1FNKA

Crystal structure analysis of chorismate mutase mutant c88k/r90s
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
115
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTMQEMDVTGGLKKKISVMMTVQTDVPQDQIRHVYLEKAVVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHORISMATE MUTASE)
publication title A strategically positioned cation is crucial for efficient catalysis by chorismate mutase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 30
structure length 115
sequence length 116
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1fnkA00
3M1XA 3R0PA 2CSLA 1PF5A 3ZOPA 2CVLA 3ZP4A 1ODEA 4NWOB 2CWJA 1ONIA 3KJJA 3ZP7A 2CHTA 3I3FA 3L7QA 1COMA 3M4SA 3MQWA 3K12A 2UYPA 1DBFA 2OTMA 3ZO8A 1FNKA 1NQ3A 5HP7A 2UYNB 1UI9A 2UYJA 2UYNA 2DYYA 1XRGA 4ZK7A 2CW4A 3VCZA 2B33A 3GTZA 2CHSA 5HP8A 2IG8A 3V4DA 3QUWA 1QAHA 2UYKA 3LMEA 1UFYA 1X25A 3K0TA 3I7TA 1J7HA 1QD9A 1XHOA 1FNJA 3D01A 3KJKA 1QU9A 2EWCA 1JD1A 3LYBA
chains in the Genus database with same CATH superfamily
3R0PA 4G4WA 3G6EF 2CSLA 3LFOA 3CCQF 4U39A 4YJ2A 3HWUA 1KQSF 4O4JA 5KX5A 4NUTA 5C8YA 2Z1EA 4EB6A 4G4ZA 1VQMF 2VAPA 1OFUA 3ZO8A 3N2GB 4DXDA 5LP6B 2DYYA 5CB4B 1VH8A 3TD4A 5EIBC 4BT5A 3DDNA 1QVGF 1RLUA 2HS4A 1XHOA 3CXCF 3CC4F 4YJ3A 2EWCA 3JAMM 2VAMA 2HS3A 4ZOLA 2GVIA 3JAKA 4DRXA 5LXTB 1ODEA 4EI7A 3RYFA 4FFBA 4ZI7A 1GO0A 4O4IA 1T0KB 3GYQA 4HNAB 4X1KA 5IJ0B 3K2XA 3IKEA 4TV9B 3LWOC 1IV3A 4NQ3A 1Z5VA 5BMVB 3RYIA 3C9RA 3LWPC 4TV8B 3VIUA 1YHQF 4O4HB 2CHSA 3FPIA 3HTNA 1TUBA 3FFMA 3CCLF 2I6DA 3CMAF 4BT6A 1RQ7A 3ON1A 3S0WA 1SDSA 5LOVA 1QU9A 1XV2A 3WGMA 3ZOPA 4I50B 3UT5A 5EB0A 3PAFA 1ONIA 3I3FA 3MQWA 3OONA 2Z1FA 3JVHA 1OAPA 5J2UA 3F0FA 1UI9A 1JFFA 3WXMB 5HXUA 2G9IA 2CW4A 5B8FA 5AVMA 3J80M 2FC3A 5EZYA 2QI2A 2LCAA 3FD5A 3VMFB 5JCOC 4BT3A 3M84A 3LMEA 3RA6A 4TUYA 3C8LA 3ERNA 5KX5B 2HVYD 3CD6F 4X20A 3K12A 1VQ8F 1RLGA 1U43A 1W5AA 3P10A 4F6RA 2VXYA 4ZK7A 4G4XA 3BYQA 4BT4A 3F0DA 3I56F 1JN1A 5A2QM 5GONB 3I7TA 4YJ3B 3SIUA 1SZQA 3D01A 1N8RH 2HP0B 4ZOLB 3WPWA 3JAKB 3B6NA 1NJIH 1GZ0A 5JH7A 5G4VC 4ZI7B 3ZP7A 4ZHYB 3CMEF 2RHLA 4O4IB 4X1KB 3IEWA 4EI8A 5JQGA 3JASA 3N4ZA 1E7KA 2IG8A 1TUBB 4C8EA 1YGYA 4PWTA 3WGNA 