1FNKA

Crystal structure analysis of chorismate mutase mutant c88k/r90s
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
115
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTMQEMDVTGGLKKKISVMMTVQTDVPQDQIRHVYLEKAVVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHORISMATE MUTASE)
publication title A strategically positioned cation is crucial for efficient catalysis by chorismate mutase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 30
structure length 115
sequence length 116
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1fnkA00
3LMEA 3K0TA 1COMA 3V4DA 3I7TA 3LYBA 3ZOPA 2DYYA 3K12A 3KJJA 3ZP4A 1J7HA 1UI9A 2CHSA 1PF5A 5HP8A 2CW4A 3L7QA 3KJKA 2CSLA 2UYNB 2IG8A 2UYNA 1JD1A 1DBFA 1FNJA 3ZO8A 1UFYA 1ODEA 1QAHA 3R0PA 1X25A 2EWCA 2CWJA 2UYJA 3VCZA 1NQ3A 5HP7A 3QUWA 3MQWA 3ZP7A 1XHOA 2UYPA 2UYKA 1QD9A 2OTMA 2B33A 1FNKA 3GTZA 3M4SA 2CHTA 4NWOB 2CVLA 3M1XA 1QU9A 4ZK7A 1XRGA 1ONIA 3I3FA 3D01A
chains in the Genus database with same CATH superfamily
3HKEA 5MN5A 3I7TA 3IMPA 4X3LA 5IYZB 3IKFA 4LNUB 3HJWC 4ZHYB 3PLAC 2KTVA 2UYNA 1IV1A 1X7PA 4ZI7B 2GZLA 2CWJA 3AGKA 4O4JB 2VXYA 2ZAUA 1GX1A 3VO8A 4BT4A 4BT5A 3E20B 5G4VC 3ON1A 5HXUA 2OTMA 5EIBD 1U3LA 1W5BA 5EZYB 3S0HA 3M1XA 4ZK7A 5JVDA 1VQ8F 3I3FA 2PMPA 5LOVA 3VYUC 2DYYA 4LCKA 2HS4A 2BO1A 2OHWA 4IHJB 2HS0A 2IAFA 2PHNA 5GIOC 3I56F 3WPWA 3V3TA 2L26A 2ZOVA 4O4LB 3HKDA 3CYQA 2Z1UA 2N48A 1YJNF 3KIZA 2Z1TA 2HRUA 2QEXF 5MN6A 2RHHA 2LCAA 4EI7A 2JNBA 4FFBB 4X1YA 3F6MA 2CVLA 3F0FA 3N2KA 1Z5WA 2I6DA 4BY9D 1W41A 3ELCA 5J2UB 1YJWF 2WALA 3R0PA 5J2TB 4I55A 2RHLA 1KC8H 5GANK 3MCAB 5EWRA 1S72F 1RQ2A 3RE3A 1FFXB 1IV4A 5IJ9A 1DBFA 1FSZA 3VIUA 3TD4A 5MN4A 1X25A 1TVKA 2KG4A 3FD5A 5EAZA 3LWRC 1JFFA 4TV8A 1T0AA 1IV2A 3SIVA 1CLIA 4U3JB 5JH7A 2KGWA 3CMEF 3CCVF 3WXMB 3CCUF 2ZVYA 5CA1A 3V4DA 3LYBA 3HKCA 3KJJA 3WPXA 1OAPA 3JASB 3RYCA 1UI9A 5LYJA 3BYQA 5HP8A 4BW0B 5KMGB 3N4YA 2H6LA 3IR9A 3T80A 1R1MA 1TUBA 2HS3A 5FJ4C 4TV9A 1Z5VA 3OBWA 4BVSA 3HAXD 5CA0A 1SA0A 3VYSC 3CC2F 5FLXM 2RHJA 5EIBC 3GTZA 1YIJF 2YYEA 3HTNA 2HP0B 2HX0A 2VAMA 1QU9A 2W8BC 3HKBA 5FNVB 3U0OA 3JVHA 1KNJA 5DCVA 2Q1XA 4HNAB 3N4ZA 5EB1B 4C4WC 2V9YA 