1FNGA

Histocompatibility antigen
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
182
structure length
182
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MHC CLASS II I-EK, ALPHA CHAIN)
publication title Structural and functional consequences of altering a peptide MHC anchor residue.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 37
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fngA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1fngA01
1WCBA 2AJ3A 4XCEB 2VITB 5A2KH 4GXUM 3RBSA 5E95B 12E8L 1WTGT 5HVHC 5C08D 1RSFA 5AG9A 2OQJB 3CFJB 3RWGA 2HT3C 5HHXH 3K74B 5I2IB 1GOGA 1RJYA 5I19H 1YYML 2IFFL 4UINH 3SGJC 3EOTL 1OGAE 3IRPX 2Z31A 2DD8H 5ALCL 3R8QA 5EPMB 5EOCH 4QRPD 4HLJA 5F88B 4G8GA 2EDHA 5D72L 1KCUL 2PO6B 4FABH 4UIKH 1CF8H 3BSZL 1UFUA 4PD4K 4LNRB 4LLMB 4WUUB 1AHWB 6FABL 5KVEL 1WBYB 4G42B 3V7AG 2NY1B 4HV8B 4QT5B 5GQBA 1AQKL 4PP2B 1V7NH 2OCFD 4JFYA 1RJLA 1AFVH 2F8OA 2X4QA 1H3UA 4K2UH 4WI5A 1CZ8H 5TDOA 1RURL 4JM2B 5J1AA 3ULUD 5D7IF 2DM2A 3OQ3B 4LEXL 4NSKA 2AXGB 1D5BB 2YZ1A 5E4EC 5HGHB 1KCLA 4OFYA 4LPYA 3GI8H 4M7LT 1V3MA 4ZUTA 1YYLL 2P43B 4NNYB 2D0HA 5DFVC 5B39G 1E4XH 1MHEA 1TVHA 2NY1D 3DRTB 3PP4L 5DI8B 2EC9T 1AGCB 3BZ4B 3EDKA 3E8UL 4PJHB 1GPOL 3O3AB 4YHLL 3PL6A 1DQDH 4JM2D 3H6JA 3TV3H 4DGVH 4H1LH 3C9NA 4PJ5A 1Q9WA 5J12B 3MBEA 1E4WH 4G9FE 4HXAL 2FATH 3S88H 3FO2B 1MVUA 1RZJH 1SBBA 1OM3L 3G6AA 1FDLL 3ZE0E 3MJ9H 4U1SA 2XZQL 1QFPA 4O9HL 4QEGA 4DKEL 1INQA 1N26A 3SEPA 3MROA 3C6LD 4GG6A 3RWEB 5EN2A 2YPKB 4PRBB 4PJEF 4U1JB 4P5TC 1K5NA 4KK9D 1JP5A 2ZOKB 2RCSL 3BZEA 2F5BL 3BVNA 3IDXH 3VFRB 1UB5B 1JMZA 2DLTA 1NGXB 3GSNL 5FB8A 2FHBA 1UQSB 4NO3B 3FHQA 4IRZL 4Y19E 4KKCC 5H35A 4FQIH 4LPWA 5DFWH 3GK8H 1OF2B 1UZ8A 2NY4C 2NLJA 1OSPH 5HHOA 1MVFA 4C83A 5JQ6H 1M4KA 4HHAA 2VAJA 3KWWB 3MRHB 2Y07H 4MDIB 4QXTB 3RVUD 4D0BA 1CDHA 1ZGLA 5CHNB 1BECA 1KJ2H 2ADFL 1KG0A 5F9OH 2B2XH 2NY5C 2OJZL 1KULA 3SN6N 4FFYH 4FZEH 5BVJB 2E9IA 5F1OB 5T33H 2FJFA 3HFML 3EYOB 1DJSA 3RIAF 2P8PB 1A6UL 3F58L 1DEEB 2BNRB 3RVVD 1FE8L 3TYFA 1N8ZB 2CKNA 4HUKB 3VFMA 5IKCB 1R3LB 2Z35A 1W0VA 4I4WB 1WC7B 4Z7WE 1S7UA 1K85A 1MOEA 3WIHH 2ZG3A 5JIHA 8CGTA 3PDDA 3RPIA 4CJ1A 5FECA 4XVUD 1IJ9A 5F3HA 1GGYA 4NJ9L 3MLUL 4P23A 5CJ5A 2DQHH 2FZ3A 2BNRD 3G6JB 5AAWA 3SKOA 4YDJB 3H7BA 2BXZA 1E28A 4Y4HA 3FFDB 3U0TB 5CD5D 2PYEA 4JO1L 3BP4A 3PV6B 3RY6C 2C26A 2HTKD 1KB5L 4XC1H 3DV6B 4NN6C 1MCOH 1S9WA 3UC0H 3D69A 3T4YA 3BPLC 4F7EB 1NMAH 1URLA 5I17B 3WFZA 4JDTH 2ZUQC 4B50A 2HRPL 5D96B 1XGRB 4HGMA 5D7SL 2DLEA 5IG7A 5F6IC 4L3EE 4DTGL 5I16B 2JJUA 1AJ7H 5AUMB 1NC2A 3IU3B 4FXLA 4KRPB 3VRLF 2JE8A 4NM8H 4HGWA 5E9DE 3ZSTA 3BRDA 1OAKH 2AEIT 4JCLA 5CZVL 1FGVL 1FORL 4QTHA 5GRZA 1CGTA 3DI3B 3KPQB 5CEZL 3L5JA 2UYLA 3ZTNL 4LSTL 3U4BH 3WDIA 5IVZB 1F4XH 4FMFA 3IFOB 1Z0MA 1SJEB 3ZKQD 1GXEA 3ULSB 1PVHA 1HHJB 2BVPB 5JPMA 4G8EB 3RUGF 3GKZA 4KRPD 1JYWA 3GM0A 3AGVA 1BZ9B 5CD3A 3HLAB 2W9EH 3MPCA 4OGXL 3U7AA 4YXKL 3NIDF 2R0ZL 1DDHB 3D5OF 4OF0A 5CJ8A 1V05A 2KH2B 3PIQB 3TPKA 4A6YL 3OR6A 4FQCH 1MWAB 1WICA 4LPXA 3CFCL 4OCSL 2R23B 3OKLA 2DBJA 1U8JB 4OD2B 3PGCA 5MEND 5D93B 3KPMB 5FM4A 1F3DJ 1J8HD 3LKRA 1G7PB 3P30H 3RFZC 5IMLB 4NKOB 3SHSA 1NANI 4X6EB 1X4ZA 2X7LB 1D6EB 3OKNA 2CK2A 3VRIA 1G7QA 1KXQE 2KBGA 1FLRL 2JCCB 1Q1JL 2ITDA 2CGRH 4O2CB 5DMYA 3O3DB 1YJDC 3ARVA 5EC2B 3WE6B 2VQ1A 4OM0L 4JFFD 4UB0L 3IKCA 1LK3H 3F6LA 3DYPA 1U8LB 1XGPA 1WZMA 4JRYE 1F4YH 1HSBB 5FKAA 4JO2H 4N0YL 5FYJE 1VDGA 1LP9F 3SOBL 3UAJD 5GGSA 4ONHA 2Z4QA 4UIMB 3DMMA 1NLDL 5KSAA 1MCFA 3NA9H 4LGSB 2YD9A 4PG2A 2B4CL 1CGVA 1F42A 4D3CL 1JWMA 4ELMA 2V2TA 5A16B 1AGBB 3QCVH 1DN2A 2V7HB 4M1CD 2HT4D 1BOYA 2E27L 5ACLA 1G9MC 5TDNA 5L9DL 4F7PA 4K9EL 5FYLD 1DLFH 2XN9A 5C07A 1OW0C 4YC2B 4POZC 3MRNA 4Y2DA 3HG1E 2PR4L 2V2WB 2IPUK 5K9OB 1PG7L 5D2LF 1F6LL 2ZUSA 3CVIH 5ICXB 2YD7A 4YHPB 4FQXB 2VDOL 1MFEL 3B43A 3U1SH 2BVOA 4KDTA 4N9GA 2LAAA 4IMLB 4YLQT 2D7PA 1L9NA 5GS0D 3CDYA 5I73B 5KTEL 1XZ0A 3ARGA 5I1HL 3DTXB 4M1DL 4EI6A 3DURA 5KG9B 3BJLA 3F7YA 5L6YH 2VISB 4RGOH 3SKMA 1WFOA 3HC4L 5IOPA 4WDIB 5C2UB 2HVJB 2YK1H 3GI9L 4YGAB 5E99L 1PZ5A 2CMRL 2R2HA 3B2VL 5F7DB 4OLYH 5I1KH 4BQCA 2VMFA 3SDAB 2NZ9C 2DQDL 3VMNA 1U6AL 5IHZB 3Q1SL 3F5WA 4BSVB 1K8DB 5B22A 3RNQB 5I15L 1T03H 1EFXD 4OTXL 1A2YB 4P3CH 3V0VB 4JG1L 4TNWK 2WUBL 3T2QA 2N1KA 5LBSL 5MP6L 5FK9A 4C56E 4I2XB 2ZCKH 5D7LB 3QIBD 1UEMA 4HULB 4P2QE 5DSCB 4XH2A 3GSRA 5B8CC 4F58L 1V7ML 5DMGC 3MLSH 1MCPL 3KLDA 5DJXB 1FJ1B 4YEFA 2EEBA 4WHDA 3V6OC 5C08E 4NQED 1FZMA 4F7CA 1PZUB 2OP4L 3BO8A 4KMTL 3T08A 4JY5L 1QYGH 4L8BA 5AWNH 5HYQB 1DEDA 1X7QB 4ODVH 1JPFA 5KBNC 4YO0B 3S4SG 2FO4B 5HSFA 1VA9A 3V0WL 3DXAD 5T5NF 3A6BL 4PJCF 4CDHA 5CINL 1EDQA 4HWBA 1NANH 2AABL 4OIIL 4QRPE 1PDKA 4I0PC 4FQ1L 1HINH 4ZFOB 1T22B 4MX7B 1BD2A 5GZOD 4JEGB 2OSLA 1CICC 4YDKH 2ZUYA 1UJ3B 3GSVB 3RL2B 1DTUA 5L2KA 5DZNA 1NGPL 1XF3B 2VDNH 2LE9A 3C5JA 4M48L 4NYLB 3LN5A 5I74B 1A8JH 1KOAA 2CUHA 3CCHB 2EH7L 3N1MC 5BOPA 2BC4B 4IDLA 3PWUA 4HAGA 3L5IA 1DQMH 2RHEA 2GK0B 5CJQL 2KZWA 2VDPL 4OZGB 5ESQA 4LPUA 3UPRA 1F97A 2R4SH 4AMKH 5IROC 2VZTA 5EWIH 32C2A 5D8JH 5BRZD 