H9GB 4OD1H 3F58H 5DJ0A 1BF8A 3B9DA 1CF8L 3E1F1 3QDJA 4F58H 1F5WA 2FEDD 2X09A 1UJ3B 4GAGH 4O00A 5KSAC 1A1OB 1K8IB 4LCCA 4LLVB 5F9OH 1KLGA 1NUGA 2NY5C 2ICCA 5E8NA 1EVTC 4K94L 5GS0H 4O58H 2E7CA 2BY1A 1JRHH 3O6FA 1KACB 2AEPH 3D9AL 3FRUA 2Z8VC 4X6DB 5T5NF 3OJDB 4XVSH 3RGHA 3Q2CA 3RVVC 4NPYA 3VFVA 3MV7D 1E6JH 4QTIH 2HKFH 3WSQH 4ODWA 1NLBH 4LCUA 3BE1L 3SDDB 4Z77B 4QRPB 4UB0H 4KI5F 3SE4A 1B3JA 1AC6A 1NC4D 1OAKH 2VDRL 3QUMB 1AD9B 2HRPH 4M5ZH 1J86A 3QPQC 4TQEL 2BOBA 3L6FA 4R4BA 4B0MM 5HI5D 3CH8A 4PGEA 4ODWB 5JW3L 4XP4L 4NBZB 1NPUA 3W39B 1NDMA 4PP1D 2QQNL 4X0KB 2DYPB 2H2SC 5J6HA 1EVUA 4JVWA 4KRPB 2HJLA 3SDCC 3FQTB 1QBLH 2NNAB 2FO4B 1X5GA 1OAXH 1HHJB 1YEEL 5D9SA 3O11B 3OAUL 5HJ3B 5AG8A 5T1MA 1CK0H 5DVOA 2YMXL 5ITBH 3DIFA 1HNGA 4EN3D 4NC1C 2BX5A 2YPVH 5C0CA 1CLYH 3GEWB 4ZOEA 3QA3A 1WK0A 2GCYA 4JRXB 4Q0XL 4NWTL 1J8HD 2ADJB 1K2DB 3WFCH 1RI8A 5EO1B 2JB5L 1YJDH 4KKAC 5FECB 2H3NB 5DSCA 4JY4B 1CGUA 3V5KA 4DGVH 4J3WA 4P9HH 2MHAB 5ISZA 3DX7B 2R2EA 5F7UA 2FJHA 2XOTA 1RMFL 1NGZA 4WW2C 4TUJA 4RCAA 4NN6B 5I8EA 3VGBA 1K6QH 4JEGB 5HYSA 4M8QA 4LVEA 4FFZL 4GQ9H 3BKYH 1F58H 1BBDL 1A4KB 2UYLA 5D7KD 5E6IB 4MYWB 3BP5B 1KUMA 3EYSL 4KJYB 4YHYB 1LK2A 5I1KL 1ED3A 4CU8A 3WMSA 1W2KT 3V0AC 3IU3B 4HUWB 4GT7A 1S7QB 1DQDH 2VQ1B 3FT2B 5F6IC 1T03H 4P49A 3O6KH 4PTTA 3KDMB 4F7MA 5ID1B 3AROA 1IM9A 5IESL 4HWBA 3T3ME 4P59L 4FP8L 3D18A 5IB3A 3C08L 3T4AA 1JPSH 2PYEB 2PTVA 5EOTB 2E7MA 4DCQB 1X5KA 4XVTH 4F3FB 4NKDA 5I1CL 3BGMA 4PTUB 1KPVA 2LTQC 3GSVA 4XAKD 4YE4H 1A6AA 3UJJL 3AS2A 4YXKL 5DI8A 1U9KA 2CKBL 5ICZA 4PJXF 2NW2A 3QYCA 3O4OC 5GRUL 1OF2A 4KKBD 1J5OH 1I1FA 2IAND 1AGDB 1F8TL 1QLEL 4P2QB 2CR3A 5GGVH 4P2RA 1DQQB 2AJSH 2XXCB 4DWHA 3MOBH 3VU2A 4NN5C 1BLNB 2JJTC 3DSFL 6CGTA 4Y5VC 4LLQB 4PJ8B 2VIRA 5CMAB 3ARUA 4HKJA 3SJVA 5E5UB 2ICWJ 4G8IB 2YD4A 3UROR 2DKSA 4NM8L 1GGTA 3V6OC 3V0VA 3IVKB 3MLPA 4OCWH 4C56D 3IDMA 3LEYL 4Y5YA 5KVGH 3MCLH 4K3JL 3U0TA 1XF2B 4MSWB 3MGTB 2HT2C 1B88A 5L8KB 