1RQ7A 1KNKA 1ZWZA 2VAPA 4EI9A 3UT5B 3VMFB 3G71F 4M8IA 4F6RB 1YHQF 1YI2F 1SDSA 4X1KB 4YJ3A 1ODEA 5B8FA 4DXDA 1IPAA 3HWUA 3CCQF 3JARA 3NVIB 2BTOA 5CB4B 3NMUC 2OTJF 1DT9A 2GVIA 2I6RA 5LA6B 4IHJA 4ZHQB 5LXTB 4O2BA 3K0TA 2QI2A 3ZOPA 2AMTA 5IYZA 3ESJA 1VHAA 4LNUA 3P10A 1YJ9F 4B46A 4ZI7A 3WGNA 4O4HB 2VGMA 2MQEA 4O4JA 3JAWA 2FGYA 4ERHA 3E1YA 3ZP7A 4EB6B 5LP6B 1VQNF 4G88A 4WBNB 2IQQA 3C9RA 3CG6A 5EZYA 3RYIB 1XRGA 1K8AH 3M84A 1GO1A 1W581 3VYTC 3KJKA 3OBYA 4O4LA 5EYPB 4YJ2B 1QAHA 3MCQA 4G4YA 5BMVB 5KX5B 5HP7A 1RLGA 3VOBA 2RB9A 3D54A 4FFBA 4ZOLA 2CHTA 3C9UA 5JVDB 1W40A 3CCLF 4E6EA 5JQGB 4X3MA 3CCEF 3JATB 1XBIA 5J2TA 3KE1A 3TD3A 4BVQA 3OW2F 1N8RH 3CMAF 1U3PA 5A2QM 2CHSA 5LP6C 4G4ZA 3WGKA 4ZHWA 4DRXB 3ZO8A 2ZODA 2HRYA 3LWOC 3P0ZA 4X1IB 3CC4F 4X1YB 2ZF8A 3M4SA 1M90H 4U3JA 4TZZA 5GONB 4O4IB 3F0DA 3LMEA 3P4EA 5HXZA 1COMA 1U43A 3FPIA 1JY8A 3GYQA 3PAFA 2QTPA 4ZHVA 1JN1A 3JASA 2LBTA 4B62A 3RYFB 1Q81H 3RA5A 2NMUA 5KMGA 3IKEA 1FNJA 1UFYA 1VQVA 5C8YB 1W57A 3F0EA 2LBXA 3VCZA 3CC7F 4G4VA 1JFFB 5GAPK 5IJ0B 2UYPA 3NK6A 1YITF 1W2BF 3IEWA 2DT4A 3N2GB 4NWOB 3VOAA 1K9MH 3NVKE 2HP0A 5AVMA 4IIJB 5FNVA 2ALEA 3DC2A 2Z01A 3HKCB 3S0WA 4HNAA 4PWTA 3LWVC 3JALB 2LBWA 3S02A 3CCSF 3RYCB 4TUYB 5IT9M 4I50B 2CW4A 3UT5A 5EB0A 3MBMA 3JAKA 4X1KA 4RHAA 1TUBB 4TV9B 5HY4A 3G6EF 4O2AB 2AIZP 5CA0B 1SA0B 1W55A 5EO3A 5CB4A 3LDTA 3F0GA 3J80M 2F9ZC 3CYPB 3QHDA 5LA6A 4C82A 3V7EA 1VQPF 1JJ2F 3I55F 2BTQB 3JAMM 2QA4F 4I4TB 1Q86H 1GZ0A 1CN7A 2YXZA 5ITZB 2UYJA 3J81M 3LFOA 1VQLF 5JCOC 3LWPC 2ZVZA 3K2XA 3C8LA 1Q82H 4X20B 1E7KA 1H48A 3O85A 3RYHB 4R40B 1XV2A 2Z1EA 4YJ3B 2IG8A 2K1SA 2OZBA 3G4SF 3JARB 4O4HA 3FFMA 3QUWA 3MQWA 2HQSC 4EB6A 5LP6A 3E22B 2H8CA 2B33A 3Q8HA 2R751 1CK2A 1H47A 4WBNA 4C8IA 3CB2A 4BT2A 3HKEB 1QVFF 4C81A 1Q8RA 2CZWA 1VQKF 1VQ6F 2UYNB 4RQOA 4BT6A 1VQ5F 5EYPA 3SIUA 4YJ2A 1YQNA 3JAWB 5KX5A 5BMVA 2EWCA 3C9TA 1XHOA 4NQ3A 1FNKA 3CPWF 1OFUA 1W5FA 2FC3A 4U39A 5JQGA 1ONIA 3JATA 5J2UA 3CCJF 1X52A 3D00A 3TD5A 2Z1FA 5LOVB 3WJQA 3EORA 1QVGF 3WGLA 1IV3A 1FFXA 3S06A 2CSLA 4C8EA 1RA4A 4DRXA 1JD1A 2P6YA 3HKDB 1SZQA 4NUTA 1W59A 1VQ4F 2HP3A 4XCQA 2UZHA 4ZOLB 3JCMM 4X1IA 2UYKA 3S03A 3QTYA 3J7AR 3NK7A 5HWEA 