1FNKA

Crystal structure analysis of chorismate mutase mutant c88k/r90s
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
115
Chain Sequence
b'MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTMQEMDVTGGLKKKISVMMTVQTDVPQDQIRHVYLEKAVVLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHORISMATE MUTASE)
molecule tags Isomerase
source organism Bacillus subtilis
publication title A strategically positioned cation is crucial for efficient catalysis by chorismate mutase.
pubmed doi rcsb
total genus 30
structure length 115
sequence length 116
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1fnkA00
3ZOPA 2UYNB 3GTZA 3ZP7A 2UYJA 3LMEA 3ZP4A 3LYBA 2OTMA 2B33A 4NWOB 2CHTA 2CHSA 1NQ3A 3QUWA 1QU9A 3K12A 3KJJA 1QD9A 3MQWA 1UFYA 1JD1A 1ONIA 2UYPA 3D01A 1PF5A 2CVLA 3KJKA 3K0TA 3M4SA 3V4DA 2CSLA 3R0PA 1UI9A 1XRGA 1X25A 1FNKA 1XHOA 2CWJA 3I7TA 2UYKA 3VCZA 2UYNA 1ODEA 1DBFA 3L7QA 3M1XA 4ZK7A 1J7HA 1FNJA 1COMA 2IG8A 2DYYA 3I3FA 5HP8A 3ZO8A 5HP7A 2CW4A 1QAHA 2EWCA
chains in the Genus database with same CATH superfamily
2JNBA 3MDOA 3RYIA 1SZQA 3HKDB 3LYBA 1K9MH 3MBMA 2Q1XA 1RLUA 3ELCA 3K12A 1RLGA 2HRYA 3WPXA 3N2GB 1YQNA 2R751 1FFXA 1X25A 4I50B 5EYPB 4ZK7A 4TV9A 3SIVA 1KD1H 2LBXA 5EO3A 1COMA 3FD5A 3NMUC 4EI9A 3WGLA 3QTYA 4U3JA 1VQ4F 1YGYA 3CCRF 3I55F 2GZLA 2OTMA 4ERHA 2Z1FA 3JAWA 1VQLF 3JATB 2VAPA 5LOVB 2YXZA 4E6EA 2RHJA 3MQWA 5KX5A 3K14A 1W5FA 5DCVA 4O2BA 1XRGA 4X3LA 3M84A 2KTUA 3CPQA 5JVDB 1Q82H 4HNAA 5HY2A 4G4WA 1OFUA 4EI7A 5HP8A 2ZVYA 3P10A 1TVKA 1N8RH 2Z1EA 4G4ZA 1VK3A 4I55A 4G4XA 4O4IA 5LXTA 3PLAC 2P6YA 3CC4F 3N2GA 3VI6A 2CHTA 1JJ2F 5LA6B 5IJ9A 2VAMA 2HP0A 1FSZA 2I6DA 3J81M 3VIUA 1CLIA 3CXCF 3JVHA 5G4UC 5JCOC 1GO0A 5IJ0A 4BT4A 1Z5VA 2IQQA 3RYFB 2H8CA 1QVGF 4U39A 2H6LA 2HX0A 1E7KA 5JVDA 3ZP7A 2ZVZA 3JCMM 3VYTC 4BVTA 3J7AR 1NMUB 5J2TB 1DT9A 3UT5A 3F0EA 5J2TA 2OHWA 5CA0A 3S02A 3E22A 3OBWA 5FNVB 1VHAA 1SA0B 4IIJB 5LYJB 2ZAUA 3HAXD 1GO1A 3RYHA 3CG6A 1VQ8F 1SDSA 1VQOF 3ESJA 3DC2A 1XV2A 2VXYA 4X1YA 3JASA 4BY9D 1W5BA 5BMVB 1JFFB 1VQ9F 3SIUA 4C4WC 4O2AB 3V3TA 3HKCA 1M1KH 1YI2F 5EB1B 3KJKA 2PMPA 3K0TA 5JH7A 1NJIH 1W2BF 3LWPC 4TZZA 2AIFA 3WJPA 1U40A 4O4LB 3HKEA 