1FNSL

Crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQSPSSLSASLGDRVTISCSASQDINKYLNWYQQKPDGAVKLLIFYTSSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYEKLPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN NMC-4 IGG1
molecule tags Immune system
source organism Homo sapiens
publication title von Willebrand factor conformation and adhesive function is modulated by an internalized water molecule.
pubmed doi rcsb
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fnsL01
1ZKAA 2IANA 3RTQB 4HUNB 1WV7T 4M7LL 4KRNA 1FGVL 3LS4L 1K6QH 2ADFL 3EOAA 3AGVA 3T04D 3QEGL 5GS1A 3V2AR 4RMVA 4X4YB 3UTSA 5FGSA 1SMAA 3EOYG 1X5XA 2P5EB 4HWBL 4G6KH 1OPGH 4KZDL 4PJDA 4OFVA 5IESH 2DBLH 2ICES 2F58H 4XVTH 3ROOA 4M43L 2E7LC 4WHYG 1KB9J 2DM2A 4I1NB 1ND0B 4U31A 3HG1D 2C1PA 1DLHA 3BEWA 4N1CA 2NR6C 2W60A 4NSKA 4MHHI 5IEHA 3GRWH 4P57A 4UUJB 1LEKB 2JJSA 1JGDA 4XMPL 5BMFH 4ALAL 2BCKB 1KELL 3WUWG 3IJSB 3X17A 1NEZG 3MRJA 4QNPE 1SBSL 1PW3A 3HE6B 1OTTC 2XA8L 1P4LB 1A47A 5DFWH 2XIDA 1N2RA 2DQDL 3X14B 4PUBL 1T1WB 4KI5D 4WO4D 3FO2A 1ZLSL 2ED8A 4L8CA 3WNKA 3PP4H 5C3LD 3SKNA 5ILTH 5GS0L 3DUUB 4D9RE 2IQAA 3HS0B 4ISVB 4LCIH 4E41D 2H32B 4PGEB 4QXWA 5HI5D 5I1LA 1BFOA 1QQDB 5F9DC 1FZKB 3J7HA 3LKSB 3K4DA 5T1LD 5IBLC 1UM4H 3NGBC 1MEXH 3Q6GH 2YA1A 3UAJC 4PGCB 4L9LA 3MXVL 1T83C 5B39A 3EFDL 1ODAA 3QIUD 3MUJA 4CN4A 4DVRH 1IM9A 2QR0A 5L9DL 4H1LH 3VXRD 4AEHL 2X4PB 32C2B 2IADB 3NH7H 2VAJA 4JFDD 1S78D 1B2WL 4P2QA 3S35H 5C0GB 1IQWH 3OHXB 2J12B 4XP6H 4MSWA 1AKJD 5E6YA 1G7PA 5KSUA 3TZVA 1BWMA 4MNQB 3I9GH 4FQXB 5BXFA 3L9RB 4PV9A 1FZMB 5B21A 1VB9A 5JQ6L 5C0CE 1OAZL 4R4BA 3WNNA 3LEXA 5E8DH 1HE7A 1QG3A 4ZUVB 2FHBA 1I9IH 1JI1A 3VXSE 1ORSA 1I1AB 4ZTPL 3BKJL 3TBTB 3O2WH 4WNQA 1HINH 5C09B 1CR9L 3V6OE 4XZUA 4F7CA 1OGTA 3S5LA 3U0WL 2NY1B 4FG6D 4LLDB 2FO1A 3BKYL 2VXQH 2OJZL 3OGCA 3Q5TA 4DFIA 1GPOL 4QHKI 4DK3A 1ZGLM 2KQMA 3T2OA 4KUZL 5DRWB 3CFDA 3OSKA 3RKDD 3ULVD 1I8MA 1MREH 4JR9L 