3N2KB 5GONA 3MDOA 3VI6A 1PXWA 4O4IA 5G4UC 3D01A 4I55B 3FBAA 4BT7A 2G9IA 1NJIH 3K12A 3DDNA 3V7QA 5HY1A 3RYFA 5IJ9B 1W3EX 5JCOA 1KD1H 5C8YA 2AIFA 4BVTA 1TVKB 5IJ0A 4TV8B 1QD9A 1W5AA 3CXCF 3N2GA 5JH7B 3CCMF 3WJPA 5GINC 4IIJA 3S0YA 1Q7YH 3OONA 2OTLF 5CA1B 4EI8A 1KQSF 1M1KH 3JALA 1H7MA 4TUYA 3FD6A 4I50A 5LYJB 1PF5A 1VH8A 3KHNA 2RHOA 3L7QA 4B45A 1T0KB 1GO0A 3VTIC 1NMUB 3K14A 4F6RA 1K73H 1VQ7F 3CCRF 4KWEA 3IEQA 4O2AA 1X7OA 1NQ3A 3CD6F 1VQMF 3WGJA 3WJRA 3LWQC 3GHZA 4I4TA 1W42A 3HKBB 5GIPC 5ITZA 1VQ9F 2GLZA 4ZHQA 5LXTA 4BT3A 3B6NA 1W5EA 4X20A 3ERNA 3RA6A 4C8GA 3ZP4A 5HY2A 1J7HA 3RYHA 3JAKB 2BTUA 2VAWA 3C9SA 4B5CA 2R6R1 1YGYA 2VGNA 4G4XA 1VK3A 4G4WA 5HY0A 1VQOF 3E22A 4BVRA 2HVYD 1U40A 2H8EA 2Q1YA 1RLUA 2KTUA 3WGMA 3CPQA 3RYIA 4O2BB
chains in the Genus database with same CATH topology
3LMEA 3K0TA 1COMA 3V4DA 3I7TA 3LYBA 3ZOPA 2DYYA 3K12A 3KJJA 3ZP4A 1J7HA 1UI9A 2CHSA 1PF5A 5HP8A 2CW4A 3L7QA 3KJKA 2CSLA 2UYNB 2IG8A 2UYNA 1JD1A 1DBFA 1FNJA 3ZO8A 1UFYA 1ODEA 1QAHA 3R0PA 1X25A 2EWCA 2CWJA 2UYJA 3VCZA 1NQ3A 5HP7A 3QUWA 3MQWA 3ZP7A 1XHOA 2UYPA 2UYKA 1QD9A 2OTMA 2B33A 1FNKA 3GTZA 3M4SA 2CHTA 4NWOB 2CVLA 3M1XA 1QU9A 4ZK7A 1XRGA 1ONIA 3I3FA 3D01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LME A;  3K0T A;  1COM A;  3V4D A;  3I7T A;  3LYB A;  3ZOP A;  2DYY A;  3K12 A;  3KJJ A;  3ZP4 A;  1J7H A;  1UI9 A;  2CHS A;  1PF5 A;  5HP8 A;  2CW4 A;  3L7Q A;  3KJK A;  2CSL A;  2UYN B;  2IG8 A;  2UYN A;  1JD1 A;  1DBF A;  1FNJ A;  3ZO8 A;  1UFY A;  1ODE A;  1QAH A;  3R0P A;  1X25 A;  2EWC A;  2CWJ A;  2UYJ A;  3VCZ A;  1NQ3 A;  5HP7 A;  3QUW A;  3MQW A;  3ZP7 A;  1XHO A;  2UYP A;  2UYK A;  1QD9 A;  2OTM A;  2B33 A;  1FNK A;  3GTZ A;  3M4S A;  2CHT A;  4NWO B;  2CVL A;  3M1X A;  1QU9 A;  4ZK7 A;  1XRG A;  1ONI A;  3I3F A;  3D01 A; 
#chains in the Genus database with same CATH topology