1RQ2A 1W41A 5KMGB 1TVKB 3JAKA 4O2BB 1VQPF 5HXUA 4O4HB 3ZOPA 3BYQA 4BT2A 4NUTA 1H48A 3VTIC 2HP0B 3N4YA 4BT6A 3CPWF 3V7EA 3WJQA 3IEQA 1CK2A 1VH8A 1NQ3A 3T80A 2I6RA 5FNVA 3RA5A 3CD6F 2Z1UA 3ON1A 4TV8B 2OTJF 1XBIA 3LFOA 3LDTA 2CWJA 1IV1A 5GIPC 3I7TA 3VO8A 3WGMA 2HS0A 2PHNA 3M1XA 4O2AA 4EB6A 1VQNF 5MN6A 4PWTA 2RB9A 1Q86H 1T0AA 4YJ2B 4F6RA 1GZ0A 2UYNB 3MCQA 3ZP4A 3JAKB 1RQ7A 5HXZA 5GONB 3VMFB 3G6EF 2KTVA 2ZODA 1Q81H 3IKEA 2OZBA 5EAZA 4C81A 3P0ZA 2HVYD 1U3PA 4ZOLB 3CMAF 1UFYA 3JARA 3E22B 2F9ZC 3V4DA 3C9TA 3F0DA 3VOBA 1XHOA 3VCZA 2UYKA 4B62A 3G71F 3CCUF 5EIBC 3I3FA 2WALA 2VGNA 2HQSC 4B5CA 1YIJF 5GIOC 1SA0A 4IIJA 5LYJA 2OTLF 1Q8RA 1U43A 1W40A 3WJRA 2CHSA 2MQEA 3CYQA 3P4EA 3JASB 2K1SA 2BTUA 1IV4A 1GX1A 2CSLA 3R0PA 4EI8A 5LP6A 4BVSA 4ZOLA 3ZO8A 1OAPA 2CW4A 1IPAA 5HY1A 1JN1A 1IV2A 5FLXM 3KE1A 3S0WA 4TV8A 4I55B 5MN5A 3TD5A 4LNUA 4TV9B 1RA4A 5ITZB 3CCVF 3C8LA 4O4JA 3NK6A 3M4SA 2KGWA 3E20B 5IJ9B 4LNUB 2HRUA 5EZYA 3F6MA 2G9IA 3WPWA 5AVMA 3WGNA 2H8EA 2RHLA 3G4SF 2FC3A 5MN4A 1J7HA 4XCQA 1FNJA 2AMTA 3OW2F 3IEWA 2ZOVA 1QAHA 3JAWB 2BTOA 2W8BC 4RQOA 3RYCB 4X1KB 5GONA 1VQ6F 2RHHA 2Z1TA 3ERNA 4EB6B 3LWRC 1YITF 1KNJA 2AIZP 2VGMA 3IMPA 5KX5B 5GINC 4X1KA 5JH7B 2DT4A 1K73H 2GLZA 3RA6A 1QD9A 1X7OA 4DXDA 2KG4A 3HKBB 3KHNA 3WGJA 2LBTA 5JQGA 3MCAB 1DBFA 3L7QA 3WGKA 1YJWF 5HY0A 4R40B 3LWVC 1W581 3NVIB 3VYUC 5JQGB 5EZYB 2EWCA 4G4YA 2LBWA 5LA6A 3FBAA 4X1IA 4C8GA 2UYJA 1U3LA 3QHDA 5JCOA 4BT5A 3S03A 4C82A 1ZWZA 3CCQF 2RHOA 5FJ4C 3RYFA 4NQ3A 2ZF8A 2N48A 3FD6A 1KQSF 4X3MA 1VQVA 3C9SA 5BMVA 2HS3A 3RYCA 1FNKA 3K2XA 3GYQA 2UYNA 1ODEA 5HWEA 4BW0B 4ZI7B 2QA4F 1YHQF 4KWEA 2IG8A 3I56F 3U0OA 5IYZA 1TUBB 3GTZA 2GVIA 3D00A 3IR9A 3LMEA 3TD4A 3DDNA 2B33A 4I4TA 1M90H 3JALB 4BVRA 5CA0B 3QUWA 1W55A 4C8IA 4G88A 3HWUA 1JY8A 2CZWA 4TUYB 3RE3A 3CMEF 3JALA 3D01A 1W59A 5ITZA 3RYHB 2BTQB 3F0GA 3Q8HA 2VAWA 3CCSF 1W57A 1IV3A 3HTNA 4X1YB 3WXMB 1CN7A 3N4ZA 3S06A 3VOAA 2UZHA 5EWRA 3TD3A 5LXTB 4YJ3A 4IHJB 4ZHYB 3O85A 3D54A 3CC2F 1K8AH 3HKCB 3AGKA 4LCKA 4G4VA 2QTPA 4IHJA 3HKBA 3OBYA 5LP6C 4X20A 1KNKA 3FFMA 3E1YA 3JATA 1X52A 2L26A 5CB4A 4WBNB 4X20B 4BVQA 5CA1A 5IYZB 2HS4A 3HJWC 5EIBD 4TUYA 3EORA 3OONA 4DRXA 5IT9M 