1YPZB 5ITBH 4O58H 4RGMB 4AM0B 4WEBL 5DT1H 2F8XC 2E8ZA 4UOJA 4GW4B 5HGBA 5IR1A 1YMHB 3R1GL 1BZ7A 1S9YA 2ADIB 4FNLL 1NCCH 1ULVA 4BZ2H 1TVBB 3UEZA 4XBGB 2VLRA 3K1KC 2O61A 4RFNB 1MFDH 4ZMAT 1CGYA 3DIFB 4IRJC 4UQ3A 1JWSB 4KI5C 1FCGA 1SEQH 4UNUA 4QHUA 4AIOA 1J7VR 3HCVB 2LV4A 2V5RA 1RUKL 3QJFA 2E7LA 1QBML 1DANU 5HVHB 4J3UA 4OFVA 4LHUB 1U92A 4ZS6C 3WNLA 3ELAT 1SY6H 4Z8FH 3DX8A 5HPMB 3HI5H 2XOTA 3AY4A 3B9EA 4XNMA 1C16B 3BQUD 3MXWL 3B9DA 4MJ5A 5F8QC 2NCMA 4JG0L 4WCYL 2F53B 4X6CE 5F44A 4M6NH 3TH2T 5INDB 5MEOB 2AKRA 1BWWA 1EMTL 1OAYH 5F72S 4CMMB 5B3JF 4R3SA 5AD0A 2X4OA 2OR9H 3FHAA 4RX4A 3BIKA 3CXDH 4Y4KC 1MCKA 4PJGB 2VZUA 4BK5A 1KIQB 4JY6B 2IANB 5F7EL 5DQDL 2X42A 3BPOC 4FZ8H 5DR5L 1X5KA 1RZIB 4X5XA 1W8OA 4QXUH 4RFOH 4E0RA 1JGVL 2F53D 2DL9A 3X13B 5DD5H 4XMLH 2WIMA 3BWUC 3QPXH 5EU4B 2BOCB 3L3DA 5D7KE 1MAML 4OI9A 2R0KL 2XT1B 2X1PA 3UXFA 3C08H 1ZVYA 1AGDB 4HKJA 2QEJA 3BZFB 5E4EB 1A3LH 2V5TA 4P57B 3A67H 3NABH 1E27A 1AC0A 5GJSH 2IAND 3C5SB 2ADJB 4GKSA 3SGEH 1KENL 5J6GA 1ODAA 5DA0B 3ESUF 3VWJC 1MLBB 4XXCA 3H3PL 5I1JH 5DK2A 1NCUA 1QFUL 2DYPD 1R0AH 2OLDA 3NCCB 4JJ5A 4UDUB 1TNMA 1JZ8A 1U8NA 1B9ZA 2AQ3A 5KSBB 1C5DB 1JV5B 3HKFA 1P84K 4OF8A 3TYGH 2X4RA 4XCYA 1ZOXA 3LAFA 4RDQG 4WRLA 3CPLA 1QEWA 4PJAA 4KTYA 4HK0B 5J0BA 4L4JA 2X4PB 3SCMA 3CUPB 3LN9A 4P5TB 4ERSH 2VXQL 4OZIA 2Z91A 4ZFZA 1NJ9B 2EYSA 3OZ9H 3MSPA 1QQDA 1PKOA 3PHOA 4JB9H 1I8MA 2C3VA 3QCTL 4OIAA 3DJ9A 4J3VA 4Z78B 1TJGL 1A4KB 3WEXA 4NZUH 1AKJA 1A3RH 5FDYA 5FO8B 5EIIB 1NCWH 4DKFL 4F9LA 4F80A 2NY4B 1B88A 5D2NA 4EVNB 1QR1A 5MEPB 4U6VL 2WBJD 1UWEH 3OG4B 4X6FB 5D7JD 1CYGA 3IJYA 4KTDL 5DJ6B 2YPLD 3V5KB 5CMAB 4JR9L 4H8WL 5E5RB 1LK2B 4R6UA 3LPFA 1UH2A 1JUFA 5J89A 3BH8B 1RZGA 5EOQH 4MQ7A 1C5BL 1GZQB 2HA1A 2XZZA 2R0LL 2KDGA 3REVA 1QUNA 3I3EA 1FNGA 4I8DA 4FQLH 4OGYL 1TNNA 3BDXA 5EU6B 5TPWH 4WO4A 3C8KB 2VDQH 5KS9F 4OD1H 3EW3B 3QJHA 4Z7VA 4U1GC 4U33A 5IEKB 3OKKA 1F58L 1FO0A 1YDPB 3K7UA 3H3BC 5F1IA 3PNWA 3OXRA 4YIQA 5DVNA 2Q7NA 4UT7L 2DIBA 1BBDL 5BQ7B 1EEUA 1U8MB 1U8OB 2JJSC 2AJXH 4MJIB 5IGXH 5MENE 3L3JB 3BGFC 3ULVF 3M8OL 3RX7A 2VXUL 1J8HE 4S1SL 1FAIL 4U6TA 1KPUA 4WFGE 1PGRB 3RIFF 1MHCA 1S5IL 3HTLX 5ACZB 3KDMA 1Y0LA 5E94A 1A6WL 5FHBH 3WFBL 1W8NA 3S7GA 5FUZL 3U82B 2YBRB 4UV4H 1WZKA 3MLXH 4ENEC 5C0EB 4TOYH 4NN6B 1J18A 3BPLB 3O2DA 3ROOA 5JHLL 4HBCL 2ZUQB 4LSVL 4NO0B 4JFFE 4M7KL 5HDQH 3QI9C 2NY7H 5F6IB 1R6VA 1CFSB 4UTBL 5KANG 3NIGF 4F2MB 5C6WH 2R1XB 4J1UA 2GTZA 3QAZC 1S7VA 2AK4E 3EFDL 1P4IH 5C0BA 5ERWA 2P5WA 4L4TB 5I0ZA 1IM9B 3W5MA 1TLKA 4Y2OA 3SDXF 4PJ8C 3EZ8A 1RUPL 1CFTB 3LQMA 4JHWL 4NO0D 5F9JB 2DKMA 2YWZA 3PP3H 2VAAA 3UJTH 3QUKA 4M7ZC 3NFSH 4X4XB 1QRNB 2FR4A 1F3JB 3MRIB 3K1DA 3TN0C 5ISZD 4NC1E 1QFWH 2QBWA 2VDRH 2V9RA 5T1DH 2YC1B 1BJMA 4L4TD 1IM9D 2ZJSL 3GSXA 5D71L 1A7RH 5IB4B 3BKYL 1VACA 1JVKA 1KELH 1T7YA 1AGEB 2CDFB 4L4VB 1EVUA 1QRKA 5T3XH 5E56A 3IYLW 4MD5A 1QRND 1HKFA 1R3JA 2PUQT 4HFUH 2V9QA 1TZIA 4APQC 3P73B 4FFVD 3JV0A 4BQBA 1AR1C 2X89D 4G7VH 5F1NA 3SGKC 1I9JH 4GW1A 3DX6A 4J3SA 1CD1A 3MV7B 5D7IE 1NGYB 4XPHL 2IQAB 5EFIB 3WIIL 3AC0A 4HFWB 5GGTL 5ICYB 3AM8C 4JCMA 3KHQA 3TBWA 1GGCL 4WWKA 3PF2A 4LHJB 5LCVH 5IMMB 3CGTA 1JHTA 1T83C 5HHMD 1Y18A 1ZANL 3T0BA 4DVBB 3O2VL 5ETUB 4ODHL 3TNNB 5FKPB 1AD0A 5C9JB 3HZMA 5HYSA 3QZWB 3ZZ1A 1GZPB 1G9NC 5EU3B 2NTFA 3FOLB 3RQ3A 3U0PB 1G7JB 4X8JA 4N8PA 5EIVA 3ARDD 4ZSOE 2EXWC 3W2DL 4R4FH 4XNQB 4NQEE 5GRYA 4JFDA 1BJ8A 3BEVB 1ORSB 5KVDH 1YYMH 1XGUA 3I9GL 3EOTH 3TVMD 4JY4B 4UILH 1HZHL 1TZGH 3H7LA 4O2FB 4Z7UF 3DXAE 3GMQA 1QLFA 5HHVL 3ARXA 1KCUH 4PJEE 4Y16A 2AGJH 3CVHA 4MDJB 3ECBB 3S96A 3RZWA 1G7IB 2HVKB 4G8IA 1NGZB 1T5XB 2CLRB 3CXHJ 4QRSB 1I4FA 3IAPA 1J1PL 5DUBB 3S5LG 4S10A 4Q58C 5C0AE 1AQKH 3UMTA 5I18L 4RMRA 3TP4A 1NL0L 4X6BA 1RURH 3VD5A 1CE1H 4IMKC 4POZD 2CIKB 4OCXL 4QHLB 4KHXL 3GMOB 1KN4L 2G5BA 1FFOB 1J05B 3FB7A 5BV7B 3BP5A 4YXLL 1E4KA 2B1AL 4M8QB 5BRZE 4YQXH 2XWBB 3OF6D 5DDHA 2WMPA 1I1YA 1ADQA 3QO1B 4LFHG 2ILLA 4M6OL 4QRQA 4F3FA 2CKBL 4OV6F 1FIGL 1KTLB 4HXAH 2AXFB 1JTTA 2A38A 4AEEA 4J3OC 1JZ5A 3WFHA 5GRVK 2YZ8A 1ZVSB 3FOMA 5B8CB 1K3IA 3BIAX 1WZ1L 5FIEA 1TTUA 4DKEH 1FO0H 1P6AB 4DVRL 1KJ3L 5IJVB 2NZ9D 2NQCA 1T1YA 4HK3N 2EDNA 5E8OB 1A6ZA 1OTTC 5GRJL 5F7HA 2A83A 3K46A 3OKMB 1NFIA 1HYSD 2X4TA 4K07A 5IFAL 1A5FH 1NKRA 3BH9B 5HI4C 4IRZH 2AJUL 4HWBL 3HNTL 4FQJL 5J57B 4WFHD 4XNXH 1YEGL 5DMGD 1P5VA 4W4NA 2QQLL 2H9GB 4I0PB 2DI9A 1I8KB 3VH8A 4GH7B 4GBXA 1CICB 1IAOB 2WWMC 4YR6A 2W9LA 1RZ8B 3T0VA 2OJEA 1H15A 3VMOA 5JW3H 5E5UB 3SPVA 1B4JL 1ZTXL 1BFTA 4XRCA 1C08A 1EXUA 3D3VD 1PYWA 1RI8A 4GG6F 3V4PH 4I0PD 4ODXB 3TT1L 2IWGA 2WK2A 2V17L 3GMLA 2R1YA 3HE7D 4X80L 1CICD 4EI5C 5GRUL 2H32B 4TULH 3SKJL 5K9JH 4Z0XB 1RZFH 4P5MB 4B53A 3IU4H 2ZOLA 3UTSB 2APBA 3GIVA 1I85C 5D6CA 5DRZA 3VFSA 4X5WA 4HJ0C 4J3XA 3THML 3KS0H 1NSNL 5IJKA 1F13A 2GTWB 5HVWA 5JHDA 1FRGL 4NJ9H 4IRJB 2IH1A 2NW3B 4N0CC 3TO4D 1CDIA 1RIVH 3JV5A 4XNUL 3GZKA 4G5ZH 4P4KA 4I48A 1AQDB 5HDBF 3N0PB 4OI8A 1FN4B 3BZDA 3UTSD 2H3NB 1CTNA 1KBGL 5MHSD 2M8XA 2ZPKH 3LB6C 4NN5C 4XHQA 4HUWB 4JO1H 1TENA 4IIQB 5FOBB 1KB5H 3NOIA 1IC4H 4X83A 3H9SB 