1FNSL

Crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPSSLSASLGDRVTISCSASQDINKYLNWYQQKPDGAVKLLIFYTSSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYEKLPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN NMC-4 IGG1
publication title von Willebrand factor conformation and adhesive function is modulated by an internalized water molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnsL01
5C0NC 1WTGT 1FH5H 2GEEA 5D7LA 4JRXA 4G8FA 4WW2C 4P49A 3OZ9H 2FJFB 5C8JA 2WP3O 2YEZB 4U3HA 4O9HL 1KLGB 3DX9A 3GJEA 1TETH 1OTSC 3BP5A 1AY1H 3NZHH 1S9VB 5E08L 3T3PF 1E4KA 5CJ5A 5CILL 4NO0A 1K2DB 1YC8A 15C8L 2QLVB 1A4JA 4ZO8A 2IQ9H 1MIEH 4IDJH 2NY1C 3S3SA 4M6AA 2HTLD 1RPQA 4Q0XH 1Q0YL 3KYOB 1Y0LA 4UOW1 1J88A 3UDWC 3WUWA 1NBYB 4P9HC 1S7UA 2H6PA 3MLPA 3OKEB 2VKWA 4YC2C 3CU1A 4ODUA 5EO9A 3SO3B 4LBEA 1T0PB 1V7NL 1CE6B 3WHE0 4BUHA 4UIMB 4JB9L 1S78C 3K74B 2UYLB 4WIQA 4XMPH 4QRSB 4BH8A 4YHML 2IH1A 2YD5A 2BSRB 3BP6B 5EWIL 4AQ1B 1JYXA 4C83A 1I9IH 1KLUB 3LRHA 4FZEH 4I2XA 3D18A 3LSOB 5TDNA 4BKLB 4G9FD 4YGVA 4WHTB 4NQEE 4U7MA 1IM3A 1BREA 4JM2D 2MSPA 4U1HB 3MLYL 2FCBA 3QA3A 1CFSB 2CLRA 2WIIA 3FAWA 3MV8A 2AJUL 1FN4A 3D39D 5DJZB 1J1OH 4KUCF 5TQ2H 1D6EB 2YKLL 1LE5A 4KC3B 3RHWF 5CLWA 3VH8B 3O4OC 2ZCKH 3LAFA 3QJFA 1J0HA 4D8PA 1N6QL 4G5ZL 1CFQB 1MJJA 1BGXH 5IT2L 2Z8WC 3LV3B 4I18B 3WEXB 5JOPE 4B0MM 3K1KC 3BVNB 1NFDB 4QY8B 2ATKA 3BAEL 4D9RE 3WUWG 1BM3H 4OFIA 5MI0B 3I6GA 2OSLA 1DLHA 1KC5L 4K3JL 4S2SA 5DT1H 4JZOA 1GZPB 2G2RA 1XIWC 3ULVC 5MEOB 5DTFB 2D4FA 3L95A 4NM4L 2HP4A 1TPXC 1DEEA 2EDHA 5DLMH 1ACYL 4PGDB 1RZJH 1IE5A 2YD8A 4J3WA 4KQ3L 1PKQB 3STLA 1Q94A 1KCRH 5FYKE 1ETZA 2C1OB 4JY5L 4PD4J 3DGCR 1VGEH 1AP2A 3IJHA 5JLZB 1MJ7H 2AK4D 4BQ8A 4EI5D 1FL5B 3QHTC 3KHOA 2DKUA 1IFHL 2UZIH 4AL8H 1NFIB 2VABA 4B7IA 5AZEH 3VFTB 2B8OT 3JV4A 5B22A 1Q1JL 3MGAA 2HJFB 4M00A 3S9DB 5DJ2B 3LQMA 5C0GA 3Q6GL 4R2GD 5ALCL 4EN3B 1TIUA 2EDDA 1C1EL 3T8XA 3KPOA 1U0QA 1KG0A 1WIOA 1EZVX 1UEYA 4GRMB 2WM0A 1KCUL 5IHBA 1M7IB 3EDEA 2HFTA 3VFGH 1OAXL 1ZSDA 3VXME 2QQLH 3VW3H 4RFOH 1UKSA 4JDZB 2YSSA 4U49A 3MV9E 4PV9B 4PJIE 3NCFB 4ZFOL 3L3GA 3KYNA 4M7LL 1A1MA 1KBGH 4IRZH 1GIGH 5D7JB 5HHMD 3V2AR 1EA9C 4Q74A 2P8PB 2PNDA 5IIEB 4RWYH 4QLRA 4IMLA 1F4YH 5ADPH 2EXWC 5GISH 3O0RL 4NIKB 4IRJA 4KVNH 1FORH 1H8NA 5LXGH 3TT3L 3QDJE 3UC0H 4D94A 4PJEF 4WFED 3N1GC 4ODVL 3QIBD 3BZEA 1U92A 3QI9A 2VISB 4RFNC 2P4AB 1ED3A 1E6JH 4F9PA 3GMQA 3IDXL 4XGZB 5CBEB 4IOSD 3HNSH 3HZKA 5D8JL 4K2UL 4C54A 3VU2A 4PLKD 2VR4A 3E0GA 3O3DB 4Y4FC 3Q6FA 4WW1A 2DBLH 5HGBA 5LGJB 3SDCD 5ITBL 4M9PA 3KYAA 5F7EH 5CD5C 2D03L 5EULV 2WIMA 4MB3A 1BWWA 2NTSP 4EUPH 3W0WD 3JTSB 4GQ9L 1RMFL 1A1NB 4U6HA 4ZUTA 4OTXH 4KHXH 5AUMA 1HEZA 4MLIA 4LLDA 2VLJE 1N7MH 3ULUC 2AVGA 4KRNA 2A0LD 4QF1B 1CS6A 1QP1A 3RZWA 4I3SL 1JZ8A 5I6XB 3VFUA 5SWSE 2MWCA 2R0WH 4ZOCA 4DKFH 1CLZL 5IFJB 4H25A 2BNRD 5EU3A 4XH2A 4MA3A 3B43A 1KPRB 5D96C 1KIRB 1NJ9A 5A43C 3H3PH 1U93B 1DBAL 1PG7H 2VTFA 4GRWH 4OD1H 1NCAH 2X1XR 3AXLB 1AKJA 2C7UB 1RI8A 4MMZC 3FJTA 4LLAA 3V7MA 4G7YL 4FQIH 3SN6N 3CD4A 1OAQL 1OHQA 4PJEA 5DHVB 4KQ4H 1KCSH 4N0YH 5LCVH 3MJ8B 4I48A 1QOKA 2P24A 3O3EB 4FTVB 5CGTA 4YJZL 4EDXB 2W92A 3PXJA 3ARFC 1R6VA 3P30L 3QCTH 2WAHA 3F5WB 4Y19D 5IR1B 5HYJA 3SCMC 2NW2A 1A7OH 4GLRH 3MRQB 5A2LH 5BW7C 5CP3A 4JFDA 1NC2B 1P6AB 4L8DA 1BQSA 4MQSB 3VGEA 5F88A 4FQJL 5B4MD 3SKUD 1WC7A 5HVGB 3QQ9C 2BVPB 1WZ1H 3SKNB 2QQNL 1A9EB 1JGVH 4ENED 5I1KH 1H9VA 4K9EL 4P2YA 3P4NB 4LARL 4AYFA 4R97B 4NJ9H 3DVNA 4HDIA 1K4CA 2E7CA 3WXVH 1D5BB 1JHLL 4D0DA 5JO5A 4U31A 4PGCB 2GJ6E 3S97C 5IB5B 1HKFA 3MV9B 4P57A 3T2OA 3L3IB 2Q87A 1YEDB 2VN7A 5ESAB 3QH3B 5D1ZA 2V2TB 4FXLA 3BO8A 4NBXB 1FE8L 4HBCL 1FL6A 2V17H 2Y23A 2IPKA 2DTMH 1CDYA 5AZ2L 1LGVA 3QDJB 4TPRL 4S1QL 1Q9KB 1FNSL 5I1AB 4WEBH 3RVVD 2CJUL 1DQQB 1ERNA 3OR7B 5INCB 4XMLL 5HYSA 2BVEA 3QUYC 4JVUA 3NFNB 2ESVE 3NVQA 1G7PA 2ZUUA 3VE0B 5E8PB 4PP2A 4KAQL 2VLMD 4PRPE 5F1NA 2R56L 3LH2H 1CG9B 4YWGH 4MJIA 4HK0A 3BKML 2H9GA 2VO5A 3B8YA 4QCIA 3VXUE 5JORA 1FVEB 1T6WA 2BNQE 1RIUH 5DO2D 1OM3L 5GGRB 3GB7B 2FJFA 4M43H 1X5FA 4MA7L 2VLRD 2YEZA 2CH8A 4DQOH 4PRBB 3OKOA 1KLGA 3JBG7 3V4VH 4KHTL 4ERSH 1MFDL 4UTAL 5JZ7C 1JL8A 2YHGA 1ZXQA 1S9VA 3DRQB 5CZVH 3WDJA 4Q9RH 4FMFA 1W72L 1K2DA 5A2JH 3BEVB 1CQYA 1C5BL 4YFDB 4GKZB 4OCXL 5LAXB 4WI4A 5I8OL 5D71H 1NFDF 1BIIA 3WMSA 4KUZH 5IF0B 4KJWC 3IAQA 3BYTA 3C5JB 5F96H 1DBBL 4GG6A 1NBYA 4O2CA 3UPRB 4WNQB 3OKEA 4N8VB 3B2UC 4KJPC 1MCSA 2VXSH 1SEBB 1N0XL 1CE6A 5JW5B 4FQHB 3QUXC 1BZ7B 2AJXL 1QFWM 4X8XA 2UYLA 1B6UA 4KJQD 4QRSA 3ET9F 2XRAL 3S96B 2BSRA 3BP6A 3WO3B 4DUXA 5CZXC 2BFVL 4NQXB 4F58L 5HYSG 3HPLB 4YHPA 1PZ5B 3LSOA 4HCRL 5HY9B 4BKLA 3GHBL 3P0YL 4MXVE 5F9WC 5L8KB 5BVJB 4WHTA 1KJ2L 5IQ7H 4MD5B 4U1HA 1KTRL 3RIAF 5EC2B 4DWHA 1CFSA 1RUQH 1VCAA 4PRDB 5HI5C 3FO1B 5DJZA 3B83A 4M3KB 4Z7QF 4J4PD 2XYCA 4JGJA 2BXYA 3VH8A 1RURL 2B4CH 2X4UB 1C5DA 1A3LH 3ULSB 3NCYS 2P45B 1CFQA 3D25B 4KDTC 5L7XL 4PBVC 5F7YC 1QEWA 1JF1A 2OL3L 3LV3A 2UY6A 2WBJC 4I18A 3WEXA 3EZJB 3UJTH 3MUGA 4X9HA 2BXZA 5HGHB 1GXEA 4A6YH 4OI9A 2YD6A 2UZXB 4JFPB 1HCFX 5EZJB 1H15B 