2R2HB 1B6UA 5GRWA 1X6NA 3VFOA 1LEIA 1OLLA 4GMTL 1ROWA 4L1DA 3HCVA 2D0FA 4L3EB 3MJ7A 4PY8I 4MDJB 4FS0A 5TQ2H 5FEBA 2OP4H 4HBQA 4HS8L 2H2PD 4P3DB 3HPLA 3H9SD 1G6RH 3PQYB 5CP7A 2XZZA 4WTZG 5F9JB 2Z31A 3Q6FA 1MIML 4ISVA 1INQA 4CVUA 4WI2A 5HHNB 1F3JA 4RGMC 4BFEA 4XPBL 3LEXB 1MRDL 2BY3A 4MQ7A 5HVWA 3JWOH 4JCMA 3IAQA 1TQCC 5CZXC 4HGWB 4O02H 4Y4KB 4WV1C 3BQUC 3HE7D 1CGSH 2DIBA 1JZ2A 3WIIL 4MAYB 4WO4B 5L0QB 1U8OB 5GPRA 5D7IB 5H35A 3BVNA 2FD6L 1JPST 2NXZB 5E4IA 2DJUA 4F7CA 5CCKL 1Z0MA 5IVXE 4DFIA 2MSPA 3I6LE 4LNRB 1L7TL 5E9DE 1DN0A 1PG7X 5FECA 4XNYL 1D6EA 3I75A 5HYJE 1JWMB 4Y5YC 1XF5B 3MBXH 3DYOA 4XCEA 1IM9B 1QFUL 2JF1A 3UTZB 3EZJB 1ZT4B 1F90H 2NX5A 2XV6B 3UDWC 1JHTA 5MENA 5CEZL 1ERNA 5C7XH 5KW9H 1E6OL 1K3IA 4X7CC 2GITA 1SYVB 5HHOB 2LABA 2PO6B 3CMGA 1QOKA 3KWWA 1TFHA 2ITCA 2JJTA 1JYNA 1CU4H 4UTBH 3JWDH 1PZ5A 1QQDA 3WS6C 3FO2A 4P2YA 2CXGA 3O6ML 4OI8A 1WISA 5D7SH 1S9KC 2C5DC 1DL7H 4PGEB 2HRPL 4D0BA 5I1GH 2NY4D 3WEXA 3TNNB 3ZHKA 4JG0H 4NDMB 4NQXA 4OCYH 5EN2A 3U9PH 3LQMA 1I1YA 2O5YL 5I1GL 3BMVA 3WXVL 2I5YH 1MH5B 1E6JL 4QTIL 2BSTA 4QOKE 2F8VA 2AXGB 4HMEA 4LK4A 2H1PL 3RPIA 2CD0A 1EEYA 4PRHD 2AVGA 2BVOA 1Y0LB 3INUH 1I8MB 1XGUA 4DN3H 3ZTNH 3VFVB 2FX9H 3LIZL 2R9HD 1FG9C 4QOKB 1T2QH 1CBVL 1PEZA 2AJYH 3OGCB 4YPGB 1I9JH 1S9YB 5DHYB 3FFCE 3IJYA 5KAQG 4KK5C 3IKCA 1U58B 3OKKA 1WZKA 4MXQC 4OZGF 5IB1A 3QAZC 4OFVA 1IGML 1A7OL 3O6FC 1CXLA 3WDHA 5C0EA 3LQAC 3K1KC 5CJQH 5TF1L 4WFGD 5BS0A 5E9DB 1EUUA 4ONFL 4XCYB 1JV5B 1UXSB 5MHSD 5I76A 4HGWA 1JPTH 2P5WB 5TQ2L 4DTGH 4QXTA 5CJXA 3GDBA 5ALBL 4XWOD 4ODTL 1DP0A 4YDIL 3KAAA 1PQZB 2GHWB 5GGRY 5L2KE 4PLNC 2JK5A 2Z92A 1C08A 5B3JE 3BDBA 4EBQL 2OLDA 5IBTH 3QG7L 5I74B 2DDQH 1FVCB 2RHEA 3GM0A 4NZUL 1TVBB 4HULB 1E4WH 3QWOB 4AIZB 3BW9B 5A2KH 1NCBL 3MLVH 4G9FE 2J1KA 3U7WL 1TJHL 2EIEA 1BQLH 1CGXA 2FGWL 5BZWA 4WFHE 5IVXB 5ETUA 5ACMA 2NTFA 2H8PA 2MQCA 5DR5H 3RWDA 1V7NL 3T4YA 1H3UA 1CGSL 5IB5A 4YO0A 5CSGA 2EH8H 1ZGLP 1AO7A 1ZHBA 