5EZLA 1MIMH 1N5AA 5KSBE 3NAAL 2GJ6B 3QEQB 1UWGH 2CRMA 4KI5D 5CSZA 5JW5A 3EGSB 3L6FB 1G0DA 3IDNA 2J5LC 2W0PA 1JGEA 4GRWE 4JGMA 4Y4KB 2UVEA 4DGYH 1YEFH 1ZT1A 3SDCC 1SYSB 2BSTB 4G7YH 4CMHC 1JHLL 3FQUA 3G5ZA 4ONFL 3U7YL 3BPOB 2FDBP 3L95A 3H9SD 1NAMA 3FFCB 4R4BA 1KT2A 3HB3D 4R7DA 4KK5D 4MD4A 3ZYIA 4EIGB 5B38A 5ESAB 4PRIA 1LP9E 2YPLE 3QEQD 4KAQL 4PJBA 3AU1B 2RIKA 4NQXA 4IHOB 4NKDA 1G7LA 3X12A 4XVSL 4RMWA 1YMMB 3LRSA 1K3ZA 4Y4KD 3P77B 3TNMB 3GSUA 4WI4A 3MR9A 1LO3H 1AC6A 2ZUTA 3VWJB 1B0RB 4OGXH 3FFCD 3X14A 5AYUL 4Y8DC 3CFEB 4UOW0 4PRPA 4LCYA 2R0ZH 1AP2A 1UKQA 4WFFD 4LARL 1U8HA 1BF2A 3VD7A 2XKSA 4NCDA 3D6GA 3D25B 2NY2D 3OL2A 1VPOL 1YMMD 3VJ6B 3D85A 5D2LE 2AERT 5C6PB 3VXUD 3HZVB 4HXBL 4M00A 3BN3B 1I1CA 2BFVL 3VWJD 4XI5C 3FT3A 2VLJB 4CVZB 4FQQA 3L3GA 2HKHL 1Y6KR 3UCRA 4NZDA 3GO1L 3QQ3B 4PRHD 4ONOA 4OLWH 1OL0A 5ANMA 1UXWA 2GUOB 3WSQL 3FQRA 1EFQA 4V1DB 2J88L 4QRUB 2IBZX 1U3ZA 1J86A 2W60A 4UB0H 1QLRB 3LCYA 4PJFA 3UDWA 4R0LA 4MCYA 2HWZL 3V4VL 2VLJD 1FCCA 2DQEL 3X3GL 4TPRH 1XCQA 1NLDH 1IGMH 5IB5A 1OTSC 1ADQH 4OZFA 4D3CH 4EOWL 4V1DD 4JQXA 1BIHA 2H2SD 4KFZC 5JW4R 5D70H 1OGAA 4PRDB 4JPWL 2FSEB 2FX8H 1JI2A 5FGSA 3QFDB 5ICZA 1SHMA 1RIUL 2VABB 4GUPB 3GKWL 4XX1E 4BQ6A 2DQJH 4N8CL 4R96A 2CSPA 2BSRA 2UUDH 1NFDE 1OSZA 2PR4H 5ENWA 5CAYB 4NPYA 5IFHL 5ISZE 4O2EB 3OAUH 3QWRD 5H37H 4GAYB 2VKXA 1J0HA 2R2EB 4TSCL 3IXAB 3VFVB 2VDOH 4POYA 4WW1A 2O5ZH 4U1GB 1U8IA 2IBGA 2EEAA 5ID0B 4YFLI 3ZKXC 3EOAB 4NFDA 4PLKC 2DLFL 2V2XA 3WDJA 4KUCD 3RWHA 1J0IA 4RMUA 1OT2A 3ZHKA 1K9TA 1GYAA 1MRDL 2UY7A 4KH2A 4HSQA 1C1EH 4J8RA 4ELMF 5C6TL 3BGFB 4XPTH 1T6VN 3EIFA 4MMZC 2DMBA 2VIRB 4JDVB 4HUVA 1Y6MR 4N0FB 4K55A 3QDMB 3KPRA 4PB9L 3EO0A 3FB5A 2QSTA 2FYYA 2EXYD 2CMRH 4MNGB 3LEVL 1MJ7L 1BEYH 4C4KT 5DJ0B 5IVXA 1UM6L 2BDNH 3QDGA 2DQDH 1U6AH 2JELL 3Q1SH 4ODSL 2R1WA 4M9OA 4URTB 1RUMH 1M7IB 2Z31D 3ABZA 3PGFL 2X41A 5E8EB 3G5XB 1MREL 2A73A 5TDPB 2WUBH 5CWSB 5HHME 5LBSH 3QI9B 4G8GD 4PGDB 1KLFA 3FCTB 1EHXA 1F02I 4RIRA 4U2YA 2YD1A 2DIAA 4WI3A 5D5MB 3W9EB 5E8DL 4ENED 3DX7A 3QAZB 1MJ8L 2CLVA 3Q6FA 2GJZA 4KMTH 4NKIH 3BPNC 4I13B 2R2CA 2APXA 4PJ8B 3GSQA 1GAFH 5GGRY 3B6SB 4WHTB 3SKNA 4QOKB 1FH5H 3CK0H 3HMXH 5HY9B 4M7ZB 5CINH 4RMSA 2L7UA 4OFYD 2AABH 2Q1EA 3TN0B 4LQ1A 1QBAA 1ZWIA 1EZVX 2GSGA 2W91A 1HHKB 4N0UE 1PX4A 3VWKC 1ZV5A 4M7JL 1QPPA 5FHAL 4XPBH 3L9RB 3DUSB 4YGVA 5B3JE 3MMEB 4PJ8D 1NGPH 1RJCA 4UTAH 5F7FA 1ZLVH 3B2UC 4QOKD 1P5UA 2OTWA 2NY3C 2R8SL 1UB6A 2OL3L 1MJJA 2EH7H 2EH8L 2PW1A 1T4KB 4NHUB 4YPGB 4APQB 2WIIB 5C3LD 5CJQH 2VDPH 5FA4A 3FN0H 5FYKU 2OR7A 4K3EL 4Y1AA 1HSAA 4QNPF 5I8KL 5FOJA 4FQ2L 4P99A 4G3YL 4K7PX 1BQHA 1O0VA 1YNLL 1I3RB 1X5ZA 2XG5A 4Y5YC 4APQD 2VL5A 4JREC 4HW6A 5JNYB 1AR1D 1R5IA 3DROA 4MAYC 4L9LC 4HKBB 1S78C 3SE4A 3GUTB 3QXAA 5HPOA 3GEWB 3RWDB 5DRXA 4I77H 2J6EA 2IAMA 4NQSA 4YBQC 5IIEB 2FEEI 2C1PB 4KJPD 1MFAH 3IJHB 3NMEA 5A1AA 2HTLC 2IEPA 1ZT4A 1BGXL 4WCYH 1TITA 1T5WA 1R5WB 3BP7A 1NUGA 4RRPG 1ZXQA 1MJUH 4WGWB 1T89C 3NTCL 2W65B 3BP6A 4L3CA 1I8IB 2NNAA 1ED3A 1KCSL 3CVHL 4HT1H 1MHPH 1A0QL 3MZTA 4WFHE 2PCPB 3LH2L 3DNKA 3FQTB 1WIOA 3CZFA 3NZHH 5IWLA 5I76B 5I1AB 4JPKH 5E9DA 5DQDH 5LGHL 2C3GA 4D0CB 4NQCA 1I3GL 3V79C 2GHWB 3VFPA 1QTYT 2Y4SA 3MJ6A 1YEHL 1L7TL 4DGIL 3MACL 4HAFA 5GS1C 1ZKAA 3I75A 3SO5A 1S8DA 3D3VE 1W72L 3NPZB 1YN7B 3FZUC 4OZFH 4JE4B 4PJ9A 5K9KB 1NMBH 5T3ZE 2J3SA 3S97C 3P4MB 1Q9OB 1EEYB 1QNZL 2CJUL 2DICA 3IFPB 5KVFH 2VE6B 1X5YA 4R97C 4Z7NF 2DN7A 3BMWA 4BH8B 1AIFA 1H8SA 1UCTA 4AH2B 1FL5B 5IBLC 1A7NL 1CGUA 3MLYH 3TH4T 3QUMH 3F12B 2OTPA 5IQ9B 4MHHI 3STLB 3HI1B 3WMSA 2EO9A 4M3JA 1A7QL 4ZUUA 5KS9E 4HIHB 4MCZB 3NFPB 1NC2D 3MLWH 5DVKA 1R24B 5I1LA 1UCBH 3VXSE 3T0EA 2BJMH 3BE1H 3HR6A 2FX7H 1FL6B 1UM5H 4M6ML 3OJVC 5KSUB 1HXMB 3UTSE 1VFBB 4YX2H 5GHWH 5MHSE 2R69H 1IBGL 2VXQH 4JDZA 4IEFB 2J8UE 5TF0A 1CGXA 4NNXB 5DK0A 4D2NA 1TCRB 2Q86A 4DAGH 3ULVE 1RULL 4TUKH 4G8FB 3MYJA 2AXJA 3QCTH 5IMOA 1ITCA 5CP7B 2PXYA 3B5HA 4GOSA 4K3JL 5DYOB 1TJGH 1F6AA 4NO2A 4N5ED 5DMKB 4AL8L 1X5LA 5IMKB 3PGDB 4PGCA 3N85L 4PJ7F 4CU6A 3V8OA 1VFAA 1OTTD 4PV9A 4FQHA 4E5XB 3H9SE 4ZTPH 3O4LE 3P11H 5E08L 4JR9H 2VZ1A 2EYRB 4PJAF 4U31A 3C60A 4FTVE 4RGNC 3QEQE 3NIGE 5DJ8B 3S37X 2ATKA 1VGEL 3EO1B 5HHPB 1AO7B 1C5BH 3QXDA 4HH8A 4HKZA 4OZIF 1QZ1A 3HG1A 4R4NC 4F9PC 4EI5B 4H26A 2V9TA 4WJ5A 3SDXE 1HILB 1DUYA 3N1FC 3QWOA 4NWUL 4CW1B 3RAJH 3AMKA 3W9DA 1DBBL 4L8CB 3FFCE 4RA0C 1SM3L 5F97E 4MB4A 3QG6A 4D8PB 3TBSB 2ITCA 1OB1A 3QNYB 1OCWL 3QUYC 2DWDB 1RIHH 4YK4C 1AO7D 2P8LA 1YMME 2LU3A 3GJEB 5CZXC 2P24B 1Q0YL 4M03A 5C1MB 4U1HA 3VXUE 3SBWC 1IM3B 1XGTA 4MMXC 1QSVA 3NN8B 1IAIL 3DO7A 3OHXB 3QBTB 2OTUB 4FS0A 1S5IH 4NN5B 2DQFA 3FT2B 3WFBH 4GAGH 4HJ0D 4JAMB 4EKXA 1CFNA 1X5GA 4JO3L 4JZOA 4S2SA 4PRHE 3WL9A 4KVNH 5E1AB 2ESVA 3UYPA 4NBYB 4N0CD 2QKIB 4XWGL 4S1DC 4LSUL 2HJLA 2X5PA 4TSAL 4LSVH 4OQTL 3QFJA 5DLMH 3IDYC 5D9SA 4OF5A 3G6DH 5C07D 2XA8L 3CC5A 4CAGA 3LS5L 4U1LA 4Z7VF 2OS7A 4H0IA 3SDCB 5FCUH 4UTBH 4CMHB 3GIZL 1NAML 5C08A 1TXKA 4XVJH 2VERN 4GAFB 2J8OA 4J4PC 5AZEL 4OZ4B 2CIIA 1JIBA 5J6HA 3OAZK 1K4CB 4V1DE 1HDMA 3PWVB 3DGGB 1KJMB 4HIIB 