1A22B 5GQBA 3KWWB 5FGBA 1NFDA 1OLLA 2GJ6B 4X6DE 3BISA 5BXFB 3QO0B 5EIVA 1WWWX 4NHUB 4P9ML 4Z5RB 4P4KB 1IBGL 4ZTPH 4FFYL 4PS4H 5MEOA 1MVUA 5DTFA 1RUPH 1EPFA 2YD4A 2BNUA 3HTLX 3MUJA 3S88L 2DF3A 5F89B 4NWTL 4PGDA 5E6YA 3RJQB 3VXNB 4GW1B 3WIIH 3UBXI 1PKQA 3BIBX 1HZHL 4WVRA 2KQNA 4KPHH 3MXWL 2H2SD 2VZVA 4APQB 5JLZA 1HK6A 4WI2A 2ESVB 1FL5A 4L5FH 3F58H 2ZG2A 4ZUWB 4URTB 1NFIA 2WWMD 4JKPH 5M94B 2V7HB 3UP1A 3U1SL 3RA7L 1N59B 3VXUB 4F9LA 5ADOH 1E4XH 2HJFA 5FHBH 1UA6L 5DJ2A 4ZTOH 3FT3A 5GS0H 2I5YH 1UM5L 1XF5B 5J9PB 1R0AH 1ZVHA 4FFZL 4HC1L 4HS8H 4PGZA 4RMWA 2P5EE 1JNNL 4NRYB 3U7WH 1OGTA 2ICWB 2Z4QA 1YYML 1FCGA 2FX9H 3HI6H 25C8L 3VH8G 3EIFA 1IC7L 4GSDL 4GRMA 2DD8L 4U0RC 1ZLVH 2FO4A 1M7IA 4RAUB 3CDGB 3QQ4B 5EU7C 4JREB 5FDYA 3U48A 3WDHA 3L9RB 1AJ7L 4QXGH 3U4BL 3VFSB 4H5SB 2HA1A 3T1FB 4XMKH 4GMTL 4JDZA 1BQHB 1MFEL 4PJ9D 5C7XL 4NWUH 3VGDA 1OF2B 3PWNB 4AENB 3ZL4L 3LEYH 4YHYB 2F58L 5D7JA 5TGBB 3S36X 2VDMH 2RR3A 4HG4J 3EJJX 5J3HC 2O5YL 3JV5A 3SGDH 1JMZA 3E6HB 2W91A 3B5GA 4MDJB 2XG4A 5DK2A 1LE9B 3OKDB 1CFVH 2VISA 5E56A 1VFAB 3O6ML 5KVEL 4DEPB 4D3CL 2PXYB 3C8KB 4X6FB 4XGZA 4NM8H 1RHFA 4XPHH 1JZ3A 5GS2D 2VIRA 4NQEA 3G5VB 2IH3B 3O6FC 1FGNL 3O3DA 1IGIH 3GRWA 3VD9A 1IAIM 5LGJA 1HSBB 4NGHL 4ODXB 3WS3A 2JJSA 2YUXA 3KPRE 5C09B 4EZMA 3PP3H 2IAMB 2ED8A 5D1QB 1YEFL 1A1NA 3RWJB 5IKCB 1GGCH 3JWDH 1LD9B 4QF1A 4OAWB 3PV6B 1H8OA 5IFJA 1RK0B 1RZKL 1LVEA 4LIQL 3IFNL 4DVRH 4Y5VC 3EYQC 4X6DB 4HFUL 1KPRA 1KIRA 4UAOB 4KK6C 1MFAL 3W5NA 1U93A 4OFYA 3U9UB 2XA8L 4GBXD 4H8WH 4KV5E 2FIRT 3NTCH 5C0BE 2DS4A 2C7UA 3AXLA 2GW5A 4ZFOB 5ECJE 4N9GA 4N8PA 4M6NL 3OQ3B 4QRPB 3MLUH 4KDVA 2E7MA 3RU8L 4M1GL 2VQ1B 3MSPA 2YZ1A 5D1XD 4G6KL 5DHVA 4RWHA 5TE4H 4JRYE 3MJ8A 5DUBB 2E27L 1P4BH 2Y25A 1RZGB 1KFAH 1BAFH 3I9GL 3O3EA 4FTVA 1JWUA 1UWXH 5FCUL 1U3HC 5I1CH 3MCKB 4EJ1C 4V2CB 2HFFB 3F5WA 5IR1A 3SDAB 2X9WA 4LLYB 4BQ6A 3MRQA 2DIBA 3JXAA 4WWKB 3D3VD 1NC2A 3BD4A 3KLSA 3ZE1F 1I3UA 3DETC 2CXGA 3LZFH 4MSWB 3C60B 3U0WH 3LS5H 2P5EB 4IIQC 4MAYD 1DL7H 2BVPA 1F5WA 4LCWD 2CRMA 4PG2A 4XPTH 1NGWB 1A9EA 1MFCH 4LP5A 3P4NA 3VXMA 2FJHB 3NOIA 4YPJA 2DQJL 5T3ZD 1D5BA 5C08D 3S4SB 3HG1E 2X9YA 5IB5A 3MV9A 1Y18A 2IJ0C 1YEDA 4PJIA 3Q1SL 4G6FB 3THMH 5T5NF 2V2TA 1ZMYA 2LU3A 4JO2H 2AS5M 5I9QB 1F4AA 4MQ7B 3GMRA 4ODHH 4JHAH 4N5ED 4LLQB 3VRJB 5B39B 1FPTH 1DFBH 2A1WL 4UOW0 1CQKA 3KNBB 1AQDB 3QDJA 5F1SA 5IROA 1Q9KA 4Z0BH 4HIIB 4P5TB 5I1AA 2BJML 1DQQA 3OR7A 2R4RL 5INCA 5IB4B 2FBJH 5KANI 5CIPB 3VE0A 2DI9A 4Z7VE 1MJUL 1CG9A 1F3JA 4PTTB 4NNPL 2HVJB 3EAKA 1V3LA 1FVEA 2FYYB 4QRRE 2V9TA 2J12B 3TZVA 3MJ7B 3GB7A 2A2QT 5T1DL 3SDXE 1I3GH 1Q9WA 1CK0L 4PUBL 3CMOL 4PRBA 1A6WH 2HLAB 3Q2CA 1JV5B 3KPRB 4OCYL 1NLDH 3FN9A 3DRQA 1V3JA 2C9AA 4I13B 1MEXH 1U42A 4N0RA 5T3XH 1NGZB 2VLJA 4X99A 5GS1C 2JIXB 4GKZA 1S5IH 2CK2A 4GAYA 5LAXA 3VXSB 4MLSA 2H8PB 1XF2A 1KYOK 3ARGC 1OARL 1EJOL 1MRDH 5I19L 3ARZA 5J1SC 1E4XI 1QFWI 3UPRA 4JFFB 4JDTH 5BMFL 4K7PX 4PBWD 4N8VA 3WFDL 3DOSA 4WHYG 3VWKD 2VXQL 5C0BB 1HQRB 1SEBA 1I1FB 2J2ZA 5JW5A 5I15H 4FQHA 1BZ7A 1FLRH 2IFFL 4JANA 5DK0B 43C9B 4Q9QL 1SJXA 3ARDD 3S96A 3LIZH 4X7FC 3MLZH 4Y5YC 4GUPB 4WCYH 2NY3D 1UEMA 1BX2B 1JPTH 3U2SB 1UCTA 3HI5L 4Q6IB 3HPLA 1PZ5A 1FIGL 2CKNA 5HY9A 2VDKH 1NGXA 5GGUB 5BVJA 1BD2E 1JIBA 3I2CH 1TDQA 3RUGB 1CFTA 4YFLF 4MD5A 1T1ZB 1QFPA 4J3TA 2HYMA 4OB5L 5EC2A 3MLVH 3FO1A 5CP3H 1MY5A 3S3PA 1KJVB 1BBDH 5CUSH 1KN4L 5KS9E 3RAJH 2LAAA 2X4UA 4XVJH 3TT1L 2HRPH 3ULSA 3B5HA 4PJ7E 3HNTH 5T1LA 3KPNB 3X11A 2EYRB 5E5UB 3VG0H 3BGMB 4FQ1L 3P73B 1QLEL 1HIMH 1W72B 4JFZL 5EZJA 5I1EL 1H15A 2ZOLA 3HE7D 1FZMB 2GJ6A 5BXFA 2IMNA 1ZHNB 3QYCA 5T5NG 3IFPB 4P4KA 4JO3H 4JZJA 4MX7A 1OSZB 4N8VG 3WJLA 1EK3A 3LB6C 1IQDB 1TFHA 3BJ91 4DOHE 5F89A 4KH2A 4G9FE 4GW1A 1F11B 1UACH 2RQ8A 4FG6C 3F6LA 5L2KD 3RI5K 4LFHD 2P44B 4XP5L 3LQZA 3Q3GB 4OZGE 2HFEB 4YX2H 3MA9L 1HN1A 1Z2KA 4W81A 3V6BR 1MCWW 3V7AE 4APQA 2C4FU 5IFAL 2ESVA 4HGKC 3D39E 4MXVF 4PRPA 3C5ZC 4ZUWA 3TJHD 3BSZL 1QBMH 5BZDA 5AYQA 3CIQA 2V7HA 3SDYH 3S36L 3CU7A 3VXUA 5EOQH 2X05A 3JSSA 2IANB 1HXMB 3PP4L 4QRRB 2BNQA 1A47A 5JXAL 2O26U 1Q0XL 3C6LD 4JFHE 1PZUB 1Z9OA 4WFGD 3ZMRA 4AT6B 1KJ2B 5EBGA 2E7LC 2LTQC 1DVFA 1WCBB 3TV3L 5CGYC 4NRYA 1GGIH 1TQCC 3HZMB 1VFBB 2KUTA 1B0RB 2GJJA 5E2UL 2ZUSA 4O51A 4U1NB 4RAUA 3CDGA 3QQ4A 3W9DA 5E4IA 2R39A 3QG6B 4F15C 3HRPA 4H5SA 2NXZC 1FL3B 1RIHH 1ZLSH 3MMEB 5KSBB 4ZFGH 4TUJB 4ZS7H 1BQHA 2DJSA 2OL3B 3W39B 1A6UH 1X5JA 4PJXB 4X6DF 1OF2A 3BWAB 3PWNA 5TGBA 4CAGA 4GO6B 5EO1B 4LLWB 1NLBL 4Z7UE 2XTJB 3B8SA 3FN0H 1DCLA 3E6HA 3GMMB 3W11D 5JW3L 3PHQB 2HH0L 5C07E 3ROLB 3P11L 5EA0H 3UTPD 2HMIC 1LE9A 4LKCA 1T7VA 2WUBH 3OKDA 4ZXBB 3BMVA 1C12B 3ESUF 3HC3L 3N1FC 3IVKB 5IG7B 4OD3L 2ADIB 3CFCH 4Q2ZB 4L8SB 3C8KA 4X6FA 2H1PH 3CX2A 1IAII 4OZFA 1A6ZB 1BD2B 3ARBC 3G5VA 2IH3A 1KEGL 4JZNB 5KJRH 3CMGA 3K4AA 3RX8A 4XNZB 4EQ2A 4TUOA 2DQDH 2D7QA 1HSBA 3GO1H 1FHGA 3RDTD 4ODXA 3RZCD 3KLHC 3G5YA 4JO1L 3PQYB 1AXSA 2W9EL 2Y4SA 3QJHA 2DM2A 4I0CC 4Y4KC 3CPLB 5KS9B 3DMMA 2IAMA 1CGVA 2W0FB 3W9EB 1JRHH 4ELME 5F70A 3L5XL 4PJ7B 2YD1A 1F3RB 1BEYL 1M71A 3RWJA 5IHLB 5IKCA 1T5XB 