1WC7B 4I5BB 4K7PY 3RIFF 4ZQKB 3UO1H 5C92A 1FN4B 3UBXB 1K8IA 4G9DB 2NY3B 1AP2B 2VH5L 3CSYA 3QDJE 4JANB 3GSVB 3U0PA 1T0NB 1KN4L 1EAPB 1I1AC 3QJHB 1NUGA 4OTXH 4K7FB 1R3KA 3T0EE 1NL0H 2DWEA 3HI1B 5FM5M 3CXHJ 3DGGB 3FB8B 2ZOLB 4Z76A 4YK4B 4PS4L 1NANH 4I4WA 4YDJA 4LLQB 5FFLA 1VFBB 1U3HB 1E4WL 2A6IB 4QKXB 2CDFA 4HS8L 1OAUL 1JNLL 1IQDA 2VAAB 2OJEA 1CCZA 2FATL 4LNRA 1G7QB 4HULB 3L5XH 4CNIB 1JUFB 1FIGH 5ETUB 3DMMB 3ES6B 2IFFH 3RVUC 1YEEH 4PJGB 3C5ZA 1UKSA 4UU9A 4FFYL 5T1KD 4PJAA 5FKPB 3QDJD 1OB1B 4CW1A 2VR9A 2GJJA 5CP3H 4ELKB 3S8WA 5C9JA 5FO8A 1U3HC 3M8OL 4MNQE 4TSBL 5FUCE 3GI8L 3WIHL 4MDIB 4CVZA 1TTFA 4AJ0A 1QBLL 3O3BB 3BQUD 3GUTA 2X1WL 4O9HL 3ZMRA 1CXLA 5DFTA 3KPNB 3QQ3B 1AD9A 4GG8B 4JDVB 2AXGB 5EUOA 3H7LA 2FR4A 5F6HJ 3PIQB 3N85L 1CF8H 3LZFH 4FZ8L 2E6PA 5CILL 5EDXA 1M7IA 5C07B 4U1JA 2EDQA 1T7VA 4H8WL 4XBGA 5IBUB 2YWYA 3BP5A 4JO3H 4PJHB 1PZUB 4PLKD 2Q8BH 5HHVH 1P4BH 3T4YA 2PTTB 1HHIB 1RHHA 1U8MB 1B0RA 5MEOA 1OT1A 4IRZH 5M95B 1IEBA 1RZFH 3L1OL 3O3AA 4ODUB 3MNZB 2CSPA 4JKPH 4XHQA 3TT1H 1MI5A 4L3EA 5E5MA 3V52L 2ATKA 5KJRL 2C3VA 3FRPA 4LGPB 5CINL 3P4NB 3CFCH 3TCLB 4OLXL 1WZMA 4PLOB 3VGBA 3U82B 5DJYB 1MFDH 4TSCH 2CDEB 2FWOA 1T04B 4Y2OA 4I77H 4D9QD 1F90L 5DA4A 4G9FA 1OCWH 2VDPH 4LOUD 3Q48A 5T3ZL 1AO7D 5KANG 5C0AA 4OCYL 4P2QD 2WW8A 3NCCB 5F3BB 2YC1A 3HNVH 2EH8L 1CT8A 3N9GH 1HZHH 2ZG3A 2GSGB 4NHCH 5DS8B 2JIXA 5KVGL 1ZSDA 2VXUL 4L8SB 2VDNL 4G7VH 4OI9A 4PJCB 3JVGC 2OZ4A 2FGWH 3CU1A 2KPNA 3TZVD 4JGUA 1YQVL 4M02A 4X9IA 4CAGA 1ZT1A 1AGBB 5K9OB 4KJQD 3O6ML 5I2IB 3CFBB 4E41B 1MF2H 1A2YA 1QFUH 2Q86A 3VFSB 2GTZA 2IPKB 3L3GB 4GRLB 4O2EA 4N0YL 4JFZL 1TDQA 3D0LA 3RGHA 1HHHB 3RL2B 3BZDA 4G8GA 3HMXA 3MJ9H 5JOPE 4JFFB 2AJYL 5IIEB 1ONQB 2OP4H 4NNYB 2A0LD 3OXSA 1ZWIA 4QYOA 5TPWH 3DURB 1RJZA 1IVLA 4IRSB 1FE8H 3L3JA 4P23D 4FN0A 4O4YL 1CXKA 2AQ3A 2Q3ZA 2JELL 3QIUB 3P30L 5D7SH 2ORBH 2R2HA 2CJUL 2V2WA 3U30B 4EIZC 4Y4FC 4EUPA 4J3SA 4KK8C 4YHKH 4MJ5A 2PYFB 2GSIA 1A6UH 5T3XE 