1FNEA

Histocompatibility antigen
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
182
Chain Sequence
b'IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional consequences of altering a peptide MHC anchor residue.
pubmed rcsb
molecule keywords PROTEIN (MHC CLASS II I-EK, ALPHA CHAIN)
source organism Mus musculus
molecule tags Immune system
total genus 38
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fneA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1fneA01
5IEHA 4JJHA 2MCPH 3DXAB 4RMTA 4J4PD 2EXYD 1T5WB 4FMKA 4RZCB 1NFDE 4OIAA 4H25B 4Z5RA 2FGWH 4DN3H 1XF4A 3CFDA 5DS8A 2GTZB 2ZKHL 3OKDA 1NH6A 5T5FH 3W0WD 1AXIB 1G7QA 3OB0K 1E6OH 4PJXB 1NEUA 1X5GA 5CJOH 4KROD 1BM3L 5D93B 5GRUH 5DVKA 5IMOA 5CJ5A 3RVWC 3CX5J 1FGNH 1PBYA 3MNWB 4NFBA 4X9FA 3MREA 4XNXL 5D2NB 3TA3D 3V7MA 3WXWL 1DANU 3PP3H 4HKJB 3SDAD 5JHDD 1UWGL 3SDXA 3H42H 5I19H 4PS4H 2OL3B 2R1YA 4Y5YB 5EU6A 1CG9A 3KPMB 1IM9A 2VE6A 2R0KL 5E8PA 4G8GA 4GBXD 4LSRL 1NCTA 2DBLH 4NQCA 4ZTPL 1I8KA 1XEDA 2NTFA 4GKSA 5GGRY 1LDPH 1ZKAA 5BMFL 5BO1L 1KJMA 4R8WH 4UU9B 5FOBA 2H32H 2KL6A 5HGGS 4LASH 5CHNA 4Z76A 1MHHA 3TF7C 1HINL 4W68A 5E2VL 1OTTD 2FBOJ 1S9YA 3F7QA 3W82A 1QO3A 1S3KH 3ARVA 1FYTA 1J8HA 3FO2A 1RZ8A 1RZIA 4OAWB 4B50A 4X80L 4KRLB 4X6BA 5TF1L 5K9OA 1R5IA 5J12C 3MRNA 4HDIB 5AG8A 1KCLA 1XT5A 1VACB 3GSNH 2HVJA 3TBSB 1NGZA 2A2QT 3BW9A 3BUTA 1K4DB 4NKOA 4ZO6A 1BIIB 3MACL 3O4LB 1B3JA 1C5DA 3CCHA 1NCAH 4P5KB 1ULVA 4XVJH 1A14H 1NC4A 3QNYA 4KI5D 4BSVA 1DQLL 4OCXH 2A0LD 3BQUD 3I84A 4NBZB 1Z9MA 1X4XA 3IFPA 3MCLL 4GRWF 3D39B 3P9LB 1MUJA 1JMXA 2NY0C 3T65A 3MRMB 5F6IB 2JELH 4MD0B 5F6HJ 4JFPB 1KLGA 4DOHB 1YEFH 5E4EB 4LARL 3HNTL 2PTTA 3G5ZA 5FUCE 3GHBH 1AI1H 5C0CA 3CXDL 1UQSB 1JZ7A 4UNUA 1LEGB 1RJCA 1JPFB 2UVEA 5DSCA 1Q9KB 3LKNA 3PGCA 2X44D 5EUKA 2BC4A 2NLJB 4DW2L 4H0IA 5H94B 3D85D 1N4XH 3HNVH 1RURH 2YWZA 3U2SA 2AABL 1HEZA 5GJTH 5IK3B 2FJGB 1OARL 4DUWA 3FRPG 1BJ1H 4X4MA 3QDMD 1QSFB 3SKNB 4FQJL 5L7XH 4NO5A 1L9MA 4M7LT 2NZIA 3BP5A 4P46C 1MQKL 4FP8H 4RNRB 2YPKA 3PWJA 4XP6L 5DVOA 2X4RB 1YEJL 5JMRA 4WU7A 3DO7B 3S4SG 5BW7A 2NXZC 3MA9H 5DMIH 5IG7A 5J11C 1ZEAL 1C08B 3MRGB 3OXSB 4BM7A 2DWDB 1NAMB 3QXVA 2XRAL 3CSYA 5J57B 4OD1H 3DOSA 4LKXB 1XAUA 1BF2A 1C5CH 1ND0A 4P9MH 2HG5B 2J5LB 2EDTA 3BIAX 3QI9D 2ICEA 5EBMB 5I71C 4I0CC 1PEWA 4H8WH 3LMJL 3RUGF 2R1WA 1WF5A 1PY9A 3QPXL 4HIIB 5C2BH 1JFQL 5C07E 2FSEA 5DLML 1KJ2A 1PG7L 5C08A 4ZSOA 5DRXB 1FNGB 5J1AA 5DC9B 1BZ9B 2QSCH 3CFIC 5E8NA 4JRXE 1TCRA 1IT9H 2JLLA 4KQ4L 4RMUA 2D31A 1J1PH 5TE7L 5C09B 4FZEL 1GSMA 2DKSA 1V3MA 2Z31A 5D1ZB 3GIVB 3V6OC 2WLZA 4ZAKB 4M43L 1U8LB 3V8CA 5DDHB 3WFEH 2XT1B 4PV9B 1TQCC 3FRUA 1W0YT 2PTVA 5HYJA 1WFOA 5IROC 3RZCB 4K8RD 6CGTA 2VLRA 1G9EA 1RMFH 3EW3B 4KK8D 4P2QD 2Z93B 1A1MB 1LO3L 5EIVA 4ONHA 3QEHB 5GSVB 4YUEL 3T4YA 2R23B 2VZVA 3KPRB 1G1YA 1CTOA 4JG0L 2X1XR 1RIHL 4HWZB 2ZOLB 2YN5A 1ZGLB 3UPRA 3QUXD 3JWOH 5I0ZA 5BCAA 1KPRB 3THMH 4RWHA 2PCPA 2ADGA 4ZUTB 3FFDB 2EIDA 4UDUB 3O3BA 1CL7L 4U1GC 5FGBC 2WIIB 2AJZB 3LSOB 4PRBA 2CO6B 1KB9K 1JN6B 3B9DA 1T04B 3MRIB 5D7JC 4P4RB 5L2JB 2I07A 3VXSE 4M1GH 4BFEA 5ESAA 2R69H 3DGCR 3QEQD 4P3DB 1CDHA 1BFOA 1F4YL 4PY7B 4KDTC 1T6VN 4PJCE 4GW4B 4ODWB 3SDCB 4GFTB 1LMKA 3BWAA 4WI2A 4Y16D 5C8JA 4EDXA 1IAIH 5ENWB 4JQVC 1WFNA 5LQBL 4R4ND 3VCLA 3HE7A 4YDVB 4RRPA 3WBDA 4EN3C 3RWJA 3TBTB 3QYCA 5I6XC 4GS7B 3MLVL 4JPVL 1PGRB 5KVGL 3QHZH 4H8WC 5KS9F 3QH3B 4XI5C 1NGWA 1MSPA 2DN7A 1HCFX 4I0PC 4PB0H 2FR4A 1X5XA 3ZSTA 5HI5C 1M7IA 3V5DA 1MOEA 5A3ID 3U9UA 4LOUC 3LKQA 4PRIE 5DQ9A 3IJHA 2Q7YA 3Q1SH 3O81A 3BH8A 4YHMH 4HKBA 2I26N 1FBIH 4K8RL 4HCRA 1F90L 4JFYA 1A6VH 2WBJA 4UV4L 2A1WL 1IARB 2R2EB 5CUSH 1D5MB 1A7PL 3B9KA 5I8CB 3QO1A 5F97E 2M26A 5LJYH 4P4KD 3JTSB 3GUTA 1XGPB 1VSCA 1A7BA 1DBAL 4I4WB 1SJHB 2GK2A 1S5HB 1AE6H 3Q48A 5C7XH 4G6ML 2KKQA 2ORBL 3IF1B 4QNPE 3GRWH 1AHWC 1HDMA 4XPGH 2D4DA 3QT2A 1UGNA 2BCKA 1AY1H 2IQ9L 3S9DB 4KK6C 3OPZL 1W0WB 5KSBB 4WWID 5I1KL 3E8UL 1FO0H 2HVKB 3P3YA 4TQEH 1I9EA 3DMMD 1YN7A 4G7YL 2H1PL 4IRSD 5FYKE 4KZDH 1MCPH 1NMAL 5DFVD 2JB5H 5INDB 2VH5L 1Q0XH 3HRZB 2BHZA 3FT4B 5FYLE 1JWUB 3KPQB 1DBBL 5DURD 5ERWB 1EEYA 1WBZB 4O9HH 1QP1A 4OLZH 4KI5F 3TVMB 4UV7H 2J6EL 1AP2B 2C3GA 5BS0B 3GNML 2BOBA 5HYEA 5L0QC 1DVFB 3FQNB 5HGAB 4J3TA 4FTVD 4OCYL 3X3GH 2HH0L 2M1KA 1Q9WA 3HRPA 3ARDC 3LV3B 2J8UA 2NY4B 2RFXA 1XIWB 3BPLB 5I1HL 4PJHF 5T1KB 2PO6B 2YEZB 4V1DB 5FUCC 4XCFH 1JWMA 3QIWC 1DE4B 2VXVH 5D1QB 5KS9A 2BNQE 3MV8E 3TA3A 1EAPA 1IEBA 4JPKL 4RAUB 2NX5D 3SDAA 3QFDB 1A9BB 5F7UA 1JI1A 2EE6A 3DETD 1PSKL 5J7CC 3DO3A 1M05A 5J06A 1KENL 1UADC 2EH8H 5FM4A 4G8EB 5TFSL 3ALPA 5AZEH 2XZQL 5CLTA 4IMKA 4GKNB 1JGDB 2A83A 2OJEA 1KCSH 3ZDYE 1G7PA 35C8H 1K8DA 4EUPG 1BLNA 2WSKA 1PEZA 4LCYB 4M5YH 4KKAD 5DMKA 1AGBB 4U1IB 2VR9A 2DM7A 2P45B 3CJJA 5IF0B 3VXUA 3EFFA 1MFBH 2RBLA 5EU4B 3VXOA 4JQXC 5CKAA 1Q94B 1OTSD 2NZ9D 2R9HD 4KKCD 4R3SB 4LSPH 3WFCH 3NZHH 1Q9OB 1K3IA 1CE6A 5J9PB 4LL9A 1AQDA 4MMZC 4XBEH 4GJTB 2CDFA 5ADOL 4RAVA 3K4DA 3H0TB 3V5HB 4JJ5B 5IESL 3H3BC 1EGJA 4JFXA 4XMPL 2X10A 2FATL 4JFDA 2FB4L 5CJBA 1TQBC 1FL6B 5TDPB 