1RUPH 4JHWH 2L4OA 3EYFB 3L7EB 2B4CC 4TSBH 3BHBB 5KOMC 3EOBB 4ODBD 2G60L 2W59A 3L1OH 4QRPA 3SDCD 1RHHB 4XCEA 2EE3A 3UTOA 2VITA 3X3FL 1FZJB 2Z8SA 2OQJA 2Y7QA 4S0SD 3ALXA 3CFJA 2K1MA 3DSFH 3SQBA 5I2IA 3QNXB 4K9EC 2DAVA 4OCWL 3M07A 2XRAH 5DZLA 1JNLL 1N6VA 1UKSA 2VXSH 2ICWB 1BF8A 4S11A 5EPMA 2HFEB 1IGFH 1ZHKB 1B2WL 5F88A 4OLEA 1HHHA 2LABA 1QHOA 3P0GB 4XBEL 2E8YA 4LPCA 1F4WL 5CEXA 3CLFL 4LNRA 4LLMA 3BI9X 1RU9L 4WUUA 1AHWA 1WBYA 4G42A 4Y4FC 1ZLWK 3KPSB 4PP2A 4XPHH 1WWWX 5GGTH 4LP4A 1NEZG 3RVWC 4OM1H 2EDKA 1IC5L 1CQYA 3LQAL 4JM2A 4WTWA 3DLQR 1JNNH 4CUCA 2AXGA 1D5BA 1ZANH 5HGHA 4ODHH 1UH3A 5IB3B 3RUGB 4XI5D 4YFDB 2GYSA 3BMVA 4NNYA 4G8GE 2VH5L 4LCWB 1KNOA 3DRTA 2ENYA 4ISVA 5DI8A 3KPSD 1AGCA 2R4RH 2CRYA 5JXEA 3BZ4A 1IVLA 4JLRB 4ZFFB 4U05A 3O3AA 5JZ7D 3JXAA 3PHSA 1CG9B 4AEHL 3D9AL 3SE9L 2A2QT 4X6CA 1UXSB 1HWGB 3BN9D 4TVPH 2XQYG 4M43H 1K4DB 4G6KL 3FO2A 1HZHH 3VCLB 3F7RA 4WVRA 4KKAC 1S9XB 5HHVH 5TE4L 5ADOL 4JFZL 5C0JB 5DWUL 5IHUL 4OCMC 1OTSD 3BD4A 3EYUH 2VDMH 5D5ME 4H20H 3UBXB 3RWEA 2YPKA 4U1JA 1F90L 1J1PH 5DVLA 1YY9C 2WINB 2X4SB 2ZOKA 1TPXC 3MTRA 4H0HB 1CDCA 3VFRA 1UB5A 3O6MH 4MJ4A 3ZKXB 1NGXA 3D18B 3WXVL 1UQSA 4C55A 2VLRD 4NO3A 3UJIL 4S1QH 4PJIB 2P46B 1WTLA 1MFBL 5D4QA 1OF2A 5IQ7H 5SWSB 3I3DA 2Q87A 2FJGB 5CJXA 3KWWA 3MRHA 4QXTA 4MDIA 5CHNA 3BX7C 2B1AH 5IB1A 1CGSH 4GG6E 4PLKD 1S7SB 4LAJH 1KEML 4BSJA 4FQPA 4YDVB 4Q9QH 3RY4A 3VRJB 3T2OA 4G6ML 1AXTL 5BVJA 3JWOL 4JFED 3R8BB 3VD4A 5J56B 3EYOA 4TTDD 5T3XD 4OGAD 4RX4D 2O5YL 3TBVB 4F37K 4NRZB 1CI5A 2BNRA 4YBLC 1BVLB 1N8ZA 4MD0B 3ZTJH 4HIEB 2R29L 4X7TB 4I4WA 2QR0A 1WC7A 2VJXA 5DJZB 1NGQL 4WY7L 3QDAA 3WS3B 5HHOE 3EDEA 4ODUB 4Y8AA 2FEEL 1GIGH 3BPNB 5TE7H 3U9PL 2J1KA 3D0VB 1MCDA 3BUTA 3N9GL 3OSKA 4JM4L 4OCYH 1KB9J 3O9WC 4NO5B 1T3FB 4P9HH 3DVGB 2FIKB 3UJJL 3G6JA 2DQIL 3EHBD 5CBAA 1YEGH 4YDJA 4TN9A 4DW2H 4KHTL 3HNVL 3FFDA 3U0TA 2GJJA 2QJDA 3VWKB 4CNIB 5E6ZA 3PV6A 2MNUA 1IGCH 5F6HI 3DV6A 3RHWK 1PFCA 5CILL 4L8DB 2BNUA 4H25B 4BZ1L 4F7EA 4QKXB 5I17A 2NY3B 1A6PA 2DB8A 3LMJH 3RI5F 2P44B 3WUWG 1XGRA 2B1HL 15C8L 2XFXB 3QCUL 4QGYA 3CDFA 5AUMA 3IU3A 3VWKD 4Q0XL 4MGXA 4BELD 5GJTL 1JGUH 5GRUH 4W70A 1F3RB 3MNZB 1GC1H 2ARJB 1OD7A 2ZKHH 1A6AB 2ZWLT 2R9HD 3IGAA 3V6FB 1ZT7A 3SCMD 1WEJH 4DKAA 3B2UD 3KPQA 2NY3D 3TIDB 4IS6B 2C1OB 4NKMB 1P9MC 4RAUA 5IVZA 2Q3ZA 4OLVL 3IFOA 2F19L 4Y5YB 4M93C 1SJEA 4JREB 1CGWA 5IV2B 2O5XH 3ULSA 2BVPA 3E6FB 4G8EA 5MENA 4MAYB 4L9LB 43C9B 4B7LA 1BZ9A 5IVNA 1NC4B 3HLAA 4P3WA 4UT9L 4G43B 5E2WL 4RWYH 5I0DA 2HLFC 2J6EL 5L7XL 3MBEC 3ZLQC 5BW7A 1DDHA 2Y5TB 4UDTB 4KJWC 1CXLA 1MI5B 4I3SL 5T1LB 1D5ZB 1UADC 2M1KA 2R23A 1U8JA 4OD2A 2H8PB 4MAYD 1CL7I 3KPMA 3NAAH 5SX4I 4PJXB 1G6VK 4OUUA 1G7PA 2FWOB 5DGRA 3AB0C 4RAVB 2IG2H 5IMLA 4NKOA 4UNVA 4X6EA 2X7LA 4YBQD 1D6EA 3H0TB 1JHLH 4RNRB 3GSNB 4ONFH 2JCCA 5T1LD 2I07B 4MAUL 5CKAA 4LCUB 2F9BT 4O2CA 4ODTH 3O3DA 2NW2B 1T21B 4HC1A 3WE6A 1YEEH 4EUPG 4KAQH 5GS1B 2JB5L 5I1DB 1IQDB 4QRRB 1U8LA 3MNVB 4XVSH 1HCFX 2D0GA 4HIXL 4PBXA 4UU9A 1J1XH 1HHGB 4ELKB 4UIMA 5IK3B 4H8WC 5F9DC 1I1RA 4ZQKB 2YRZA 3FB8B 1X6LA 2K9UA 2EDYA 1UACL 4Z0BL 5A16A 3QEHB 3ZDXF 1AGBA 2P8MA 4R97B 35C8H 1EAPA 2V7HA 1MEXH 4KKNA 4QRRD 2XNAB 1GSMA 3UTTB 2AAVA 5IBUB 5EULV 3WDHA 3LQZB 1KEGL 1B6DA 1AO7E 4JPVL 3FO9B 4DQOL 3I6GB 4XHJC 5DJYB 2V2WA 2BFVH 3EJYC 5K9OA 2EICA 3FT4B 4KPHL 3M17B 4PJBF 4HS8L 2CO6B 5ICXA 4YHPA 3BKCL 4BJLA 4FQXA 4IJ3C 4XPFH 1II4E 1FG2B 5IBLD 1LQSR 5C0BD 3L5XH 5FGBC 4IMLA 3LKSB 3B3IB 3KJ4C 3UTTD 3WSQH 4ELME 4NFCA 3LIZL 4GSDH 3S36L 1VADB 2ZCLH 4XP1H 3FTGB 3DTXA 1U42A 5FYJL 5DA4A 4NZJA 4BSWB 5KG9A 4MYWB 3UYOD 1G6RL 1I9IL 1KB5B 3PJSB 2VISA 3DGCR 3K4AA 1B90A 3QIBA 5C07E 2DQEH 5L0QC 2Z92B 2FL5B 2ARWA 3KPPB 3WCYA 5F7DA 5K9QG 2JLLA 4P59L 4YFLF 1HE7A 1DBAL 3MODH 4PYGA 4NUJB 3RPKA 1CIUA 4NQEA 2DRUA 3ES6B 3SDAA 3I6LD 2VDKL 5IHZA 4KV5F 1SQ2N 4BSVA 1K8DA 3QIWC 3RNQA 4JPWH 3PABB 1A2YA 4RGNB 1BLNB 4OF7A 3V0VA 3W11D 3FQXB 1CT8B 4I2XA 3KYMB 5D7LA 2HKFH 4AENB 1RIUH 5DSCA 1S3KL 3WFCH 5DJXA 5FXCH 1FJ1A 4ZD3L 4XPAL 3JV6B 5M94B 3SE8H 4C59B 4TSCH 4PJFF 4NRYB 3MA9H 4ZS7L 3ESVF 1YA5A 4JQIL 1X7QA 4F33B 5HYQA 1BM3H 4RGND 2W9DL 1CL7H 4YO0A 4NDMB 3QUYB 5SX4H 2FO4A 3V4UH 1EH9A 2X10A 2UZIL 1N6QH 4YK4B 2DJSA 2DLIA 4XX1G 3KPNB 3MRQB 5EZJB 4LRNL 5CEZD 4A6YB 5TFSL 1T22A 4MX7A 4CU7A 5JDJA 3LPGA 1MF2L 1EPFA 5T5NG 2A74B 5IESL 3GSVA 1UJ3A 1VENA 3RL2A 5BRZA 1GGUA 3QUYD 1MJ7H 1OPGH 2D0FA 3GBNL 3VG0H 4ODSH 5HGAB 1R3KB 3CCHA 4NZRH 4D0DB 4PS4H 4XWOD 3V6ZB 5I71C 2FHFA 1ZK9A 2BC4A 4HF5H 3IDYB 3TESA 2GK0A 1IARB 3H9HB 4GJTB 4QNPE 4OZGA 2C3HA 3D39B 1QBBA 1YPZA 5GIRB 5HGGS 3GSOB 25C8H 4AT6B 4AM0A 3RDTD 2YXMA 5TE6H 4QCIB 4U7MA 3C09B 1YEIH 1BD2E 1IZKA 4FXGB 3KPSE 3UYRH 1KTDB 1YMHA 1DFBL 1QD0A 1FFNB 2ADIA 3LEXB 5L2KE 1TVBA 4XBGA 1OAUL 1IL1A 4F15C 3HUJB 2MPAL 3ILPA 4L9DA 1RJZB 1REIA 3DIFA 1E6JL 1JWSA 3D39D 5HYIA 2BRRH 4Q9RL 4PLJC 1MWAH 2Z93B 2DF3A 5IVXF 3RKPA 2BMKB 2BSED 3GGWB 3GM8A 4LHUA 3HMWL 2RJMA 3ZT6A 1PJ9A 3SDYL 4J4PD 5HPMA 3KPLB 4LLUB 3BUYA 5F93C 1BJ1H 3NH7L 3IXTA 3BOVA 2D2OA 1C16A 3MA7B 4MXWH 2F53A 2MQCA 5INDA 5MEOA 3K8MA 