4JB9L 3QPXH 1U42A 2AQ3A 4K9EH 2X89D 2VLME 3KPSD 4QRPD 3L9RA 2EYTB 1HOCB 4HCRH 5C8JA 4XWGL 1ZSDA 3FO1A 4YHPB 5HHQA 1DSFL 5D7LA 5FYKH 1XGRA 5AYUH 5L2KD 1RURH 3CFDB 1D5BA 4PJXA 2ADIA 1NLDH 2NTSP 2VLJE 4Z7VA 3KPOB 4TSCH 1BFTA 3AGVA 4WFFE 1INEL 4YDKH 5T1KA 5C0GB 4YHLH 2GTWA 4V1DD 4AEHL 1F2XK 3O3UN 4I9WE 4KROD 4GQPH 1KFAH 1VKXA 1WCQA 1OGAA 4HF5L 3KVQA 3MRRB 5HYQB 25C8L 1U3HA 1DBAH 4KJWD 3JWOL 4P4KB 5DQJA 2X9YA 5KSBE 5F72S 4GRLA 4QO1A 3O3AA 3VWKC 3V7AG 1M7DB 3ETBF 2UWEB 3K81A 3LKOA 3VXPA 3D39B 5DK3A 1NBVH 4B7IA 4BZ2L 4MJ6B 5DURB 4KVCH 3FL7A 3CFBB 5HHVL 1XF5A 3PGFH 3T3MF 2OXHA 5IIEB 3N85H 2CKBA 2AW2A 1GHFH 3RU8L 4WEMB 1JGVH 2KZ1B 3O2DA 2YKLH 3ARFA 4PRAB 3LRHA 3SKJH 2R4SH 2VLJB 5JOPE 1N0XH 4H26A 5FK9B 2WP3T 4RWYH 4NQDD 1MCPH 2F5BL 4WO4A 3TBTB 1YMME 5IFHL 1CFBA 4LLUB 3T0EC 5E08H 2Y5TB 1M7IB 1K3ZA 1C1EH 2V2XB 5BVPL 2A6DA 1FIGH 1EAJA 1AC0A 2VDPH 3DO7B 2G9HB 4NQDB 3LPFA 4LU5H 3IXAA 1IGTA 5EIIA 3KYNA 5ILTH 3KPLA 4MX7A 3VD3A 2HA1A 3STBA 4URTB 4X6FA 1P6FA 1ADQH 4IRJD 2JLLA 3MV9B 3KPSB 4X99A 3HE6C 2ATPA 1OD7A 5CAYB 4P3WA 1OTTD 3RUGA 3RTQB 3OF6A 1FZOB 1HEZA 2PTUA 3ARDC 1E4WL 4NZTL 3T8XA 2BHZA 1P1ZA 1H5BC 2Q76B 4G6FB 4K94C 3ALXA 3KYKH 4NBXB 3C87A 1ORQA 2QSCH 1T2QL 3H3BC 3HZYA 2N56A 1YJDL 3RIAK 4PB9L 4ZAKD 5FOBA 3CVHB 3MXVL 3X14A 1BJ8A 5EOCL 3CFEB 4KPHH 3V5DB 3RZCB 5J9PA 1TQBB 3HAEH 1WAAA 2CDGA 3BP6B 3AU1A 1CICB 1QLRA 3GI8L 3TYFA 4RMQA 1Z9OA 4E41A 5EWIL 2ZUTA 1A0QH 1KJ2H 4OV6F 3DX7A 2HTLC 2DJ4A 3UPAA 5LQBL 4XWGH 1I1AD 4XCNA 1L4IA 2V7NA 4QHMB 4R96B 5BV7H 1UM6H 4OLZH 4JKKA 1H0DA 4MNQB 4K7PH 3LH2L 1I1RA 3CSGA 3GKWH 4GRLC 4MDIA 4JRYA 3GI9L 1YMHA 3X13B 1S7UB 5D70L 1LO3H 1FDLH 2AJXH 4TSAL 1WV7T 3U4EB 5BV7L 3D6GA 1NUFA 1U6AL 2BFVH 5CILH 4UAOB 1ZVHA 3T0WA 3BHBA 3MUZ1 3KXFB 1OW0A 2VSDA 2V9RA 1ZGLB 4FQJH 3MOQA 1NJ9B 2JTDA 2QADB 1MFCH 1MWAH 1S7TA 4OZHB 1P7KB 3DBXB 2EC8A 1HYSC 1PFCA 4UQ2B 4KK8D 1NFDF 3C60C 4LVNB 1W72B 4HUVA 1JWUA 3FCTB 4NRXB 1AR1C 5FYLE 4DKDC 2DQTH 