4I9WE 1CE1H 2OTWB 4MJIE 3VI4F 2FLRT 2MQ3A 1WK0A 4HWBH 3GGWA 5D7KD 2O5XL 1EMTL 3BQUA 5DHVH 5E5RB 4LCWB 1UM6H 1HXYB 2OLDA 3PDDA 3T2NL 4IIQA 3TN0A 5CIPA 4QHNA 4PRPD 1QBLH 5GGSA 5HBBA 1UB6A 2FIKA 1OWRM 4AL8L 1WCBB 3PWPB 4DKFL 4UILL 4C58B 1G7LB 5KANG 2PR4L 4M8QA 1T2QL 3QRGL 4I8DA 1OAZH 4X98A 1TJHH 1IQWH 1XGYL 2CKNA 3HS0A 3QFJD 4XNUL 3WL9B 2WQ8A 4JFZL 3RWFB 3A6CL 2WM0A 4MJ4A 4CKVX 2KPNA 2D7TH 4WCYH 3KYOA 5DO2C 4YFEA 2JKXA 1L9NA 3CMOL 1GIGL 3KYMA 4JZOA 5CWSA 3ALWA 2H6PB 4OQTL 2NW3B 4GLRI 4Y2DC 1EBPA 2FEEI 3QNZB 4EUPB 1FSKB 3HZVB 5FYKH 2ICES 2Z0BA 4JLRA 4JDZA 5JO5B 4Y5XC 5FIEA 5FYLH 5DRZB 1F4WH 4HJ0C 1OL0A 3OAUH 5DJAA 3IJYB 4XNQA 1T1ZA 3RVVC 2HJLB 4PGBA 3O2DL 4FFWC 4Q6IA 5EOTB 3ALXA 1BZ7B 4HQQL 3SE9H 5C9KA 5C0AA 3UC0L 5I1CL 4Z7VE 5F7DB 3CZJA 1KEGH 4MD5A 1PZ5B 4B7LA 4F7TB 3DUUB 3UMTA 5HGBB 3PG2A 2AK4B 2E3VA 1A47A 1T89C 2F54E 4L9LB 4AY0A 3BXNB 4NQDD 3UBXA 1WBXB 1HOCA 1HQ4B 3GMQA 4RIRA 1DUYA 1YUHA 4YQXH 4M6OH 4IOFC 4F7PA 5DHYB 4NQEE 5CMAA 1FVEB 3ESUF 4QRSA 4YEEA 2VLKA 3UTSD 4LLYA 5EPMA 5I9QB 1I8MA 2CKBA 1ORSA 2ITCA 4S0TD 1G84A 4PB9H 4DGIL 4GXVH 3RHWK 3W2DH 3HCVB 3DX6B 2A6DB 1SBSL 3QXUA 5F71A 2Y5EA 1NBQA 2BX5A 2LU4A 3ME0A 4C56B 1T03H 1A7QH 4L1DA 3D0VB 2ZG2A 3NFNB 3TC9A 1H5BB 3S7GA 3OGCA 3A67H 2AQ3A 3I02A 1R6VA 3DJ9A 1JPSH 1MRDL 4NM8L 3MA7A 2EKSA 2BY1A 4L3EB 2R2CA 3TIEB 2EH7L 5EWIL 5E6ZA 3D25A 3GHEL 3GB7B 3UJJH 3STZA 4KKNA 1AGCA 5T1LB 4B7IA 5K9KA 5IM7A 4LLQB 1E4XI 5F3HA 43CAA 2YD2A 3TZVA 2Q7NA 4QRRE 3UJTL 2OSLA 3QUXA 3HE6B 4KK9D 4ZFOL 5TJWK 4RFOL 5JXED 1FORH 5A2JH 2SEBA 1U3YA 3QDJE 4X9BA 3VH8B 3MUGA 2J12B 3DWTA 4PJEB 4CRPA 3OR6A 4PD4K 2Y36H 4QOKB 4OGYH 1G7HB 4FABH 4ETYA 1IGTB 2N7BA 4WW2C 4MCZB 3QEQA 1HKLL 2AXGA 3D18B 4MAUL 5HY9A 5ACZA 2ICCA 4KHTH 3LKSA 3OKKA 4P23C 5E5UB 2COQA 4FRWA 1NGPL 3DUHA 3DNKA 2J6EA 5DR5H 5IB3A 4Y16A 3HC3L 5E8EB 3H3KA 2A73A 3KXFA 4PREA 5JPNA 5HHOB 4DUXA 1Q0YH 2ITDB 2XZCL 3LPFA 3QEGL 2IFFH 3ILPB 1E4XH 5DZOA 4YHNA 5I1DB 2P5WA 1K6QL 5DUBA 5GJSH 5HHMB 1SEBA 3GSXA 1BREA 1LEIA 5FOJA 4WV1B 5DUMH 1OAXH 1HILB 4HFUL 3WEXA 3U7WH 4EEEA 5FA4A 3QUML 5DEGB 1D9KD 4OB5H 1NMBH 1KJVB 3QCVH 3DECA 4RGNE 5IB5A 4TPRL 3GIZH 1ACYL 4MD4B 3KS0J 2W0FA 2AXJA 3VXMB 5A16A 2W9LA 2AI0L 3X11A 1AIFA 1PYWB 3INUH 4G7VH 3AUVA 2AV7A 2DTSA 1JNJA 4MXWL 4YDJA 3WNOA 4DTGL 4TUOB 2VXQH 3QNXA 3S35H 4U1HB 3CK0L 2JE8A 2RIKA 5E2UH 4OZ4B 5FUZL 2I5YL 4IOSD 4F7CA 5C0DB 3QDGD 3MJ9H 3U4BH 1TMCB 3T08A 2WMPA 4YHOL 2ZPKH 12E8L 4ZO7A 1V05A 4O4YH 5EOCH 5HHVL 1QA9B 1T0PB 1K3ZA 1C12B 2P5EB 2BVUA 5F1NB 5IVZA 4NKDA 4I48A 2OQJA 5GPRA 4IRSA 2W07A 5ESQB 1MH5A 3HNSL 3MJGX 2ZUWA 3PP3K 2C1PB 5HI4C 1XH3A 4GAJL 3RWIA 4GG6B 1VPOH 3NCFB 4HH9A 2W9EL 3ESVF 3SDYL 1TZHB 3F7YB 4Y4KB 1T4KA 1MJUH 5FB8B 3WNMA 4YHLL 2VSDA 3FOLB 1RZFH 3TCLA 1WWWX 3GSRB 4DJMA 1MNUL 1PQZA 2ICWI 2NY5H 2Z92A 3CSBA 5DD6A 2KZ1B 2F5BL 3B83A 3HFML 4OZFA 1CDGA 4ODVL 4D0BB 1RJZB 1A8JH 3RGVA 5AWNH 3GMLB 4KROB 5HPOA 5KOMC 2NX5A 2LABA 4H1LH 4XPHL 3T4AA 5IIEA 3MJ8A 4ZNEA 1ADQL 2VXSH 4XWGL 1HE7A 1S5IH 4NOFA 2VLJE 5CJQL 3B2UC 4XP9L 5JHDB 2VDRL 1HSAA 4TULH 1A6TA 4XXCA 2QL1A 5IBLC 2X4SA 5DD3L 3VFWB 1TETH 4QF1A 4MNQE 4GBXB 5CJXA 1U42A 4HC1A 3IDMA 1TTGA 1XF5B 3IT8D 4PJGE 4LGSB 4U1SB 3R1GH 4FQQA 2EZ0C 3L9RB 1ZLVK 4LDLB 4O2FB 1H3UA 3NIFF 4POYA 1JF1A 1JZ5A 5C0IB 4ORZC 2Y7QB 1ZK9A 5CBEB 2K3TA 4Q74A 2XWJA 4DVRH 1F6LL 1NLBH 4YE4H 4S1RH 3EO1B 3I3DA 2CDEB 1JPFA 5DJCB 2GY7B 4YFDB 5I1LB 5IHZA 4U6YB 1JWSB 4HS3B 1FL5A 1G6RB 5E6IA 3F12B 4AQOA 3MRDB 4JFEE 3HMXH 3NBNA 1X7QB 3PE9A 4EIZC 4Z7UE 4GW5A 3OJMB 3O4OC 5ALCH 3C6SA 4ODXA 4S11A 3I6KA 1NDGB 1B2WH 4HBQA 3IETB 1YMMD 3N85H 1VGEH 4PRPA 4QXUH 4U33A 4XMLL 5BOPA 3STLB 4MXVE 3ES6A 1PKQB 2DL2A 2XPGA 3O8XB 2VR5A 5KTEH 4YBHA 3DO7A 3VXTA 5T5NF 2C3XA 1RD6A 3TNMA 3C8KA 5ICZB 4P46D 3RIFF 3ZKSD 3O45A 4BK5A 1KFAL 3EYFA 1QSEE 5KN5B 4PJHB 3AMLA 2EDHA 4ZO9A 4I77H 5IR1A 3RDTB 2NXZD 1I9RL 1U3ZA 3MOAL 4N0RA 5BRZD 5A2KH 5HJ3B 2HG5A 4DN4L 4JFQB 4Q7DA 3TPUA 4R2GB 1EHLL 3BGFC 3NN8A 4CVZA 2VAAA 3T0EE 5HGHB 4I3RH 4I3SH 3MCKB 4MLSA 4K7PH 4X6CA 2P8MB 3D85B 3AB0C 3P4MB 3NAAH 2YXMA 1S9VA 2ESVE 4HT1L 1KV3A 3T0VA 3BFOA 3QAZC 3QWOA 4UUJA 2D7PA 1EJOL 4DCQA 2W60B 3QDMB 4Z7OE 3K4AA 4A6YA 1MCKA 3IJSB 4C59B 3MLZL 4U6TA 3H9YA 3RY4A 5T1DH 1TPXB 3L7EB 4OD2B 4G6FB 2YKLH 3MXWH 5E9DB 1JK8A 3EYVB 1JUFB 4HW6A 2ADJB 4DN3L 1LNUB 3QQ3B 5T5FL 2RQ8A 1E6OL 2HAZA 5I8KH 3FRPA 3F5WA 5GRUL 1CGTA 1FGNL 3QI9B 4YC2B 4Y4FB 3N06B 4BFBD 4UDTA 1YEDA 1F2XK 3LD8C 5DT1H 1ED3A 5B3JE 3ARZA 3CFBA 5I19L 4ZUUB 1A1NA 5J1SC 5GRVK 1N6VA 3S4SA 3HR5B 4LPYA 1QOKA 4HWEH 2DBLL 1F3DJ 4XH2A 1HHJB 4PBWD 5TDNB 1LDPL 4LRNH 5MEQB 2Y5TA 3AS2A 1ZANL 2XTLA 4R8WL 1T6WA 4PJFB 1T1YB 4LASL 4EXPX 3K7UA 5GRZA 5IMMB 4F58H 5FGRA 2YD5A 5D7JD 3HPLB 5C0BD 5CEYA 4IDJH 1V3LA 4EXKA 4O00A 4YXHH 4UB0H 1MIEH 1S3KL 3PHOB 5JOPE 2GSIA 2GEEA 3L1OL 3CFKA 2J1KA 4LSQH 2FDBP 4HV8A 4JGMA 4EQ2A 1B6DA 4P2QB 3RKDC 4LSVH 4FQXC 3TBTA 5J1TC 1KCVH 5JXEA 5L8KB 3GSNL 5FO7A 2JCCE 3REWB 1LE9A 4EN3D 1WWAX 4OLXL 1IQDA 3OXRA 1Z9OA 4LLDB 1LP9E 1T7VA 2LVEA 1G0YR 1NCAL 2DQTH 4YLQT 3JV0A 1RJYB 3JTTA 1A14L 4JPWH 4RDQF 