4F7PB 1HIML 2GW5A 4PJDF 4WCYL 2AXFB 4WO4A 1JPGA 3BO8B 4CMHC 2X4SA 3RDTA 4QRTB 5D1XC 1NMBL 3KPOA 3S36L 2MPAH 3STBA 1KJ2B 4ZAKC 4MS8D 2Y5TB 1G7MA 1LO5B 5HGAB 3BXNA 4ACPA 3OPZL 5DRZB 4LBEA 1F3JA 4BFIB 1UQSB 3JV4A 3R8QA 3AS0A 3ARTA 2MCG1 2P8PB 4YNYA 3K4AA 4X7TA 1A3RL 5B3JE 3CUPB 5J1TC 3BAEH 4HG4K 2QKIB 1MIEH 2VLME 3NPSC 2BNRA 2CIIB 3CMOH 2CLZB 4OZIF 5D93B 4GKSB 3LKNB 2VITA 2ICWI 1J5OH 2I5YH 4L5FL 4PJBF 1X5LA 2UWEF 3HUJE 1I1FA 4GQPH 4FQHB 5MERA 4UT6L 2HFTA 5E2VL 5FHBL 2ZG1A 4XPBL 1ZTXL 3S9DB 1MH5B 3EAKA 4NKOB 1BIIA 3U46A 3QG6A 4KHXH 4TPRL 3WHE0 4JO1H 4JFPB 5I16B 1T5WA 1VDGA 2DQHH 4YDLB 2X2YA 4YGVA 3ALXA 4ZTOL 3LRSA 3DARA 3D9AL 4P2YA 5GGVL 3GBNL 4YHMH 1S7WB 2DQEL 1E4XH 5EFIA 4XCNB 1E0OB 1IL1B 4Y19B 1N26A 2X70B 5HJ3B 3QEHA 1FNEB 5KZCB 1HQRB 2IAND 4UILL 3LVEA 4U1IA 3H9SD 4P48A 1BVKA 3BSZL 3O8XC 4QTHA 5JTWA 5C71A 2NY4D 4FNLH 4IBLT 3WKMH 1BQLH 3SBWA 3V0WL 3ZZ1A 3GMOB 3T0AA 1J0ZA 1FBIH 3Q3GA 3SHSA 4GS7B 3STZB 1NCBH 4MD5B 2NW2B 3IFNH 4JQIL 3FO1A 4ZO6A 4LPVA 1PG7L 1JZ3A 4U6XB 4MA1B 3NCFB 4MJIE 3ARGD 3GIVA 1CGXA 2ZUYA 4LCCA 4Y5XA 4FQQA 5IK3B 2BHYA 4KUCF 3QCVH 3PJSA 1M05B 4KH2A 1H8OA 1I8LC 5TDNA 2OZ4L 4U1MB 2EEBA 2WBJB 3ILQC 4HMCA 3VFMB 4BH7B 4EOWH 5D7LD 1LO2L 5DC4B 2AK4E 1Z6JT 2ATPB 3R0MA 4U4BA 1NGQL 2JB6B 3SKOA 5DQ9A 3P73A 4M62L 3KS0H 5BRZD 2IANE 1NLDH 3FFDA 1NQBA 2IGFH 1WJ3A 5CGMA 2W65A 5CZVH 2AV1A 2X4NB 3V95A 2R0LL 1S5HB 1UWXK 3P11L 3B2UD 1A4JB 4K8RH 1EAJA 3RWHB 3BI9X 1KCVL 3C9NA 3BYTA 5IUSA 1BQSA 4Y16D 1TVHB 3UTTA 5T33L 1XF4B 4RNRA 5LCVL 1FNFA 5CUSL 5ADOL 2FJFB 3TYGH 5EZOH 1RIUL 3SOBL 2VXSH 4ZOBA 3MXWL 1TLKA 3F58L 3HMXL 2ICWA 1KYOK 3WS3B 5IQ9A 1BLNB 1NGYA 2IWGA 3T65B 4YEFA 1G1CA 3RA7H 4OZHF 4U6YA 1C5CH 2GT9B 4XPHH 2BVTA 2CDGB 4NZJA 3RVWD 2Z91A 3LKPB 5I1CH 3U7YH 5DMKA 1QLEH 3EUUA 1JV5B 4L1HA 5I6XC 2WIIA 3ULVE 2R29H 4DN4L 5GGQL 4PRID 5HI4D 5IW1A 5GZNC 5FECA 2XKUA 2YPLA 5C1MB 3C2AH 1QKZL 4YZFE 1XAUA 5EN2B 1KIRA 1C16A 3QWOB 4LASH 2HJLA 3M17A 