3VYSC 3V7QA 4X1IB 5HP7A 1QVFF 2HP3A 1PXWA 5GANK 3CCLF 4I4TB 3B6NA 3CCJF 5KMGA 4HNAB 3GHZA 5J2UA 3S0HA 5HY4A 1W5AA 3CC7F 4O4HA 3C9UA 3RYIB 4ZHQB 2QI2A 5J2UB 1YJ9F 2QEXF 3KJJA 4O4IB 3CCEF 4FFBB 1ONIA 2IAFA 4ZHQA 2CVLA 4BT7A 2Q1YA 4ZI7A 3CYPB 1UI9A 3NK7A 2V9YA 5IJ0B 2FGYA 5C8YB 3J80M 5CA1B 1VQ5F 4RHAA 3LWOC 4DRXB 2BO1A 1TUBA 3JARB 1JFFA 1W42A 2LCAA 4U3JB 4ZHWA 5A2QM 5G4VC 3LWQC 1YJNF 1KC8H 3NVKE 5CB4B 3S0YA 3C9RA 3F0FA 4M8IA 2Z01A 1JD1A 2UYPA 3HKEB 1S72F 1PF5A 1VQ7F 5B8FA 4O4JB 3UT5B 3N2KB 2R6R1 4YJ3B 5EB0A 3CB2A 1T0KB 2NMUA 2DYYA 3FPIA 1W5EA 3KIZA 1H47A 1W3EX 4B45A 3N2KA 4ZHVA 1VQKF 1H7MA 1X7PA 5C8YA 4C8EA 4FFBA 4BT3A 4B46A 4NWOB 3CCMF 1FFXB 1QU9A 4I50A 5EYPA 5GAPK 4WBNA 1R1MA 1VQMF 1Q7YH 3IKFA 2ALEA 1Z5WA 5LOVA 3PAFA 2YYEA 4F6RB 4YJ2A 3HKDA 5LP6B 4O4LA 3JAMM
chains in the Genus database with same CATH topology
3ZOPA 2UYNB 3GTZA 3ZP7A 2UYJA 3LMEA 3ZP4A 3LYBA 2OTMA 2B33A 4NWOB 2CHTA 2CHSA 1NQ3A 3QUWA 1QU9A 3K12A 3KJJA 1QD9A 3MQWA 1UFYA 1JD1A 1ONIA 2UYPA 3D01A 1PF5A 2CVLA 3KJKA 3K0TA 3M4SA 3V4DA 2CSLA 3R0PA 1UI9A 1XRGA 1X25A 1FNKA 1XHOA 2CWJA 3I7TA 2UYKA 3VCZA 2UYNA 1ODEA 1DBFA 3L7QA 3M1XA 4ZK7A 1J7HA 1FNJA 1COMA 2IG8A 2DYYA 3I3FA 5HP8A 3ZO8A 5HP7A 2CW4A 1QAHA 2EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOP A;  2UYN B;  3GTZ A;  3ZP7 A;  2UYJ A;  3LME A;  3ZP4 A;  3LYB A;  2OTM A;  2B33 A;  4NWO B;  2CHT A;  2CHS A;  1NQ3 A;  3QUW A;  1QU9 A;  3K12 A;  3KJJ A;  1QD9 A;  3MQW A;  1UFY A;  1JD1 A;  1ONI A;  2UYP A;  3D01 A;  1PF5 A;  2CVL A;  3KJK A;  3K0T A;  3M4S A;  3V4D A;  2CSL A;  3R0P A;  1UI9 A;  1XRG A;  1X25 A;  1FNK A;  1XHO A;  2CWJ A;  3I7T A;  2UYK A;  3VCZ A;  2UYN A;  1ODE A;  1DBF A;  3L7Q A;  3M1X A;  4ZK7 A;  1J7H A;  1FNJ A;  1COM A;  2IG8 A;  2DYY A;  3I3F A;  5HP8 A;  3ZO8 A;  5HP7 A;  2CW4 A;  1QAH A;  2EWC A; 
#chains in the Genus database with same CATH topology