2AMTA 3VI6A 3TD5A 3CYPB 3LWQC 3KHNA 3KIZA 4O2BA 5KMGA 2QTPA 3UT5B 3CCUF 5GIOC 3ZP4A 3S03A 2F9ZC 3NVIB 1R1MA 3JARA 1NMUB 1JFFB 1FFXA 1GX1A 2UYJA 5EAZA 5IYZA 5IJ9A 3MDOA 1H7MA 3GTZA 1W40A 2W8BC 5CA0A 2BTOA 1U3PA 4X1YA 2GZLA 4KWEA 4LNUA 1VHAA 2ZVYA 5HY1A 3CCEF 2BO1A 3CPQA 3F6MA 2MQEA 3HKDA 5CA1A 2ZOVA 5FNVA 5GANK 3J7AR 3JALB 3KJJA 5HY2A 3NMUC 2VGNA 1VQNF 3VOBA 1IV1A 3WPXA 3RYHA 2NMUA 3VOAA 1VQPF 3RE3A 2OHWA 3WJQA 3HKBB 4X1IA 3HKEA 5JVDA 2DT4A 4I55A 3GHZA 5JCOA 4O2AB 1T0AA 5FJ4C 3HKCA 3S02A 1QD9A 2OTLF 2CVLA 4LCKA 1DT9A 1W581 1U40A 2VAWA 3D54A 3CG6A 3LWVC 2IQQA 4I4TB 4IIJB 5EYPA 3EORA 1COMA 3M4SA 5LA6A 5EO3A 2HRUA 3F0GA 5JQGB 3TD3A 4O4LA 5GIPC 3JASB 1XRGA 1YI2F 2RHHA 2YXZA 1SA0A 4XCQA 2V9YA 1H47A 5G4UC 3VO8A 3CCRF 1VQVA 1VQ6F 1TVKA 2H6LA 4IHJB 2WALA 3N2KA 3E1YA 3RYCA 4YJ2B 2K1SA 4O4JB 2CWJA 5MN4A 1Q81H 4EB6B 5C8YB 2QEXF 3IKFA 1YJWF 2LBWA 3JARB 2HQSC 5ITZA 3C9TA 3CYQA 2YYEA 1W2BF 1FFXB 1X7PA 3N2GA 3E20B 4G4VA 5IYZB 2OTJF 3D00A 3Q8HA 4X1YB 5MN5A 1RQ2A 3V4DA 4LNUB 1IV2A 2UYKA 3OW2F 1VQ5F 4R40B 3N4YA 1Q7YH 5DCVA 1Q86H 2AIZP 4U3JA 4WBNA 3LYBA 4B62A 2HS0A 1Z5WA 1VQ7F 4DRXB 2OZBA 3NK7A 2UZHA 3RYFB 5LXTA 2KGWA 1VK3A 4FFBB 2LBXA 5IJ0A 3HKEB 3RYIB 2UYNA 1W41A 2Q1XA 5JVDB 5BMVA 3P4EA 3VCZA 2ZAUA 4TV8A 2R751 1W3EX 5LP6C 1YJ9F 1JJ2F 3HKCB 4M8IA 3LDTA 3JATA 3K0TA 2R6R1 1H48A 3FD6A 1ZWZA 3OBWA 5LOVB 4BY9D 3CB2A 5EYPB 1VQOF 4NWOB 5LA6B 2CHTA 3E22A 1KNJA 3ELCA 2UYPA 1CK2A 1X52A 4C8GA 4O4LB 5J2UB 3WGJA 1YJNF 2HX0A 5HXZA 4C8IA 4E6EA 1SA0B 3C9SA 5EZYB 1KD1H 2L26A 2Q1YA 3S0HA 4ZHQA 4BT7A 1TVKB 3IEQA 4BVRA 3RYCB 4TUYB 3M1XA 3PLAC 1KNKA 3MCAB 3O85A 1VQKF 5ITZB 4X20B 3WJPA 2ZODA 1CLIA 4BT2A 3MBMA 4F6RB 3CCJF 3G4SF 2I6RA 4G88A 3I55F 1KC8H 2VGMA 4C81A 2GLZA 2HP3A 5GONA 3V3TA 4U3JB 4WBNB 4RQOA 3KJKA 2HP0A 5LYJA 4TZZA 5JH7B 1YQNA 1PXWA 3FBAA 1X7OA 4B5CA 3AGKA 3KE1A 5MN6A 1DBFA 2AIFA 2N48A 3G71F 2UYNB 2P6YA 3S06A 4BW0B 3WGKA 5J2TA 3CPWF 3LWRC 4X3LA 1YIJF 1VQLF 5HY4A 3ESJA 1QVFF 1IPAA 3JATB 2RB9A 3JAWA 4X3MA 5EB1B 1M1KH 3WJRA 3S0YA 1VQ9F 2H8CA 2JNBA 4O2BB 3VYTC 5KMGB 4G4YA 3L7QA 1K9MH 1PF5A 3CCMF 3E22B 3OBYA 3V7EA 2KTVA 2HRYA 3WGLA 2IAFA 1FNKA 4B46A 5HP7A 2FGYA 2H8EA 5IJ9B 