5TDOB 1NEZA 5FUZL 2ZUQB 5EOQH 4PJXA 2C4XA 4G3YH 1JL8A 4D9QE 4ODXB 1TQBB 3CDGB 2NXZC 2W9EH 5IMOA 1T1XB 3F7VA 3QBTB 2GITB 2IALA 3BKCH 3NCMA 3IDNA 1X5FA 2VDRL 5I18L 4PY7B 4UV4H 4PP1C 2HH0L 2O5XL 1DEEB 5HD8C 1CXIA 2JCCE 2FB4H 2E9IA 1DSFL 1X5IA 1VFUA 2J6EL 3IDJA 3KR3L 1U41A 5EZLA 5FYKH 2HT3C 4OZHA 5IB4A 3BWAA 3HB3C 4YDVB 1WBXB 4ZFFB 2HWZL 1QSEE 4CMMA 4PJ5A 5FGCB 1GGTA 2ZUQC 5D1ZC 4R8WH 5ABDE 2FSEB 3MROB 5EH1A 3D18B 2H6PB 1GZQA 4P9MH 4QRPA 4BSVA 1MVFA 4PJFF 1IGFL 4BSWB 4N8VB 3IJSA 3OL2A 1MQKH 3KYKL 2FZ3A 2OSLA 4ENED 4JCMA 4BUGA 4U7KA 5MENE 4DOHE 3MR9A 5J3HD 5FGBA 4IRSD 4M48H 5F9OL 3RQ3A 5KS9A 1QFOA 3FO2B 1Z0MA 3MYZA 4KK8D 1UB6B 1ZLSH 4HPYH 1CLZL 5E70A 1MFBL 4JVWA 2BVOA 3VXOA 3CCHB 3SDCA 3WJLA 2BY2A 1QQDA 3BPNB 5KVEH 5GPRA 3QNYA 2EYSA 4C56E 1IGTB 3RUGF 5EORH 2EDRA 5CJOL 4G43B 4UBDD 1WAAF 3BKMH 1CE1L 3MFFA 4K3HA 1FGVH 4K7PX 5IT2L 1QYGL 1UJ3A 3RWIB 5F1IA 5B39B 1OARH 5DFVD 4G8FB 1ZT4B 1J18A 3BDXA 3MCG1 3PWUA 4P2RE 3LQZB 4X7CC 4LLVA 3PHQA 4EUPG 1B4JH 4FQLH 2Q76A 5CBEB 3L3KB 4PJDB 3TZVC 1IKNA 1I3RA 4PRPA 1A4KA 5E2UL 3HZMA 3FN9A 1NLBL 1G6RL 3BOVA 1RJCA 1KCUH 4KJYA 1FZMA 3WN5C 5CJXC 4FXKA 3SO3C 1W0WA 3GJEB 4ONGH 3TBYA 3EO9H 4ZUWB 3O9WC 5GZOC 4ZUVA 3IDYB 5HYFA 1NCDH 2CIKB 2YWZA 2V5RA 4F7CB 2ENYA 3NIGF 4WEBL 4XNUL 2A9ML 3DI2B 4M7LT 2V7HA 3MLWL 4RISL 3MRIB 3MLPA 5ILTL 3SKNB 2R2EA 4LLMA 3OKOA 5DUML 5HI3D 1MREL 2WUBH 4JPKH 4LCIL 3B83A 1R24A 2DI9A 1VA9A 4HKBA 1TQBC 2YRLA 3FB5A 4NC1C 4RCAA 4KKAD 1NGXB 4IDLA 2X4QB 4QWWD 3VE0A 5D72L 1U95A 2ZWLT 1F6FB 5EU6B 2RB8A 2QADD 2D0FA 1EEZA 4LSRH 3DGGA 3GMPB 2GK0A 1IC7H 1DUYB 4KY1H 5KN5A 4K2UH 5DSCA 1F58H 3I84A 3FQXB 3HZKB 4JHWH 1CD9B 5HDLA 3BN9C 4UV7H 1XR9B 1LP9F 5DK3A 2OL3B 3FZUC 4NCC2 2BRRH 2D7TL 1IARB 4IOIA 1MCOL 1VGEH 4QCIB 4QHLB 5GGTH 4WI4A 1KJMA 1KJ3H 5IVZB 1IQWL 3OHXA 2I07A 4U2YA 4ZMAT 1U93B 1UH4A 4OLVL 1BQHB 2NYYD 4MNQA 4LVNC 4Q9RL 2OS7A 2OTWB 3RWCA 4CNIA 4HLJA 2XKNB 1PLGL 2YK1L 5CMAA 2YXMA 4JPWL 3SDAD 