 3HKE A;  5MN5 A;  3I7T A;  3IMP A;  4X3L A;  5IYZ B;  3IKF A;  4LNU B;  3HJW C;  4ZHY B;  3PLA C;  2KTV A;  2UYN A;  1IV1 A;  1X7P A;  4ZI7 B;  2GZL A;  2CWJ A;  3AGK A;  4O4J B;  2VXY A;  2ZAU A;  1GX1 A;  3VO8 A;  4BT4 A;  4BT5 A;  3E20 B;  5G4V C;  3ON1 A;  5HXU A;  2OTM A;  5EIB D;  1U3L A;  1W5B A;  5EZY B;  3S0H A;  3M1X A;  4ZK7 A;  5JVD A;  1VQ8 F;  3I3F A;  2PMP A;  5LOV A;  3VYU C;  2DYY A;  4LCK A;  2HS4 A;  2BO1 A;  2OHW A;  4IHJ B;  2HS0 A;  2IAF A;  2PHN A;  5GIO C;  3I56 F;  3WPW A;  3V3T A;  2L26 A;  2ZOV A;  4O4L B;  3HKD A;  3CYQ A;  2Z1U A;  2N48 A;  1YJN F;  3KIZ A;  2Z1T A;  2HRU A;  2QEX F;  5MN6 A;  2RHH A;  2LCA A;  4EI7 A;  2JNB A;  4FFB B;  4X1Y A;  3F6M A;  2CVL A;  3F0F A;  3N2K A;  1Z5W A;  2I6D A;  4BY9 D;  1W41 A;  3ELC A;  5J2U B;  1YJW F;  2WAL A;  3R0P A;  5J2T B;  4I55 A;  2RHL A;  1KC8 H;  5GAN K;  3MCA B;  5EWR A;  1S72 F;  1RQ2 A;  3RE3 A;  1FFX B;  1IV4 A;  5IJ9 A;  1DBF A;  1FSZ A;  3VIU A;  3TD4 A;  5MN4 A;  1X25 A;  1TVK A;  2KG4 A;  3FD5 A;  5EAZ A;  3LWR C;  1JFF A;  4TV8 A;  1T0A A;  1IV2 A;  3SIV A;  1CLI A;  4U3J B;  5JH7 A;  2KGW A;  3CME F;  3CCV F;  3WXM B;  3CCU F;  2ZVY A;  5CA1 A;  3V4D A;  3LYB A;  3HKC A;  3KJJ A;  3WPX A;  1OAP A;  3JAS B;  3RYC A;  1UI9 A;  5LYJ A;  3BYQ A;  5HP8 A;  4BW0 B;  5KMG B;  3N4Y A;  2H6L A;  3IR9 A;  3T80 A;  1R1M A;  1TUB A;  2HS3 A;  5FJ4 C;  4TV9 A;  1Z5V A;  3OBW A;  4BVS A;  3HAX D;  5CA0 A;  1SA0 A;  3VYS C;  3CC2 F;  5FLX M;  2RHJ A;  5EIB C;  3GTZ A;  1YIJ F;  2YYE A;  3HTN A;  2HP0 B;  2HX0 A;  2VAM A;  1QU9 A;  2W8B C;  3HKB A;  5FNV B;  3U0O A;  3JVH A;  1KNJ A;  5DCV A;  2Q1X A;  4HNA B;  3N4Z A;  5EB1 B;  4C4W C;  2V9Y A;  1RQ7 A;  1KNK A;  1ZWZ A;  2VAP A;  4EI9 A;  3UT5 B;  3VMF B;  3G71 F;  4M8I A;  4F6R B;  1YHQ F;  1YI2 F;  1SDS A;  4X1K B;  4YJ3 A;  1ODE A;  5B8F A;  4DXD A;  1IPA A;  3HWU A;  3CCQ F;  3JAR A;  3NVI B;  2BTO A;  5CB4 B;  3NMU C;  2OTJ F;  1DT9 A;  2GVI A;  2I6R A;  5LA6 B;  4IHJ A;  4ZHQ B;  5LXT B;  4O2B A;  3K0T A;  2QI2 A;  3ZOP A;  2AMT A;  5IYZ A;  3ESJ A;  1VHA A;  4LNU A;  3P10 A;  1YJ9 F;  4B46 A;  4ZI7 A;  3WGN A;  4O4H B;  2VGM A;  2MQE A;  4O4J A;  3JAW A;  2FGY A;  4ERH A;  3E1Y A;  3ZP7 A;  4EB6 B;  5LP6 B;  1VQN F;  4G88 A;  4WBN B;  2IQQ A;  3C9R A;  3CG6 A;  5EZY A;  3RYI B;  1XRG A;  1K8A H;  3M84 A;  1GO1 A;  1W58 1;  3VYT C;  3KJK A;  3OBY A;  4O4L A;  5EYP B;  4YJ2 B;  1QAH A;  