5LP6A 3VTIC 3IR9A 4B45A 4C82A 2QA4F 5CB4A 1W57A 5CA0B 3F0EA 2ALEA 4ZHQB 1QAHA 5EIBD 2CZWA 1UFYA 1M90H 3T80A 5HY0A 5CA1B 3HKDB 3SIVA 5IT9M 1U3LA 5FNVB 1Q8RA 1JD1A 4C4WC 2ZVZA 3RA5A 2PMPA 1CN7A 1YITF 1RA4A 2Z1TA 3JALA 1XBIA 3VYSC 4RHAA 3RYHB 1NQ3A 4BVSA 4EI9A 4HNAA 1K8AH 3MCQA 4TV9A 4X1IB 1GO1A 3HKBA 4ZHWA 2B33A 2BTQB 3J81M 4BVTA 5HP8A 4ZHVA 3P0ZA 1W5EA 2KTUA 2RHOA 4O4HA 5GINC 3CC2F 4I55B 3QUWA 4ERHA 1W59A 3CC7F 1IV4A 3NVKE 4O2AA 1X25A 1J7HA 2LBTA 1W42A 2RHJA 5LYJB 1FNJA 2Z01A 1W5BA 1Q82H 5GAPK 3CCSF 4I4TA 4IIJA 4I50A 3HJWC 4BVQA 3V7QA 3IMPA 2PHNA 1W55A 2OTMA 3NK6A 1K73H 3HAXD 5J2TB 3K14A 3QHDA 1FSZA 1W5FA 3QTYA 5EWRA 3JAWB 3JCMM 3C9UA 2Z1UA 3U0OA 5FLXM 3VYUC 1JY8A 2BTUA 2ZF8A 1VQ4F 3CCVF 5HWEA 1S72F 2KG4A 3DC2A 3N2KB 4IHJA
chains in the Genus database with same CATH topology
3M1XA 3R0PA 2CSLA 1PF5A 3ZOPA 2CVLA 3ZP4A 1ODEA 4NWOB 2CWJA 1ONIA 3KJJA 3ZP7A 2CHTA 3I3FA 3L7QA 1COMA 3M4SA 3MQWA 3K12A 2UYPA 1DBFA 2OTMA 3ZO8A 1FNKA 1NQ3A 5HP7A 2UYNB 1UI9A 2UYJA 2UYNA 2DYYA 1XRGA 4ZK7A 2CW4A 3VCZA 2B33A 3GTZA 2CHSA 5HP8A 2IG8A 3V4DA 3QUWA 1QAHA 2UYKA 3LMEA 1UFYA 1X25A 3K0TA 3I7TA 1J7HA 1QD9A 1XHOA 1FNJA 3D01A 3KJKA 1QU9A 2EWCA 1JD1A 3LYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1X A;  3R0P A;  2CSL A;  1PF5 A;  3ZOP A;  2CVL A;  3ZP4 A;  1ODE A;  4NWO B;  2CWJ A;  1ONI A;  3KJJ A;  3ZP7 A;  2CHT A;  3I3F A;  3L7Q A;  1COM A;  3M4S A;  3MQW A;  3K12 A;  2UYP A;  1DBF A;  2OTM A;  3ZO8 A;  1FNK A;  1NQ3 A;  5HP7 A;  2UYN B;  1UI9 A;  2UYJ A;  2UYN A;  2DYY A;  1XRG A;  4ZK7 A;  2CW4 A;  3VCZ A;  2B33 A;  3GTZ A;  2CHS A;  5HP8 A;  2IG8 A;  3V4D A;  3QUW A;  1QAH A;  2UYK A;  3LME A;  1UFY A;  1X25 A;  3K0T A;  3I7T A;  1J7H A;  1QD9 A;  1XHO A;  1FNJ A;  3D01 A;  3KJK A;  1QU9 A;  2EWC A;  1JD1 A;  3LYB A; 
#chains in the Genus database with same CATH topology