4XI5D 5EN2A 4I0PD 4O2CA 5AG9A 1DFBH 4KVNH 5HI5D 4L3CA 2IGFL 5JW5B 2HRLA 2XA3A 4KQ3L 4FXLA 4LOUD 2YS4A 5F1OB 2G9HB 2JELL 3B2VH 4LPTA 5FKAB 5IBUB 3EO0A 3DBXB 2DKMA 5I8CA 1BBJB 1OSZA 4U05A 1IM3B 2DKUA 4NYLB 4XVUD 3GHBL 3MLUH 2LAGB 3B5HA 2X4OB 2Y25A 3MLTA 1JYVA 3O0RL 3BRFA 1NCWH 2E9BA 4PBVC 1EVUA 4QEGA 3KPSB 3ZZ1A 3UP1A 4KY1H 5ITBL 2R0WH 3RZWA 1N4XL 3PDOA 1D9KA 4U3CA 3RA7H 5JA8B 5IVXF 1ADQA 1IC1A 1IAKB 3T2PA 5GJTL 3DLQR 3IXAA 2OJZL 4G42B 4KK6D 2X4NB 3FT4A 2AJUH 3CSPA 4O51B 5L7XL 2NQCA 3RY6C 5FO8B 4UAOC 3V7AE 5CP3H 3CZFA 2P8PB 4FP8L 1F00I 2I25N 1JV5A 5BV7C 4LMQI 2MTPA 3WE6B 2PW1A 5E00B 3VG0H 3MA9L 4P4KB 1AQKH 1AXTH 1FAIL 3QDGA 1YC8A 2HLAA 1OT2A 4YHZL 5C0JA 4MAYC 4XNZB 2VLME 4LSTL 3VGDA 4OD1L 1DE4A 2IH1B 2YWYA 1R3HB 2XKSA 4P9ML 5EIQA 5L2KB 4NIKB 3TJHD 2FBJH 5IKCB 3DURB 4NO2A 1J1XL 4N1EA 4H8WL 1IBGH 3QIWD 1HZHL 1FNEA 2RR3A 4EOWH 2BVQA 1Z2KA 2Z8SA 4LCCB 5IMLB 5C2BL 1J12A 3P73A 3VWKC 2IBBA 4R4FL 3DMMB 5IHBA 3QRFM 5FYKU 2FH8A 1Q72L 4UINH 4WJ5B 2LAAA 4XZUB 5GQBA 2NMSA 4OGZA 1MRCL 1J1PL 5ALBH 5DURB 2BVOA 4NFDA 5GGQH 3C8HA 3UROR 3WFEL 5JHLL 4LHUD 2H3NB 4PP2B 1VFAA 3P4LA 2XN9B 5BJTA 5IQ7H 4X99A 3HC4H 1RMFL 2PYFB 4BQBA 3U4AA 3RFZC 2JIXB 1XGQB 2BSTB 4Y4HA 4X6FA 5IVXA 5I16B 2HFEA 3BDYH 3IRPX 3PV6B 4Y19B 1M71A 4MDIB 3LVEA 1Q9LA 4LHJB 1EPFA 1WBYB 4APQD 5HHXL 1MCDA 2W1NA 1A6WH 2EC8A 1NBYA 3MUY1 1R3LA 4IS6B 1A3LH 3L95B 4PJ7B 3UZVB 3O9WC 5J6HA 1DUZB 3LS4H 1DN0A 1DTUA 5DD5L 5DD0H 3U46A 3AFLA 5C07D 2BMKB 1G9MH 1T0NB 3UJIL 4M1GL 4YHYC 3SE3A 4P3CL 4KJPD 3BAEH 2R69L 4JRXD 5ID0B 2QKIB 4Z78B 4DGVL 3NZ8B 2A9NH 3HHRB 4P57A 3NGBB 4J3VA 3GBMH 5BVPH 4RX4D 1IAIL 1ZLSH 1OD7A 3CH1A 4QY8A 3RAJH 4QRPA 4XMKL 2FZ3B 5CCKH 4XC1L 5MENB 3VG9B 2VN4A 3M8OH 4U1KB 2ZUQC 3ARSA 2F8VA 5F9OH 4OKVB 4HSQA 4YDLB 4RQQB 4L4TB 5DO2D 1ZT1B 2XKNB 2UWEE 3DX7B 2HKFL 3C9NB 1RHHA 4PGDA 4QHKJ 2FJHA 3VFNA 3L5WA 1YMMA 4G5ZH 4CN4A 3AMKA 4KKLC 2M8XA 1KIPB 1KT2A 4Y2DD 4EI6A 5IW6A 1MFCL 3VXNA 3BSZH 3Q1SL 4M6AA 4PPTA 3UAJC 1OAYL 2R2HB 3D1MC 1FBIL 3VFTB 4HJ0D 2JB6A 3NA9H 2DYPA 1CXIA 1NDMB 2X5PA 4P46A 3MGTA 5CUSL 1DBJH 3HUJE 5T3XE 3RVVD 1NFIB 4KZEH 3O2WL 4FFWD 4FXKA 1N26A 1BVLB 4ZUSB 3ULUH 3KLHC 5GXBB 3MBEB 1HWGB 3VXSD 4PGCA 3O3AA 3V5KB 3MRHB 4QT5A 3REVA 1FYHB 4AIXA 1AE6L 2VQTA 3QFJB 5C7XL 3MRLB 3TO4C 4ZD3H 5B4MC 3GRWL 3S5LB 2XFXA 3VA2C 1KNOB 5F9WB 4HHAA 1AY1L 1NFDF 1ZT4B 3A6BL 3QXDB 1MAMH 3ECBB 3MYJB 4IOFD 4R96B 1AC0A 1FO0L 3AROA 32C2A 1C16B 3B6SB 1CGYA 1MCPL 1MVFA 1K5NB 5K33A 2JB5L 4JANA 3NCYP 4HJJH 5E7FA 4ZFOB 2VL5A 1H3WM 1N3NA 2GJZA 1R5WB 4O9HL 4OLZL 4NRYB 4UV7L 4LCUB 5IUSA 2WLYA 3QQ9C 3V6OA 5EZOH 1IGYA 1JHTA 1G9MC 4PRID 1IE5A 1H3GA 5J89A 3IDNA 4KVCL 4HLZH 4NQDB 4G9FE 5E95B 4NRZB 4GUPB 4XCFL 5FKPA 4ZPTB 1P7KB 2MHAB 4JKKA 3ARXA 5TQ2L 1ORQB 3QB7C 2Q86A 3WFDH 4LDEB 3HE6A 4MSWB 5ICYA 2AEIT 1WGOA 1JNLH 3MLWH 3GKWH 3G08A 4ZS7H 5DJ6A 3EHBC 3GMMA 1BEYH 3HN3A 3UTSB 2C1OB 1VKXA 1AJ7L 4PRHE 3L3HB 4NP4H 5L8JB 1TDQA 4YBLC 2PYEA 4LVHC 3TH2T 2AJYH 3BYYA 1CD0A 4JHAH 1IC5H 2OR7A 1QFWH 1ZXQA 1AO7A 3QUMB 1K2DA 2ZSWB 5FYKD 1KCSL 35C8L 1RSFA 4YDIH 4A2MA 4WNQB 2YHGA 5FYLD 2BXZA 5C0BA 3SPVB 4YNYB 2YA0A 4G6JH 4F7EB 1N64H 1KG0A 4P23D 1I7TB 1N6UA 5DWUH 4FQLL 1MFBL 3MNZB 1ZGLM 3Q6FB 5SWZB 5JNYB 1XGTA 4WI9A 3WFCL 3GJFH 5LBSH 3HLAB 2AJVH 1U92B 2EDWA 5LGKA 1UWXH 4L8SB 1MFAH 3QO0B 3N1GC 5D71H 5SWQA 3ZYIA 4ODTH 4WUUE 3TV3H 4PGZA 2BNQD 3MV8D 1IZJA 5B3NA 4GMSL 2GJ6B 1IGFL 3G6AB 4I0PA 4HWBL 4IOIB 3PNWA 1SQ2N 2XYCA 1YEIH 4PJ5B 5CBAA 1QBLL 5F7NC 1P4LB 4CADA 3IU3B 7FABH 1EHNA 3WHE1 3OKMA 1KB5A 4YAQB 1A3RL 3RX8A 5IP4A 4U3XA 1UXWA 1XFPA 5HVHC 2CIIA 5T3XH 1E28B 2XTJC 3QCTH 3ILQC 5GHWH 4JPIA 5F7EH 5C0DA 4U6XA 3OKLA 4M00A 1IQWL 3SDXE 1SVCP 2OP4H 3LEXB 1A64A 4XGZB 3VE0B 2HJKA 5EU6E 2Y07H 1UZ8A 3ZTJG 5LWYH 4G8GE 3TBWB 1AHWA 3BEVA 3V9FA 1HSBA 2DLHA 1KIUA 4N8CH 4D0CB 2AK1H 3ULSA 1MREL 2HJFA 1ZHKB 5HHNB 5J6GA 1HYSC 3WHXA 1ZVSA 1UJ3B 2MKWA 1QEWA 5FYKL 1QACA 1U8HA 2IQAA 2OYPA 1EHXA 5FYLL 3K2UL 5JW4Q 1F4WL 3U0WH 1CXFA 4P0DA 3KJ4B 1U8IB 1NCUA 4MQ7A 5C6TL 4I9WD 3MLPA 2FCBA 2B5IC 4MJID 5HI4D 3AY4C 2ATPA 1FYTE 3QUZC 1J8HE 3PXJA 3SKJH 1HHKA 1UA6L 3RX7A 1A7NL 4XCEA 5I75B 3ARDA 3GSQB 5IHUH 1E0OB 4D0BA 4WRLA 3LEYH 1NAKH 3CFJB 3I75A 5EC2A 1FGVL 4OLUH 3FT3A 4W70A 2OTPA 4FQCH 5TH2A 2CQVA 2EC9U 4ENEC 2EIZA 5TF0A 3H9ZA 4U6VH 1N2RB 3FL7A 1T3FA 1I1YA 2VR4A 4PB9L 3B2UD 2FEEL 4U1JA 3AREC 4C55A 2VIRA 3L5HA 4NUJA 3RJDA 5DYOB 3DX9B 3VFSA 1I8IA 4F33B 5IBLD 4UOW0 3FB8A 4R97B 1A7QL 2MPAH 2YR3A 4LHUA 3RIAK 1CI5A 1JF6A 3HI5H 5C0CE 4QYOA 3A67L 3LPGA 1JPSL 4PV8B 2EZ0D 3QIBB 5LKNA 4NSKA 3SOBH 3VXPA 2EO1A 1H15A 5D72L 3C60C 3UJJL 3OKNB 4OLEA 4QRUB 2VQ1A 4FXGB 2RB8A 1W0VB 1MCRA 2ZJSH 3QG7H 4X4ME 3PABA 3GMPA 3K1DA 3HZKA 4PJCF 3MMEB 3PWNB 3MNVA 3SGDI 2LVCA 5J12B 3C08L 3I6GB 3BJLA 1I7RA 1U8PB 3TH4T 4CJ0A 3UTQB 5BQ7A 1G9NH 2GFBB 5D1XC 4CBPA 4OLWH 1JPGB 3A0OA 2P4AB 3R4DA 4NQED 4YXLH 4OGYL 3VRJA 4FABL 5IFAL 3NA4A 1TITA 2IALB 5FO9B 2XXCB 4L29B 1ZA6B 2F74B 2IADA 3BVNB 4GAGH 4JRXA 4KHTL 3DSFL 5DR5L 1K4CB 1UWEL 2NY6C 5L8LB 4D9RE 2GSGA 1YMHB 3NCBB 4U1LB 1MCLA 1XR8A 2HA1A 