 2JNB A;  3MDO A;  3RYI A;  1SZQ A;  3HKD B;  3LYB A;  1K9M H;  3MBM A;  2Q1X A;  1RLU A;  3ELC A;  3K12 A;  1RLG A;  2HRY A;  3WPX A;  3N2G B;  1YQN A;  2R75 1;  1FFX A;  1X25 A;  4I50 B;  5EYP B;  4ZK7 A;  4TV9 A;  3SIV A;  1KD1 H;  2LBX A;  5EO3 A;  1COM A;  3FD5 A;  3NMU C;  4EI9 A;  3WGL A;  3QTY A;  4U3J A;  1VQ4 F;  1YGY A;  3CCR F;  3I55 F;  2GZL A;  2OTM A;  4ERH A;  2Z1F A;  3JAW A;  1VQL F;  3JAT B;  2VAP A;  5LOV B;  2YXZ A;  4E6E A;  2RHJ A;  3MQW A;  5KX5 A;  3K14 A;  1W5F A;  5DCV A;  4O2B A;  1XRG A;  4X3L A;  3M84 A;  2KTU A;  3CPQ A;  5JVD B;  1Q82 H;  4HNA A;  5HY2 A;  4G4W A;  1OFU A;  4EI7 A;  5HP8 A;  2ZVY A;  3P10 A;  1TVK A;  1N8R H;  2Z1E A;  4G4Z A;  1VK3 A;  4I55 A;  4G4X A;  4O4I A;  5LXT A;  3PLA C;  2P6Y A;  3CC4 F;  3N2G A;  3VI6 A;  2CHT A;  1JJ2 F;  5LA6 B;  5IJ9 A;  2VAM A;  2HP0 A;  1FSZ A;  2I6D A;  3J81 M;  3VIU A;  1CLI A;  3CXC F;  3JVH A;  5G4U C;  5JCO C;  1GO0 A;  5IJ0 A;  4BT4 A;  1Z5V A;  2IQQ A;  3RYF B;  2H8C A;  1QVG F;  4U39 A;  2H6L A;  2HX0 A;  1E7K A;  5JVD A;  3ZP7 A;  2ZVZ A;  3JCM M;  3VYT C;  4BVT A;  3J7A R;  1NMU B;  5J2T B;  1DT9 A;  3UT5 A;  3F0E A;  5J2T A;  2OHW A;  5CA0 A;  3S02 A;  3E22 A;  3OBW A;  5FNV B;  1VHA A;  1SA0 B;  4IIJ B;  5LYJ B;  2ZAU A;  3HAX D;  1GO1 A;  3RYH A;  3CG6 A;  1VQ8 F;  1SDS A;  1VQO F;  3ESJ A;  3DC2 A;  1XV2 A;  2VXY A;  4X1Y A;  3JAS A;  4BY9 D;  1W5B A;  5BMV B;  1JFF B;  1VQ9 F;  3SIU A;  4C4W C;  4O2A B;  3V3T A;  3HKC A;  1M1K H;  1YI2 F;  5EB1 B;  3KJK A;  2PMP A;  3K0T A;  5JH7 A;  1NJI H;  1W2B F;  3LWP C;  4TZZ A;  2AIF A;  3WJP A;  1U40 A;  4O4L B;  3HKE A;  1RQ2 A;  1W41 A;  5KMG B;  1TVK B;  3JAK A;  4O2B B;  1VQP F;  5HXU A;  4O4H B;  3ZOP A;  3BYQ A;  4BT2 A;  4NUT A;  1H48 A;  3VTI C;  2HP0 B;  3N4Y A;  4BT6 A;  3CPW F;  3V7E A;  3WJQ A;  3IEQ A;  1CK2 A;  1VH8 A;  1NQ3 A;  3T80 A;  2I6R A;  5FNV A;  3RA5 A;  3CD6 F;  2Z1U A;  3ON1 A;  4TV8 B;  2OTJ F;  1XBI A;  3LFO A;  3LDT A;  2CWJ A;  1IV1 A;  5GIP C;  3I7T A;  3VO8 A;  3WGM A;  2HS0 A;  2PHN A;  3M1X A;  4O2A A;  4EB6 A;  1VQN F;  5MN6 A;  4PWT A;  2RB9 A;  1Q86 H;  1T0A A;  4YJ2 B;  4F6R A;  1GZ0 A;  2UYN B;  3MCQ A;  3ZP4 A;  3JAK B;  1RQ7 A;  5HXZ A;  5GON B;  3VMF B;  3G6E F;  2KTV A;  2ZOD A;  1Q81 H;  3IKE A;  2OZB A;  5EAZ A;  4C81 A;  3P0Z A;  2HVY D;  1U3P A;  4ZOL B;  3CMA F;  1UFY A;  3JAR A;  3E22 B;  2F9Z C;  3V4D A;  3C9T A;  