 3R0P A;  4G4W A;  3G6E F;  2CSL A;  3LFO A;  3CCQ F;  4U39 A;  4YJ2 A;  3HWU A;  1KQS F;  4O4J A;  5KX5 A;  4NUT A;  5C8Y A;  2Z1E A;  4EB6 A;  4G4Z A;  1VQM F;  2VAP A;  1OFU A;  3ZO8 A;  3N2G B;  4DXD A;  5LP6 B;  2DYY A;  5CB4 B;  1VH8 A;  3TD4 A;  5EIB C;  4BT5 A;  3DDN A;  1QVG F;  1RLU A;  2HS4 A;  1XHO A;  3CXC F;  3CC4 F;  4YJ3 A;  2EWC A;  3JAM M;  2VAM A;  2HS3 A;  4ZOL A;  2GVI A;  3JAK A;  4DRX A;  5LXT B;  1ODE A;  4EI7 A;  3RYF A;  4FFB A;  4ZI7 A;  1GO0 A;  4O4I A;  1T0K B;  3GYQ A;  4HNA B;  4X1K A;  5IJ0 B;  3K2X A;  3IKE A;  4TV9 B;  3LWO C;  1IV3 A;  4NQ3 A;  1Z5V A;  5BMV B;  3RYI A;  3C9R A;  3LWP C;  4TV8 B;  3VIU A;  1YHQ F;  4O4H B;  2CHS A;  3FPI A;  3HTN A;  1TUB A;  3FFM A;  3CCL F;  2I6D A;  3CMA F;  4BT6 A;  1RQ7 A;  3ON1 A;  3S0W A;  1SDS A;  5LOV A;  1QU9 A;  1XV2 A;  3WGM A;  3ZOP A;  4I50 B;  3UT5 A;  5EB0 A;  3PAF A;  1ONI A;  3I3F A;  3MQW A;  3OON A;  2Z1F A;  3JVH A;  1OAP A;  5J2U A;  3F0F A;  1UI9 A;  1JFF A;  3WXM B;  5HXU A;  2G9I A;  2CW4 A;  5B8F A;  5AVM A;  3J80 M;  2FC3 A;  5EZY A;  2QI2 A;  2LCA A;  3FD5 A;  3VMF B;  5JCO C;  4BT3 A;  3M84 A;  3LME A;  3RA6 A;  4TUY A;  3C8L A;  3ERN A;  5KX5 B;  2HVY D;  3CD6 F;  4X20 A;  3K12 A;  1VQ8 F;  1RLG A;  1U43 A;  1W5A A;  3P10 A;  4F6R A;  2VXY A;  4ZK7 A;  4G4X A;  3BYQ A;  4BT4 A;  3F0D A;  3I56 F;  1JN1 A;  5A2Q M;  5GON B;  3I7T A;  4YJ3 B;  3SIU A;  1SZQ A;  3D01 A;  1N8R H;  2HP0 B;  4ZOL B;  3WPW A;  3JAK B;  3B6N A;  1NJI H;  1GZ0 A;  5JH7 A;  5G4V C;  4ZI7 B;  3ZP7 A;  4ZHY B;  3CME F;  2RHL A;  4O4I B;  4X1K B;  3IEW A;  4EI8 A;  5JQG A;  3JAS A;  3N4Z A;  1E7K A;  2IG8 A;  1TUB B;  4C8E A;  1YGY A;  4PWT A;  3WGN A;  2AMT A;  3VI6 A;  3TD5 A;  3CYP B;  3LWQ C;  3KHN A;  3KIZ A;  4O2B A;  5KMG A;  2QTP A;  3UT5 B;  3CCU F;  5GIO C;  3ZP4 A;  3S03 A;  2F9Z C;  3NVI B;  1R1M A;  3JAR A;  1NMU B;  1JFF B;  1FFX A;  1GX1 A;  2UYJ A;  5EAZ A;  5IYZ A;  5IJ9 A;  3MDO A;  1H7M A;  3GTZ A;  1W40 A;  2W8B C;  5CA0 A;  2BTO A;  1U3P A;  4X1Y A;  2GZL A;  4KWE A;  4LNU A;  1VHA A;  2ZVY A;  5HY1 A;  3CCE F;  2BO1 A;  3CPQ A;  3F6M A;  2MQE A;  3HKD A;  5CA1 A;  2ZOV A;  5FNV A;  5GAN K;  3J7A R;  3JAL B;  3KJJ A;  5HY2 A;  3NMU C;  2VGN A;  1VQN F;  3VOB A;  1IV1 A;  3WPX A;  3RYH A;  2NMU A;  3VOA A;  1VQP F;  3RE3 A;  2OHW A;  3WJQ A;  3HKB B;  4X1I A;  3HKE A;  5JVD A;  2DT4 A;  4I55 A;  3GHZ A;  5JCO A;  4O2A B;  1T0A A;  