1OTUD 5I30H 1PD6A 4PR5A 4CMMA 4XXDB 3OPZH 2VLRE 3AFLA 4Q97A 4PJGA 1INDH 4X4ME 5JR1L 1PKQB 1KIQA 4JY6A 1K8IB 2IANA 4NN7C 3WFEL 1XF5B 3DUUB 5E5MB 3IF1B 1RZIA 2YD5A 4KTEH 2YD3A 3GHBL 4Y4FB 5I8KH 3EKCA 4XP5H 3MUGB 4GXVH 2BOCA 5FYLH 3TFKC 4LAQL 1YNLH 1AGDA 2M26A 4AG4L 4IDJH 5SWZB 3BZFA 3FONB 4U6XA 1D6VL 4PJIE 5CSGA 1HIMH 4JFEE 4P57A 5DD0H 1RUQH 1IT9L 3C5SA 2ADJA 5DQ9B 4QHKI 4X7CC 4QLRA 4Z7NE 5T3XE 1DQLL 3BFOA 1MLBA 4Y4FD 5BZWB 3SJVB 3DYMA 2AV7B 4PGBB 5C09B 3W5NA 4UDUA 5JOFB 3QDHA 2MTPA 5HI5D 5KSBA 1B0WA 2XZCL 5SWZD 1C5DA 1JV5A 5CJOH 3TF7C 3NTCH 1FYTB 1N4XL 1DE4B 5I1EH 5HHNB 5DVOA 1A0QH 2RAMA 1CTOA 4ZTOH 1U95B 4HK0A 3LH2H 2NPLX 5C09D 4PREA 4O51A 2BZDA 2X4PA 1B6UA 1FNAA 3CUPA 4P5TA 3UTZA 1FFQA 1I3GH 1TPXB 2BY0A 1AH1A 1JHKL 3FRPG 2GT9B 1NJ9A 5D7JA 1OHQA 2DS4A 2BNQB 4GFTB 5EBLB 1CS6A 1L7TH 2IGFL 4JHAH 3ZKMC 4YUEH 4KKAD 4LLDB 4Z78A 3ZYJA 3UZVB 2QSVA 3MV11 4L5FL 1W72H 2EKSB 5L88H 8FABB 5EIIA 4P4KD 4FHBD 5D1XC 4EVNA 3RGHA 1JF6A 5MEPA 3RWJB 1FNLA 1QNZH 4PJAE 4BUGA 2R0WL 4MNHB 4X9GA 2XKNB 4MSWB 3GMNB 5DJ6A 1LD9B 2DTML 4ZNEE 3GJFB 4ZDHB 5CMAA 3V5KA 1Q8MA 5L8JB 2K7QA 5C0GB 4NQUA 4LSRL 4ODWB 4WI8A 3Q6GL 4F8QA 1RUAL 4ZOCA 1MNUL 1C12B 3BH8A 3MCLH 2VSCA 1YNKL 1A6VL 3GBLA 3PWPB 3PDOB 1GZQA 4WW2C 1U91B 2LAGB 5HI3C 1T2QH 5CS7A 3L3KB 4DOHE 1VFUA 1RZKL 4YBLB 5EU6A 4ZUWB 3QUXC 3C8KA 3G5VA 5BVPH 2YPVL 1EHLH 1KACB 5IEKA 1YDPA 4FFZL 2E7LC 1FAKT 3T65B 3PWPD 1EVTC 5BQ7A 3UZQA 4LP5A 1MY5A 1VEMA 4QGTA 3IDMB 1U8MA 1U8OA 3O9WB 4MJIA 1RPQA 4ZXBC 1BFSA 3L3JA 3AY4C 3RJDA 3MO1B 3M1BB 1CR9H 1UA6L 4NC2B 4GRLC 1A7PH 3WFDH 4RAHA 1T0NB 1AY1L 4LLYB 1H3XA 5ACZA 3TO2B 3RY6A 1L7IH 3MRCB 2YBRA 5F7NC 4HMEA 5C0EA 4CVWA 1JZ2A 3E6HA 3I2CH 4R26L 4Z7VE 3O9WD 4LSPL 5LGKA 4OF3A 1MPAH 4MZ2A 5JW4N 4NO0A 1KYOJ 2ED8A 1VGEH 5H8DA 4H1LG 2C9AA 1M6OB 4ONGL 4X99B 1CFSA 1NFDA 1KC5H 1RJLB 2RFXB 1RVFL 2L7JA 2D7TH 4F2MA 4LF3B 1ZA3B 4CN1A 5J1AB 1GL4B 2R1XA 3LDBC 3PWNB 4M8VA 1T2JA 5EC1A 1JRHI 4L4TA 4LDOB 1IM9A 1FZOB 3V7MA 3WO3B 5MERB 4ETQB 2BY2A 3TCLB 1XR8B 4ORZC 4YDLC 3EYVB 4DEPC 2ZUXA 5F9JA 4M93B 3TT3L 4XXCC 4R90L 1NUNB 1QRNA 4X4XA 4O4YL 3DETD 2QADD 3RL1B 3MLZL 1F3JA 3MRIA 2W38A 2H1PL 4BA8A 1EJOL 3CFDB 1UKTA 1I1FB 2X89A 2XQBH 1DL7L 3VXMB 2EDFA 1IAIH 5IB4A 3WIFB 1XCTA 1AGEA 1WFTA 2CDFA 1DP0A 3VFWA 5GSVB 2MKLC 5C86A 2NXZC 4PJDE 5C0BE 3QISA 1IC7L 1ZHBB 3KLAB 4LOUC 3RKDD 3UTTE 2VQTA 3S37H 2ED9A 3U0WH 4PD4J 2BP3A 3MV8D 2EE6A 3P73A 4OQTH 1J12A 3AB0B 3C5ZD 2XA8H 3VXMD 3LS5H 2AW2A 1YEKL 3RVTD 3WO4C 4DFIA 2DLHA 4ZFGL 1I7ZB 4KJWD 3GIZH 3MV7A 1NCBH 1UYWL 5J1TC 1MCNA 1NGYA 2IQAA 5EFIA 4HFWA 5ICYA 4HC1L 5AZEH 3S35H 1JBJA 4P3DA 3WKMH 1KUMA 3I6LE 5D2NC 5IMMA 3I50H 3ARZA 4DUWA 3QHFH 4C83B 1QG3A 2UWEB 5ETUA 3TNNA 5FKPA 1IKFL 1MIEH 3CMGA 4M5ZH 5C9JA 3QZWA 2FO1A 1IMHC 1GZPA 3FOLA 1CXEA 3U0PA 5F1KC 4N1EA 5EG6C 4WWID 1G84A 5DRWB 2J7LA 2DWEB 2GKIA 4P46D 3D48R 4XAKE 3LKNB 4XNQA 2NXYC 4OCWH 3BEVA 1ORSA 5C0IB 2IF7A 3QDGD 3ZE1F 1JNLH 4LQFL 4I3RL 4JY4A 2CRZA 4NUGH 4M5YH 5JDSA 5GS0L 4O2FA 4YNYB 3HI6H 2OXGA 5I8OL 2SEBB 1B2WH 1OW0A 3O41A 1ZS8B 1QR4A 3GMRB 3ECBA 3RPIB 3TBTB 1M05A 3HZKB 1G7IA 1CDJA 1NGZA 1T5XA 2CLRA 4HH9B 4QRSA 3WNPA 4YHKL 1XGYL 5GGQH 5DUBA 2XA3A 5F3HB 3MJ8B 3LOWA 3HAEG 1EEZB 4IJ3B 1XMWA 3A6OA 4M62L 2HMIC 1DSFL 4ZUVB 3KJ4B 4OI7A 3OF6A 2P49B 5FUOL 2W92A 3CH1B 3MREB 2R2BB 1T7WA 2ZSWB 2CIKA 4XHJD 4QHLA 1ZLVK 3DRQB 3GMOA 5GGVL 5HTSA 2WNGA 1KFAH 2ZSVA 4DK6A 2VH5H 3DI2B 3AREB 3GJFK 5L0QB 2CK0H 4RA3A 1JRHH 3KLHC 1J05A 1O7SA 4M8QA 4UQ2B 4X4YB 2DQUH 5I6XC 3ULUF 2XWBA 5ALBL 3SE9H 3PQYD 3GNML 2IPKB 2C3WA 3DYOA 3QIWB 3QO1A 3LV3B 1NLBL 3OG6B 3OKOB 1H9VA 4P2RB 3EBAA 2AXFA 3DARA 5GGRB 4NT6B 5F89B 4LU5L 3ARED 1ZVSA 5B8CA 1KCRH 4KI1A 4PLOB 5ADOH 3AS2A 4HS3B 4JM2F 5IJVA 4XCFL 1A64A 2VZVA 3ZL4H 2P47B 4Y1AD 2VNCA 5E8OA 3QIWD 1WLHA 2FB4H 1HOCB 3MLRH 4P2RD 3OKMA 3HUJE 3VW3L 4PTTB 3BKJH 3OGCB 5LWYL 5DJ2B 3DX9B 3UJIH 1M71B 1T66C 2H9GA 1NBVH 3BD5A 2VLLB 4I0PA 3L3HB 3OKYA 2GY5A 1I8KA 4UT6L 1F8TL 4X6CF 4OFPA 3PUCA 3HE7A 1CICA 4K23H 3TGXA 1HCVA 5FGCB 1RZ8A 4NZTH 2X40A 2FBOJ 4HS6A 3FRUB 5K93A 1BWMA 1U8QB 3BGMB 5I71B 4PBVC 4G6MH 1AXTH 4KUZL 3OKNB 5HJ3A 5IHLB 1NH6A 3OJDB 4ODXA 5C2BL 1J1OL 3OGOE 1FNSH 5CJBA 4PV8B 1ACYL 1W0WB 3ZO0A 1D3CA 2HFGL 2H32A 5IROA 4Z0XA 2R29H 1GCFA 4OLXL 3UTSA 4WY7H 5KW9H 1EIBA 2IALA 3EJZC 2J8UA 3U9PH 3LHPL 4WEUD 4XTRC 1RY7B 3SE3A 2GTWA 4F15B 3N9GH 2XTJE 5CIPH 1U0QA 5E2TL 4JKLA 2UV3A 2NW3A 4NGHH 3BAEL 2DQIH 1AQDA 4H88L 4PJ9D 4R9HA 3MFFB 2Q8BL 4YE4L 4F57L 4GMSH 4XB7A 4H1LA 1FN4A 2H3NA 3HNVH 2IBBA 4F7PB 4HUWA 5HBBA 3QP3A 4IIQA 5FOBA 4YWGL 1U2HA 3H9SA 4JRXB 1X44A 3UTPD 1ERNA 1BBJB 3MJ9A 3QRGL 4FP8H 2Q20A 1QOKA 1CBVH 4XC3H 1T7ZA 3I6KB 1H8NA 4BZ1H 2GJ6A 3QEQA 3EGSA 3L6FA 2B1HH 5B39B 3QDJD 4GO6B 2A6JB 3RU8L 4Y4KA 5D1ZC 3HNSL 4N9GB 4TVPD 3VFGL 4IRSC 1SYSA 2BSTA 2OK0L 3ZYOA 4NN7B 3P40A 2D03L 3MV9B 4TRPL 3EYQC 3R0NA 4HWUA 5DJDB 3BEWA 4WFED 4JRXD 3MOAL 3FFCA 5MI0C 2YUVA 4XMKL 3LZFL 3CDGB 5ESAA 3V52L 1KXVC 3MRKA 1LMKA 3AU1A 4IHOA 1GHFH 2DJ4A 4FOMA 3GMPB 5E8PB 3AS0A 4NHCL 1CFVH 2E9JA 1XT5A 1YMMA 2F19H 3HN3A 2R2HB 