4PJ5E 2F8OA 1OAZH 2R2CA 4ORZC 4NQED 2IFFL 3LV3B 1FQ9C 3MRCB 3RVTC 1F45A 1AI1L 1JPFB 2B1AH 3Q6FA 4XXCC 1A6ZA 1HOCA 2B5IC 2VXVL 3KLAA 1U42A 6FABH 1QO3A 1ZA6A 5AAMA 2B2XL 2OBGA 5KW9H 3JWNC 1Q9KB 3T1FA 3V0VA 5KSAA 1UKQA 1YY8B 3S98A 3KPLA 3RNQB 1WWAX 4I3RH 4Z7WA 1F4WL 1Z3GH 3UYOD 1QR1B 3QI9A 1D6EA 4X5LA 2C1OB 2XQYK 1WC7A 5E6IB 5ICZA 3SKMA 5IFAH 4NQCB 5EUOB 4C56A 1K8IB 4TQEL 2Y07H 4AIOA 1IKFH 5BV7C 3MLRH 1KENH 5I19L 1NL0L 2DWEB 4GKZB 5JA8B 1INDL 4AYFA 3HC3H 1DVFA 4LFHD 4P5TA 5GXBB 1XGTB 4I4WB 3WFHA 1M7IB 4RAUA 5C07A 4YDJB 3PUCA 1P7KA 3LN9A 3JBG7 4P46D 5K93A 1WCBB 2EDXA 5JA9A 2A6IA 4NKMA 5SX4I 3RFZC 1VEPA 4S11A 3PGCB 4WDIA 5HPOA 3MRRB 3TNMB 1EEYA 5MI0C 3AB0B 4EXPX 5MEQA 5FV2A 4HWEL 2MFNA 3O3AB 4CVWA 3T2QA 2ZCKL 1DCLA 3OKYA 2OQJB 3QULB 3X3GL 3BZEB 3QHTC 2P42B 1YYMH 4GW1B 5GRUL 3U30C 4HWBA 4OLYH 2FIKB 3HRZB 2CDEA 4WI7A 1LGVA 3C6LA 4PRDB 4LKCA 5FKPA 3WFCH 4OF8A 4AMKL 3NOIA 4PRIB 4UBDC 1MHHA 5IB1B 1GIGL 4LSTH 4MDIA 4CVZB 4HFUL 1F42A 1QBLH 4XH2A 5F7FA 15C8H 4PRIE 4NIKB 5MEPB 4XMKH 4W68A 3WO3B 1FVEA 1M6OA 5FDYA 3TBWA 2PR4H 4AENB 1U8QB 5HYSB 4L8SA 1CF8L 4BM7A 4JGJA 3PWLA 2E7LA 3QIBB 3ZTJG 3MBXH 2EDBA 5TE6H 3O6KL 3O6FA 4G8GD 1S7UB 3CFIC 3SGEH 1UB5B 5FF6A 5IKCA 4BH8A 1CDIA 3ZKNC 1P7QB 4F33A 4Y7MA 3UTSE 4N0YH 2NQCA 3RNKB 3UJJH 3LKRA 3GSNA 3QYCA 1TMCB 1XH3B 1EO8H 4FXGB 1E4KA 2BXYA 3RVVC 1S7RB 5ENWA 3HNTL 4LRIC 4HIIA 2HT3D 4XVSH 5F96L 5HHPA 3MNZA 1LO0L 4JN2A 2XWJB 2ADFH 1P53A 4NZTH 5HI5C 4K3JH 2O26U 3QNXA 1IC5H 4X4YA 4DKAA 1G0XA 1N7ML 1D5XA 4G6KL 4WO4C 2GSIB 4OFDA 1A6VH 3MO1A 1INQB 4DZ8A 4Q6IB 4JY5H 3RZCB 4WGWB 1CE6B 2AJZA 5SX5K 2XWBA 3BP7A 4LDOB 4G9FB 5EBGA 1NC4A 2XTLA 3MCKA 4XVUC 5EU6E 2APVA 4IMKA 3V6ZA 1PD6A 1KJ2A 2YMXH 2YOCA 5KG9A 2NX5A 1BD2A 4YWGH 2Y5TA 4U6VH 2WBJD 5IEHB 3ULSB 4FP8H 4GAJL 1QACA 4NFCA 5LVEA 1OAKH 1MI5D 3HNVL 5GHWL 2B1HH 2GJ6B 1KEML 1DBKH 1YEDA 4X6CF 3MV8A 4YQXL 1ZSDB 2VXUH 1SBSH 4ZNEA 3MBEB 2AVGA 4KTDL 4OIAA 1CICB 1YQVH 2VLJE 