5FJ4 C;  3HKC A;  3S02 A;  1QD9 A;  2OTL F;  2CVL A;  4LCK A;  1DT9 A;  1W58 1;  1U40 A;  2VAW A;  3D54 A;  3CG6 A;  3LWV C;  2IQQ A;  4I4T B;  4IIJ B;  5EYP A;  3EOR A;  1COM A;  3M4S A;  5LA6 A;  5EO3 A;  2HRU A;  3F0G A;  5JQG B;  3TD3 A;  4O4L A;  5GIP C;  3JAS B;  1XRG A;  1YI2 F;  2RHH A;  2YXZ A;  1SA0 A;  4XCQ A;  2V9Y A;  1H47 A;  5G4U C;  3VO8 A;  3CCR F;  1VQV A;  1VQ6 F;  1TVK A;  2H6L A;  4IHJ B;  2WAL A;  3N2K A;  3E1Y A;  3RYC A;  4YJ2 B;  2K1S A;  4O4J B;  2CWJ A;  5MN4 A;  1Q81 H;  4EB6 B;  5C8Y B;  2QEX F;  3IKF A;  1YJW F;  2LBW A;  3JAR B;  2HQS C;  5ITZ A;  3C9T A;  3CYQ A;  2YYE A;  1W2B F;  1FFX B;  1X7P A;  3N2G A;  3E20 B;  4G4V A;  5IYZ B;  2OTJ F;  3D00 A;  3Q8H A;  4X1Y B;  5MN5 A;  1RQ2 A;  3V4D A;  4LNU B;  1IV2 A;  2UYK A;  3OW2 F;  1VQ5 F;  4R40 B;  3N4Y A;  1Q7Y H;  5DCV A;  1Q86 H;  2AIZ P;  4U3J A;  4WBN A;  3LYB A;  4B62 A;  2HS0 A;  1Z5W A;  1VQ7 F;  4DRX B;  2OZB A;  3NK7 A;  2UZH A;  3RYF B;  5LXT A;  2KGW A;  1VK3 A;  4FFB B;  2LBX A;  5IJ0 A;  3HKE B;  3RYI B;  2UYN A;  1W41 A;  2Q1X A;  5JVD B;  5BMV A;  3P4E A;  3VCZ A;  2ZAU A;  4TV8 A;  2R75 1;  1W3E X;  5LP6 C;  1YJ9 F;  1JJ2 F;  3HKC B;  4M8I A;  3LDT A;  3JAT A;  3K0T A;  2R6R 1;  1H48 A;  3FD6 A;  1ZWZ A;  3OBW A;  5LOV B;  4BY9 D;  3CB2 A;  5EYP B;  1VQO F;  4NWO B;  5LA6 B;  2CHT A;  3E22 A;  1KNJ A;  3ELC A;  2UYP A;  1CK2 A;  1X52 A;  4C8G A;  4O4L B;  5J2U B;  3WGJ A;  1YJN F;  2HX0 A;  5HXZ A;  4C8I A;  4E6E A;  1SA0 B;  3C9S A;  5EZY B;  1KD1 H;  2L26 A;  2Q1Y A;  3S0H A;  4ZHQ A;  4BT7 A;  1TVK B;  3IEQ A;  4BVR A;  3RYC B;  4TUY B;  3M1X A;  3PLA C;  1KNK A;  3MCA B;  3O85 A;  1VQK F;  5ITZ B;  4X20 B;  3WJP A;  2ZOD A;  1CLI A;  4BT2 A;  3MBM A;  4F6R B;  3CCJ F;  3G4S F;  2I6R A;  4G88 A;  3I55 F;  1KC8 H;  2VGM A;  4C81 A;  2GLZ A;  2HP3 A;  5GON A;  3V3T A;  4U3J B;  4WBN B;  4RQO A;  3KJK A;  2HP0 A;  5LYJ A;  4TZZ A;  5JH7 B;  1YQN A;  1PXW A;  3FBA A;  1X7O A;  4B5C A;  3AGK A;  3KE1 A;  5MN6 A;  1DBF A;  2AIF A;  2N48 A;  3G71 F;  2UYN B;  2P6Y A;  3S06 A;  4BW0 B;  3WGK A;  5J2T A;  3CPW F;  3LWR C;  4X3L A;  1YIJ F;  