5KVDH 4YDKL 1LD9A 5DI8B 1U3ZA 1V3KA 5DA4A 1V7ML 5HHME 1RZJC 3OF6D 1MJ8L 3SOBL 1OAZL 3AMKA 5J8OA 3PV6A 4UT7L 1RK0A 5DMIH 3VXTB 4K8RH 4ZD3H 1BQHG 4P2QD 4X6DA 1AGEB 3U9UA 4IBLT 5TF0A 2LV4A 4WFEE 4AEEA 4NQDB 4ZFOA 5FM5M 2DLTA 1LO5B 3D85A 3S6CA 4HFWB 3OKMB 4DOHB 1IGCH 1FVDB 4M6ML 1XZ0A 1BP3B 3KPTA 3RRQA 1A7QL 3TPKA 2XY2A 4JM2B 1L0QA 3TJEL 5DUBA 4WWID 1RZGA 3MLXL 3S98A 1XF3B 3D39B 3MCKA 1FG2B 5TFSH 4OZFG 1JGUH 4P5KB 3W0WE 3DX8A 2HFFA 2AK1L 2DL2A 1RULL 4LLYA 1OAUH 4ODSL 1S5HA 2B0SH 1MCFA 4WWKA 2EDRA 3NZ8B 3ARRA 3R8BB 1IC4L 5TQ0L 3C60A 2P5EA 1UZ8B 3VMOA 2BNRE 4LHQB 1FAIH 4DGIL 1QLRB 4S0TD 1H5BC 3BPOC 5AG8A 4KJYB 4YFEA 2FJHA 3EO9H 1RUAL 5GGSY 3V6ZA 4HZAA 1EX0A 2X4SB 3S4SA 1J0IA 3QEGH 3TCXA 1JFQH 2FECI 2Z31D 4KV5F 4MQ7A 3CH8A 5HGDB 2Z92B 2ICES 4Z7UB 2X4RB 1GJIA 4LLQA 3VRJA 3MLSL 2X4TB 3KNBA 1AQDA 5JA8B 3EDKA 1UH2A 2P5WD 4G6AC 4H88H 3DSFL 1DQDL 5C07B 4HIIA 4P5TA 4Y19E 2NY6D 2JB5L 3L6FA 4PB9L 4XXDB 4YXLH 1KPUB 5IB4A 3S35X 3EYOB 5CIPA 3ZT6A 4X4ZA 5ALBH 4WGWB 5ILTH 2O5ZH 3BKJL 1TTGA 4PTTA 3RUGF 5K9KB 3GSNL 4K7PL 2HVJA 1Y6KR 4CJ0A 4DUVA 1MLCB 2FYYA 1R3HB 1LO4H 3O3BA 3REVA 4RA0C 2EYTB 4X83A 3GRWH 1KJMB 4DGYH 4D9QD 5H8DA 2DBJA 2HLAA 4LU5L 5DRWA 5GRJH 3KPRA 4IEFB 3RGVC 4DAGL 3S34H 3VA2C 1QUNA 3ARED 1NCNA 5F6IB 4RIRB 3OV6A 4UT6L 1NGZA 2W0KA 2FSEB 3D2UB 3LPWA 5HHMB 4OM0L 1QYGL 2JIXA 3QUZB 2CRYA 2VZTA 5I8CA 4TQEL 2QQKH 1F6FB 2H8PA 3QNXB 3S4SG 1WFOA 1PYWB 2DQUL 3OKYA 1F00I 5DZNA 4JFFA 4NUJB 4KMTH 4OLXL 5DURD 5C0BA 4OLUL 1WBXB 1EMTL 3QIBB 2DWDB 2HRLA 1MCLA 3GHEL 4MA1C 3OB0K 1I7UB 1UZ6E 5J4MA 2J5LB 2VLME 43C9A 5DK0A 5BO1H 3MLTB 1IVLA 3EHBD 4W6YB 1MCEA 3RVTC 3MXVH 1J0KA 5FYLL 4GUPA 2QSCH 5EUOE 4JPKL 1YEJH 3PWJB 4LVNC 1BX2A 4KK8C 3U2SA 4PP1D 5FYKH 4Q6IA 3FO2B 2GAZA 2X4QB 2AJYL 3GK8L 4J3XA 2H41A 5ANME 5CBAB 2KH2B 2ZSVB 3WFEH 5IW6B 1CICC 1YEHH 1T5WB 2DM3A 4LPVA 4LNRB 1KJVA 1DN0B 4D0BA 4H20L 1EBAA 3FRUB 3WUZA 3WN5B 2QHRL 1ZGLP 1Z0MA 4YHKL 2BNRB 4JQVC 1X6NA 5IB3B 5I73B 2F5AH 3L5JA 1HNGA 5C6PB 2NXYC 2R9HC 2EYRA 2NTFA 4CVZA 1DN2A 1WICA 3BGMA 3P73A 1TZHB 5EZOL 2MFNA 3X17A 5KSBF 3QPXH 1W72A 2COQA 1FZMA 5CSBA 2DLFL 4PJXF 1J7VR 5KSVB 1ZA3B 3HC0B 2ARWA 1WJ3A 4UUJB 3IFPA 2IGFL 1UCBH 1OSZA 1GAFL 3UJIH 4C4KO 3BYYA 4WHYH 3F7VB 1HE7A 4N5UA 1UVQA 4HAFA 1MCDA 2I24N 3GBMH 1JTTA 4S1RH 1TJIL 4CADA 1F11A 1IAOB 4XBGB 4XWOD 3MRBB 5EBWB 3ABZA 5I1DB 2E3VA 2JJTC 2ERJB 1OSPH 3Q3GA 3O2WL 1CD8A 1XCQA 4L4TE 2HFEA 2R0LH 4MCYB 3WFBH 4BSJA 4LP4A 1FYTD 2B2XL 3O4LB 1YC7A 5LGHH 1VSCA 3IJSB 4YXKL 4C58B 2XA3A 4Z7VA 2NY0C 2VDOL 5HSFA 3CFIC 4KROB 1LK3L 4POZD 4X5WB 1ZGLB 2IANA 1CGSH 2EDNA 4HCRA 4R9HA 4QRRA 4CDHA 4HMDA 2A73B 4DJMA 1ZHLB 4AT6A 1KJ2A 1C08B 4XXCC 3MRLA 4OCLC 4FQCH 3QCVL 3OAYH 1RIVH 5KS9F 1F6AB 3MRGB 4DKAA 4HIXL 1B0RA 4PJ7F 3ZKNC 1AO7E 2PKDA 4U1NA 5IBUB 4AMKL 2VDRH 2J6EA 3QG6A 1FL3A 1IM9D 3PDOA 4TUJA 4RISH 2OL3A 3W39A 1F97A 2UVEA 3QHZH 3FZUC 3BWAA 5E2TH 1RJLB 5EO1A 4HS3A 4LLWA 5C0RL 3RY6C 4JG0H 5FM4A 4GMSH 3NIGF 3LKSB 5KVGH 3OX8B 2DMBA 4MS8D 1IC5L 4NKIH 1BF2A 4YXHH 3GMMA 3VXRD 4XCFH 4K94H 1T04B 3PHQA 2P1YA 2NQCA 2GTWB 3QG7H 5MERB 3ROLA 1KXTB 3FB6B 3TYGH 1RFDH 4JM2F 3V8CA 4ZXBA 5EUOB 1F42A 3WLWC 1KTLB 5A3ID 5IQ9B 3MJ9A 1DSFL 1TITA 3IVKA 4JPIA 3KR3L 1FBIH 5IG7A 2ADIA 3WDIA 2ADGB 4L8SA 2CLZB 5FUZL 5KSAB 2B4CC 2NY4D 4FQXD 4QYOA 1A6ZA 1BD2A 3WO4B 4JZNA 5ANMB 5D5ME 1CGTA 5DVMA 4R4FH 3VFOB 3KJ6H 1OY3B 1I1AB 2FX8L 5HPMB 5MEQB 5I75C 3PQYA 2BSTA 4N1EA 4OM1L 5ICXB 2OZ4H 1BECA 3CPLA 5KS9A 2W0FA 3W9EA 1HKLL 1YECL 3BQUD 4LVHC 4TSBH 4X4ME 4PJ7A 2J4WL 4HC1A 4PJAB 4KZDL 1T5XA 5DEZA 1XMWA 5GGTL 5DQDL 4BFIB 5DI8A 4O9HH 3EJZC 3DVGB 2VLKE 1A2YB 1WUNT 2GUOB 3LEXB 1AXTL 1B9ZA 1HWHB 1MCNA 3O2DH 4X4YB 5CEYA 3SKMB 15C8H 3O11B 1AGEA 2F8OA 2HT2D 3TO4D 2YPVH 4XBEH 4Z7UF 2DLIA 2HG5B 3MOQA 4HFWA 3OKMA 1P7KB 1XGRB 1HILB 4GRLC 1FVDA 1CE1H 4G9FA 1L7IL 5GS0C 4TNWF 5BRZB 1EFXB 4JM2A 4OZGA 2XN9E 4L4TB 1V7NH 3IKCA 4NDMB 4HUVB 3QISA 3CCHB 4OCWH 3UTQB 3CFDB 3D39A 1DQML 1MREL 3IDIB 3ZE0E 1S7SB 1FG2A 2GCYB 4M1DH 3GDBA 3P0VH 4NN6C 1E4KC 3FFDB 5D9SB 4X7SH 1A64A 1U8QA 3E2HC 1F6LL 1J1PL 4IOIA 5DWUL 3NZ8A 4AIZB 2CDFB 2PTVA 4W6XB 5E4EC 2HLFC 4XPGL 5IFHH 3LDBB 3P4MB 4RGNC 1UZ8A 3OB8A 3S35L 3T0XA 1AO7B 4UB0L 1QLRA 2AJUH 3FHQA 4KK5C 5E9DE 1J8HD 4J6RL 2NR6D 3DUSA 1CR9H 3MUHL 2PYED 4KJYA 1E4WH 4JHZA 4G80A 2R8SL 4KI5C 1XGYL 1N6QH 2X4SA 1SQ2N 4N8CL 3ZYIA 5IEKB 4UTBL 1TVDA 4I9WD 4RGOL 5EZLB 2F53D 5HGDA 1X5KA 5GGRY 4F57H 4Z7UA 5JUEH 2X4RA 5KVMC 3MBEC 3WIHL 3C5SB 3JUZA 1KGCE 1NUFA 3FOLA 1AGBB 3C8DA 1YMHB 5C07A 5I30L 1CLYL 1XF4B 1LO2L 2A9NL 1KPUA 2C3GA 5GJTH 2CSPA 1X5AA 2CQVA 1OAYL 3EYOA 3D3VE 1NUGA 4M4PA 3V7AG 4JQXA 5FYLE 3MV8D 1OLZA 1YNTA 5MP6H 4AM0B 4NCDA 4OZFH 4XVUD 5DVOA 1T83A 4HGWB 1MLCA 1R3HA 1FFOB 2OR7A 4TTDC 3O9WB 5B8CA 2EYTA 5ACMA 3UTTB 4C55A 4OJFH 1QSFB 3K80A 5EU5B 1KJMA 1CFNB 2IADB 2OR8A 3NH7H 5BZWB 5T3ZE 3H2WA 4HX1B 5KW9L 1SJEA 5C08E 1G9NL 1CLOH 3WXWH 4L3CB 1MNUL 4XCCL 2LE9A 4ELMA 3Q48A 4H8WC 3EFDL 7FABL 4UV4H 2FSEA 4OCSH 1G7QB 5C6TH 2VLKB 3QUZA 2YPLD 3UJJH 3GKWL 1MWAL 4BQCA 1SYSB 3ALPA 2CIKB 2Y36L 3QNXA 