3CH8A 3F7PC 3KNBA 4KDWA 3V0VA 1S7XB 1Q0YL 1A7RL 3UXFA 2IFFL 4WY7H 1JTOA 2A6IA 4N0UB 5C08E 4ZSOE 3GI8H 4ZMAT 1GJIA 4AEHL 3W39A 5CKGA 3FAWA 5IEKA 3U0TB 2BNUB 3C09C 5DUML 3SGDH 3U7WL 4GW1A 5IB4B 2E8YA 1NMBL 4LEOB 4TNWK 3KPLB 4QRRD 3GIZL 1MFDL 1U3HC 3H8NA 1DLFL 4Y2DA 3P0VH 2CLZA 5CZXC 4WEBH 4DEPC 4I18C 4QNPF 2VERN 5JPMA 3C87A 3QDJD 5HYJE 3MV7B 5EO0B 4G7VL 2PW2B 2VLRE 2CJUH 1ITBB 1N7MH 3PL6A 4E41A 1NSNH 5F7HA 3S36H 3E6HB 1INEH 3N1QC 5E2UL 2H32B 4CN6A 5IJKC 4WW2F 4HZLB 2ARJA 1HH6A 1NCDH 1T89A 5ANMB 4DVBA 5J11B 5BRZB 3ARPA 2ZPKL 4P9HH 3G5XB 1RZGB 3M17A 4EI5C 1FZKB 4XP1H 2NY3D 1D6EB 3PIQB 5EOCL 3MFFB 1DQML 2R2BB 4G9DB 4Y8DC 3BHBB 3BIKA 1ZE3C 2R8SL 3BT2H 1NGXA 4GMTL 4HXBL 1V8HA 4OGAC 1KEMH 1IC4L 1CZ8H 4OV6F 1S7TA 3MOBH 1IEHA 1BD2A 1CTNA 4PTUB 2B2XH 3GSNB 4MJ6A 2X4QA 3SDDA 3TP4A 2FO1A 3TEUA 5EU5B 4RGND 2VLLA 3S97C 3SY0A 4MA8H 1RZFL 2ADFH 4IM8A 3X14B 4WU5B 2VDML 3H7LA 3BRGC 2MSPA 5J8OA 2Q8BL 1MIMH 2CLRA 4Z0XA 1CXKA 1KIRA 1M7DB 2XV6B 3Q5TA 4CVXA 3LN9A 1ZMYA 1OWWA 4QRTB 3ZDYF 5AWNL 4X5XB 2A6KA 4TOYL 4HUUB 2H9GB 3RKDD 1GGBL 1S5IL 3OJDA 4D9QE 3NCCB 2V7NA 2MFNA 4IMLA 3ROOA 2X41A 3KS0H 4PJAA 3A6OA 3GBNH 4ZQKA 4TULL 1P69B 4ZYKA 5I2IA 4FHBD 4WWKC 4YIQA 3I85A 5H2BA 3VFPA 1MVUB 1OAQH 4WO4B 1AC6A 3GMNB 3OKOB 1JPTL 5D4QA 4XPTH 5AUMB 1HK6A 4NC1C 1PVHA 2B1HH 3E1F1 5JORB 4M6ML 3QUYC 1XMWA 4AENB 4CMMB 3OR7B 3R1GL 2ZCLL 4WW2A 1DLHB 4HK0A 2N56A 3EJJX 3PJSB 1S9WB 4P23A 5D7JB 3FO1B 5ITFA 3RQ3A 1U8QA 2Z9TA 5EO9A 1H3PH 1D6VL 2VKXA 1LO2H 2CUHA 3PF2A 1S7VA 1NLBL 2APWA 4YE4L 1TENA 4S1RL 3OKEA 1FNAA 1WC7B 1I3VA 1ZHLA 4TTDC 4JKPL 3UTPE 3NFPB 4GRWH 3CC5B 1NFDB 2HT4C 4EVNA 4WW1B 1D7FA 1KJ2H 3B43A 4X6DA 4G80A 2VO5A 3JWDH 2X9YA 2WK2A 1NGQH 3PWLA 5D7IA 5CZVH 4EN3B 1F97A 4G42A 5I6XB 3P4OA 5ALCL 4A2LA 2ATKB 2DIJA 2FX9H 2JJUA 1DQJB 2G60H 1K8IA 1BGXH 2VLJD 5E08H 3MTRA 3N85L 4OCSL 2BNRA 1A22B 1WQVT 2J8UE 4X4XB 1QFOA 2A6JA 1NUDA 3FQUA 3F58H 3IFOA 5I1JL 5KTEL 3C2AL 2D7QA 4P5TA 4MNQD 5D9SA 4M6NH 1TXKA 3TH3T 2J2ZA 1KF9B 1J9CT 2D3VA 4DZ8B 5DEFA 4QTHB 1TCMA 4PIRF 5CFHA 1DR9A 4PYHA 5ESVB 2YRZA 4NKQB 4YX2H 5FHAH 4MAYD 4Z7VF 4XC3H 5K59E 3MV9A 4I3SL 2PXYA 1MCOH 4OT1H 4OF7A 4KRMB 5DMGC 1A9EB 4Y7MA 1NBZB 4PJBB 5F1KC 1UB5B 4WFGE 1F3JA 2FL5A 3EOAA 4H0GA 5BXFB 4XVSH 3W81A 2AV1B 1DBML 4CDHA 4OM0H 3DUSB 2IANA 5GZNC 1BQSA 3EDJA 3TYFB 5I66B 4JFED 5E1AB 3EDEA 1A6AB 5SV4A 3QQNA 5CD5C 4HLJA 4MJIA 2E9WA 3RPKA 4F3FB 3KDMA 4K71B 3VXUE 3C6LA 1E27B 4HWNA 4FS0A 4KI1A 4HXAL 3JV5A 3ZKND 2OZ4A 3FOMA 1CICA 4OZGB 5FGCB 5IV2A 3M1BB 1AD0A 4PLJC 2YKLL 3MXWL 4R4BB 1I1FA 4FQ1L 2ZCHH 1MCBA 3FQRB 1BM3H 1UH3A 4OIIH 3MRFB 2OTUA 3T3ME 3BJ91 2BY0A 5HGDA 5I8KL 4JFDE 4D3CH 4JY4B 4XNXH 3U9PH 3WLBA 2D0FA 2E7BA 3LQMA 3QIWB 5DT1L 3D9AH 4JVUA 1GZPA 3AM8A 3JWDC 2OR8A 1ODAA 3O11A 2R0KH 4OUUA 4LPUA 1EO8L 4LSRH 3ZDXE 4HCRH 1CYGA 2Z31C 1OB1A 1XCQB 5BMFH 4LRNL 5DRWA 2ESVD 4BFIB 4UIMB 1IKNA 5I8EB 5BV7L 1R3KB 4HGWA 1MLCB 2IFGA 1NMCC 4AM0B 1ZS8A 3TPKA 1P7HL 1HINH 5E2VH 4K7FB 1L4IA 3BZEA 1CLYH 3ARFC 5EBWB 3BN9C 1WWBX 1E4KA 2WV3A 4CL7A 1I9IH 3QA3B 4IDJL 4HH8A 1JYXA 3RX5A 1KLFA 1FZJA 1OAUH 2R56L 4YXHL 4UB0L 5B8CA 1CFNA 1MIEL 3PHQA 4KPHH 4PLKC 1UVQA 4X80H 1P6AB 3DPBA 2YZ8A 3KPTA 4NPYA 3CXHK 5TF1H 3VJ6B 2C3VB 4TNVF 1MQ8A 4P5MA 4AK1A 1KCVL 1I7UA 2WANA 1OSPH 3EYOB 1QYGH 1WIOA 2XKNA 2EYRB 3QUKA 5GS1A 2DAVA 2NY2D 4H5SA 2M2DA 3HG1B 5SX4H 4APQB 3DYPA 3WD5L 5DQJA 4QRQB 1F5WA 3MCLH 4N0CC 5C0AE 5AAMA 3KLAB 2G75A 4ELMA 4NNPH 4KVNL 4NDMB 1FO0B 4TTGA 4BH7B 4XBPB 4KKLD 3KAAA 4XPAH 5C07B 3B2VL 3T2QA 3B8YA 2I9TA 1U41A 3Q2CA 3VXRA 4LARH 3UAJD 2O5YH 4ZFZB 1TJGL 2V9TA 4YXKH 1RUPH 4LQ1A 3BUYA 3WLWC 5ID1B 3HE7C 3V5KA 3QDHA 4ZS6C 2YSSA 5FCSH 3UTZB 3MLUL 3L7FB 4DW2H 3KLHD 3B4NA 2VLKE 3L5JA 5DJYB 5AD0B 5IFJA 3DYMA 1NCWL 5JOPD 1CGVA 2E5EA 2QTEA 4M61A 1ZHNB 4CMHC 1CFQB 5B4MD 4UI2A 2EYTB 2D0GA 4OM1L 1OARH 5KG9B 3RA7L 1F3DH 4QRRA 3S96A 1E4WL 4FQJH 3WIFB 1F42A 4FZ8H 3IU4L 3JSSA 2WBJC 1D5ZA 1RUKL 1Q1JL 1FCCA 3B9KC 5HHQA 1ZSDA 4Y5XB 1OP3K 3GJEA 1XCTA 3SKMA 5IGXH 3MQIA 3QQ9D 5DK0A 2XRAH 1CDBA 2UUDH 4P2RB 1O0VA 1AXTL 3VXSB 3ZYOA 3P77B 5C1MB 5LGJA 4J1UA 1EGJH 4B41A 5KSAB 2C9AA 3FONA 4KUCD 5CEXA 3LMJH 5MP6H 4PJCB 5CGYC 1GYAA 4CDGC 1QG3A 4ONFH 4YHPA 1IBGL 3ARUA 3KPPA 3QPXH 1IAMA 2Y72A 4EOWL 4FA8A 5CD3B 1JFQH 3WFBH 3TLRA 5CIPH 1PG7H 1I3UA 1M6OB 3ISWA 5F7KC 1Y18B 2H8PB 2FHCA 3IFNH 2ZG3A 3QEQE 4R7DB 3EHBD 2C4FT 3PGFL 4DAGH 4UINL 4UQ3B 4Q97A 5KJRH 3TNNB 5D8JH 5D7SH 2BY2A 4M43H 4HJGA 5D5ME 1XR9B 2ZP0T 3GO1L 3DGGA 3K8KA 1RK0A 4LVOB 5EH1A 5GGQL 7CGTA 1S9XB 3RHWF 1FVDA 5DHVB 3MOQA 3N50A 3SKOB 4JZNA 2I9LA 5FUOL 4PRIB 3KXFE 4RAHA 4W81A 2EYSA 2AJSL 3MLXH 5FFLA 2VOTA 5IQ7L 3MRPB 2B4CC 5D7LE 2P5WE 3P4NB 3HC4L 5M94B 1LO3H 4H26A 3ZKQD 4OF6A 5LG1A 4YUEH 1V5JA 4PJGF 2BFVH 2JJVA 4XNMB 1S7RB 1RIHH 2DQIL 4F15C 4ONGL 4L8BA 5ACMA 5CS7A 4FQXA 5EU7E 2VLMD 3GJFK 1ITCA 4BFGA 5E2WH 4MA3B 4NC0B 1SYVB 5FHBL 2VN7A 1BX2B 1S7WB 4IMKC 2DQFA 5DJZB 3TT1H 1UXSA 3GSOA 4Y1AA 2ERJB 1DCLA 3LS4L 5DD0L 4I3GA 4O2EA 2QLVB 4WI7A 4Z0BH 1G9ML 1HXMA 2WQRA 1S7UA 4Z7UF 3VFRB 5BVJB 1F4YH 3BAEL 1Z3GL 1KOAA 