3MCQ A;  4G4Y A;  5BMV B;  5KX5 B;  5HP7 A;  1RLG A;  3VOB A;  2RB9 A;  3D54 A;  4FFB A;  4ZOL A;  2CHT A;  3C9U A;  5JVD B;  1W40 A;  3CCL F;  4E6E A;  5JQG B;  4X3M A;  3CCE F;  3JAT B;  1XBI A;  5J2T A;  3KE1 A;  3TD3 A;  4BVQ A;  3OW2 F;  1N8R H;  3CMA F;  1U3P A;  5A2Q M;  2CHS A;  5LP6 C;  4G4Z A;  3WGK A;  4ZHW A;  4DRX B;  3ZO8 A;  2ZOD A;  2HRY A;  3LWO C;  3P0Z A;  4X1I B;  3CC4 F;  4X1Y B;  2ZF8 A;  3M4S A;  1M90 H;  4U3J A;  4TZZ A;  5GON B;  4O4I B;  3F0D A;  3LME A;  3P4E A;  5HXZ A;  1COM A;  1U43 A;  3FPI A;  1JY8 A;  3GYQ A;  3PAF A;  2QTP A;  4ZHV A;  1JN1 A;  3JAS A;  2LBT A;  4B62 A;  3RYF B;  1Q81 H;  3RA5 A;  2NMU A;  5KMG A;  3IKE A;  1FNJ A;  1UFY A;  1VQV A;  5C8Y B;  1W57 A;  3F0E A;  2LBX A;  3VCZ A;  3CC7 F;  4G4V A;  1JFF B;  5GAP K;  5IJ0 B;  2UYP A;  3NK6 A;  1YIT F;  1W2B F;  3IEW A;  2DT4 A;  3N2G B;  4NWO B;  3VOA A;  1K9M H;  3NVK E;  2HP0 A;  5AVM A;  4IIJ B;  5FNV A;  2ALE A;  3DC2 A;  2Z01 A;  3HKC B;  3S0W A;  4HNA A;  4PWT A;  3LWV C;  3JAL B;  2LBW A;  3S02 A;  3CCS F;  3RYC B;  4TUY B;  5IT9 M;  4I50 B;  2CW4 A;  3UT5 A;  5EB0 A;  3MBM A;  3JAK A;  4X1K A;  4RHA A;  1TUB B;  4TV9 B;  5HY4 A;  3G6E F;  4O2A B;  2AIZ P;  5CA0 B;  1SA0 B;  1W55 A;  5EO3 A;  5CB4 A;  3LDT A;  3F0G A;  3J80 M;  2F9Z C;  3CYP B;  3QHD A;  5LA6 A;  4C82 A;  3V7E A;  1VQP F;  1JJ2 F;  3I55 F;  2BTQ B;  3JAM M;  2QA4 F;  4I4T B;  1Q86 H;  1GZ0 A;  1CN7 A;  2YXZ A;  5ITZ B;  2UYJ A;  3J81 M;  3LFO A;  1VQL F;  5JCO C;  3LWP C;  2ZVZ A;  3K2X A;  3C8L A;  1Q82 H;  4X20 B;  1E7K A;  1H48 A;  3O85 A;  3RYH B;  4R40 B;  1XV2 A;  2Z1E A;  4YJ3 B;  2IG8 A;  2K1S A;  2OZB A;  3G4S F;  3JAR B;  4O4H A;  3FFM A;  3QUW A;  3MQW A;  2HQS C;  4EB6 A;  5LP6 A;  3E22 B;  2H8C A;  2B33 A;  3Q8H A;  2R75 1;  1CK2 A;  1H47 A;  4WBN A;  4C8I A;  3CB2 A;  4BT2 A;  3HKE B;  1QVF F;  4C81 A;  1Q8R A;  2CZW A;  1VQK F;  1VQ6 F;  2UYN B;  4RQO A;  4BT6 A;  1VQ5 F;  5EYP A;  3SIU A;  4YJ2 A;  1YQN A;  3JAW B;  5KX5 A;  5BMV A;  2EWC A;  3C9T A;  1XHO A;  4NQ3 A;  1FNK A;  3CPW F;  1OFU A;  1W5F A;  2FC3 A;  4U39 A;  5JQG A;  1ONI A;  3JAT A;  5J2U