5C0DA 1KCUH 3BPCB 3WD5L 4O2EA 3UXFA 1A5FH 3HZVB 3NFSL 5IEHA 3QB7C 3QIBA 4MWFA 2DWDA 4M7LH 5EOCJ 3MLTA 6FABL 3U9PL 2N4IA 3PWJA 2VDPH 2XN9B 1IGFL 3O0RH 3MOBL 2A9ML 3FO2A 3WS6C 2I9LB 5BJTB 3GSXB 3N9GL 5BQ7B 1W2KT 2DQEH 3N1QC 3N85L 4KKBD 2X4QA 3DO7A 3C9NB 3W0WA 4ODVH 4KUCD 2I25N 1L9NA 1K8IB 5DJCA 5IUSA 2BSED 4WFHD 1NGQL 1T5WA 3L3HB 4D2NA 2PETA 3D87B 4LNRA 1CXEA 4OQTL 3CDFA 3SE4A 3GSNB 1X5GA 3ZKXB 3FRUA 4HIEB 5D7SL 3WN5A 3CFBB 2BNRA 3OKNB 4F37K 5IB3A 1R5WA 5JTWA 5GGVL 5E9DB 1OP5H 4WV1B 1S7QA 5KVFH 5GRUL 1TZHA 2NY2C 4IRJC 2H32B 3PJSB 1RMFH 4XPBL 5KSVA 1ZA3A 3HC0A 1NAML 5J13C 1RU9H 3J7HA 4WUUB 2ZUQB 5JOEA 1TJGL 1H3XA 2Y06L 3QI9C 3TA3C 4HUMB 3NN8B 4F9PC 3F7VA 1KIQB 4EVNB 1TVBB 2ITDB 3K4ZA 4I3RL 1QNZL 1UZ6F 3VI4F 3F8UB 4P9HL 1IAOA 4XBGA 3MRBA 1XH3A 5EBWA 1DBAH 5I1DA 3OXSB 2BRRL 2O61B 5C9JB 5KTEH 5EUOF 1LEIA 4OGYL 1R3KB 2V6HA 4MCYA 5T5FL 3VWJB 5FB8B 3U30B 2PR4H 2C5DC 5F7HA 1HYSC 3D3VB 4G7YH 3CXHK 4KK9D 2FZ3B 5HHQB 3BDYL 5DR5H 1WQVT 3ZTNL 1RJZB 4YHNA 4HIJB 1VADB 3BH9A 3QQ3B 5FGSA 3L3KB 4MVBD 1JHTB 4R8WL 1EGJL 4X5WA 1ZGLA 2R2EB 4M8VA 1I9RL 1NANH 3V4UL 2R0KH 1DBJH 1HHIB 2GK2A 3BZDA 2F8XC 3HMXL 3O3AB 4QHLB 1WFUA 2G5RA 1F6AA 4ZS6C 3MRGA 3QEHA 4HXBL 4Z18A 3H7BA 3L3JB 2HJLB 3O8XB 4KTEL 4PY7B 4PJAF 1H3UA 2AGJL 4XNXL 1JZ4A 4Y8DC 2ARJA 3K81A 3FAXA 4FQJH 3TF7C 5GZOD 3IJYA 3VRLE 4HZLA 2HTKD 1OD7A 3RNKB 5ICYB 4KKCD 2OP4L 5E94B 4NRXA 3QNZA 3PGFL 5L2KE 5JDJA 1RJLA 4YGAB 5IVNA 4YFLI 3QIUC 2IBZX 4QHKI 1HCVA 4J3UA 5I18L 3LKSA 3OX8A 2FRGP 4U7KA 3AS0A 4PLOB 1UB5B 3MNWB 1T04A 1FE8H 3RIFF 2ICWI 2GTWA 3H7LA 4XP9H 4P2OB 3FB6A 3TVMC 4NO3B 3ULVL 5F21B 5EUOA 1KTLA 1V05A 5IQ9A 1DR9A 5HYJD 5C1MB 3RWEB 1WWBX 1AGDA 4WFGE 5KSAA 3OGOE 4JFDD 3CFEB 4NN5B 5ANMA 4M02A 3QRFM 4U05A 4XNYL 1RUKL 2VOTA 4OLVH 5MEQA 4LLUB 5HPMA 4HKZB 2EO1A 4NQTA 4WEMB 2DYPD 3FQRA 2QR0B 4UBDC 1IKNA 4GXUM 5LQBL 3BKMH 3MRHA 3QCUL 4X6EA 1Q38A 1OM3H 3T65A 3GIVB 3CDYA 5C0AD 4OLWH 1UM4H 4WU7B 4MA7H 1CXHA 5IBUG 4BFIA 4DN4L 1JYNA 2EE2A 3BN9C 3BW9B 4GW5A 1A6VH 4Y4HD 2ORBL 4YK4B 1A2YA 3HCVB 4U1GB 2V9RA 5D1ZD 2M2DA 4R26L 4NKDA 2GUOA 3LEXA 3IXTA 1A7NL 3WFCH 1W72H 1IGJB 3K2UH 3LOWA 2JJUA 2APWA 5JDSB 1OT1A 3SKMA 3O11A 5E6IB 2X4NB 3UTPE 5HJ3B 2NY3B 1CD0A 5I8OH 1QRKA 5JNYB 2HG5A 1U9KA 2HFGL 5B38B 2AERT 1XGRA 1HILA 4QXTB 1AHWB 4MZ3A 4K71C 3PIQB 2J88H 2XNAB 3W82A 1EFXA 5DJ8B 2DN7A 4EEEA 4IJ3B 3P9MA 4L4TA 2Q1EA 2V7NA 3JTTB 3MC0A 4L9DA 4HJ0D 4KGJA 4HUVA 1TNMA 5FOBB 3WFHB 1NBVL 4Z8FH 3CFDA 3IDIA 1T4KB 4DKEH 1S7SA 2XRAH 5I1IH 3QDMD 3MACH 5TJWK 3VFPB 4J4PA 4CU7A 3EO1B 4YLQT 3EYUL 4JFEB 3FFDA 5D9SA 4F58H 1GHFL 2J8UE 5HD8C 3FFCE 4F7PB 2ZG3A 1WISA 4AIZA 4GXVL 4N0CD 1E6OL 1NEZB 4CGTA 2CDFA 4L9LA 2Q76B 3VGGA 4NCC2 4MJ5B 4M7ZB 1PDKA 3P4MA 3E3QC 3T2PA 5IWLA 3N1MC 4TRPH 4JRWA 1JN6B 1AO7A 1WVZA 3AROA 4P2CG 1S9XB 2EE3A 3WLBB 4OD2B 3DYPA 4MXQC 4LSVL 2LVEA 3RWCB 1A9BA 2J6EH 4HF5H 4KI1A 5E5MB 1J5OL 5IEKA 3N50A 2OL3H 3BRDA 1PD6A 2Y6SC 3ULUL 1JZ5A 5EZLA 4BFBD 3QP3A 5IB1B 3AVEA 4M7JL 3FMGL 3IB4A 3F65A 5DZOA 1ZLVK 5H2BB 3G6AB 1F4XL 4GAJH 4BZ2L 1IQWL 3C5SA 4JKKA 4P23C 1P9MC 1KN2H 1X4YA 1YMHA 4LL9A 4HT1L 4KDWA 3HFML 2DQHL 2FDBP 2XICA 1AE6L 4JPWH 2WNGA 4QWWC 4TVSa 3S88H 1LEKB 3MJ9H 5AWNH 2OK0L 1N4XL 3DHJA 4AM0A 2NZIA 5D5MA 1FFOA 5BS0B 2NYYC 4NYLB 3S5LB 2D7MA 3O9WA 4G43A 1N64L 4EI6B 5DD5L 3U83A 1QSFA 3EOBB 5EU5A 2IADA 1A0QL 2BY1A 5FGBC 2VXVL 4HX1A 1MUJB 1U58B 1VEOA 3MZTA 1P4IH 4K8RD 4X4MA 5MI0C 1UM5H 1C8PA 1AI1H 2HAZA 3JZ7A 1WT5A 3PUCA 2AV7B 2P43B 4G9DB 4HC1H 1TMCB 4PIRF 1G7QA 2VLKA 1SY6L 4ACPA 3HE6B 1U8JB 1SYSA 1IC7H 2CIKA 4GSDH 4G6ML 2DD8H 1A7PH 4N1HB 3BPCA 5B21A 2P5WE 3PP3K 3CVHL 1YQVL 2WUCH 3HZVA 1TZGL 4LF3A 1ZTXH 2FIKB 1EH9A 2BVYA 3WBDA 5I8KL 3KJ4B 4X9GA 1N3NA 2DQGL 5FA3B 2FD6L 5JIHA 1AD9B 3I3EA 1PLGH 2E7BA 3RVUC 3U82B 2VDNL 5D6CB 2X4PB 5DRXB 4UZGA 1SEQH 2ZJSL 2XN9A 2W0PA 4J1UB 2I9LA 5GS3A 4U1SB 3GSXA 2YD2A 1ZHBB 5BQ7A 2MTPA 1IEBB 5DF0A 4EN3D 5DYOB 4XVTL 3FB7A 3FQXB 3C9NA 5GRZA 1PQZB 3CLFH 2EE9A 1K8IA 4XC3L 4F33B 2J8UB 4EBQH 3FFCB 1NMBL 3O6MH 4HUWB 3LKPA 1B90A 3L3HA 1JZ7A 4PJBE 3LN5A 2P47B 3GM0A 4CMHB 5HPOA 3OBAA 3GSNA 3IU4H 4OGAC 5IESL 2IALB 3WKNA 4HIEA 5EORL 2W60B 1QHPA 3REWA 3CFBA 1UWXK 3OKNA 3G08B 1KXVC 5C92A 5EFIB 5E9DA 4NFDA 4WV1A 4HXAL 2BY3A 3OTTA 1DANT 4YHOL 4NJAL 5D7JD 3H9HA 2G9HA 2H32A 3PJSA 1YEFH 4Y2OA 3O2VL 4XHQA 2XZAH 3GUTB 2BCKB 4LSQL 4KKAC 5HYEA 1CZ8L 2QTEA 3MBXH 5L9DH 4Y16D 3GSWB 1MWAB 5D1XA 1BFOB 2XWBB 3CK0L 4JQIL 1KIQA 1RZKH 4EVNA 5HHXH 1SBSH 2IMMA 4PJ8C 2ITDA 1QZ1A 5J12B 1U91B 4HFUH 5E2VH 3X3GH 3OXSA 5H35A 2Y5TA 4F8TA 2O61A 5C9JA 5ID1A 4FXKB 4Y88A 4Y2DC 2UWEE 1ACZA 4JPVL 1R3KA 4LHJB 5FB8A 4OSUL 1MQKL 3D3VA 2JJSC 2APFA 5HHQA 2FZ3A 5DD0L 4U1LB 4KRPB 5FYJD 5I74B 1JCKA 4FP8H 2EDXA 3RNQA 1N5AB 4K23H 3QQ3A 3A6BH 4ZAKB 3L3KA 4MAYA 1JHTA 5L6YH 4F7MB 3U4AA 2A6IB 2R2EA 1ZKAA 5J11C 3GGWB 3UTSD 3LD8C 3O45A 1T3FB 4WDIA 1VACB 1HHIA 5I6XC 5D7KD 1IC1A 3QIWB 4MJ6B 4QTIL 3IU3B 3O3AA 1N2RB 2YMXL 2B5IB 3QEQD 4QHLA 4ZPVB 2MJWA 3RTQC 2XQBH 1TVHB 1VB9A 3L3JA 5CJOL 5JOPD 2VL5B 1T89A 3O8XA 5C08A 4PY7A 4OBRA 5D2NE 1EO5A 