4RISH 1DQTA 4BJLA 3BP6A 1I7ZA 1AGDA 1GGIL 2A9NL 2LTQC 3WDHA 2X4TA 3Q3GA 2NY1B 3GBML 3IDYC 4MXVF 4HK3J 3LZFH 2XTJD 3C5JB 1U6AH 4L8DB 4ODHL 4RMWA 1F13A 3ILQD 5CCKL 3R8QA 4TUJA 2CKBH 4HS6B 2R1XB 3GSVA 2V5SA 3RWGB 1P84K 3O3DB 5I1IL 1F6AA 3MRRA 4JY6B 4YPGB 3MLSH 4M7KH 3RTQA 2X40A 3MV8B 1SJXA 4FFZL 4PG9B 4IIQC 4YR6A 3TN0C 4CU8A 2DQCL 1G7IA 3ARGC 4KTEL 3KPOB 3TO2A 3LN5B 1OF2A 4G5ZL 4B0MM 4EDWL 2AKRB 4Y2OA 5EUOB 2VTFA 4F57H 4FFYL 3BSZL 1F90H 1NANI 3RY6A 4MNQA 1I1CA 1A7PH 1FL3B 2Q6WA 1QQDA 1A1OA 3HA0A 4KZEL 3UDWA 4RMRA 1CIDA 4PJGA 3QXWA 3QUZD 4Z7OF 2CRZA 4ZNEE 3G04A 3P0YL 4QXWA 1R3JA 5KSUB 2X89D 2HLFC 1KIQB 4F2MA 1YY8A 1U0QA 2DJUA 4ZD3L 2EDFA 2IQ9H 3O3EA 5IB2B 4QHKI 4I5BA 5I1KH 3E8UH 1C5BH 1ZT7B 3RL1A 1CLOL 2XWTA 1MAML 4G7YH 2H1PH 1QLRB 4ENED 2VH5H 3CIQA 4LLUA 2HMIC 3IDGA 1DBBH 3LQAH 4JFEA 3RI5F 3VWKA 5IMKA 2GY5A 5C0RL 4Q6IC 2Q20A 1ETZA 1T1XB 2J6EH 2ZZUT 3GNMH 1JJUA 5IQ9A 3VRLE 4GH7B 5DK2B 3ARED 3JV4B 5B3JF 4N0YL 2QSQA 3W5NA 4OCYH 4PRNA 3BKYH 5EZOL 2HH0H 5AYUH 2GT9A 1CBVH 4L8CA 43C9A 1W72A 1PFCA 3P0GB 5GGTA 2AXFB 5DI8B 2OXGA 2BVPB 1GHFL 5K9JL 4HUXB 3PP4L 4QRUA 5T3XD 3ZT7A 3P30H 3R06A 2BXYA 3C60D 4FOMA 3WFDL 1QSFE 3PWNA 3T8XA 3MLWL 1EEZB 3GKWL 2ZSVB 1FFOA 3VGBA 5MERB 2ADIA 3FFCA 2WBWB 2XZQH 4NP4L 4NO0A 4OD3L 2QADB 1FAKT 4JM2A 4TYUA 3QQ4A 4JHAL 1IC5L 4R26H 1QFWL 5D1XD 4J12A 3O6FD 3O9WA 2JCCF 2F74A 2YMXH 5E70A 2A74A 4YDIL 4H1LG 1LP9F 4MVBC 1GH7A 4NGHH 4U6HA 3QWRD 3S34L 5F89A 1N64L 3RVTC 4OJFL 3TYGH 3ARWA 3V6FA 2BOCB 4X6CE 2RGSA 4ZOBA 1T1WA 3ZKMC 3U6RB 1BVZA 2UVFA 4MQTB 4Z7VB 5D6CB 5ADOH 1KPUB 4LBEA 4I2XA 4XCYA 2AJVL 2PKDA 5IESH 2F54B 2VISA 4OFVA 2Z91A 3EYUL 2MKLC 4KUCF 2FATH 5D71L 1ZAGA 5C09E 2DQGH 2A9MH 2EDJA 4PJIA 1FFNB 1EMTH 1EUTA 3MLRH 2DTML 4MCYB 3U0PB 3CDYA 3T2NH 1VADB 4JREC 2RAMA 1YN6B 3C5ZC 5E4IA 4HMCA 5L88H 4L4VA 1V7ML 3DX8A 4NQEB 2B20A 1GGTA 3LQAC 2W65A 5EO0A 3DIFB 1U3HD 4HFWB 1A6ZB 5CZXD 3EJZC 4P2YA 2IAMD 7FABL 4PRHD 5HI3C 1G0DA 1YQVL 4OZFH 3FN0H 5C0NC 4F37K 3RWEB 3U4EA 1LO5A 1GL4B 2HRPH 4X7TA 5T3XL 2X4PA 2AEQL 5JDSA 1T2QH 3QIUB 2WW8A 4JN2A 3VRIA 3KPRE 4G43B 2FYYB 4TUKH 1XGYH 5EU3B 4XNUH 4HIHB 4JFZH 4ZDHB 1HQRA 2V2XA 3A6CH 1OLZA 3FQXA 4R7NB 4NKIH 4RFEB 2W91A 4E5XB 3GMRB 3CVIL 1P4BH 3TO4A 4TSAH 5F70A 4U4BA 2UYLA 5LWYL 4Y5VB 4QLRA 2ZUUA 5C9JA 2DQHH 5TGBA 4EI5D 5HDBE 2AK1L 4M3JA 3LRHA 4HC1H 2OI9C 5SX5H 3B5TA 4H1LB 4OGAD 1Y0LA 2WP3T 4RFNB 4WUUD 3U0WL 1KB9J 3T77A 1R24B 2E7HA 3KPNA 5DRNB 3QDJB 5ECJE 3ZSSA 4S10A 3RWCA 5I1CH 2VUYA 1P2CB 2D0HA 3OZ9L 4BH8A 1BMGA 1WTGT 2D4FA 1SEQH 4HEPG 5LAXA 3ROLB 2QBWA 4K2UH 1BOYA 5D93C 4KMTH 5JW4N 3CU1A 5D6DC 1KYOK 5I74B 5TE6L 3ULVE 3EOBA 4FQHA 1LQSR 4QHUB 3LEYL 1NAKL 3BKJL 4K94H 4CUCA 3O6MH 4OLUL 2BERA 2KBGA 4MDJA 4LQFL 1U36A 4L9DA 3JV6A 1RK1A 4FQCL 3ZLQC 2NY3B 2QHRH 3WN5B 4UTAL 3LRGA 3LS5L 2JK5A 5HYQB 3JZ7A 3ARBA 1HHGB 4DGIH 2Y4SA 4WFEE 5EU6D 4PRDB 1MVUA 4J3XA 3MO1B 1B0GB 4G8GD 4B5EA 4WWKD 1NJ9A 1FC1A 1XZ0A 4QHMB 1NC2A 3WV0A 1RZJC 4Z77B 1P5UA 4XPFH 4W4NA 1TVBA 3QXAA 3R8BB 2MPAL 2VABA 2AJ3A 3DI3B 3OHXB 4RGNB 3S37X 5J0BA 1QD0A 3HI5L 1U8MB 5CZKA 3IB4A 3HZYB 1NEZG 2EH7H 3BPCB 5B39B 3LKOB 3T1FB 5GGRA 2XACC 3GHEH 3RGVC 3PWUB 1S8DB 3SOBL 4K9EH 1J8HD 2Z4QB 5KSBE 5IW1B 2L0DA 3VA6A 4S2SB 1MELA 5DUPH 5TDOA 2AW2A 1PG7W 4IRZL 4RFOH 2ZJSL 3QG7L 3D69B 4TTDD 4NCC1 4XXCC 5H8DA 3VFMA 2HT4D 4YGAB 3W9EA 4A6YH 2WINA 1J0KA 1M7XA 4OKDA 3VI3E 2YC1B 1NC4D 1G9NL 4RGMC 4OLWL 1TLKA 1JGVL 5C0EA 4MAUH 5E4EC 4HUWB 4OTXH 4J6RL 1QSVA 2UWEF 4JRYA 2GYSA 3HC3H 3L3OA 1A4KB 4NN7C 2E8ZA 4L5FH 3SJVA 5F3BB 1VB9A 1P7QA 1UH4A 3F7VB 3DV6B 1X5JA 1VFBB 5C0CD 2FIRT 2XZCH 3QEGH 4X6EB 1X9QA 5E6IC 3TFKC 1K6QH 4G8FA 4MNGA 3HUJF 1DZBA 2CUIA 1ES0B 4G3YH 3O41B 5HTSA 4YZFE 4P2CG 2BY3A 2P24B 3KYAA 3FQTA 3V95A 2Q8AL 4HMDA 1DL7H 4NNXA 1ACYH 4XAWL 3MR9B 1AKJB 5DMGD 2AI0H 4NC2B 4XXDA 1I75A 4M9PA 3W5MA 1S7SA 1NEZB 2VLJB 2C7UA 3QULA 2P1YA 3SE4A 4DZBB 3FO9B 5CP7B 4LHQB 4M48H 1H0DA 5GZND 5JIIA 4Q9QH 1KTLB 5DC0A 2CJUL 5CD5D 1N7ML 4XBGA 3AY4A 1XGUB 1NSNL 2YUZA 2DMKA 3MBXH 3WFHB 4J3UA 4KWUA 2I5YH 1S7QA 4N0FA 2OR9H 4EJ1C 4GKOA 1ONQA 2D03L 4MX7B 5M95B 2X89A 4PLJD 1NCDL 1IZKA 4ELKA 4K9EC 12E8H 1U8NA 5KSVB 5DZNA 4LKCA 3AU1B 5EO1A 2BSSB 4P9HL 2G5BA 2LE9A 4MAYB 2WUCH 4XP1L 1ZHBB 4JFOB 1W2KT 4OF3A 5DJ8A 3AAZA 5C3TA 1C7TA 2DS4A 3BT2L 3HNSH 4NQSB 2XNAA 4KRPB 2NNAA 3G6JA 1CZ8L 3W9DA 3PWPE 4LAJH 5D1ZC 1PX4A 4BSWB 5C08D 4ZAKC 4NWUH 1A4JB 2B2XL 5I1EH 2H26B 2W9EH 3AREA 4P2OA 4Z7UB 2Z31D 4OBRA 3BGMA 5DJXB 2YD8A 3QEUA 1JL8A 3RZCC 4MA8L 4QRPE 2MOVA 1P5VA 1BQLH 3KYKH 3VDAA 3FKUS 4M7ZB 1EFQA 1FVCB 1G7JA 5DZLA 5T33H 2VLRD 4J8RB 4PTTB 3BN9D 2X7LB 1U8OA 4D9LH 5MEPB 1FCGA 4NOBA 2FO4B 4XPHH 4PLKD 1P4IL 1ADQH 2ZNXA 1QSEB 2HN7A 4GRLB 3SGJA 2XWBB 2EDYA 5CJQH 4LVNC 4XP9H 2VDRH 4X9HA 4S1QH 3GBNL 5F7MC 1L7TL 4AT6B 3T0EB 4HGKC 2AP2A 3CU7A 1OAQL 3PDGA 3IDJA 1VGKA 3G9AB 1KPVA 2NYYC 1U95A 2OXHA 4HK3N 2PN5A 3MLYH 1FV1B 2B1HL 1MI5A 2ESVB 1MHEB 3EDDA 1ZWIA 5FF6A 5ADPL 1SY6A 3SDCC 4F9PC 2K9UA 4PY8J 4PGEB 4MB4A 4MWFA 1WTLA 1M4KA 4NZRL 1FLRH 5B38G 5JW4R 4E0RA 1T0MA 1BQHG 4N8VA 5AAWA 1LO2L 