3F0D A;  3VOB A;  1XHO A;  3VCZ A;  2UYK A;  4B62 A;  3G71 F;  3CCU F;  5EIB C;  3I3F A;  2WAL A;  2VGN A;  2HQS C;  4B5C A;  1YIJ F;  5GIO C;  1SA0 A;  4IIJ A;  5LYJ A;  2OTL F;  1Q8R A;  1U43 A;  1W40 A;  3WJR A;  2CHS A;  2MQE A;  3CYQ A;  3P4E A;  3JAS B;  2K1S A;  2BTU A;  1IV4 A;  1GX1 A;  2CSL A;  3R0P A;  4EI8 A;  5LP6 A;  4BVS A;  4ZOL A;  3ZO8 A;  1OAP A;  2CW4 A;  1IPA A;  5HY1 A;  1JN1 A;  1IV2 A;  5FLX M;  3KE1 A;  3S0W A;  4TV8 A;  4I55 B;  5MN5 A;  3TD5 A;  4LNU A;  4TV9 B;  1RA4 A;  5ITZ B;  3CCV F;  3C8L A;  4O4J A;  3NK6 A;  3M4S A;  2KGW A;  3E20 B;  5IJ9 B;  4LNU B;  2HRU A;  5EZY A;  3F6M A;  2G9I A;  3WPW A;  5AVM A;  3WGN A;  2H8E A;  2RHL A;  3G4S F;  2FC3 A;  5MN4 A;  1J7H A;  4XCQ A;  1FNJ A;  2AMT A;  3OW2 F;  3IEW A;  2ZOV A;  1QAH A;  3JAW B;  2BTO A;  2W8B C;  4RQO A;  3RYC B;  4X1K B;  5GON A;  1VQ6 F;  2RHH A;  2Z1T A;  3ERN A;  4EB6 B;  3LWR C;  1YIT F;  1KNJ A;  2AIZ P;  2VGM A;  3IMP A;  5KX5 B;  5GIN C;  4X1K A;  5JH7 B;  2DT4 A;  1K73 H;  2GLZ A;  3RA6 A;  1QD9 A;  1X7O A;  4DXD A;  2KG4 A;  3HKB B;  3KHN A;  3WGJ A;  2LBT A;  5JQG A;  3MCA B;  1DBF A;  3L7Q A;  3WGK A;  1YJW F;  5HY0 A;  4R40 B;  3LWV C;  1W58 1;  3NVI B;  3VYU C;  5JQG B;  5EZY B;  2EWC A;  4G4Y A;  2LBW A;  5LA6 A;  3FBA A;  4X1I A;  4C8G A;  2UYJ A;  1U3L A;  3QHD A;  5JCO A;  4BT5 A;  3S03 A;  4C82 A;  1ZWZ A;  3CCQ F;  2RHO A;  5FJ4 C;  3RYF A;  4NQ3 A;  2ZF8 A;  2N48 A;  3FD6 A;  1KQS F;  4X3M A;  1VQV A;  3C9S A;  5BMV A;  2HS3 A;  3RYC A;  1FNK A;  3K2X A;  3GYQ A;  2UYN A;  1ODE A;  5HWE A;  4BW0 B;  4ZI7 B;  2QA4 F;  1YHQ F;  4KWE A;  2IG8 A;  3I56 F;  3U0O A;  5IYZ A;  1TUB B;  3GTZ A;  2GVI A;  3D00 A;  3IR9 A;  3LME A;  3TD4 A;  3DDN A;  2B33 A;  4I4T A;  1M90 H;  3JAL B;  4BVR A;  5CA0 B;  3QUW A;  1W55 A;  4C8I A;  4G88 A;  3HWU A;  1JY8 A;  2CZW A;  4TUY B;  3RE3 A;  3CME F;  3JAL A;  3D01 A;  1W59 A;  5ITZ A;  3RYH B;  2BTQ B;  3F0G A;  3Q8H A;  2VAW A;  3CCS F;  1W57 A;  1IV3 A;  3HTN A;  4X1Y B;  3WXM B;  1CN7 A;  3N4Z A;  3S06 A;  3VOA A;  2UZH A;  5EWR A;  3TD3 A;  5LXT B;  4YJ3 A;  4IHJ B;  4ZHY B;  3O85 A;  3D54 A;  