4HK3N 4AQOA 5DS8B 2YUZA 1NCTA 2DKSA 1KT2A 1NGPH 4ONOA 1EZVY 4FXGB 3KDMB 3SQOH 4OFYD 2VXUL 4CVUA 5GRWA 1IGML 1NUNB 4U2ZA 5CCKL 3RNKA 5ICYA 3VD5A 5E94A 2P5WB 2DQJH 1V3MA 5GHWL 3MUZ1 1FYTE 1NAMB 3BDXA 3VMNA 2I60L 5DQ9B 4PREB 2NY1B 1ZGLM 4DUWA 1IT9L 4QXUH 3MNWA 4FTVD 4Z78A 5LWYL 4P2OA 3TBTB 4NO3A 3RL1A 2FGZA 1F90H 1ZEAL 2A1WH 1M05B 1NSNH 1H8SA 2EEBA 3RWEA 2O93L 1KB9K 2FWOB 5FF6B 3TNNA 5BV7H 4YC2B 1NC2D 5TPWL 1M4KA 1YMME 1NKOA 2AJSL 4MNHB 3CFEA 3GSOA 4TSAL 5D2LE 4OZIE 3B6SA 3U36B 2FGWH 1NL0L 2AJVH 4PG2C 1RZ8B 2VQUA 3VXQB 1FO0A 4JG1H 2CMRL 3SKJH 4HKZA 3ISWA 1MJUH 3HR6A 2HVKB 4FQQB 35C8L 4QRTB 4KMLB 3QQNA 3DX6B 1G6RA 3GIVA 4WU7A 1SMOA 3GJFA 1CK0H 3BW9A 5H37G 3NCJH 3EO0B 3SHSA 3GI9H 1T6VN 3KGRA 3HCVA 4OV6F 2GITB 3VRLF 1IGJA 2B7DT 4I5BB 5JDSA 2DM7A 2LVCA 4MA8L 4CNIB 3ARDA 3O4OB 3BI9X 3NACL 3QDJD 4KTDL 5HJ3A 3LKRB 2B20A 5MENE 4XNQB 5JNYA 5K9JH 1EAPB 4NHCH 4QRQA 4WUKH 4JY4B 5GPRA 5I76B 2HKHH 5B38A 1P7QB 3EJYD 1F45A 1MHHA 4FRWA 2ZNXA 3HB3D 1AFVL 1OPGH 3PIQA 2XNAA 3WFDH 4N9OB 3OG6B 1JPSH 1G1CA 5DJ8A 3TZVC 1NFKA 1HHHB 2UWEB 1JGLH 3JTTA 1XR8B 4M5YL 2D7PA 1H3GA 3OG4B 1XEDA 3MGTA 3WFHA 3K0WA 5CS7A 4U6YB 1T4KA 1YYLH 2YD9A 4PJDB 3VFRB 1XIWB 4U1MB 3IS0X 4PJCE 3VFPA 5DHYB 2AXHA 4G6JH 4ORGB 1BFSA 3MFGB 1TPXB 3D9AH 4JFEA 3HI5H 2A6DB 4PGBA 4LOUD 4F7PA 3L5HA 1T7YA 5EU4B 1QPXA 1NEZA 3UX9B 3MYJB 3FT2B 3VGAB 3IDMB 4NKMB 3NA9L 2YWYA 3HE7A 4Z0XB 1BQLL 4OB5H 4UI2A 5T33L 1T20B 4YO0B 3T09A 5EUKB 3WLBA 4OD2A 2W07A 5HI4C 1G0XA 4TN9A 4DGVL 2I26N 4PY8J 3RWCA 1CD1A 2D31B 5E5MA 4OCRL 2WK2A 3CUPA 5L88H 4UNVA 5L2KA 1U8LB 2LQRA 1EHNA 4JFZH 4DZ8B 3BZ4B 3PWVB 5H2BA 3OKKB 3G6AA 4XNUL 5B38G 3DUUB 2AABL 4RMVA 3TH2T 4ZOAA 3LEVH 2DLGA 2FLBT 4U6VL 2R2BB 3ORJA 1LEKA 4IS6B 2F8VA 1ND0B 3PWPD 1FSKC 2Z0BA 1YMMB 4XP5H 4M48L 2XPGB 5D2LB 4JJHA 3IGAB 2XZQL 4QOKD 3MA9H 2J8UF 4NYLA 5IFAH 3DJ9A 5IBLD 4EI6A 1J8HE 4HJGA 1F8TL 2PYEE 3EOBA 1ORQB 1NEZG 3AS1A 4BK5A 3S36H 4NPYA 3MRDB 1MUJA 1YDPB 2A74B 1S7WB 1R3IH 2AV7A 3BPNB 2GJ6D 4I9WE 4JZJC 1U95B 4G9DA 1QHOA 2F53E 4U33A 2XZCL 4YDLC 4ZODA 4Y4FB 3HE6A 1UT9A 2R23B 4P4KD 3TPUA 3CZJA 5E2UH 2Z8VC 4M1CD 5I1HL 2FO1A 1HDMB 3E8UH 2OJZH 4LAQL 4BJLA 3FO0L 4LFHG 2NLJA 1B2WL 3GMLB 5MENB 1F2QA 2APBA 4ZMAT 4YBLC 1G7IB 3NABH 5FA3A 4APQD 1AR1C 5JPMB 3K1DA 2AJ3B 5D6CA 1EO8H 2X4PA 2AXGB 5HHVH 3OAUL 1Q72L 4LEOA 4MNGB 3LS4L 1DUZB 4J1UA 2HKFL 1DVFC 2B1HH 3T3PE 2E6PA 1IEBA 4L29B 2HWZL 5JW3H 3IFLL 1WZLA 3FQXA 5FIEA 4PJCB 1PQZA 3GMNB 4PLJD 1QSVA 2OTWB 4F33A 2J8UA 3IRZA 3FFCA 4OD3H 4JREC 2GFBB 1GGBL 5DXWA 3WSQL 2DQIL 1XF1A 1ZANH 2YPLE 3OF6A 2W60A 2FH6A 5FECB 3G08A 4LPXA 4JJ5A 1YY8A 5EFIA 3TO2B 1M7XA 3ARFB 1CD9B 3SCMB 2FR4B 3MRPB 4JFYA 5D70H 5F7MC 4OT1H 1OW0A 5M95B 1HHKB 2DDQL 4L3AA 3GUTA 3VRIB 1BEYH 1EBPA 1BJMA 2ZPKH 4XHJC 3KYKH 3V79C 1V7MH 1MWAA 1AXIB 1MJ8H 1BFOA 4MJ4A 4UT7H 1MIML 4R4NC 4FNLH 4XTRC 1NGYA 4WI3A 1U91A 5IJKC 3CVHB 3IF1B 2VLLB 2PXYD 2R4SL 4FXKA 4WFHE 3SDDC 4AY0A 1JJUA 1JTPA 3DMMC 5F97E 3IRPX 4TOYH 4ZAKA 1LILA 4IOFC 5CD3B 5C09D 3GGWA 1JUFA 1T3FA 5CJBA 5D1QD 4O5LH 1VACA 4ZSOB 4JN1L 1J8HB 4LDOB 4MJ6A 1EEUA 3IU3A 1N2RA 4ZPVA 4YUEH 5BOZG 3QWOB 1P1ZA 2RGSA 2AK1H 1TVHA 1RULH 4UQ2B 2YD7A 4ODSH 1Z9SA 4PGEB 3RL2B 4TULL 4UAOC 4OQTA 4F7TA 1CF8H 2X5PA 1YEKH 2XACC 3QR2A 5HVHC 5DS8A 1LK2A 4ZOBA 1D9KC 3VA6A 2F53B 3ZT7A 2Z31A 3TN0C 4FXGA 3KDMA 4HKJB 3S3JA 1UWGL 1HOCB 1D3CA 1UXSA 4XI5C 5DJXB 4NZDA 4QRPD 3PGDA 1JGEA 2P5WA 1T2QL 3DYOA 5IGXL 4O02L 3BH8A 1RUAH 3D0VB 3KG5A 1P6FA 3I50H 3M17A 5E8OB 2ZKHL 4FQLH 1EERB 4PREA 4ZO9A 4TVPL 2AEPH 3C09B 3DXAE 4HLJA 1X9QA 2V5YA 1NBZA 3TBTA 2UWEF 3UDWA 5GS2H 1MFNA 3UAJD 3SDAD 2YRLA 1M05A 2EIZB 2PTTB 1IAMA 1VFUA 4PJDF 4WWKD 3RFZC 1FH5L 4MNHA 4MYWB 2JB5H 3U36A 3OZ9L 3B9AA 3BP7A 3QUXB 1RZ8A 3C60D 3WE6B 5HI3D 3CNKA 3AREA 1I3RB 1TETL 3HS0B 4FA8A 3V5KB 1AY1L 1KELH 1Q9OB 4S1DD 5DJDB 2WWKT 2HVKA 5IHUL 2WBWB 4FQQA 3GSNH 2WMPA 2IQ9L 1MIEL 3DX6A 5F9WB 4Z76B 4Q0XL 2DQFB 2PTUA 4WI5A 4GG8B 2NZ9C 3MPCA 4G6FD 2G5BB 4H26B 2X41A 4WEUD 4LU5H 1B4RA 3KYMB 5KSUB 2H2PC 3OWEA 4X98B 2BERA 2VQTA 5IB2B 4LDEB 3QWRD 4JDVB 4CNIA 2EXYC 1YY9C 3GBNH 1WF5A 4AEFA 3LKRA 4XMPL 4XNQA 3X12B 1EAPA 1AC6A 4P5TD 5I76A 4JY4A 4LCUB 1P7QA 2XWJB 1NMAH 5I1LA 2CR6A 2WBJB 3T3MF 3ECBB 1I9IL 4PJ5E 4FZEL 1T0MB 2R0ZH 3ARSA 1MI5B 4OLXH 4YIQB 1HHHA 2UWEA 1B4JL 1AIFB 1XR8A 3GHEH 4MHHG 1MHEB 4NP4H 3UMTA 1CIUA 2EO9A 3QT2A 4U6YA 2CLVB 3VFRA 1XIWA 3GSVB 4U1MA 3HA0A 1FNHA 5D2LF 4P59H 2FEDD 4ORGA 5FYJU 3AAZA 2A6DA 1X5LA 1BFVH 4CMMB 5EU4A 5C0AE 1NH6A 2ADFH 2BHUA 3F7YB 4PRHB 2ZCKL 4JLRB 3QFJE 3KPMB 3MYJA 3FT2A 1VKXA 2YRZA 5C3LD 2D0HA 1GOHA 1BGXL 3IDMA 4NKMA 2JIXD 1PSKH 1L6ZA 4GAGH 4LSRH 5T3ZH 5D2NA 3VXSD 5EBMB 1T20A 4YO0A 2QKIB 3GMOB 1TXKA 1SYVB 1YN6B 5H37H 4Q9CA 3MRRB 1QVOB 1XCTB 3NIDE 1BM3L 4JFFD 1W0VB 3G6JE 3NCEB 3T0EC 3QFDB 5DRNB 5IP4A 2D31A 2JLLA 3MA7B 5DT1L 1G6VK 3OAYK 5E95B 4FZ8H 4P2RB 2ZNWA 1N6VA 1U8LA 2V5MA 5DLML 4NZJA 1FVCB 4DZ8A 3BZ4A 1WIPA 3PWVA 3OKKA 4U0RB 3GSUA 1FYTA 1KCRL 3ULUF 2YOCA 3DUUA 2IC2A 4X5XB 1VGEL 4IRSC 3QDME 1MJ7L 2IGFH 3DXAB 1BVKB 1GAFH 2C4FT 2R2BA 2UZIL 4AL8L 