1NGYA 4GS7C 3ULVC 3GK8L 4LF3A 4WDIB 3WLWD 5L6YL 3HE7D 3WO3B 3CUPB 4Z7WA 3U79A 3PGDA 4ZS6D 4NNYA 1AGEA 2D2OA 3Q5YA 2GK0A 3MFGB 4NQXA 4JHWH 1KJ2L 5B22A 2FJFB 3IGAB 1EIBA 1CD1A 1CK0H 1QKZH 3CPLA 5JUEH 3JWDL 2F53A 3UZQA 4K3JL 4ISVA 2E7LC 4M8VA 2NW2B 5EG6C 2DWEA 3BP7A 5CZVL 1CXEA 3F65A 1KBGH 2NY2B 3QG6A 4HKXB 3SDXF 1QR1B 2FX9L 4MZ2A 4XMLH 1KXQE 3VGGA 4HKZA 1KLUB 4D9QD 1BGXL 5E08L 1U3HA 2EXWC 2B8OT 4I18A 4PRHA 3ZE2E 4ALAH 3F58L 3TBYA 5CINL 4U1NA 3U83A 2WBJD 5C71A 1KFAH 3B9KD 4M6NL 4ODBD 1RJLA 3SBWC 3C5SA 3GSWB 3MRBB 2DMBA 2GITA 4DN4H 5IJKA 3HC0B 2UUDK 4Q9RH 4CU6A 2WWMD 2NXYC 3UYRH 3LN4B 4HULB 3IDIA 4M02A 4ODUA 1CFSA 4XC3L 4PJEE 4DWHA 1MCOL 4QOKE 3L6FB 3E0GA 1AR1D 2PYEE 4EI5A 1N0XL 4OT1L 5DMYA 4YGVB 2Z35A 4MB5A 3UTPD 3F7RA 1EJOH 3DRQB 1AO7E 4PJDB 4PJ9A 3TVMC 2FWOA 1OTUC 4JZJB 4PD4J 4OM0L 5C0BE 1KXTB 3H7BB 3UPCA 2JCCB 3ZT6A 1EFXA 3LH2L 4IHOA 1D5XA 1BQHB 1LP9B 2NY4C 1DQQA 3N9GH 2IPKB 2R0LH 3BPLC 4LLVB 3X17A 3ZMRA 1X5FA 3FB6B 3U7YH 4W6YB 1U91B 3P4NA 1JBJA 3EZJB 5HHME 1UENA 1SJEA 3IXTB 4GSDL 4QGYA 5GRXG 2ZCHL 3WJLC 1DEEA 3PHSA 4OIIL 4KMLB 3T0WA 1HI6A 1LEKB 5I1GH 4MJ5B 2YD9A 5GGUA 2CDGB 4ORGA 4D3CL 2JJWA 4R9HA 3P40A 4J3SA 3CFEA 3U9PL 3L3KA 3BPOB 5KANI 2BJML 1CXHA 3H9HA 5CLWA 1KJ3L 1DSFH 3D9AL 3BH9B 4D8PA 3V2AR 1XF3B 4Q2ZA 4V2CB 1P53A 1J8KA 3NCJH 4HCRL 3WHE0 4H88H 4WWKA 3VFUB 2V7HB 1QRNA 1ZANH 3UCRA 2UY6A 3IVKB 3VXQB 5EZLB 4QGTA 4QCIA 4WFGD 4YFLF 5FA3B 3HI1A 4LFHG 4WFHE 3DTXA 2P7TB 3QUYA 3KYNB 4NT6A 1CLYL 3CVHA 4CNIB 4ZFGL 1P1ZA 4WHTB 1I9IL 5JQHC 3L1OH 3VXUD 1EX0A 1OAUL 3D5OF 4KPHL 1VERA 4LCIH 4LEXH 4PUBL 1MJJB 4JDTH 4Y4HC 5J4MA 1FZOB 3LKRA 5A2IH 3CDCA 5BZDB 1T21B 4WI8A 2CLVA 3BZ4A 2I27N 1H8OA 3HPJB 1OSPL 3P9MB 2A77H 4OLXH 1QYGL 4GG6E 5EC1B 5JIPA 1AGFB 1KTDA 4JFDD 1WEJH 4PG9A 4X4YB 3BKCH 4AIZA 1FFPA 1AD9B 3DVNA 4NZTL 1BJ8A 4U1MA 3GSUA 5F1IB 2I60H 1RZ7H 3DVGB 2AGJH 2Q76B 4N5UA 2IGFH 1MCFA 4KQ3H 3SE3C 4NNPL 5DJ2B 3TN0D 3ARGD 1GZQA 1JNHB 3T1WA 4XPAL 3FCTB 4GRMB 5LVEA 1I1AA 1BVKB 1X5KA 3DRTA 4UOW1 4FNLL 2O5YL 2V2TA 3AXLA 4YXKL 1RUPL 5EBGA 1NLDL 3LKPA 1CT8B 2B4CL 1F11B 5F8RC 2Y6SC 4XCNA 3SEPA 5HVHB 1QVOB 3O0RH 2BP3A 3RWDB 3MRQA 1LD9B 3EAKA 5IB2A 4X8XA 2EDDA 4JO4L 5ITBH 1FSKC 2HLFD 5FAAA 1LDSA 4G8IA 5FK9B 1EXUB 3L3DB 4LNRB 3B3IB 3VGAB 2BVYA 4YHIA 2H45A 2OJZH 4D0DB 2C3HA 1JGEB 2VDNH 3L3GB 1P6FA 2QSVA 1A6PA 4TVSa 4J2XA 4FZ8L 2R0ZL 2HMID 3E6FB 1LHZA 5C70A 1YJDC 1A2YB 1UKTA 1J05A 4JAMB 5DJDA 2O61B 4L9LC 5C0AD 4HUVB 5IGXL 1NL0L 4Z18A 3GM8A 1RUQH 2P8LA 4U2ZA 3T0BA 4ETQA 5IB1B 4FG6C 2B5IB 1FAIH 3MGOA 5DFWH 4MQXC 4YHZH 3QUZB 4LSTH 1EEUA 4IBLT 1CLCA 1UEYA 1CGXA 1IAOB 1EGJL 4LLWB 1TZIB 2DICA 3EGSA 1J1XH 1XF2A 2CGRL 3D3VA 5MP6L 1HZHH 5I9QC 2RCSH 2IH3B 4ONFL 2YBRB 1FE8H 2YRLA 3QJHB 4HX1A 2J8HA 4E42B 4R4FH 3WFBL 5C0FA 2VLKD 2CO7B 3GJFB 4BA8A 1QFUH 1XGRA 1Q72H 4ZFFA 4HAFA 3IFNL 5H35A 1KB5H 1FG2B 1MRCH 2GCYA 1OCWH 3ZO0A 1DEDA 4DAGL 5KJRL 4UQ2B 5GRJL 2ENYA 2H2SC 3DROB 3FTGB 1MLBA 5D8JL 5D7SL 1D3CA 2UWEB 1JZ2A 4NHUA 3DV4A 1PKOA 1G7MB 4PRAA 3VWJA 5JHLH 1WT5C 1UG9A 5I1AA 4CW1A 1IAII 3ARFA 3MLXL 4LLMA 4MNHB 1IAIM 1YEKH 1D5IL 4XHJD 1MCIA 3U6RA 1BF8A 4DGYL 3HE6C 3RVTD 5JOFA 3WSQL 2BFVL 4U49A 3K46A 1HHHB 3FT2A 2GAZA 4XP4H 3H2WA 1KTKE 3TZVD 3ZKMD 3C60B 2UY7A 1OGTA 4YO0B 3V6ZB 5DVNA 4XRCA 5E2WL 2BRRH 2CH8A 4QHLA 5EZJB 5HHXH 5GIRB 5EBLA 5GSRB 4TVPD 5I73B 3MUHL 5BZWA 5DTFA 3TT1L 3FMGH 4E41E 5DD5H 4DKEH 2R4SH 1DANT 1MCNA 1T5XA 4HIJA 4NRXB 3UJIH 2XOTA 1LE5A 3VGHA 4UTBH 5D70H 3C5ZD 4P3CH 4GAYA 5D1XB 3TBVB 3O6FB 4X5WA 2FX8L 4Z0BL 3RJQB 3EYSH 4DGVH 3QZWG 4EBQL 1FIGH 4RISL 4NO3B 3EJZD 1MCCA 1TVHB 1MEXL 3G9VA 5IOPB 5C0ND 1VESA 1SYSA 4XMKH 1VEMA 2J88L 3G5YB 2V2WA 5TPWH 3LZFL 4XC1H 2J8UF 2FGZA 2KDGA 1HH9A 3RNKB 1U6AL 2JF1A 4KJYB 1VFMA 3KXFD 4OZIA 3OAYH 1VEPA 4LGPB 3SCMB 4DQOH 1GXEA 4WV1C 1MHCA 2CKBL 4OZHA 1YDPA 3GM0A 5INCA 5D7LD 2P5WD 1BD2E 3L3IA 4AH2B 3B9EA 3WS3B 4G9FB 2HKFH 3D0LB 4WFFE 3QCUH 3MLSL 4U2YA 2BDNL 4BQ9A 4PJFE 4M7KL 5C0GB 5D2LA 3HZMA 3W11C 4PR5A 3OG6B 3U30B 2GTWB 1MFCH 4ZTOL 5EIIB 5GS3A 5K59F 1OAYH 3RBGA 4F57L 3RNQA 4JDVB 5E94A 1L0YA 1Z5LB 4JM4L 5JLZA 1T20A 5FCUH 2IAMB 3N1FC 3S35X 3VFVB 3O2WH 2HP4A 1WAAA 4BKLA 3KG5A 1LK2B 3TIDA 1OGAB 4G6KH 4N9GA 3WUWB 2QQNL 4X8JB 4JFFA 1IL1A 2QR0B 2HFFB 1GRWA 3CFCL 8FABA 2QQLH 5I30L 4JG1L 1YECL 1BOGB 3LQZB 2W0KA 3P9WB 2ICWA 3O3UN 4PJAE 1WWCA 3OAZH 4R6UA 4TVPL 5ETUB 3A6BH 4NKMB 1Y6MR 1C5BL 3MRCB 3I9GH 2J8OA 5MEOB 1J5OH 3GMOB 4O02H 1F45A 2H2PC 5F88B 2AJXL 3ZT5A 4YK4B 1BP3B 3QZWB 3T3MF 3QJFA 4Y4KC 3LQAL 4X0KB 1MCWW 1N8ZB 5F9JA 1JCKA 4WUUB 4J4PC 1QLFA 1FJ1B 5LGHH 2C3WA 1I4FB 3Q0HA 5EA0H 5C3LD 1R5VA 3BKYL 5IEHB 5AYUL 1CBVL 3FQWA 1T7ZA 3ZDXF 2CK0L 3OB0H 4G6AC 5I17A 4KVCH 3KPSE 1HHIA 1N0LA 3DVFA 1T22A 2ARWA 4X6DE 5FDWA 4Z5RB 2XQBH 1XF4B 2YPVH 3CFDB 5DS8B 2GUOA 1EBAA 3OKDB 3STBA 5TQ2H 1G7QB 3P30L 3RGVD 4DFHA 5D7IE 3ZKXC 5IMOB 2YD3A 4URTB 4M7LH 3MREB 5M7QA 4GXUM 4GBXC 5A40E 1MWAL 4HAGA 5ISZA 3SDXB 2BNRE 1AJ7H 5MI0C 3VFGH 2R1YB 1U58A 3L3JA 5EU6B 1CG9B 1IM9B 2VE6B 3VFOA 2E6PA 5E8PB 4G8GB 3G5VA 4NQCB 3BZFA 4Y0GA 1I8KB 2AEWA 2NTFB 