3CC2 F;  1K8A H;  3HKC B;  3AGK A;  4LCK A;  4G4V A;  2QTP A;  4IHJ A;  3HKB A;  3OBY A;  5LP6 C;  4X20 A;  1KNK A;  3FFM A;  3E1Y A;  3JAT A;  1X52 A;  2L26 A;  5CB4 A;  4WBN B;  4X20 B;  4BVQ A;  5CA1 A;  5IYZ B;  2HS4 A;  3HJW C;  5EIB D;  4TUY A;  3EOR A;  3OON A;  4DRX A;  5IT9 M;  3VYS C;  3V7Q A;  4X1I B;  5HP7 A;  1QVF F;  2HP3 A;  1PXW A;  5GAN K;  3CCL F;  4I4T B;  3B6N A;  3CCJ F;  5KMG A;  4HNA B;  3GHZ A;  5J2U A;  3S0H A;  5HY4 A;  1W5A A;  3CC7 F;  4O4H A;  3C9U A;  3RYI B;  4ZHQ B;  2QI2 A;  5J2U B;  1YJ9 F;  2QEX F;  3KJJ A;  4O4I B;  3CCE F;  4FFB B;  1ONI A;  2IAF A;  4ZHQ A;  2CVL A;  4BT7 A;  2Q1Y A;  4ZI7 A;  3CYP B;  1UI9 A;  3NK7 A;  2V9Y A;  5IJ0 B;  2FGY A;  5C8Y B;  3J80 M;  5CA1 B;  1VQ5 F;  4RHA A;  3LWO C;  4DRX B;  2BO1 A;  1TUB A;  3JAR B;  1JFF A;  1W42 A;  2LCA A;  4U3J B;  4ZHW A;  5A2Q M;  5G4V C;  3LWQ C;  1YJN F;  1KC8 H;  3NVK E;  5CB4 B;  3S0Y A;  3C9R A;  3F0F A;  4M8I A;  2Z01 A;  1JD1 A;  2UYP A;  3HKE B;  1S72 F;  1PF5 A;  1VQ7 F;  5B8F A;  4O4J B;  3UT5 B;  3N2K B;  2R6R 1;  4YJ3 B;  5EB0 A;  3CB2 A;  1T0K B;  2NMU A;  2DYY A;  3FPI A;  1W5E A;  3KIZ A;  1H47 A;  1W3E X;  4B45 A;  3N2K A;  4ZHV A;  1VQK F;  1H7M A;  1X7P A;  5C8Y A;  4C8E A;  4FFB A;  4BT3 A;  4B46 A;  4NWO B;  3CCM F;  1FFX B;  1QU9 A;  4I50 A;  5EYP A;  5GAP K;  4WBN A;  1R1M A;  1VQM F;  1Q7Y H;  3IKF A;  2ALE A;  1Z5W A;  5LOV A;  3PAF A;  2YYE A;  4F6R B;  4YJ2 A;  3HKD A;  5LP6 B;  4O4L A;  3JAM M; 
#chains in the Genus database with same CATH homology
 3ZOP A;  2UYN B;  3GTZ A;  3ZP7 A;  2UYJ A;  3LME A;  3ZP4 A;  3LYB A;  2OTM A;  2B33 A;  4NWO B;  2CHT A;  2CHS A;  1NQ3 A;  3QUW A;  1QU9 A;  3K12 A;  3KJJ A;  1QD9 A;  3MQW A;  1UFY A;  1JD1 A;  1ONI A;  2UYP A;  3D01 A;  1PF5 A;  2CVL A;  3KJK A;  3K0T A;  3M4S A;  3V4D A;  2CSL A;  3R0P A;  1UI9 A;  1XRG A;  1X25 A;  1FNK A;  1XHO A;  2CWJ A;  3I7T A;  2UYK A;  3VCZ A;  2UYN A;  1ODE A;  1DBF A;  3L7Q A;  3M1X A;  4ZK7 A;  1J7H A;  1FNJ A;  1COM A;  2IG8 A;  2DYY A;  3I3F A;  5HP8 A;  3ZO8 A;  5HP7 A;  2CW4 A;  1QAH A;  2EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...