1RU9H 4EN3D 1ZT1B 4RWYH 5K9OA 4IM8A 4FFVD 1OW0C 1AKJB 2BMKA 4BJLA 2X1QA 3NCBB 2BNRB 5GS0H 3ECBB 2XN9E 1MAJA 3B9DA 3I85A 5BV7H 4MAUH 2OK0H 1WFUA 2OP4L 1N6UA 3G9VA 2NY0C 4KRPB 4LK4A 3NBNA 4BFBD 3MLUH 3DMMD 2A77L 2N56A 5CJBA 3QEQB 1IC4L 1RJZB 1E6JH 5F72S 4XPBH 4NKOA 3EFDH 1MAKA 2HA1A 4L9DA 5E08L 3P30H 5D7SL 5DF0A 1A64A 3V0AC 3HCVB 4F37F 1IC1A 1L7IH 2J6EA 3DMMC 1REIA 1AGDB 4L4TE 5TF1H 1O5DT 3MRKB 2YD9A 4OFPA 4WCYH 4YHNA 4GW4B 1T21A 2ARJA 5C0GA 4MSWB 3P77A 1JWMB 5J4MA 4N0UB 2GFBA 3EOBB 1SJHB 5HGAA 3TVMB 1BVKB 4QTHB 3TO2A 5EIIB 3FT2A 4FNLL 3DX7A 1YJDH 1KTLA 1ERNA 4K3GA 1FNGA 3JV4B 4C57C 4PRBB 1FFOB 2X41A 1V7MH 4X9HA 2C3GA 2OXGA 3QA3B 4LSQL 1BOGB 3IU3A 1QEWA 1Y18B 3P0YL 3FQUA 3HFMH 3ZDZF 4EI5C 4JY4B 3F5WB 5BZWA 2FO4B 3N06B 1M05A 3PJSB 5D1XA 4ZQKA 3N50A 2PXYD 2X09A 4EI6A 3WFDL 1FN4A 3ULUD 1FAIH 4G8GE 1R6VA 4RMRA 1FAKT 1BREA 1HSBB 4TYUA 4D0BA 2FL5A 4GFTB 1I1FB 4OTXL 4ORGA 3VWJC 4TNWK 4PJHE 1TJIL 1MUJB 4C54A 1J8HE 4DW2L 3ALPA 4C55A 1XGUA 2NY6D 3GB7B 2WP3T 3HUJB 3JWOH 1UYWL 3Q0HA 3GKWH 1NLDL 4O5LL 4PGZA 1T89C 4LEXH 2CDFB 4NC0B 1T7ZA 3D85D 1S7WA 2DQEH 2EE9A 3HG1E 4P23B 3UTQA 3RWFB 1QD0A 1MOEA 4K8RL 4JZJC 4WJ5A 1R5VB 3L5XL 4WFFE 3QEHB 5TF0A 3VW3H 4GUPA 2LVCA 1JPST 4RGNC 5DWUH 5EUKB 3UC0L 2IEPA 3ARQA 1TITA 1UXSB 3BPCB 4UU9B 1J05B 5HHQB 1NCNA 1QSFA 4JFEA 5D7IB 3IXTB 2Z31D 3EDKA 4OM0L 3O2VL 1T22B 4LIQE 3NFNA 5JW3H 4MD5A 4JGMA 5LGHL 4ELKA 1KXVC 1FYHB 1NC4D 3F58H 5BOPA 1R5WB 5AZ2H 1O7SA 1GGBL 3FRPG 4A2MA 3DX8B 2AGJH 5EOCH 4P3WA 5FB8B 4Q7DA 2C9AA 2NX5E 1UACL 4YHIA 5TDNB 4V2BA 3TBSB 4PJ8D 3SO5A 3U7YL 5TE4H 3N85H 1QLEL 4V2CB 1XIWA 5IG7B 4E5XB 2E27H 3C5ZD 1T80A 5ID0B 2Q7YA 3I6KA 1H5BC 5DJCB 5K9QG 2DQGH 3ELAT 2X7LB 2FEDD 2OTUA 4Q0XL 3O45B 4MS8C 5EO0B 5EN2A 5D71H 4S1RH 5CSGA 2YSSB 5K9QI 3KDMA 4NQDD 4RAVA 5IB5B 2XY2A 1KTKE 2DB8A 5JOEA 5MEOB 5E1AA 4IHOA 3L1OH 3NACH 3C5JB 3REVA 1MCWW 3M1BA 1MSPA 1QBML 4KJPC 1JZ8A 1IAOB 1BBDL 4MDJA 5F97E 3QUKB 4WW1B 4QY8B 