A;  3CCJ F;  1X52 A;  3D00 A;  3TD5 A;  2Z1F A;  5LOV B;  3WJQ A;  3EOR A;  1QVG F;  3WGL A;  1IV3 A;  1FFX A;  3S06 A;  2CSL A;  4C8E A;  1RA4 A;  4DRX A;  1JD1 A;  2P6Y A;  3HKD B;  1SZQ A;  4NUT A;  1W59 A;  1VQ4 F;  2HP3 A;  4XCQ A;  2UZH A;  4ZOL B;  3JCM M;  4X1I A;  2UYK A;  3S03 A;  3QTY A;  3J7A R;  3NK7 A;  5HWE A;  3N2K B;  5GON A;  3MDO A;  3VI6 A;  1PXW A;  4O4I A;  5G4U C;  3D01 A;  4I55 B;  3FBA A;  4BT7 A;  2G9I A;  1NJI H;  3K12 A;  3DDN A;  3V7Q A;  5HY1 A;  3RYF A;  5IJ9 B;  1W3E X;  5JCO A;  1KD1 H;  5C8Y A;  2AIF A;  4BVT A;  1TVK B;  5IJ0 A;  4TV8 B;  1QD9 A;  1W5A A;  3CXC F;  3N2G A;  5JH7 B;  3CCM F;  3WJP A;  5GIN C;  4IIJ A;  3S0Y A;  1Q7Y H;  3OON A;  2OTL F;  5CA1 B;  4EI8 A;  1KQS F;  1M1K H;  3JAL A;  1H7M A;  4TUY A;  3FD6 A;  4I50 A;  5LYJ B;  1PF5 A;  1VH8 A;  3KHN A;  2RHO A;  3L7Q A;  4B45 A;  1T0K B;  1GO0 A;  3VTI C;  1NMU B;  3K14 A;  4F6R A;  1K73 H;  1VQ7 F;  3CCR F;  4KWE A;  3IEQ A;  4O2A A;  1X7O A;  1NQ3 A;  3CD6 F;  1VQM F;  3WGJ A;  3WJR A;  3LWQ C;  3GHZ A;  4I4T A;  1W42 A;  3HKB B;  5GIP C;  5ITZ A;  1VQ9 F;  2GLZ A;  4ZHQ A;  5LXT A;  4BT3 A;  3B6N A;  1W5E A;  4X20 A;  3ERN A;  3RA6 A;  4C8G A;  3ZP4 A;  5HY2 A;  1J7H A;  3RYH A;  3JAK B;  2BTU A;  2VAW A;  3C9S A;  4B5C A;  2R6R 1;  1YGY A;  2VGN A;  4G4X A;  1VK3 A;  4G4W A;  5HY0 A;  1VQO F;  3E22 A;  4BVR A;  2HVY D;  1U40 A;  2H8E A;  2Q1Y A;  1RLU A;  2KTU A;  3WGM A;  3CPQ A;  3RYI A;  4O2B B; 
#chains in the Genus database with same CATH homology
 3LME A;  3K0T A;  1COM A;  3V4D A;  3I7T A;  3LYB A;  3ZOP A;  2DYY A;  3K12 A;  3KJJ A;  3ZP4 A;  1J7H A;  1UI9 A;  2CHS A;  1PF5 A;  5HP8 A;  2CW4 A;  3L7Q A;  3KJK A;  2CSL A;  2UYN B;  2IG8 A;  2UYN A;  1JD1 A;  1DBF A;  1FNJ A;  3ZO8 A;  1UFY A;  1ODE A;  1QAH A;  3R0P A;  1X25 A;  2EWC A;  2CWJ A;  2UYJ A;  3VCZ A;  1NQ3 A;  5HP7 A;  3QUW A;  3MQW A;  3ZP7 A;  1XHO A;  2UYP A;  2UYK A;  1QD9 A;  2OTM A;  2B33 A;  1FNK A;  3GTZ A;  3M4S A;  2CHT A;  4NWO B;  2CVL A;  3M1X A;  1QU9 A;  4ZK7 A;  1XRG A;  1ONI A;  3I3F A;  3D01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...