2EZ0D 2B0SL 5DMIH 3P77A 3TNMA 2PF6A 3BKML 3MV9D 4HQQL 3WBDA 1I7RB 2Y36L 4UT9H 4OFDA 1B0RA 3VWJA 1P2CB 1G9MH 3TBYB 1HWHB 5L2JB 5TF1H 2CKBB 2OBGA 1A14L 1C5CH 3TFKD 5FYKE 3T2NL 3D25A 4PRHA 1VFOA 3TPUB 3VJ6A 2C3XA 1D5IH 3MX0A 3TZVD 4PJBE 3PWPE 4N0RA 4GLRI 3HZVA 4RSVA 5F6HJ 1SEBB 1F45A 4HJJL 4L8BB 3GB7B 1JPFB 1IGJB 2VLJA 4CVZA 1BOGA 2ERJC 1KJVB 1Z9LA 5AZ2L 3QQ3A 1LEGB 4W81A 1WZLA 4JFHE 4KU1A 2GUOA 4MAUH 3CLEH 4V1DA 4QRUA 4MQTB 1H0DB 2NR6D 1QLRA 4RISL 1G0YR 2OSLB 2EDXA 4Y5XA 2EC9U 4OSUL 3ARYA 1J5OL 1QSEB 2JB6B 1A9EB 5FGRA 5D1XB 3KJ6L 4R8WH 3KGRA 3CAFA 3MLVH 3W39B 4EZMA 2KQNA 4NM4L 3QWRA 1UACH 3I02B 2NY5L 4HCRH 3LPWA 1SJHB 4PRDA 4MJ6B 1CLYL 3QNZB 1CLZH 3QFDA 1QSED 4DZ8B 3SGDI 5KN5B 4NBXB 1DBJH 1NDGB 2JCCF 2VABA 1JGLH 3QFJD 4WW2B 1IQWL 4GUPA 4LHQB 4PJFE 4XB8A 1BZ7B 5F96H 2APVA 4GAYA 1S7TB 3FAWA 1N59B 2R2EA 4NJAH 2E6JA 4MQXD 4N8VG 3IXAA 3PXHA 3QUXB 4GG8B 3RRQA 3VFVA 3KNBB 4JPIB 1O5DT 3RJQB 5ID0A 4P4RB 3EOAA 1P53A 2QHLA 3QJFB 3WJJA 4XCCL 5ILTH 2Q7YB 1IFHH 4KKBC 1MHHA 5GRWA 5HI3D 3U36A 2KKQA 2JJSA 5FYJH 4ZXBB 1X5FA 5DUPL 2QQKL 1I9IH 4XNMB 2F74B 3MV8E 5SV4A 4S1RL 1NGWB 2VIRA 2ZCHH 4JDVA 4GRLB 4N0FA 3QDMA 3QUXD 3K2UL 4XBPB 2E3VA 4MNGA 4NP4H 5AD0B 1WT5C 5DJ0A 2A0LC 4Z18A 2A6KB 1ZE3C 3KYAA 5LQBH 1M7IA 1OAZH 5GGUB 5E8EA 3G5XA 1E6OL 4ZXBD 2Q76B 2H32H 5MEQB 1I7TB 5TDPA 4PRNA 5CWSA 3WLBB 3QI9A 4PGDA 3AAZB 1YN6B 4GRLD 4G6JL 2PO6D 5I1CL 1ZHLB 2FD6H 1KPRB 3FCTA 2ATPB 3MRPB 5D5MA 3W9EA 2WV3A 4WUUD 5H94B 3LDBB 2E7BA 3CMOL 5GS2H 3MCKB 5BJTB 3KPRE 4LCIL 1PBYA 4ZS7H 5EO0B 4PJ8A 3IS1X 5E2VL 1LILA 4YDLB 5IVXE 2UZIH 3B6SA 3QDGE 4GLRH 4DEPB 4QOKA 3Q5YA 5HY9A 1BIIB 2P5EB 4EN3C 4NQDB 3MZGB 1HHKA 2OZ4L 1MF2H 1U8NB 1TMCB 3JV4B 4PJ7B 4PP1C 2IJ0C 1I1AC 4K7FB 3ILQC 3L9RA 3DUSA 5JXED 3MRDB 3LKPB 4KJQC 3MMEA 3QA3B 3F7QA 2YA2A 3VXOB 4YEEA 2NXZB 2P42B 3PXJA 4QWWD 4YHOL 2DQGL 3S34L 1UZ6E 3JTTB 2P5ED 1T4KA 4NHUA 3KR3H 2EO1A 4YPGA 4APQA 3ETBF 1P4BL 2PYFB 4NIKB 3NGBC 1Q72L 3SGKA 4CU8A 4JN2B 3WO4B 1UH4A 2Y6SC 3LQAC 3C2AL 3UDWC 1CDUA 2NXZD 4KROC 1A47A 2YMXH 3AM8A 3BYTA 4DWHA 4M4RA 3SGDH 2EDRA 2J4WH 1TJHH 4HWNA 1I3RA 3FL7A 2EE2A 3FQWB 5D2NB 4JFXA 3PQYE 1OAUH 3BW9B 5JNYA 4YDIL 3LS4L 4HKBA 3ZHLA 5C7XL 4MB5A 2PETA 3GUTA 1ACZA 2VN7A 1ZVHA 3FAXA 4Q9RH 2XY2A 1KLGB 3RWDA 2FLRT 3T09A 4HDIB 2Q6WB 2EDJA 5DRNB 3SDYH 5IIEA 2K7PA 2C1PA 5TQ2H 3BIBX 1P1ZA 4CKVX 3IJHA 4KK8C 2NXYB 3NH7H 1P84J 1PSKL 3NCJL 4R7NB 4Y1AE 1A4JB 1HEZB 4LLWB 4OZGF 1H5BC 3O2WL 1R5WA 4LPTA 1DQQB 1FFPB 5EZOH 5I75C 4DZBB 1IKNC 1YPZF 2W65A 5B3NA 3AMLA 1I8IA 3U2SB 4K8RL 2IFGA 4HWZB 4NQVB 2DQCL 2P48B 2PCPA 5JMRA 4R2GC 2HP4A 4PGEB 3FQTA 3B9VA 4N90D 2VOTA 5I76A 1VEPA 5I1AA 1P4LB 2ORBL 3WFEH 5AG8A 3QO0B 4D0CA 1ITBB 4WEMB 4F7TB 4P48A 5HD8C 4EJ1C 1XIWC 4HEME 5ELIA 1MFNA 4JZJC 2F5AH 4IMKA 1YN7A 5K9KA 4OD3H 3FMGL 4CGTA 1PG7W 4OJFL 3P4MA 1Q9OA 5IT2L 2AVGA 3H2WA 1EEYA 2XICA 1A9BB 5BV7L 1LEIB 3ARWA 1MCBA 3HZYB 3IFPA 2VE6A 4X4ZA 3S4SB 2HMID 3JWOC 2VC2H 4RMVA 5E00B 1DR9A 5I6XB 4BH8A 3FQNB 5GGVY 1FV1B 1QLEH 2WWKO 4NQCE 1FL5A 4JFOB 4PJGF 1JPSL 4XP6H 4LKXB 1N5YL 2BVEA 3GRWA 4Z6AT 4MA3B 3WXWH 4ZPVB 1QO3B 3HE6B 2AK1L 5IQ9A 3HI1A 3TJEL 4HJGB 1N4XH 2P5WB 1EGJA 4HIHA 1ES0B 4MCZA 1JYVA 5IB2B 1R24A 1WCQA 4JFQB 1FL6A 3ROLB 5EUKB 1JPGB 5KSUA 1HXMA 5KJRH 1KN2L 3QUZC 1VFBA 4S0TD 3E1F1 4FRWA 2VN4A 2FECI 3P0VH 1EHAA 3HE6D 2YHGA 4NNXA 4PB0H 1TCRA 3UTPE 2MOVA 2Z8RA 2IGFH 4HUXB 3T0AA 4G8FA 4OLZL 2AJYL 5CP7A 3LVEA 1KIUA 3CSGA 3RWFB 1SY6A 5DYOA 3NACL 4G9DB 5T3ZL 2JJWA 2GIYA 4RZCA 3LRGA 4AK1A 4UINL 5DMKA 3QDJE 5IMKA 2DD8L 3PGDA 5KSBF 4AQ1B 4TVPE 2OL3B 2H26B 4WV1C 1HQ4B 3T0EE 1K2DA 1HI6B 1L0YA 1MH5B 1PG7X 4E5XA 4WFEE 4FABL 5JO5A 1CF8L 4N8VA 4GRWF 2A6IA 4N1CA 3DV4A 5F71A 2EYRA 2Y23A 1EUUA 4HK3J 1G7MB 1B0GB 3DX6B 4QHKJ 4JGUA 1RUAH 1GGBH 1T66D 5DJ8A 1MNUH 1TTGA 2JJTC 1X5JA 1YNKH 4MQSB 2RQ8A 5HHPA 1AO7A 1N7MH 1V7NL 3KXFB 3O45B 5BS0B 1AFVL 3AS3A 4EI5A 4K2UL 2NX5B 1CZ8L 1RZKH 1T0PB 2HJKB 3VGGA 1HILA 3G08B 4UV7L 4CW1A 3U9UA 4L8CA 3VI3E 1I85A 3GI8L 2Y1VA 4OLUH 3TBSA 3ULVL 3QNYA 1FVDA 1PLGL 3BDYH 1E4XL 3VXRB 2DWDA 4FFZH 5DUML 2C5DC 1JNJA 3KXFD 3C2SA 3AROA 3GJEA 5BS0D 2P24A 1A1NA 3IFNL 1XGQB 1DQDL 4JFDB 3TV3L 4DGVL 5KAQG 1IM3A 3KYKH 5FV2A 5EBWB 1UA6H 4HWEH 3MLPA 4GS7C 3NN8A 1E4WL 4XMPH 2FATL 3OHXA 3S88L 2OTUA 2YXFA 3S8WA 4FMKA 2XXMB 1RZJL 3EJZD 3GFUA 4JAMA 5EUOB 2Y9RT 3MJ9L 4PRAB 5E24E 4JKPL 5I8EB 1Z3GH 3CVHB 5E1AA 2AV1B 2HN7B 2DM7A 4R26H 1T7VA 1CD9B 2QKIA 4LSPH 4X6DE 1VESA 1R5VB 5JOPD 5D1ZB 3R4DA 3L5WB 1R3HB 1T20B 2D7OA 2WM0A 4IRSB 3SDCA 2DI7A 1VGKB 1RK0B 1KIRA 4X6BB 4U3HA 3K2MC 1LE9A 1UM4H 4FQIL 3G04B 4FQXD 3GK8L 5MI0B 3OAZH 4OZ4A 3CSYB 3WN5C 1W72B 1K4CA 3J7HA 3UP1A 3PWVA 1KJMA 1OSPL 1G9NH 4HIIA 5JQ6L 1T1XB 1Z6JT 2Y07L 1CWVA 1OAXH 1NPUA 3EYFA 3L7EA 2IMNA 1KJ2L 2ESVE 5D1ZD 1UWXK 3BHBA 4G80B 3EOBA 4IRSD 1RHHA 5DDHB 1FZJA 5F9OL 3QFJE 1NBYB 3EYQD 1FPTL 5E2UL 4FFYL 3RWIB 1R3IL 4FZEL 5BMFL 1HKLH 2BCKB 3OR7B 4JVPA 1DL7H 5J3HC 3ZE1E 1T04B 5T33L 5C0FB 1OWRM 3QNXA 3MOBH 3K8LA 4ZAKC 3SGEI 3SDAD 1RMFL 2ICWA 2EDTA 2XZAH 1NFDF 3VE0B 4MA7L 1FC2D 5HYFA 3S98A 3GHEH 