2DJSA 2BY0A 3UTTB 5BVPH 3FO0L 2YUZA 3V5HB 4HXAL 2YA2A 4XNMA 3MA7B 5IB4B 1U8HA 2W0PA 4EKXA 4M03A 3W0WE 4OCXH 3WCYA 1IGIL 3DV4B 1FHGA 1RIUH 3WXVH 3QQ9C 3GSOB 4H20L 1U8IB 1YDPA 4JZNA 5T5FH 3UTSD 1XIWD 1P84J 3C6LD 2FJGB 4OGXH 3CK0L 4X7FC 5FGBC 4PRNB 3R1GL 3SCMB 3FHQA 4KFZC 4K9EL 4OLWL 2D7OA 3KYNB 5L8JB 4FABH 1I1YB 5FOJA 4MVBD 3K2MC 3S35X 4TUKH 1A22B 3O41A 4F7MA 4OD3H 4QTIH 2B20A 4NUGH 4NO0D 5ICYB 5F9WC 5JR1H 1QKZH 2O61A 3F8UB 1I3VA 3I50H 1MFEL 1UCBH 1CE1H 2XQBL 2AJYH 1FZJB 3RWIA 4J23A 3KWWB 4LLUA 3DI3B 5GRZA 4DZBA 4U33A 4PJ8B 4WI9A 1EBAA 1EV2E 2W9EL 3HHRB 1TZGL 2J3SA 2GITA 1T7WA 1S7XB 5J11B 3QUYD 5CJQH 3L3JB 2CUMA 3L3OB 2I27N 3QIUA 5EC1A 4ZUTA 3V5DA 5HDQL 4X6DE 2Q6WA 2VYRE 2GJZB 4MAYC 4HIEB 2YPKA 4LCWA 3O3DB 4YHKL 4J12A 5D5MF 5HDBE 2AJVL 4G5ZL 3DXAB 1KCUL 1A6TB 4KJYB 4F7PA 1UADC 1A3LH 1RFDL 5C0CA 1B3JA 2BNRE 1GGCL 3OBAA 3GI9H 3HE7B 4MZ2A 5GSVA 7FABL 4QRPB 3QUXB 3VXQA 3RY6A 1CGYA 1Z5LB 3B3IA 2BHZA 4DKDC 4EEEA 4X98B 2CKBA 5MI0B 5IB3A 4HWNA 3S7GA 3BDYH 2CGRH 4XBPB 3THMH 1WSST 4HAGA 3VMPA 4X4XA 3G6JA 4AEIH 4YX2L 2FD6H 5AUMB 5KSVB 3V4PH 5EORL 4XCFL 3NABH 3F6IA 5KVDH 5C0JA 1PJ9A 4MQ7B 4W6WB 1DQQA 1U3HD 1EEZB 4LSRL 5K59E 1J5OL 1UJ3B 1JZ4A 1DUYA 1EHNA 1F11A 4NWUL 3VGFA 1AD0A 3TJEL 1F58L 5JHDB 4J3UA 1TXKA 3BGMB 4OFIA 1XIWC 2XT1B 5IWLC 3BRFA 1W72B 4RGNE 3MFGB 1DTUA 3BX7C 3L3KA 1AGFB 3VFUA 4JO1L 1OP3K 4N8PA 4X5WB 2I07B 1ACYL 5ADPH 1DBJL 1DQLL 1W2KT 3MV11 3O4LB 3N0PB 3RWCB 4OSUL 4Q9CA 1RMFL 5FCUL 1FRGL 3EDEA 3TPUA 4LP4A 2QHRH 3KPRA 4ZUUA 1LDSA 1YC7A 3KPPB 4EIGB 4XC1H 5K59F 1RZKL 5JPMA 4MZ3A 2V7NA 4UILH 4O58H 4YDKH 1MQ8A 2X9XA 3BSZH 3WXWL 1R3HB 1TVBB 1G9NL 1CQKA 4I3RL 1RAMA 4BZ1L 1J8HB 3D0VB 4P5KB 4KMQA 1X5JA 5JZ7D 5F93C 3O3UN 4C59B 3BW9A 1F97A 3OKOB 1QLFB 4AG4L 2C1OA 4JPVL 4JPKL 1L0YA 4X0KB 2D3VA 3T1WA 1Y6KR 3CFEA 3U48A 5IFAL 3A0OA 1JP5A 4JM2C 5DJ8B 5E2WH 2W59A 4PR5A 2D4DA 3HB3D 1L6XA 3MLRL 4RGND 3S97C 2Q3AA 3L7EA 3QEQD 1BEYL 4P4KB 3KXFA 4KHTL 