4GKSB 5GS0C 4R26L 3JXAA 1KJMB 4GQPH 1VCAA 5FOBB 4LP4A 2YMXL 1Q8MA 1CDJA 4U0RB 2Z8WC 1I3RA 5CHNB 5H37G 4Z76B 5L2KE 1IGJA 1MHHB 4NGHL 3ZL4L 5DJ0A 4FQLH 3FB7A 3EO9H 1OT1A 1CGSH 1S9YB 4WENB 3MV9E 3TYGL 5HPMA 1QO3B 4JQIH 3LRSA 3RWHA 1EA9C 1FYTB 1J8HB 3FO2B 4EIGB 4GG8A 1RZ8B 1RZIB 1FN4A 4J3WA 2QHLA 4X83A 4GKZA 5E8OA 2EE9A 4X6BB 5E5MB 5K9OB 2PF6A 1R5IB 3MRNB 1KELH 4M3KB 5E6ID 2IANE 2HVJB 2EE3A 1NGZB 3BW9B 4NKOB 3WKMH 2DQGL 4GMSH 1IGFH 4KI5C 2A9ML 3KR3H 4HG4K 1AKJA 3EFDL 3BO8A 3MLRL 2ZOKA 1C5DB 1BZQK 3O8XC 3CCHB 5IJVB 1QSFD 3T0AA 1NC4B 3QNYB 3RIFK 5L88L 4BSVB 3ARGA 4ZXBA 1R0AL 2XN9E 3IFPB 3OX8A 5IFHL 1A3RH 1MUJB 3BDBA 3T65B 4U7MA 1ZLUK 3FN0L 3RDTC 2HRPL 4YH6A 1KLGB 1DP0A 2PTTB 4R2GC 1FNHA 4TUKL 4JR9H 4M4PA 1N59A 5E7BA 3G5ZB 5IW3A 3E2HB 2XI9A 2VNCA 5C0CB 3U36A 4NKIL 1YYLL 5E1HB 5KZCD 4K7PX 1RULL 5EUKB 5DSCB 3NMEA 2X09A 3LKNB 1P4BL 3PGCB 4WHYH 2BC4B 4WTXA 4TSAL 1YC7A 4PJ7E 3RPIA 3WKNA 2DQHL 1CFTA 1MREH 3ZE1E 1NKRA 3CSGA 2EDRA 2YUWA 4HC1L 3U2SB 1OM3H 1HEZB 3CDGA 4RBPK 2BSRA 3K2UH 1DQDL 5GISL 1O7SA 1INQA 1NBVL 3OJ2C 5C6TH 5GRYA 5C09D 3BPNC 3MRKA 5D1ZD 3PL6C 1TPXC 4ZAKD 3BESR 4NO5B 3VH8G 3BP5B 4ODSH 1UA6H 2YPKB 3PWJB 2CMRH 1BFVH 5KAQF 5MENE 4WU7B 1SEQL 4QO1A 1T2JA 5IVOA 1A7NH 3RZCD 5IG7B 4K2UL 5HHPA 4PTTA 4KMTL 3OTTA 5T1MA 4YC2C 1FGVH 1IEAA 4L4TE 5D5MF 4Y4FC 3BP4A 3CSYB 4K94L 3O6ML 1ND0B 2G2RA 3KPRD 3MJ7A 1X5AA 3H9SA 2ICEB 3DHJA 2QHRL 1ZA3B 2YPLA 4NQVA 2XZAH 3MRJA 2CIKA 2R1WB 4ELME 5JR1H 4XX1G 3SDDC 4GRWB 1NCBH 2FSEB 1KJ2B 1IRAY 5C08B 1N5AA 4ZSOB 2FX7L 3K0WA 3VXRE 5EDXA 5AYQA 5J1AB 5E8NB 1TCRB 2XIDA 2D31B 2IPTH 4QXTA 1NAML 2O5ZL 2IJ0C 4OLYL 4XPFL 2Z31B 1IILE 1HKFA 1U8KA 3FO0L 2GJJA 2NYYD 1EVTC 4M4RA 2Y06H 2EDBA 5FECA 1ZV5A 3FRUB 3D2UA 3RL2A 4LLAA 5CP3A 4HIEA 3SDCD 5HYJB 3O2VL 5D72H 5SWSA 4K9EL 5I76A 2VLRB 3QR2A 1YPZA 3NIDE 3HI6H 1LO4L 4YDKL 4HF5H 4ONHB 1B0RA 5DUPL 3T4YB 3IGAA 3ULVD 2X70A 4N8PA 4LPWA 3UTTA 3C08H 1CN4A 3UPRB 5KVDH 4A6YL 1UACH 3KWWA 1L6ZA 1FZMA 2PCPB 4R0LA 1DN2A 2ADGB 3EJYC 2MWCA 3MGAA 5IFAH 3HAEA 2OZ4H 3LHPH 3O3BB 3U82B 3MROA 3C5ZA 3MX0A 5CSGA 1DDHA 1JVKA 4PRBB 4WFED 4OTXL 3FB5A 2I07B 3DSFH 2EXWD 4LP5A 1UWEH 2X1PA 1NKOA 5ESAB 5D5MA 3NVQA 2CSPA 4P3WA 1BFOB 4L5FL 1U8JA 3VD5A 5AZ2L 4IRJA 3BWAB 5C8JB 4EDXB 1T7WA 4OV5A 4XAKE 5I18L 1JRHH 1A7RH 3RUGB 3VCLB 3HE7B 2CD0A 3IDXL 5D7LA 2F19H 4AEHH 2VITA 4HD9A 1AXSA 4YHKH 3RWJB 4JN1L 1OP5H 2NXYD 4G3YL 5A3IC 3EYQC 2X4UA 5HD8C 1YYML 1NGWB 1DL7L 1MFDH 3QHFL 2FR4B 1DLFH 4F7MA 3IDUA 4NN6C 4CMHB 3PQYA 1YNTA 1M7IB 4ZPVA 3V5DB 1MWAA 3U9UB 5B38A 2KQMA 3V79C 3LKQB 4P5TC 5DQ9B 3IJHB 3TVMD 2XICA 2Q7YB 3BH8B 4M48L 3DXAA 4HKBB 1JYNA 4Q9QL 4P4KC 2C5DC 5SWZE 1T5WA 3RU8L 4JFYB 4LU5L 4RZCA 2WBJB 4LPXA 4XNZC 4H25A 5CSZB 2NY4D 4KHXL 3B9KB 3QO1B 3MBXL 1G6VK 2GTZA 3NH7H 5F7FA 3GUTB 2OR9L 4PJXA 3ULVL 1YEEH 4UZGA 3ZYJA 3VRLF 4V1DD 5D6DA 2PXYC 3MNWA 5K93A 2E6QA 5D2NA 2GJ6E 2APVA 2OK0L 1DQMH 4HKJA 2WUCL 1HDMB 5A1AA 2R8SH 2OL3A 4MGXA 3RVWD 4PJ5E 1CFVH 3IAPA 4GMTH 4HXBH 4Y5YA 2BCKB 4Y1AE 4AMKH 3KPMA 1IC4H 2AQ1A 3WJJA 4KXZI 1YN7B 4HPYL 15C8H 1HNGA 4NWUL 3LDBC 3C6LC 4UU9A 5I1EL 1B90A 4PJ8B 2ID5A 1I8LA 1CICC 1EEYB 5I15L 2BOBB 5I0DA 5IT2L 2E6JA 2VDMH 4CNIA 3O6LH 3ZHDA 2Q8BH 4BQCA 1BQLL 2ZUXA 1OHQA 3KYKL 3T0XA 1Q9WB 2J8UB 1J0YA 2RFXB 1OAKL 5T33L 4OAWA 2E9IA 1B4RA 3W0WB 4D9LL 2F9BT 2XA8H 1SMAA 4M62H 1IFHH 3FAXA 2LU7A 4HDIA 4K7PY 4TOYH 1JWMB 1VACA 3X13B 1PW3A 3TBSA 5KS9B 2V17H 4Y4HD 1K4DA 1GGBH 3I50H 3TA3B 1EAPB 1IEBB 1SVZA 1BIIA 3AM8C 4PFEA 3O4LA 3SDAB 2W92A 4P5KA 4S1QL 3WNLA 1GOHA 3OL2A 1DBKL 2F5AL 4X6CF 1M05B 4LCWD 4KXZH 1IKNC 1KSRA 1I85C 3D39A 1JPTH 4Z95H 3P9LA 1EEQA 3MRMA 4M6MH 4MD0A 3MLYL 2A83B 3PWPD 2ZCLH 4X9GA 4M1DL 4JFPA 1E4KC 1G7PB 2NY0D 1K8DB 1X4ZA 1BLNB 5B8CC 4MHHI 4RSVA 3ABZA 1WIUA 1FLRL 5DMKB 1D6VH 3VG9C 1BFSA 3VXUB 1UQSA 1LEGA 3EFFB 3VXOB 1A21A 4S1SL 4MB3A 4QRPD 1Q9KA 4YDLC 4C4KO 4JKPH 2NLJA 1JGLH 2Y6SD 5H94A 1CE6B 1AQDB 5GS1C 2CDFB 4JHWL 4ZOAA 4RAVB 3MYZA 4RWYH 1QKZL 1CK0L 5JUEL 5IK3A 2FJGA 4JFXB 4AYFA 4JFDB 1QSFA 3SKNA 1KBGL 5F7YC 3WFZA 4XVTH 3GGWB 3BQUB 4OCSH 4PY8I 4RNRA 2WBKA 2GIYA 2X4RA 5I1JH 4IIQB 3TN0B 5CIPB 3C2AH 4QHNB 4L4JA 4ALAL 4OUOA 5GGSB 5EOQH 1UB6B 2FIKB 2DYPD 2HFGL 3ARYA 3MBEC 5HDBF 1C08A 3MRGA 3OXSA 4J3OC 2DWDA 1NAMA 5HYFA 1TTFA 4M8QB 4LKXA 3BN3B 4FG6D 4X98B 2PTUA 1TZIA 2ICWJ 5F9WC 3UZEA 5EBMA 5GZOC 4MQXD 2AERT 3HS0B 3UPAA 2VUOA 4Q9RL 3UYRL 3FFCE 3KYOB 1L0QA 1JTPA 5T3ZD 4HIIA 1CDIA 3T04D 3ULVF 3KYMB 1VA9A 4JZOB 5CWSB 1QUNA 5DRXA 1EO5A 3CLFH 1FNGA 1DBMH 1BZ9A 1EERB 3VDBA 4JLRB 5C09A 4JDZB 4GT7A 5D1ZA 3GIVA 4ZAKA 2WUBL 5F8QC 3AS1A 5DJAB 1U8LA 1LVEA 4XNQB 5DDHA 3MSPA 4PV9A 4HXAH 1T1ZB 4PGBB 2H2SD 4Q6IB 3N9GL 4NCC2 2R0LL 1NUFA 3RZCA 5C0AB 4LSUL 4MD5B 4FQ1H 3U7YL 4I2XE 2Z93A 1A1MA 4M93B 3OKYA 2B1AH 3QEHA 5IBUG 5GSVA 2DM2A 3UBXB 2J3SA 2R23A 5T1LD 4HMEA 4CGTA 3KPRA 3GMQB 5I1GL 5F72S 3HMWH 4HWZA 2ZOLA 3TM6A 1DUYB 1YUHB 4PJIE 4ERSL 1ZGLA 3S98A 2WIMA 3HE6D 3V6ZA 1KPRA 1H8SA 4F7PB 4L4VE 1DSFL 2H41A 5CMAB 2IG2H 3MV7E 4ZUTA 1EO8H 3FFDA 1IGCL 4QRSB 5EZIH 5KSBF 2VLKB 4UDUA 1F8TH 4LLYB 5EPMB 1I8MB 