2IEPA 5AZEL 5TDPB 3VXPB 1VEMA 4IS6A 1ND0A 4O58H 4OZIA 1YMMA 4PJCF 5CKAA 2XPGA 4IM8A 5D2LA 5CSZA 4N0FB 1KACB 5DGRA 3IYLW 4RDQF 1FO0H 8CGTA 3DYMA 3NCMA 1ORQA 3P2TA 3PWUB 4TNVK 3MRDA 1R5VB 2A74A 1IM9A 3VFGL 1F02I 1S7WA 4OZ4B 4YBQC 3VFWB 2QQLL 4NO5B 3CFJB 2NY7H 5JHDB 3VW3L 1G6RH 4RFOL 4WTXA 1U95A 3O6FB 3GJFH 4Y4FA 5IK3A 2R23A 5IMLB 3GMPA 4HIXH 1KBGL 4IRZL 3FHAA 3QUKB 2EZ0C 4RWYL 1HDMA 3RWHB 1F4YL 4QGYA 2GSIB 4RQQB 1CCZA 5ADPL 5GISL 3MR9B 4ZYKB 2OYPA 4KVNL 5LXGL 2CK0H 3BEWB 5B3JE 1ADQH 5MENA 3UC0L 3BIKA 1I8LA 1YJDH 4E5XB 3VFMB 4LSUH 3DI3B 3FTGA 3O6KH 5JXED 3IDYC 2OS7A 1P4LB 4X9BA 5JPMA 4NQVA 2K1MA 2XOTA 4GJTB 4PJ5B 1E6JL 2AXGA 1U8MA 4K3GA 4UT9H 4Y5VB 4MNGA 3HNSL 4BFEA 4ZUSA 4NSKB 1DUZA 1QSZA 1PX4A 2IAND 4QRRD 4BQBA 3A0OA 3KAAA 2MQ0A 3RWFA 2ZSWB 1CLCA 2CXKA 2DBLL 2WZPD 1BWMA 3CGTA 3RKDD 4EDWH 4PJCA 2OTWA 2AI0H 5C0AB 2GFBA 3H9YA 2SEBB 3QFJB 2EIEA 4OTXL 3HI1A 4KHXL 3SE9H 3DRTB 1N7ML 3TH3T 4RCAA 3BRGC 5KOVC 4AIXA 5FECA 1A6PA 5T1MA 1U3HB 2FX8H 3TO2A 1EHLH 2BK8A 3SCMA 3MRPA 3HAEH 2MHAB 4BQ9A 4LNVA 2QADC 2X1WL 3BHBB 5BW7A 2VJXA 3G6JB 3KLAB 2X09A 1HHKA 3H3PL 4QNPF 4ZO6A 4OD1L 2XTJD 5L0QC 1NCAL 1I8MB 1N26A 4ZXBC 4IIQB 2D2OA 1DTUA 1C7TA 3QEUB 1BPVA 3SE8L 5HHNA 1AXTH 4KQ4L 4NZUH 3CVHA 1KCSL 4N0YL 5LCVL 3IF1A 2VLLA 1DLFH 5ACLA 4HD9A 3QPQD 1KENH 4PLNC 5DJ0B 4YDVB 3QDMB 1EO7A 4Z6AT 3ILQD 1BD2D 2LABA 4Z7QE 2UV3A 1JMXA 3QCTL 1FFPB 1A7OL 1L7IH 4KXZH 2HTLC 4F2MB 5KANG 5F8RC 1KIPA 3V0AC 3PQYD 4XVSH 3AY4C 3ZKMD 5CD3A 4WJ5B 5E8DH 3ETBF 2EH8L 4RDQG 1R5IB 1J8HA 1DQMH 1RK1B 3EOTL 5C0FB 1WZ1L 2PYEA 3QIUD 3QWOA 4CUCA 4ZUVB 1JGVL 5GZND 1ITBB 4UQ2A 5I1KL 1X3DA 3RL2A 4PGEA 5TH2B 4NJ9L 3BE1H 3WXVL 5SWQB 2F53A 4HBQA 4PD4K 4ONFH 5I8EB 2UUDH 4HKJA 3S35H 3KHQA 3RI5F 5J6HB 1GC1C 3ZDZF 5K9OB 3STBA 1J8KA 4NQDD 3FKUS 1LHZA 4UB0H 3BOVA 3FCTB 5D93B 5DJXA 2V17L 4PG9A 4QHKJ 2DTML 4JM2C 4X7DC 1GYAA 3MO1B 4HUUB 1RZIB 3MTRA 2B39A 2BVOB 4N8CH 4F3FB 4XBPA 2ICWJ 3NPSC 4WEBL 5E8OA 5GS1B 1B88A 5FYJE 4RGOH 1MAML 2KZ1B 5C86A 2R1XB 4JVPA 4NBYB 3ARGB 3RVXD 3UTSE 3LH2L 5F7FA 4XPAL 1KV3A 2PTTA 3P4OB 3V6OC 1AGCB 5D7KE 5FKAB 3RWGB 1RIUL 1FRGL 3QEQE 4JFHD 2DMKA 2J3SA 4M43L 3ARUA 3QUXA 1MSPA 3WE6A 4DQOL 2BP3A 3V4VL 5DMGD 4ERSL 3HS0A 4GXUN 3V5KA 4Y5YB 5AG9A 1YUHB 5DJDA 4Q9RL 3T0AA 1IZKA 2YPLA 2CIIB 1MAKA 3L3OB 1RUMH 4Z76A 1MVFA 2DQFA 5LG1A 1HI6B 2R69H 1RZKC 4GG8A 3NMEA 5D71L 1KB5A 4QT5B 4H26A 1YNKH 5F96L 3VMPA 5DJYB 5KSUA 4AIOA 5CJXA 5KW9H 3UYRH 2X10A 4EI5C 4X98A 1IGTB 4GS7B 5IB2A 3WNMA 4JDVA 2VXSL 4FTVE 1J0YA 1QG3A 3X12A 4FFVD 4LCYB 4KDTA 4R2GC 5C07D 4LCUA 4JQXC 2XWJA 1OP5K 2WBJA 1YEIL 3ECBA 1T0MA 4G42B 4YIQA 4LGSB 4IDLA 5B8CC 4W4OC 1MHEA 4O2FB 1FYHB 5EU6B 4XZUB 3FB5B 4NC0B 4X80H 3AM8A 5IQ7L 4OI8A 1F4WL 6FABH 5EOCH 4JO4L 5EOTB 1F3DJ 5ID0B 2MNUA 2XY1A 4CW1B 4CMMA 1CIDA 4WY7H 3BGFC 3F7YA 2B4CL 1UH4A 3N85H 4JLRA 4MXWL 3KPMA 1A3LL 2FATL 1LO0H 3D2UD 3MRNB 5A16A 3QUZD 3MRMB 3ES6A 4J2XA 3V5HB 5HXMA 4PTUB 3FRPA 3UJTL 5EBMA 3SO5A 5I1GH 3C5ZB 3F12B 5I1JL 2QKIA 3GMOA 1SYVA 1YN6A 4NNYB 2EDOA 2EICA 4Y16B 5IVXE 1F58L 3TWCL 3QFDA 5DRNA 2J5LC 1K85A 3MA7A 4ZTPL 4WO4D 5J0BA 1JTOA 4PS4L 1IEAA 3QHFH 2LTQB 1RUPL 4Z9KB 5FK9B 4X4XB 2DICA 4PLKC 1TQCB 1PG7W 5CMAA 2FX7H 2XIDA 5BV7C 1FVCA 4UDUB 3WIIL 1S7TA 3IDJA 3SDCC 4BSVB 2OMBA 4Z95H 3RY4A 1EEZB 2R2HA 1QLFB 4KPHL 4X5XA 4YE4H 4F15B 2NXZB 1K3IA 2GIYA 1U36A 3DXAA 3ZE1E 2JK5B 2Y06H 1BVKA 2H26B 4L5FL 4OUUB 1P5UA 5SWZB 3F58L 5E2JA 1JWMB 3U4EA 3B9DA 1OP3H 4F8QA 3UTSB 5LVEA 4I3RH 4JKPL 3SE4C 1HHJA 2A0LC 2V5TA 3IXAB 5ADOL 5FHBL 4ZTOL 5GS0L 3QEQB 4CDGC 2I5YL 1A14H 3ESVF 4YEFA 4N0FA 2BY0A 4P46D 3MRIA 5I73C 1G7MB 1X5YA 4HS8L 4JKLA 1CXFA 4NZRL 1DANU 3U7WL 2I07A 2FX9L 3HI6L 1PEZA 4Q9BA 1DDHB 3PWUA 5IMKA 1R5VA 3EW3B 4OZ4A 4QXGL 5DMJB 1BVLB 2EE6A 4XP1L 3CFJA 4MQXD 5GXBB 3FRPG 3DI2B 4XMKL 3ARBB 2WINB 4HJJL 3NIDF 4NWUL 4HXBH 5IMLA 3G6JF 3OL2A 4KTEH 4KXZI 2EKJA 3RWIB 4UNTA 4L8CB 2VDML 3RWHA 1X5ZA 3MYZA 4G8GB 2GSIA 4RQQA 2AGJH 1RAMA 2EECA 3MR9A 2YUVA 2ITCA 4OLYH 3T2NL 4I8DA 1UYWH 3A67H 3BEWA 1KCVH 5IJVB 4E5XA 4S0SD 3VFMA 4JFXB 1PW3A 2P8MA 1DUYA 4KVCH 3O4LD 1CFVL 2FH8A 1P4LA 3PWPE 4ZOEA 4M93B 5B4MC 3B3IB 4PJ5A 4ONGH 4LEXH 3MNVA 2CO7B 4NM8L 4XPHL 4BUGA 4QOKE 4Y5VA 1HH6B 4KROD 4I0PC 3P4LA 4XCNB 2OCFD 3KPSE 1X7QB 1IGIL 1S9WB 2ZSWA 5E8NB 2DYPA 5TE7H 4RMRA 5T1KB 4ZXBD 3TBVB 2NNAB 4YEEA 5C0AA 4ORZC 1B6DA 3QFJA 4RAHA 4QEGA 4NRZA 4Y4HA 5JPNB 3DRTA 1OTTD 4R0LC 1GGCL 1U3HA 4NN7B 3MLRH 3SKOB 2NW3B 4LQFH 3RVVC 4MNQE 3A6CH 4DVRL 2MHAA 4DVBA 1TQBC 5IVXB 3GI8L 1OQOA 4L1DA 4L3ED 4BFGA 1G9MH 2YA2A 3G6JA 3KLAA 3S37H 4H8WL 3VG9C 2CDEB 4DN4H 1I8MA 5GGSA 4AJ0A 4L8BA 1ZT4B 4R26H 3MLUL 3K46A 5DO2C 3LMJH 5B3JF 3ZSSA 4LSPH 3BWUC 4JN2B 3BPOB 5IMOB 1D5IH 5TE4L 1A6AB 1MAJA 5AAMA 5IOPB 5KSAD 2VDQH 1P4BL 3QDMA 1KFAL 3OPZH 3SGKC 3ARXA 3T77B 3TFKD 5CP7B 3L1OL 1FFPA 2CGRH 1I1CA 1I1AD 1U8KB 4YDJB 4GW4B 5EN2B 5GGVY 1VERA 3SGEH 3KYOA 4KWUA 3OAZH 3LS5L 1AH1A 3LKQB 4HQQH 1NBVH 3ILPB 2ZCHH 1RK1A 5AYUL 1DL7L 1IAKB 3QZWB 1Z3GH 5TF1H 5A40E 4XPTL 4EUPB 5C71A 1MFCL 4U7SA 5TH2A 4KJQC 1J1XH 4MCZB 1ZT1B 2EDBA 