2HFEA 1ZHKA 2APFA 3WIHL 1AD9B 1QSFB 5D7LD 2G75B 4TYUA 2X70B 4W4OC 5EBMB 4XNYH 2ERJB 1OLLA 4P5KB 3RNKB 5C0DA 1NFIB 2WUCH 1ZLWH 1IGIL 3U4AA 4OAWB 2DQHL 2AJSH 3KPSA 5FO9B 1WIPA 5DZOA 4U7SA 4L29B 2R39A 4CDGC 1QSFD 2HFTA 2FNBA 3LSOB 5IB3A 3RUGA 1MELA 4XC1L 5DHYB 1MRCL 2D9QB 2I60H 3O6KH 1RZ7L 3ULUE 3SPVB 3WNKA 4XRCB 1C08B 2BY3A 3C60C 4JDTL 1Z5LB 3GRWH 4ZFFA 1CG9A 4WUUE 1WJ3A 1XF2B 1AJ7L 5TH2B 1UXSA 4X7SH 5FDWB 5BO1H 3F7VB 1WWAX 1EGJH 4LQFH 4NM8L 2DQTH 1K4DA 3WHXB 5D1QC 5LG1A 1S9XA 1X5HA 1JI1A 2WZPD 4KZDL 5B4MC 1CVRA 4X4MA 4X5WB 2BRQA 3U4BL 1OP5K 5E2JA 4X9FA 1F4XL 3UBXA 2DDQH 5F7YC 2VUYA 5JHDB 3HC0A 5EU7C 4RBPK 4LBEB 2ICWI 4IBLT 4XVTH 4PJHE 3D18A 2W9EL 3MJGX 4I0CC 4PJIA 4FQCL 4JFEA 2AI0L 4Q7DA 2WLZA 5HYSG 1YQVL 2P5EE 3NZ8B 5SWSA 1WSST 5SX5H 4OQ1A 2FJGA 2E6QA 4TQEH 4LHUD 4QXGL 2HJFB 4Z76A 4E41B 5JW5B 4BFBD 1JNHB 2HT3D 3LRHA 3P30L 1S7SA 1BVZA 3QQ9C 2JTDA 2A1WH 1BX2B 4YDVA 3GNMH 4GKZB 3WNNA 4KKBD 5JA8B 2PN5A 3EJJX 4BK4A 4P2OC 1XR9B 1IGYB 1S9KC 1CCZA 2CGRL 1CE6A 3TBVA 1JFQH 1K6QH 3H42L 4NRZA 4QYOA 4MD4B 1JPTH 4MD0A 5EDXA 4PRIB 3U48A 4E41D 3LEYH 4AIZB 4HIEA 4X7TA 1LK3L 4NNPL 5DJZA 3D87B 3X17A 3QG7L 4DK3A 3ISWA 1F4YL 3WS3A 1IGTB 4ODUA 4JO2L 5BCAA 3GSUB 3BWAB 4WUKL 1NCAL 3D0VA 1S7XB 5DJAB 1OAQH 3X14B 4NO5A 1BQLH 1T3FA 3DVGA 5E03A 4EDWH 4OV5B 3UBXI 2ENSA 2ZG2A 4UT6H 4EN3B 2XTLA 5DFVD 3JVGC 4MZ3A 3VWKA 4CNIA 1I1AB 2BNRE 5SV3A 4N90E 2QSCH 2YOCA 1DLFL 1J88A 2KZ1B 3CX5K 4KY1H 1QFWI 4ZNEA 4L8DA 5IW6B 4H25A 2ICEB 1N0XH 1BAFH 4F8TA 5HGDB 3JBG7 2VWEE 4QF1B 2XFXA 2PTUA 1UT9A 3U6RB 1FC1A 3U1SL 4EN3D 2FH8A 1WQVT 4WGVB 4PP1D 3NGBB 1I1AD 3QULB 3G6JE 3ILQD 2HFGH 4HPYH 3MNZA 2IH3A 2W60B 2ARJA 3MJ7B 3VA6A 1A6AA 3V6FA 1NAKL 4OLXH 3QEGH 3B9AA 4P5TD 4WI2A 4KROB 1PEWA 5L6YL 2QHRH 4RGOL 4IS6A 2C1OA 1CLCA 4NKMA 5H37G 5DQJA 4LCCC 2VLMD 3LHPH 5J8OA 2PTTA 2A9NH 2OR8A 4O02H 3ZT5A 3SY0B 3TEUA 4Y5YA 4AYFA 5IV2A 2WLYA 2CXGA 5E4IA 1ORQB 1FGNH 3E6FA 4KKCD 3IRZA 4EBQH 4OLYL 2GCYB 4MAYA 3C6LC 4L9LA 43C9A 3D2UB 4U1IB 4LSSH 1V3JA 4H88H 3S5LB 1N64L 2Y6SD 2Q8BH 2NY4D 4F57H 1T03L 4G43A 3OX8B 3VH8G 3IVKB 1F11B 5CEYB 3V5DA 5ID1B 4P3CL 4KROD 2Y5TA 4YAQB 4UDTA 2IQ9L 3G5YB 5DEGA 1MI5A 2ZCKL 3RP1A 3LKQB 3HR5B 3DHJA 2HLAB 5T1LA 4BKLB 1D5ZA 2FECL 3QRGH 1H5BB 1CU4H 3MLSL 5DHXB 1D5XB 1OSZB 2I9LB 2H8PA 5I75B 2VXVH 1T89A 2X4UB 4PJXA 3D2UD 2FWOA 2QQNH 4RAVA 3RU8H 1QYGL 5AWNL 1HK6A 4ODVL 3HNSH 4R2GB 2J8UF 2X6MA 3H0TA 2OK0H 5EU6D 4RNRA 4KK8D 2Q8AL 4TRPH 5DO2C 5TQ0H 5ACMA 3B8SA 1N0LA 2I07A 4LCUA 2NW2A 3GSWB 4HPOL 4KI5F 1HINL 4XMKH 3LZFH 1Z9OA 1FNEB 2BOBB 5GS1A 4TTGA 1XIWB 3MUHL 1IQDA 3EYSL 2F58H 3VDCA 4QRRA 5I1DA 4YDKL 3MNVA 3RVVC 2D31B 3EO0B 4OCLC 5EZIL 3T0XA 4JZJB 43CAB 1VB9A 4LLQB 2B0SH 3T1FA 4MJID 4XNZC 4ZPTB 5FM5M 1HHGA 2I24N 2C4FT 4ELKA 4LSQH 5IK3A 1TJIH 2G2RB 3MQIA 3IDJB 4ZQKA 3MRFB 4LFHD 2Y36H 1S5HB 2A6DB 4G9FB 2XKUA 4K3DH 2AS5M 5HD8D 1DQML 3QEHA 3U79A 3KLSA 2MSPA 3IETA 1XIWD 2JCCE 2XNAA 4PJDA 4XAWL 3LY6A 4AMKL 4RIRB 5EWIL 5D8JL 3O8XC 3UTTA 1RZKC 5ITBL 1XF1A 4O58L 1A02N 3JWDL 1DBMH 4EUPH 3FJTA 3LQZA 1LO4L 4M61B 5C9KA 3KXFE 4PUBH 1EBAA 1ZLSL 1DQJB 5DJYA 2HTKC 5BS0E 1NCCL 3FT4A 4BZ2L 4BQ8A 3M17A 4G9FD 5FYLE 1MFDL 4Y19B 5ESVB 4YXHH 2XXCB 2VZSA 5CIPB 3QUZB 2QQQA 1SEQL 1FG2A 4GMTH 5DD3H 5GISL 4ALAH 3LKSA 3B3IA 5B38G 2CDGB 3OWEA 3QXTA 1VADA 3FTGA 1AR2A 2HH0L 5HYJB 5EOCJ 3HI5L 4BSWA 4OSUH 1KB5A 3PJSA 4M6NL 3INUH 2VXTH 4B5EA 5JOPE 4Y19D 3QUZD 2OTWB 2FL5A 1M7DB 1JWUB 1OAYL 3KPPA 5D96C 2DKUA 3P3YA 4NM4H 4WV1B 1NBZB 2IPTH 2XY1A 2OR9L 5JXAL 4NUJA 3ES6A 5A3IC 4MB3A 1N6UA 3VFTB 4L4VD 3WJLC 5HYJD 3PABA 2X1QA 1BLNA 4IOIB 3FQXA 5M95B 4Z7WB 2V5MA 4RFOL 3Q3GB 4BYHA 3KYMA 2IC2A 4BH7B 5DD5L 4XMLL 3D0LB 3QPXL 3WHE1 3QHTC 3RTQC 4F9PA 5CUSH 2BX5A 3JV6A 4CVUA 3MV7D 1D9KC 2H6PA 1A3LL 12E8H 1QACA 5IP4A 3A67L 5F9AC 5GJSL 1DN0A 4YHZL 5LGJB 4NDMA 3QUYA 4TUJB 2IFFH 5I1JL 3KPNA 3MRQA 5EZJA 1R0AL 3GMMB 4I9WD 1HNFA 4KK6C 5ALCH 2N7AA 3BDBA 1JE6A 3BGAA 1U8PA 2UZYB 3CSBA 3PWJA 4I2XE 4S1RH 3SBWA 5D7LE 5D72H 1T5WB 4GS7B 4N68A 4XPGL 3TYGL 3B8YA 5FCSH 1BMGA 4OZFG 1A1OB 3RGVC 3BSZH 4KUCF 1VSCA 3RDTA 3BP6B 4OKVB 2LQRA 4EDXB 3O4OC 1EJ6A 6FABH 5KVEH 4L3EB 1JZ7A 5HGAA 1R3KA 3UAJC 4D0DA 2WBKA 5EOTA 3V6ZA 1E6OH 4NOBA 4RMQA 1KPVB 1KCKA 4ERSL 3RZCC 3OTTA 1QSFE 3C6SB 3H9HA 4Y88A 1LNUB 4LEXH 3OZ9L 3V5HB 5I1CH 2P45B 2NY0C 3D39A 4JB9L 5GIRA 3GSOA 1S7WB 2GK2A 1G1CA 4QCIA 1FVEB 1YYLH 2HT4C 5I1GL 4L3ED 4NZUL 1CN4A 4G6FB 1A3RL 4GQPH 3PP4H 4J4PA 3WN5B 4HX1B 2ZUWA 1NCWL 1FFNA 2GFBB 3LEXA 4NC1C 1MUJB 1I3VA 3E8UH 1GPOH 4YHLH 4E9LA 3OAYK 3HUJA 5EA0L 1UWEL 3G9AB 4WI9A 1RJZA 3F7PC 5E6YA 2WAHA 4LVOC 3IS0X 2XIDA 3E3QE 1ONQB 1AIFB 2EDLA 1OM3H 5E6IC 2BMKA 3GGWA 3QH3B 1FDLH 3NCMA 1Q38A 4OZGE 2FEDC 1SJVA 4G6FD 4NFBA 3QEUB 3KPLA 4LLUA 1FL3B 5EOQL 2XZQH 4O9HH 4PGZA 3TIEB 1YPZE 4ZAKB 3NCEB 3MA7A 2H2PC 1QVOB 1S9VB 1KIPB 4GAJL 2RCSH 2DQGH 2F5BH 4XXDA 5TPWL 5T1KB 5D5MF 3UROR 3VI4F 1FYHB 2HAZA 2VDQL 4OD1L 3GSNH 4X7FC 1EO5A 4WHYH 1HXYB 4PY8I 1PKQA 1K8IA 2P1YA 1XF5A 3DUUA 5E5MA 3IF1A 3MYJB 4BFIB 3C2AH 2AJXL 5IGXL 4JRYB 4Y4FA 1DUZB 3MUGA 2LVCA 1G6RB 