4ZFZA 4NWUH 1NFIA 3J8F7 4XMPH 2FB4H 4JGUA 5IMMB 4OIAA 4PLKC 3IFPB 3DO3A 2JELH 4AG4L 4ODTH 5J89A 1JGDA 4WIQA 3K8LA 3FT3B 3D85A 3MLRL 4WUUA 1DN2A 3QIUD 4PD4J 4ETQB 2NY7L 1MY5A 2Q87A 3MR9B 1L0YA 3QEUB 3UTPE 3OJMB 1ZLUK 4XH2B 4OCSH 2PF6A 3SKOB 2PUQT 3IS1X 4QKXB 4YDJB 5GGTH 5T3XL 3PP3H 5F7WC 5EOCJ 1KIUA 4NO3A 8CGTA 4WUKH 3LKQB 5E24E 4V1DB 3GSQB 3SDAD 2PN5A 3T0DA 3ZLQC 2DQHH 3P40A 5E6YA 2E9WA 2FR4A 1IFHL 3NCFB 5FV1L 1R5VB 5T1LB 2DQIL 2DBLH 2H32H 2OYPA 3UYOD 2FZ3B 3SOBH 3G5YB 4GAFB 1OQXA 3QCTL 2HT4D 3LEYH 4XI5C 3F7YB 4Z0BL 3EGSB 4J4PC 2A73B 1UZ8B 3FRPG 1R3KA 4Y16C 4LCWA 4ZUWB 5JIHA 5C0AA 1NDMB 1BFSA 1X7QB 3ALWA 4X9BA 1OSPL 5KVFH 3DYMA 3QI9C 4H25A 2CIKB 1B4JH 43C9B 3C60A 2O5XH 1QBML 3QB7C 4D0DA 4YBQD 5C9JA 3U0PB 1ZT1B 1LNUB 4I48B 4JO3H 3VFNA 2ITCB 2IJ0C 1QFWM 4X6DF 4I0CC 1EFXD 3MNWA 5KN5B 3L5IA 2I60H 4FQCL 4DKFH 4RMRA 2I24N 4Z7UF 1I1AB 1SBSL 5D4QA 2B1AL 5H94B 4P2OA 3H7BA 4QOKD 1G1CA 1MEXL 4GKZA 2HG5A 2LVEA 3FFCA 3HPLB 2NY6D 4XNQA 3QHFH 4MQXC 3K4DA 5KSAB 3ELAT 2F53E 1FRGH 1GIGL 3RWHB 4XPBH 1MUJB 2VZUA 4WHYH 2LE9A 1MI5D 3PWUA 3QIBB 4BM7A 1LO2L 1UENA 2A38A 1M71B 4UNVA 2AJZB 3JTTA 4LVHC 4OB5H 1J8HE 5T5NG 5E2WL 4MJ2A 1ZHNA 4O2FB 2WINA 3B9VA 4FZ8H 1XGPA 3U48A 4YJZL 2ZJSH 3GSNH 4ELKA 3IB4A 3PL6A 1DANU 1CG9B 1AP2A 2FBJL 3BP7A 3OXRB 3DVIA 5E8DL 3GMNB 5JXAH 5C70A 1VACA 2EE6A 1GC1L 4OCWL 4L8SA 3EOYG 3HPJB 2NCMA 3LKPB 4OLEA 3LPGA 3CC5B 1UM4H 4ONHA 5D71H 4MQXD 4UOW1 1ZA3A 4KVCL 4JN2A 4NM8H 5C0DB 5BS0B 4QXWA 4LHUG 3GMMA 5DJ6B 3T0EE 1JRHI 1OCWL 1GGBH 3HC0A 4FXGB 5DHVA 2DN7A 4GO6B 3LD8C 4LLWB 3Q6FB 5C8JB 1AO7E 4JFDE 4PJCB 1QNZL 3WFEH 4BFBD 4X6CF 5CINL 2JB5H 4R7NB 5ISZB 5GZNC 1D9KC 1FORH 1DQLH 4IM8A 1AO7B 1ZHBB 1JN6A 4PJCE 4GAYB 4LSSL 4Y4FD 1P84J 3EJZD 4OCLC 2F54A 3RKDC 3K4ZA 1BIIB 3RWFA 4KZDH 3GMLB 1GL4B 4HK3J 5J1AB 4Z7NF 1MOEA 3WFHA 4U3CA 4ZTOL 3PDOA 1XFPA 1WIOA 2VQ1A 2WMPA 3QXUA 5EU7E 5KSUA 3PHOB 4LEXH 4UTAL 4DZ8A 3RDTB 1WTLA 2BVUA 3WNMA 3HG1B 1IAII