1VQL F;  5HY4 A;  3ESJ A;  1QVF F;  1IPA A;  3JAT B;  2RB9 A;  3JAW A;  4X3M A;  5EB1 B;  1M1K H;  3WJR A;  3S0Y A;  1VQ9 F;  2H8C A;  2JNB A;  4O2B B;  3VYT C;  5KMG B;  4G4Y A;  3L7Q A;  1K9M H;  1PF5 A;  3CCM F;  3E22 B;  3OBY A;  3V7E A;  2KTV A;  2HRY A;  3WGL A;  2IAF A;  1FNK A;  4B46 A;  5HP7 A;  2FGY A;  2H8E A;  5IJ9 B;  5LP6 A;  3VTI C;  3IR9 A;  4B45 A;  4C82 A;  2QA4 F;  5CB4 A;  1W57 A;  5CA0 B;  3F0E A;  2ALE A;  4ZHQ B;  1QAH A;  5EIB D;  2CZW A;  1UFY A;  1M90 H;  3T80 A;  5HY0 A;  5CA1 B;  3HKD B;  3SIV A;  5IT9 M;  1U3L A;  5FNV B;  1Q8R A;  1JD1 A;  4C4W C;  2ZVZ A;  3RA5 A;  2PMP A;  1CN7 A;  1YIT F;  1RA4 A;  2Z1T A;  3JAL A;  1XBI A;  3VYS C;  4RHA A;  3RYH B;  1NQ3 A;  4BVS A;  4EI9 A;  4HNA A;  1K8A H;  3MCQ A;  4TV9 A;  4X1I B;  1GO1 A;  3HKB A;  4ZHW A;  2B33 A;  2BTQ B;  3J81 M;  4BVT A;  5HP8 A;  4ZHV A;  3P0Z A;  1W5E A;  2KTU A;  2RHO A;  4O4H A;  5GIN C;  3CC2 F;  4I55 B;  3QUW A;  4ERH A;  1W59 A;  3CC7 F;  1IV4 A;  3NVK E;  4O2A A;  1X25 A;  1J7H A;  2LBT A;  1W42 A;  2RHJ A;  5LYJ B;  1FNJ A;  2Z01 A;  1W5B A;  1Q82 H;  5GAP K;  3CCS F;  4I4T A;  4IIJ A;  4I50 A;  3HJW C;  4BVQ A;  3V7Q A;  3IMP A;  2PHN A;  1W55 A;  2OTM A;  3NK6 A;  1K73 H;  3HAX D;  5J2T B;  3K14 A;  3QHD A;  1FSZ A;  1W5F A;  3QTY A;  5EWR A;  3JAW B;  3JCM M;  3C9U A;  2Z1U A;  3U0O A;  5FLX M;  3VYU C;  1JY8 A;  2BTU A;  2ZF8 A;  1VQ4 F;  3CCV F;  5HWE A;  1S72 F;  2KG4 A;  3DC2 A;  3N2K B;  4IHJ A; 
#chains in the Genus database with same CATH homology
 3M1X A;  3R0P A;  2CSL A;  1PF5 A;  3ZOP A;  2CVL A;  3ZP4 A;  1ODE A;  4NWO B;  2CWJ A;  1ONI A;  3KJJ A;  3ZP7 A;  2CHT A;  3I3F A;  3L7Q A;  1COM A;  3M4S A;  3MQW A;  3K12 A;  2UYP A;  1DBF A;  2OTM A;  3ZO8 A;  1FNK A;  1NQ3 A;  5HP7 A;  2UYN B;  1UI9 A;  2UYJ A;  2UYN A;  2DYY A;  1XRG A;  4ZK7 A;  2CW4 A;  3VCZ A;  2B33 A;  3GTZ A;  2CHS A;  5HP8 A;  2IG8 A;  3V4D A;  3QUW A;  1QAH A;  2UYK A;  3LME A;  1UFY A;  1X25 A;  3K0T A;  3I7T A;  1J7H A;  1QD9 A;  1XHO A;  1FNJ A;  3D01 A;  3KJK A;  1QU9 A;  2EWC A;  1JD1 A;  3LYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...