2YRLA 2ADFH 2LTQC 2WQRA 3DVIA 3QIBC 4PGCB 4U49A 2F53E 5SWZA 3FONA 5FHBL 2OJZH 3LS4H 2X9WA 4UV4L 3B9KC 4TOYL 5BOZG 1KF9B 1QBLL 3L7FB 5DQ9A 5IM7B 4WTZG 3HFMH 3C60B 4PJGE 4JRYD 5BZWA 4P9ML 3SJVA 5FYJD 1A6UH 3F58H 4MXQC 4M3KB 3U7WL 5HDQL 2AV7A 3WLWC 1FE8H 2IANE 4PGBA 5C09A 2NY7L 1GRWA 2CXKA 3EO9L 5JOFA 1PSKH 4HKZB 3NCJH 5L8LB 3HG1B 5DHVB 3O2WH 4U7KA 3R0MA 3VFUB 3EAKA 4EQ2A 2Y5EA 1HNGA 1FYTA 5D1QB 1P4IL 5E7BA 5GZOC 5HHNA 1X5XA 4K8RH 1LDSA 3MLUH 5F7LB 1U95A 1LWRA 2YRPA 2VQUA 1JN6A 3EDJA 3IKKA 3UJTL 3NFSL 3HMXA 2GT9A 2BNQA 1BQHG 2VDRL 4HMCA 5D1QD 1DVFC 5ABDE 4LLDA 3VXQB 5EU5B 3BJ91 5GS2D 1A7RL 2JJVA 1A1MB 1RHFA 2EKSA 4IRJD 5B4MD 1KCVL 1V8HA 4X9IA 8FABA 1F5WA 2NYYC 4N9OB 3P0YL 4MHHG 4LK4A 5T3XL 2HRPH 5B21A 3FMGH 5BXFB 4OJFH 5D7SH 5HDLA 5IT2H 4LIQE 3RWJA 2DLGA 3W0WB 3T4AB 3BXNB 4DTGH 3KPOB 4ZS6D 4JHZA 3P4NB 4MNHA 2XKNA 4M02A 4MSWA 3GMNA 1LD9A 4C56B 3GJFA 4G7VL 5C0GA 4P2QB 1I9JL 4ODWA 2YD8A 5CZVH 5FV1L 1JPSH 1N5YH 1FGVH 1FORH 3WKNA 2X4NB 1C12A 5CEZH 1FZKB 2AK1H 2GJ6D 2VLME 5JLZB 3OKEB 4P2OB 5C08B 1WK0A 3ZTNH 3PWPA 5J13C 4LSTH 3PDOA 1U91A 3TJEH 1P7KB 4RQQB 5SWQA 3L3KA 3HPJB 3W0WD 3MRMA 5LCVL 3BQUC 4LLVB 4ZUWA 3MRLB 3Q0HA 3QQ9D 4CADB 3VXTA 4NRXB 4YXKH 4QRPB 4LVEA 4KZEL 4A6YH 4U1NB 4P2OD 1MY7A 3T65A 3V95A 2Y7QB 4RMTA 4X7EC 3CFCH 4OLZH 4OCSH 2AJYH 3IDMA 3O9WA 4OUOA 4R4FL 5C8JB 4U6YB 3NACH 4I18C 5T3ZH 4E42B 4U1KA 5KVDL 4AJ0A 1Q9KB 3MO1A 3M1BA 4TNVK 1YECL 1H3PL 4DCQA 1T0NA 4UILL 4LLYA 4X7DC 1TZGL 3TO2A 1WGOA 3O6LL 3MRCA 2Y06L 5EU6E 5H2BA 4U6HB 1HHHB 2PTVA 1AI1L 2AGJL 4JN1L 4LEOB 2YKLL 1FLRH 1Q1JH 5CEXB 4WNQB 5J9PB 2APWA 1A6TB 4OM0H 2VL4A 4Q6IC 2ID5A 1M6OA 4X99A 2PW2B 4MJIE 2RFXA 3VGFA 4N0YH 3D1MC 4LF3A 1ZA3A 3SOBH 3NPSC 4Y5VC 3CH8A 3PWNA 4UV7H 1CE1L 1RFDL 1Q9LB 3C8HA 3G9VA 4CRPA 1FZOA 5MERA 2B4CH 2EEDA 4ETQA 4UMGA 3TCLA 1OQOA 3EUUA 3F8UB 4XP9L 1XR8A 3ULVH 1P9MA 4LCCB 3SDDC 1PLGH 1KNOB 3EYVA 5DUMH 4ISVB 1M7XA 1ZSDB 1Q94B 4YHIB 2E27H 4YQXL 3GBML 3RL1A 3C6LB 4XZUB 5L9DH 3IFNH 3FB6B 3MV8A 3R06B 4K9EH 3CFDA 2GITB 4X6CB 1YY8B 2QLVB 1I1FA 4CVXA 3C5ZA 3VXMA 4LRIC 4ZOEA 3QUMA 1C7TA 4MS8C 3WIFA 1PG7H 1I9EA 5GSVA 4JKPH 2UVFA 1JPST 5DC9B 4L4TE 1MFEH 2ICCA 1KLUB 3KLAA 1ZHBA 1FO0L 1YNTA 3UPAA 1I9RL 3DVNB 3A0OA 3ALPA 4ACPA 2EDQA 4ZNCD 5LJYH 3NIFF 4F37F 5EBGA 2WBJC 5KTEH 1WBZB 5I1HH 2ZP0T 4M1DH 5D7JC 1JF5A 1QRNE 4HG4K 5A43C 1TZHB 1I7ZA 1A5FL 3HC4H 4KWUA 3JUZA 4XNXL 4Z7OF 1TETL 3GI9H 4P46A 1FIEA 5E99H 2VRAA 3ZTJG 3B2VH 1U3YA 1LDPL 4L4VE 3REWB 4W6WB 5HYJE 3O2DL 2UWEA 1OLZA 5I15H 5IB1B 4XNZB 1SMAA 4OTXH 2CUIA 5D7KD 5A40E 5JW3L 4JG1H 5MP6H 5DO2D 1FPTH 5DRWA 5E2UH 3BISA 1R3IH 3QDMD 4P49A 2DWEA 5BMFH 1E4JA 3MFGB 4J3TA 4F58H 3RHWF 3AS1A 1V7MH 3V4PL 1MCPH 3LKNA 4ETYA 3CU7A 3MV7E 5C0IA 4D9RD 5IEHB 2AEPL 1RMFH 4TULL 2OP4H 5K9JL 3IAQA 1RZFL 3O8XB 4JY5H 4MA7H 3VD3A 4YNYA 2QR0B 3IU4L 2SEBA 3V0WH 1ZS8A 3QI9D 3SKUD 3ZDYF 3A6BH 3GMRA 3IDGB 1I8LC 3TBTA 4I9WE 3HZKA 4HH9A 5DTFB 4X5LA 4D9LL 1PQZB 1NMCC 4OIIH 1HQRB 2XG4A 3RX8A 5CP3H 4FQ1H 4WTZA 3MJ8A 3T1WA 1EEZA 1IGIH 4J23A 1RIVL 2F15A 4G5ZL 5INCB 5FGBA 5CBAB 4ZUVA 3O8XD 3MRJB 3T0DA 4KJYB 3QB7C 4OZHB 3PQYA 3CH1A 3MREA 2ZPKL 4M48H 2R2BA 2ZSWA 5FA3B 1KTRL 3KYOA 1G1YA 4GKNA 4M9PA 1IC4L 1PY9A 3DRQA 2A9ML 1MRCH 5DURB 3TCXA 3TN0D 2BNUB 1MIML 3GJFH 1RZ7H 3X11B 3IDIB 3AREA 3QHZL 1UWGL 2D3VA 4UQ2A 4X4YA 4HLZH 5DK3A 5KSVB 3HAEH 4HKXB 4WEBH 4DGYL 1YEFL 2IPKA 3QIWA 1T1ZB 2W0FB 4G7YL 3LV3A 3OKOA 3ZDZE 3R1GH 4P2RA 4FNLH 4QTIL 3IGAB 5DURD 5GGRA 1ZT7B 4NT6A 5F89A 1CXHA 4KMQA 4KZDH 3RTQB 4MWFB 5JOEA 2KPNA 4RAUB 1ND0B 3ZKNC 4HS3A 3CFBB 5A3ID 2EECA 1RUKH 1D9KB 2HG5B 1QBMH 3TH3T 1WAAA 5MENB 4BM7A 2CDEB 1TVDA 1OGTB 1HOCA 1IAKB 1LO3L 5GGSY 1I7UB 1J8HB 4FFVC 4WHCA 3VGBA 1TFHA 4KRMB 3LKOB 4P2CG 4DUXA 3MXWH 4PTTA 3OGCA 4JG0H 3OV6A 5DJ2A 2VO5A 3DX9A 4I1NB 7CGTA 1M71A 3RTQD 1MCRA 1EMTH 2E7MA 2AI0H 2ZZUT 2VLLA 3L3HA 1XF4B 1ZA6B 3O11B 3TA3C 3O6FC 1YQVH 3BYYA 2ADGB 1D9KD 4HZLB 3VXNB 5IUSA 4QXGH 4YHNB 2R15A 3RGVB 4JFFB 1KV3A 2EXWD 4OUUB 2CPCA 5F7EH 3V6OE 3FRUA 5F70A 3O4OB 5DR5H 2XPGB 1U8QA 3F6IA 2X9XA 4WFGD 1JGVH 4Z77A 3BGMA 4KK6D 3CSPA 5IW3A 1ZGLM 3OJDA 1MAMH 2R0KH 3RZCB 2AK4B 2YA0A 3ARDC 4HIJB 4OLWL 4PV8A 4Z95L 1W0WA 5GGTA 3H42H 1XH3B 2NY0B 4HUUB 3RGVD 1J0KA 5DVMA 2BSSA 1MCSA 4NNPH 3TVMC 1KENH 1X4XA 1MRFL 2EIBA 2IPUG 3PE9A 3QG7H 3WD5L 4ZUSB 3TJHC 5I8CB 4PJIF 4U4BA 2YD4A 4FFWC 4C54A 3H3PH 4UU9B 2GSIA 4WUKH 1QFUH 4Z7QF 1NCAH 2YD2A 4TPRL 1IGML 2OMBA 3RZCD 1ADQL 2AK4D 3MGTB 4V2BA 2FH6A 4LVOB 2MHAB 2NY0D 2P8MB 3QDJA 1EAPB 2ICWJ 2NZIA 3MFFA 4JHBA 5D70L 2FX8L 5E6IB 1BFOB 1P7HL 1NEZB 5JIKA 3MRRB 2JF1A 5GSRA 4JRXA 2DQJL 1BBJA 2AJVL 1TQCC 4K8RC 5JA9A 3I6KA 4MNQB 1U3HC 3OAUL 5B39A 1BFVL 5JPNB 2A6JA 5D7IB 1BPVA 1WISA 1MCLA 2O5ZL 2VZOA 5E6ID 4F7MB 4OBSA 5IW1B 2FEDD 4PY7B 4KI5E 3VFOA 3MV9A 1B4RA 5DJDA 4GRMB 4KRNA 4DKFH 3EOYG 2H2PD 4X98B 4MVBC 1EFXB 1NAKH 4K71C 1C1EL 5EU7E 3W82A 3EFFB 4MNQD 4U6VH 4XPTL 5ITFA 3CDGA 3QIBB 2LTQB 1MCQA 4KTDH 3TLRA 5E8PA 3GMPA 4KXZI 1FNFA 4GXUN 5BV7C 2VZ3A 4H8WH 4ZSOB 5HI4D 4J6RL 3TZVA 1BEYL 3B9KB 2GJ6E 3DBXB 1V3LA 3MBXL 4NQEB