4NBZB 4TUKL 4UIMA 1E6OH 4MGXA 3G9VA 4TSCH 5E8EB 2ENYA 3W81A 4YHIB 5I8EA 1IZJA 3ZE2F 1IJ9A 5K9OA 4IMKC 5J6HA 2EH7H 3FCTA 1KLUA 4ODHL 3JVGC 4JHAL 1FPTL 1DFBL 3RGVB 4LSVH 4K3EH 3MO1A 4HUUA 4C57C 4KY1H 2XKNB 3ZZ1A 5BRZD 1EFXD 2BVOA 3MGOB 4Z0BL 1HHGB 4L4TD 5GS1A 4JHWH 4J4PC 2FBJL 3PWPB 4OUOA 1TCRB 2R1XA 2A77H 3V0WH 3FMGH 1D6EA 1FNEB 5DVKA 5C09E 3I75B 4QOKB 1CFBA 2ZOKB 3UCRA 4L9LC 3P4OA 1IQWH 4I4WB 5FKAA 3KPSB 2DAVA 3DV6B 5IWLC 3HFMH 4LRIC 2NCMA 4WRLA 3BVNA 1A6WL 1INDH 1JNLH 1LP9E 1NLDL 3VFNB 1AO7D 4QY8A 4UV7H 1YN7B 4LVNB 2C3VB 4HG4K 5T3XL 4OGXL 2M26A 1GZPA 3L3OA 1BBJB 2AAVA 2MCG1 2OTPA 1S5IL 3NGBC 2BDNL 2X2YA 1HI6A 4QRPE 1JHKH 1JNHB 4MNQB 3LN4B 4DFIA 5DQJB 3Q5YA 1I9JH 2H2SC 4MHHI 1CICB 1X44A 1HINL 1MRDL 5DJYA 1IGTA 2C1OA 2WWMC 1EFQA 3EDFA 1WIUA 3VD4A 1DE4B 4YQXH 1FLRL 1CBVH 1DQTA 2GKIA 3VFTA 3LIZL 3IS1X 3MLZL 3KXFD 4WCYL 1QFWH 4JAMB 3R1GH 3QDAA 5F93C 4EN3A 3CVHH 3G04B 4ODTH 1UWEH 1ZWIB 4G42A 2VDKL 1NCBH 3QWQB 4DW2H 2XG5A 1A3RH 4O4YH 3DO3A 5I8KH 3I2CL 1FDLL 2DQGH 4XZUA 5HDQH 3FOMB 4WENB 1VPOL 3O9WD 4NQSB 1KOAA 5EOTA 5ID0A 2VDNH 3UTTD 1QSFD 4ZFFB 2XXMB 4PJ9C 4U1JB 1BBDL 5CUSL 2VZUA 3LVEA 4RFEB 4XVJL 4NO2B 2HRPL 4PV9A 4XVTH 5CJQL 1CGWA 3HNTL 4YDIH 4YH6A 3MRNA 2N7BA 2A6KB 2VLKD 3DTXB 1MCHA 3MRMA 3VG0L 2X4OB 2P8PA 3VDBA 5IIEA 4XB7A 3C6SB 4L1HA 4PTUA 3V5HA 3C5ZA 3F12A 1HIML 3WCYA 2NY0B 3MCLH 4NNYA 3RPIB 4Y16A 3D69B 3LCYA 4DN3L 1U8NB 1KCLA 1OAKH 5HTSA 5DA0B 3HC4H 5ITFB 1DP0A 2E7LA 5E1AB 1RZFL 5FK9A 3OJDB 1XR9B 4DZBB 4RGNE 5CBEA 3DBXB 1UB6B 4UDUA 2IFGA 3RPKA 1UACL 4OFPA 3OR6B 2F74B 2Q7NA 5SX5H 5JR1H 3MJGX 5F9OL 1EEZA 1QLFA 2XN9D 4J3SA 1CZ8H 2P42B 1M7DB 1J12A 2H26A 2L7UA 4OUUA 3SJVB 5SWZA 5ESQB 4JQIH 5IHZB 1QBML 3JTSA 3UTSA 4GKOA 3SDYL 4B41A 3VD3A 5FUCC 3IXAA 5EOQL 5C0IB 4LLMB 3QEQA 4JR9L 5CAYB 4WFFD 2FBOJ 1SM3H 1IRAY 1G7MA 3WJJC 1QR1B 3V52H 3VXSE 1MQKH 1CXIA 4WV1C 1GGIL 4GBXC 1LP9B 3V9FA 5E9DD 4BZYA 3HUJE 4JFFE 1BVLA 1R3LB 2XQYK 1OCWL 1T1WB 4ALAH 1Z0NA 1ULVA 3L5IA 4I77H 1ZLSL 2HT4D 5D1XC 1FAKT 12E8H 2WINA 4ZS7L 5C0CD 3D6GA 5IVXF 1KB5H 1TZIB 4WUUD 3G5ZB 2E6JA 5I75B 3RWIA 4L8CA 1CT8B 1QPPA 1WEJL 2D7TH 1UQSB 3VXOB 4XPFL 3FN0L 1QBLH 3SGEI 2X1PA 1KGCD 4LVHB 2ICEB 4EDXA 2LU7A 5IJVA 3RUGE 1QFUH 4P5MB 2NY5C 5D72H 4MDIB 3EOAB 4JFXA 5F6HI 5CCKH 5EA0L 3AS3A 1T7WA 1FJ1B 2WUBL 3VWJD 4M6OL 4MAYC 3B3IA 1DQLH 3CFCL 5FYLD 4M62H 4K3HA 1WSST 5GHWH 2H1PL 1HH6A 5DDHB 2ZCLH 4XCNA 5GRVL 5KJRL 3SKNA 1X7QA 1S9WA 5E8NA 4K7FB 1T89C 2DQDL 3GO1L 4W6WB 1S9KC 4FQ2H 5T1KA 4M61B 4GRLB 1ZEAH 2XWTB 1IAIH 4EIGB 5EIIB 3O8XD 5J1TC 4PGCA 4HPOL 1JRHL 2VN4A 4JKMA 5D7LB 3L3IA 4G8FB 5ESAA 4N5EC 1RHHB 3QH3A 4FMKA 5KVDL 2A6JB 1NL0H 2F54B 4KFZC 3GJEB 3SKOA 2NW3A 3MOAH 5DMIL 1OQXA 4ZD3L 2DRUA 5IVXA 4NO0B 2ILLA 3E2HB 1EEQA 1A4JB 5TE6H 5JW4R 3HRZB 4DFHA 5F71A 5EZIL 4OI7A 5E4EB 3NFNA 3AMLA 1Y0LB 2VB5A 5E8PA 2K7PA 4YHZH 2GY5A 1ZT4A 3CX5J 4RGNB 1IGCL 1LDPH 1NCCL 3NAAH 4K3DH 1L7TH 2ZUYA 4P2OD 2IANE 4JN2A 5IMOA 1U6AH 4LBEB 4MA8H 4JKWA 5GGRA 1A6AA 2Z35B 5IOPA 1NMCB 5KZCB 1QSED 2IH1B 3T77A 5CP7A 1JGUL 4S1SL 3WYRA 3N0PB 5J57B 1OAUL 4MD0B 1U8KA 1I85C 1I7RB 4F37F 4RX4D 4LVOB 3ARQA 4YDJA 3BEVA 3MBEB 4GW4A 5EN2A 4YGVB 4M5YH 4ETQB 2HT3D 3WIFB 5KSBE 4NCC1 1IM3B 5ISZE 3LKQA 3BKYH 3ILPA 4YK4C 4U1GC 4PJXE 1QR4A 1FFQA 1YNLH 1FAIL 3VWKC 5IF0A 3C5JA 1PKOA 3QA3B 3UPCA 4UILH 1O7VA 3HUJB 4EOWL 4WNQA 4EUPA 4WHDA 3UO1H 3W2DL 2N1KA 3RX5A 1LE5B 2XTJE 4MCZA 1ZT1A 3ARDC 2PO6C 3EO9L 5E8EA 1YJDC 4LASH 4D8PB 3BD3A 1CDJA 3QEGL 5IW1B 2AP2A 4CKVX 2KDGA 1UGNA 5E6ID 4YHIA 1CL7L 2GTZB 2C3WA 4NFBA 1BQLH 1KEMH 4NQXA 4J23A 5F44A 4ONHB 4DGVH 3G6DH 2XKNA 1I75A 5FO8B 3ZYJA 4S2SB 5GIRB 3MGOA 4H88L 4U1KB 1HHGA 5FUOL 5F7DB 3O6LH 4YXLL 2C26A 3L95B 1RVFH 1G0DA 1QTYT 3PWPA 4PRDA 1TCRA 2IBZY 3LHPH 4M9OA 5J1AB 3PQYE 5ILTL 4G8IB 1FNEA 1UJ3C 2O5ZL 1Q94B 4QOKA 4XP6H 4JFED 3B9VA 1FC1A 4I4WA 1LO4L 3BIAX 3D25A 3KPSA 3QDGD 4XX1E 2RBLA 2Q8BL 3DV6A 3HE7C 3U7YH 4AG4L 1BVZA 5HGHA 1JPFB 4JFPA 5GRJL 5FKPB 4LGRB 3KWWA 3VFNA 3S34L 1K4DB 1YN7A 3RIFK 2C3VA 3QO0A 4NHUA 4ZNEE 4Z5RA 2QQQA 4MB5A 3UROR 1BBJA 3CVIL 4BA8A 4NQCE 4NQDE 2MCPH 2IPUG 3NIGE 5DD3H 2NX5E 2QQKL 1MCKA 3RGHA 1QD0A 4MNQA 3LN4A 3VXNA 1SJHB 5DQJA 1CICA 4BZ1H 1QKZL 5EBLB 1ZSDB 1L6XA 1BQUA 4XCYB 3TJHC 4KMTL 3QXAB 5GRYA 3H6JA 1BJ8A 3AB0C 2XZCH 4PB0H 1DE4A 3PL6D 5BO1L 3H9SD 1A1MB 4JQVA 3C6LC 4LCIL 2VH5H 1P84J 5JMRA 1N59A 2QSCL 3KS0J 3LQAH 4JAMA 4KKLD 4D9LH 2NY2B 1MCJA 3F6IA 4M7KL 1XF5A 3G04A 1ZWIA 5J9PA 3B9KD 5J13B 2ICWA 3JWNC 4ESKA 5BS0D 2P49B 4NQSA 3WFEL 3TA3B 3QI9B 1YEHL 3T0ED 4R90H 4UIKH 3WFZA 1YEGL 3TIEB 3TNMB 4ZFFA 3L9RA 3OAUH 1Q72H 1OTUD 4U1JA 3HZKB 3VFSA 3BKCL 4NOFA 1FZKB 3OGCB 5LJYH 3T1FA 1CTOA 5ISZB 1LP9F 1JVKA 4RFEA 2HWZH 2JJTA 4NO2A 3Q6FB 3IFLH 4WW1B 5HGBB 3ZYOA 3JWOH 4AENA 2F5AL 2A6KA 3DTXA 4LIQE 2X4OA 3HE6D 1S3KH 3W11C 5C3TA 2OR9H 3D69A 1MCPH 1HEZB 2VE6B 4MDJA 3EYSL 1U8NA 3HMWH 4UINH 5ITFA 4XXCA 1UCBL 5E1AA 3OJDA 1VFAA 4KRMB 1XR9A 4DZBA 3T4AB 2VERN 4HPYH 1I7TB 2PXYA 4XH2B 5EIQA 2X9XA 4MA3B 3DBXA 3QULB 1UB6A 3OR6A 1MRCL 2F74A 4P4RB 3RDTC 5J7CC 3RZCC 3GM8A 3P9LB 