2CKBB 2WIIA 2AJZA 1ORSB 2ITCB 3NCJL 3LSOA 4QOKD 2PYED 4H88L 1JN6A 1T04A 3MRIA 1YJDL 4P4RA 5BV7H 5L2JA 5GGVY 1AO7D 4P3DA 5TQ0L 2EDXA 3P11H 4PY7A 2R15A 1XF1A 4GW4A 4ODWA 3SDCA 1GGCH 4F9PA 3VI3F 1KTRL 2R56H 3OGCB 3I02B 5ENWA 2F58H 3MA7B 2EKSB 3N0PB 5T3ZL 4YDVA 4LCIL 4LEXL 4JDTL 4KDVA 2KUTA 2NR6C 3D25B 3NCEB 4L8SC 3STZB 2VAJA 1AGCB 5IM7B 5K9KB 5JW3L 4AQ1B 5F3HB 5HHMD 3QH3A 43CAB 3TZVB 2A77L 2OSLB 3QUXB 4JVPA 3F6LA 1WEJL 2SEBB 2FD6H 3RVXC 4PG2A 3WD5H 3BKCL 2E7LA 4S0SD 2EEBA 2I60L 3MUGB 1RZ7L 3VXMD 2AGJL 3TJEH 4WVRA 3OR6B 1W72H 1URLA 2VXUH 3W11D 5GGTH 2DQDL 1KC5L 2R2EA 4YZFF 3ZTJH 1D5MA 1RIVL 1KCKA 1TJGH 3QEQB 2AXGB 2VZUA 3JTSA 5ACZB 1XGPA 5HY9B 4KGJA 3LKSB 3OKKB 4KAQL 3SQOH 5IB3B 4Y16B 3SBWA 4I4WA 1SJHA 1S5HA 5F96H 4WFHD 4XPBL 3IF1A 2A73B 4HPOH 3O6KH 3KXFB 4PREB 5JPNB 4X7DC 5KOVC 4NJAH 1W0WA 4K55A 5KSBA 5DGRA 2HVKA 5FYJE 4OM1H 4YHNB 1UJ3C 2P5WB 3L5XH 3RTQC 1SEBB 3DYOA 3GSXB 4K3HA 5D96B 1LEIB 5INDA 3KJ4C 3WEXB 1E4WH 3HRZA 1JWUA 3KPQA 4PBXA 5FA4B 2VDNL 4LRIC 3LIZH 3IU4H 5ERWA 2IF7A 1WBZA 3K81A 1N8ZA 5IB5B 1RUKH 2H2PD 1Q1JH 3TVMA 5F6HI 1HN1A 5CILL 1AP2A 2W0FB 5BS0A 5ILTH 4M03A 5A16B 3X11B 3U7AA 4CVWA 4TSBL 2APFA 1DVFA 4H20H 3FQNA 1I4FA 4Y4KD 4MQSB 1AIFB 1I9JH 2DQEH 5HGAA 3UDWC 4M5ZL 2AV7B 3LV3A 4DKDC 5I75C 3NTCH 4YDJB 2P48B 1RUQL 1XIWA 2X6MA 4KK5C 1KUMA 3QNXB 5T1KA 2PO6A 2YEZA 3ARDD 4V1DA 5D1QA 1MFNA 5F44A 4G6AD 4F7CB 1INDH 3WJLA 4RAUA 2NTSP 1IVLA 3QFDA 1A9BA 1MHPH 1BIHA 1QSZA 2V5RA 2CRYA 3OMZA 2Z8RA 2RCSL 2UV3A 3D6GA 5J3HC 2YRPA 1FE8L 5JMOC 2JJTC 3SO5A 2UZXB 5IVZB 1UM5H 4NKDB 4I48B 2OQJB 4G8EA 4IRSB 5TE4L 1QFUL 3PGFH 1MH5B 4GKNA 5IWLC 1Z0NA 5JXAH 4R97C 1JGDA 1KB5L 3WCYA 4FQPA 3EOTH 1OCWL 4JRYE 1XH3B 3RWIB 3CX2A 5A43C 5E8DH 3GO1H 3V52H 1F2QA 4LCYA 4V2BA 3H3PH 2E7CA 4HH9B 1VFOA 4IJ3C 3SJVE 2PNDA 2XTJE 5DD1H 1AGBA 1T4KB 2HKHL 2HT3C 2MQCA 4U1IA 5FUOH 3QIBC 5GS0D 3RBSA 4FTVB 3IS1X 2AJSH 5IF0A 3TCLB 5EU4A 1Q94A 3S37H 1JP5A 1PQZB 2VDPL 4MNGE 2Z92B 4R3SA 3RP1A 1RUML 4OFIA 2DD8H 1Q9OA 5DD6B 1YEKL 5J9PA 4OZFB 4PJBE 1X6NA 3BOVA 2DQIH 4ONGH 3NFSH 5E5MA 3RGVB 3H0TA 3V5HA 4JJ5A 2HTKC 2NX5B 4XP4L 2QQKH 3T4AB 5IIEB 3MJ8B 1Z9LA 1FL6A 5FHBH 5TDPA 2OTWA 1HWHB 2BRRL 3B8SA 4JM2C 4LCWA 1HSAB 5IJVA 2ED8A 3B9AA 4WGWB 1A6TB 1HXYA 3S5LG 2VZSA 3FMGL 2ZWLT 2X4SB 4OZGE 5FGCE 4QF1B 4DKEL 1QHOA 4JO1L 2R4SL 4TRPL 1ZLVH 1WCBA 3O8XD 3PWPA 3S6CA 1JTTA 4UTBL 3IDMB 1KGCE 2D7NA 5D70L 4RGMB 1Z3GH 4YBQC 1G7LA 1EZVX 3EYSL 2N4IA 2NY7L 1GGIH 4FQQB 1FIGL 4LDOB 1JF1B 4UT9H 1PY4A 3GBLA 2XXMB 2YXFA 3RDTD 4WEUD 3WL9A 3HR6A 2X9XA 4ODHH 3RWFA 5TPWL 5FM8A 4KKBC 2J4WL 2XWJB 4KJQC 4NN7B 3ZE2F 5JZ7C 4R2GD 4QTIH 4DQOL 3G6JE 5I1IH 4NJ9H 5FYJH 3G6DH 5IHZB 2BRQA 1FL5B 2H6PA 1VHPA 2NW3A 5E6IB 2VMFA 3QNZA 4EUPA 3HZVA 3WNPA 1YNKL 4FFZH 2DJ4A 3QCUL 5JO5A 3DARA 2DQCH 4KTEH 4GW5B 5DRZA 4EDWH 3C6SB 3IJYA 4ODXB 1MJ8H 3I6KB 5GS0L 4FFYH 4F80A 2HJLA 4PJEF 4NWTH 4PRPB 1PJ9A 4JO2L 5E56A 2RJMA 1BZ7A 5EOTA 3ES6B 1L0XA 2XPGB 5F7DA 5FCUL 3S36X 1PZ5A 4F7TA 3DUUA 5HGBA 3PL6D 2AK4A 4E41D 3VXTB 4BZ2L 4G6FD 5E9DD 3TNMB 3C8KB 1TZGH 4U7KA 3O45B 4JB9L 4L9LA 3BXNA 2AEPL 3EYFB 5T5NG 1WBXA 4Y89A 4G6KL 1HQ4A 3P0YH 2E9JA 1G6RL 5IR1B 4Z6AT 3CXHJ 3SO3B 4BUHA 2QQLL 3I3BA 4NUGH 3HG1E 5KZCB 5DHYA 3TPUB 4Y4FD 1BFTA 3UEZA 3NN8B 1ZA3A 2VAAB 1FVEA 1CLOH 3K80A 4CVZB 4X9IA 2DIAA 2Y23A 3I9GL 4X6CB 3VMNA 1J5OL 4O02L 5E24E 3HCVA 1MI5E 1S9VB 3DX6A 1EDQA 4OF8A 2A6DA 2CXKA 3QWOB 5C0RH 4UUJB 1BD2D 1J86A 1QFWI 1KN2L 3OF6D 4GO6B 4DCQB 4C56A 3SDDD 4WFFD 2VZOA 4N0YH 1QFWM 3D0VA 4A6YB 3NFNA 1V3JA 5LGHL 1H5BA 4C54A 3RGHA 5EA0L 3BEWB 4HGMA 2EEDA 4L3EA 3TIEA 4BELD 4Z7WE 1WT5A 1GHFH 3GB7A 3I2CH 4EZMA 5K9JH 2WWKT 1JK8B 5T1LA 3PP4H 2XQBL 4LLQA 2F53E 2YPVL 4NM4L 2HFTA 4QWWC 3RVUC 3NACL 2YN3A 3F5WB 1A0QH 3ARBC 3BMVA 4M7LL 1IKFH 1QFHA 4UDTB 1YEDB 3VH8A 4HUNB 4WO4C 1ED3B 3CFBB 4PJEA 2MQ0A 2VC2H 4K07A 3VFGL 1H3XA 1A1NB 4QOKA 4JHZA 4LVNB 4OD3H 1G7HA 4FN0A 2Q87A 3S4SB 1IGTA 3KVQA 4KMQA 4OSUH 4MCZA 4I13B 3KHOA 2O93L 4XH2B 3D18A 2Y5TB 3EJYD 4P2RE 4GG6F 3I6LE 2BHUA 2GI7A 5HVWA 3WIHL 3JVGA 4QKXB 3S34H 5E8EA 4OJFH 3MJ6A 4UIKL 5CEYB 4HIXH 3WNKA 3EO9L 3WO4C 1CGSL 4R90L 5HHOA 4JQIL 1MAKA 2GSIB 2ITDA 4GOSA 3VD9A 3RUGA 4YJZL 4ESKA 3CFKB 3ILPA 1K9TA 4HV8B 5I1DA 4PP1C 3KPSD 4Q6YA 3EYUH 4WV1A 1KELL 1HILA 4H0HB 5DEGA 5FO7B 1KJVA 2V6HA 3WKML 1LE9B 1FHGA 3TESA 3MUJA 2DTMH 1UKQA 4MD4A 3KR3L 1AFVL 1IQDB 3OXRB 1OP5K 3SKUD 3UYOD 3VXMA 3QBTB 1U2HA 3EYQD 1V7MH 3JTTB 5HD8D 1LGVA 1PYWA 5EN2B 4O2CB 3MC0A 4RDQG 2BNRD 4L3CB 4TUOA 1QBAA 1YQVH 1LK3H 2R29L 3NABH 4JKWA 4P5TD 2AEQH 4U1HA 5CSZA 1WFTA 3EO0B 4OZ4A 4XVUC 1CD8A 1OSZB 1H8NA 3LY6A 4JR9L 3AVEA 4E9LA 5HXMA 5L2KD 2DOCA 3CVIH 3NOIA 4U31A 3V4UH 1QA9A 4POUB 2D7MA 1C12A 3MLTB 2P5EA 5F1NA 1JZ8A 1JPST 3MV9D 4AZ8A 2FECL 2D9QB 2PXYD 4PLOB 1CF8H 3UTOA 1JHLH 5ESQA 2NXYB 4Z8FH 1QRNE 1W8OA 2C1PA 3PDOB 2ZUVA 1D9KB 2VJXA 1RIUH 2DQUH 5I8OH 3JWOC 1OM3L 4NC1E 3IXAB 3SE4C 1SY6H 1I3GH 4K71C 4GG6A 4Q0XH 2IAND 4PJ8A 3JUYA 1TZHA 3F7YA 4Y4KA 4RMSA 5FB8A 1GC1H 1EZVY 1UCBH 3FOLA 3J8F7 3OZ9H 4BZYA 3CZFB 3C6LD 3GSRA 3V6BR 4ODSL 4J4PA 1JV5B