1OSPL 3WFBL 1AKJB 5K93A 1AC0A 3HNVH 4X7TB 3EGSB 3FO9B 4G3YH 2QV2A 2W9LA 1ZAGA 2OM5A 3KLDA 5C09A 5D1QA 3T2QA 1IGYB 3FFCD 1CGSL 4I48B 2P24B 3RY6A 3QIUB 3IFOB 1URLA 4RRPA 4X7EC 3VGBA 1U3YA 3ROOB 5C2BH 1Q9LB 3CLEH 1QR1A 2AKRB 4OAWA 3HLAB 4HSQA 3P3YA 2M8XA 5FGCB 1LP9A 1T21B 1T0NB 3TVMB 1ZE3C 1OW0C 3FQWB 3QXVA 1REIA 2OLDA 4L8DB 2VDRL 2ZUWA 5F88B 1R3LA 1JZ6A 5F7KC 4NQCB 4AEIL 3QAZC 2NX5B 4QRPA 4RISL 3JUYA 1Q8MA 2PN5A 3A6OA 3QRGH 2VQ1A 2R2CA 1K6QH 1TZIA 3R0NA 3UTZB 5CHNB 1AD0B 2RIKA 5E2TL 1JK8B 1VGKB 3CSGA 2Q8AH 3C2AH 2W9DL 1NEUA 3DVNB 1CT8A 3U7AA 1MCRA 4GMSL 1SBBA 3VXOA 3T0DA 5KVGL 4NKIL 2DI7A 4YXHL 2ICEA 3O3UN 3BO8B 4P5MA 1XGPB 4MDIA 1UWGH 3EOAA 3QG7L 3SDAA 3TYGL 1FJ1A 3QXTA 5HHPB 2XTLA 4XRCB 3LRGA 5ESVB 5IGXH 4LMQE 4KRPD 4QHMB 2Q6WB 4MSWA 1RJCA 2BVTA 4XWGH 2O5XH 4ZAKD 5DDHA 3BJLA 2XKSA 2W1NA 1T2XA 1NDMB 2J8HA 2QADD 2J8OA 1NGWA 4R4FL 4K7FA 1G7PB 3QIWD 1O7SA 4AZ8A 1EUTA 3TH4T 4RRPG 4M61A 5F1NB 4GRLA 2JELH 2VC2L 3PF2A 2XWTA 3EOYG 4MJIB 2OZ4L 3DIFB 5F9JB 2H9GB 2YN5A 1X4ZA 2Z31C 4K71B 5DUPH 1BHGA 4TSBL 4PY8I 3IDGB 5DFVC 1RHHA 5FO7B 2BC4B 3PABB 2IPTH 2A6JA 3HUJF 4JM4H 2F54A 5C0ND 3OKOB 4LPCA 4NUGH 4HWEH 1J87A 4N90D 3QWRA 5CINH 5B39A 4MB4A 2NY6C 3U46B 1UKTA 5IHUH 3ALWA 3Q5OA 3O2DL 1OTSD 2Y07H 3HRZA 3TIDB 2YPVL 4AH2B 3O4LE 4XBEL 3EZ8A 4QO1A 1BIIB 1TTUA 2NY1D 4GG6B 4PJFE 1CE1L 4O2CB 2YA1A 3GIZH 3DNKA 4JGMA 2FEEL 2VZOA 4UU9B 3MJ7A 2Z35A 5FYJH 4OCWL 5B3NA 3AREC 1AR2A 2DTSA 1P5VA 3P9WB 1ZLWH 1WZKA 1JV5A 4M1DL 4F7CB 1S78D 3P0VL 1WLHA 1MRFL 4ETYA 2K7QA 4X7SL 4MD0A 4YHPB 1I7RA 4FFWC 3MBEA 4HWNA 1B4JH 5F9AC 4ETQA 3WIFA 1H3PH 3VXSA 4P23B 5CEZD 3GSRB 5IFHL 1VDGA 4C4KT 2VZ1A 4X6CE 3INUH 2C3HA 4P3WA 1Z5LB 5EG6C 4L3EE 3S8WA 3HUJA 4OIIH 1CR9L 1E4WL 4RNRB 3EHBC 4WO4B 1HQRA 4OIAA 1I1FA 1C5DB 5B39G 2X44D 4WI7A 4G7VL 5IW1A 3VI4E 4BELD 1MFBH 4PP1C 1QEWB 1JF1B 2GTZA 3H9ZA 2JKXA 2W0LA 4LHUD 1OWWA 3WKMH 1I3VA 3MUGB 1EDQA 4IHOB 4LSDA 3MODH 5DHVH 1P7QD 4F57L 4ZQKB 5JUEL 3U0TB 4HEPG 4ONHA 4LQ1A 4GAFB 5GGUA 1MPAH 1BOGB 2BOCB 5FO8A 3RUGA 2KQMA 5GIRA 4U1KA 5F7DA 1MVUB 3GJFK 1T1ZA 2AV1B 5GJTL 2BNUB 3DURB 5J1AA 5A2IH 1XIWD 3ULVD 4G8IA 3TC9A 4P46B 1KULA 1FLTX 5ERWB 3SY0B 5MP6L 1INEH 3VGAC 4PJAE 4XP4L 3KPNA 5D2NC 3IAPA 2AQ2A 4OJFL 1T1YB 1JPFA 4Z7NE 5FKPA 3NH7L 1G9MC 1MQ8A 3C08L 3WXWL 1CLOL 3FT3B 1K4DA 2RHEA 1ZHNA 4UV4L 5BVPL 3WS6A 4WI6A 4OCSL 2OX5A 5C6TL 1JYWA 1IQDA 4XWOC 1OGTB 3UJJL 2Z4QB 4XAWH 2R1YB 2Z8RA 5LBSH 1SJHA 4KZEL 3ZDYF 1JNJA 2FO4B 5BRZE 5EBLA 1A5FL 4XCYA 3G5XB 3QXAA 5JXEA 4JVWA 5DFWH 3R4DA 5HVFB 4POZC 1C5CH 1ES0B 5HGGS 4Q6YA 1FNAA 4PJFB 3GBLA 2EDFA 2YXMA 1BMGA 4LSSL 5EB9A 4GOSA 1J11A 1VFMA 3GSQB 1HXMA 2VDPL 3ELAT 2X6MA 5C2UB 5JHLH 2EYSB 4GQPH 1GH7A 2DQEL 1YMMD 1U8HB 1WCBA 4OF6A 2EXWD 4P0DA 5DK2B 3HZMA 1SVCP 1VFBA 1MF2H 4NC1E 1V8HA 4FABH 1INQB 3TA3A 2Y5EA 3BPLC 3TIEA 3TNMA 4PJ8B 1GPOH 5DEFB 4PRIE 5DFTA 1FZKA 2VIRB 3BPNC 3OGCA 4NQEB 3MMEA 5FCSH 5KSBA 5ISZA 3BFOA 4PJXA 4X6CB 4Y2DB 2R29L 5AEAA 2DJ4A 4P3CH 3WS3B 4L3EB 4MS8C 5E24E 4Y4FD 5KVFL 1A21A 1UM6H 2VXTL 3EDJA 5CD5D 4Y1AE 2OMNA 1NCDL 2VUYA 5A3IC 1I8LC 3X3FH 5JOFB 2VE6A 5DVLA 1IKFH 5LGKA 5J11B 3LD8B 1RU9L 1F2XK 2Z8SA 2NY4C 4FQXC 4P3DB 3WHXB 3KXFE 1C12A 2FNBA 5MEND 1KJ3H 1E27B 3RTQB 3ULUD 3T4AA 4Q2ZA 1ROWA 1I7TA 1SHMA 3QULA 3TBSB 2VDLH 2VAJA 4P4RA 5ELIA 3L7FB 4HKBB 3B2VH 4OF7A 3D48R 5KTEL 4CN1A 3P9LA 5FFLA 4X7TA 1B3JA 1NAKL 2UUDK 4N9GB 2HN7B 2PR4L 3EGSA 3FO9A 3UTTE 1QSFE 3BQUC 2MKLC 1N5YH 4GFTB 5DR5L 3TT3H 3ARWA 3SE8H 1IGYA 4O00A 3QIUA 3IFOA 2R0KL 1DBJL 3I02B 3K3QA 1JWUB 3ROOA 1Q9LA 2AKRA 3T04D 3HLAA 3VXTA 5E08H 2HT2C 1T21A 3TO4C 1T0NA 5CILH 3TVMA 3IT8D 1FFNB 3ARFD 3FQWA 3SCMD 4EXKA 4ZNEA 1Q0YH 3DUHA 4NZTL 4HS6B 4NQCA 4NQDA 2EH8H 1LO5A 2B1AL 2NX5A 3EOTH 1MCBA 2G60L 2QBWA 5JIKA 1WZMA 3UTZA 4MMXC 5CHNA 1AD0A 4I0PD 1EHXA 1JK8A 3QQ9D 1VGKA 3VXMB 1QRND 1I8IB 4JB9H 2XT1B 3FQTB 1XF3A 4XCEB 1Y18B 2V5RA 4GG6F 4PJIB 4YHMH 3PHOB 1ZT7B 4M4RA 5EWIH 4P5KA 1XGPA 4B5EA 4XP9L 1FCCA 3SE3A 3GMRB 2ADJB 3TEUA 5HHPA 1DBKL 4XRCA 1WFNA 5ESVA 3T0BA 4QHMA 2Q6WA 3CAFA 4WFFE 1X5XA 2NR6C 5CFHA 3ARVA 4LPYA 3MLYH 1NDMA 3QSKB 4R3SB 1MAMH 4OLVL 1G7JB 4XC1L 4EIZC 4XX1G 3V8OA 2YKLH 1GGTA 3QUYD 1F3JB 4HMCA 4OKVB 4PRIB 4XPAH 4L4VE 3DIFA 3HZYB 5F9JA 1HWGB 4G5ZH 2DWEB 2GT9B 1FRGH 4ISVB 5C0CE 5IT2H 3IDGA 3TZVB 4PBXA 4HV8B 5FO7A 2BC4A 1UM4L 2YS4A 3PABA 4OLWL 2YUWA 1Q9WB 3K8MA 4WUUE 1A6VL 2Z92A 1CDBA 7CGTA 3L5WB 2X4TA 3WFCL 3BAEH 3U46A 4Y1AB 3K2UL 1I8KB 4CN4A 1KC5H 4K3JH 5JZ7D 2VLJB 4X99B 4XXDA 3TIDA 3ARTA 4NM4H 3KXFB 5SWSB 3C09C 4AH2A 4GAYB 3N1PC 4XVUC 1ACYH 1T7XA 1XF2B 2R15A 4KQ3H 3UZQA 5K9KA 3VI3E 5EDXA 3OKLB 4JY5H 3JWDC 2J88L 4KGLA 2IQAB 2AEQL 4KJWD 1VEPA 3SBWA 5ABDE 2ZZUT 4UU9A 1I7ZB 1IFHH 3B2UD 4FQPA 3VCLB 4KJPD 5JQ6L 4JANB 4Z8FL 4DKEL 4H0GA 5I1IL 1Q1JH 1EJ6A 2IG2L 3MACL 3QUXD 4F7CA 3U0PB 3RVWC 3WV0A 1YEIH 3Q6GH 2F19L 4RIRA 5ALCH 1J9CT 2CRZA 3D2UA 1C1EH 5CZXD 1NGXB 3T1WA 4UMGA 2OI9C 1CFTB 4P23A 1P9MA 3GSRA 1F4WH 4B53A 4G8EB 4JO4H 1F13A 4TRPL 1PYWA 5CJXC 1Z5LA 1OP3K 5DJAB 1F3DH 1OAXH 5DMKB 2QJDA 4WU5B 4NUJA 2VZ3A 3BMWA 4RNRA