4PJ8C 3SDXA 3MSPA 5SWZE 2QADB 3Q5YA 4K2UL 1I7TB 5FK9A 2E8ZA 2WBJA 1F3DJ 3VJ6B 2FBJH 3UPRB 4FXLA 4QRRB 3K3QA 1A1MB 3CPLA 4NKMB 4AH2B 43C9A 1WUNT 1LE9A 5T1LB 1S9YB 1LDPH 2Y9RT 5EC2B 5CS7A 3CVIL 4JDTL 3T0EC 2MTPA 2IGFL 4QRRD 2R23A 3RRQA 4J3XA 2MHAB 1KULA 3QULA 1MHCB 2BSED 5D93C 5INDA 5DJDB 4JPWH 2EEAA 4X5XB 1S5HA 2NW3B 5HHNA 2VLKE 4LLWB 3LV3A 3MRCA 2W91A 4ZSOB 3RWHA 2CK2A 2P5WB 5ESQA 5IHUH 1ZA6B 2ZPKL 3V6BR 5I9QC 5DXWA 3C60A 5J9PB 2O93L 4HPOL 3IB4A 1XR8B 1YY8A 2QTEA 2HTKD 4NNPL 2BSTB 3MGTB 1U36A 3MZTA 4JO4H 1M4KA 4ZAKB 5I1GH 3ARGB 1J11A 1MCFA 2Y06H 3S4SG 4XMKL 1B6UA 4XB7A 5DJ2B 3WE6A 1MLCB 3AVEA 1CDHA 1M6OB 2E8YA 1CU4H 4JO2H 3DVGA 3HI5L 4X8JA 3IFOA 4ZPVA 1INDH 3LB6D 5C0RL 5DD6A 2N1KA 5HVGB 4P5TB 2CDGA 3CAFA 2DJUA 5SWZA 4N9OB 4HBCL 2E5EA 1I8IB 1JPSL 4Z0BL 1FO0L 1H3UA 2IH1A 4PRPD 1VESA 1A6WL 2W92A 5FECB 4XP4H 3WLBB 1KTRL 3VH8A 2XN9B 3EYUH 2ZCKH 4NJ9L 4RWHA 3REWA 2H3NB 1HKLH 3B2VH 4D3CL 2XWJA 3DSNA 4Q6IC 3NIGE 2CMRL 3BZEA 3FAXA 5E9DD 3IKKA 4HGKC 1U6AL 5DD1H 1D5XB 2BNQB 2XFXB 4E41E 4GBXA 3HRZA 2VDQL 3LD8B 5IV2A 1J0HA 4HK3N 2HH0H 3EOTL 4TVPD 1K9TA 2C5DC 5HY9A 4N1HB 5DC0A 3FT3B 3F65A 2O5ZL 3KR3H 1XCTB 1U8PA 3QUZA 1MCCA 3OQ3B 1WBXA 3QQ4B 5ACMA 3R4DA 1BFVL 1T03H 4LSSL 3CXHK 2VZ3A 3D18A 3JXAA 3T08A 4P9ML 1JYNA 2VABA 1WWBX 1ETZA 2EE3A 2QLVB 1XF3B 3V5KB 2DOCA 2ZOKA 4TRPH 3O6KH 4P3CH 4AQ1B 1DQTA 4NPYB 4P9HC 2ARWA 4DEPC 3RNKA 3OAZH 3VXOB 2BHUA 2D2OA 1A7BA 4KV5F 2Y7QB 1DZBA 4Y4HD 1YN6B 4X6DF 3L3DA 3HNTH 4OIIL 3C6SA 2MCPH 3DX9B 2YZ1A 2FX7H 3BISA 4XVSL 2VZUA 5F96H 3HE6C 4NN6C 1WIUA 3MFFB 1LO0H 1N6QL 5IVXA 1ZVSA 2CLRB 3O2DH 4NO5B 3R8BB 1IC5L 4P2CG 3O9WA 1N0XH 1IAIH 3I75A 1I8KB 1FYTB 3R06B 4PJ7F 5E2TL 2D7MA 2V5MA 4PGJA 2HVJA 3T3MF 4LU5L 4XVUD 1VGKA 3T0ED 4OCMC 5DRXB 3FRUB 2XWBB 3BIAX 3MCKB 3DRQB 1U2HA 2VLKD 3C09C 1S8DB 2EYRA 5D2NA 2GFBB 3EOBA 2CQVA 1OAXH 3DIFA 5SWSA 1FL6A 4NYLB 1F4YH 5GHWH 4LVOC 1BVZA 2I25N 2V2TB 2XZAL 2ZNWA 1RK1A 4D2NA 4JY6B 2DYPD 5HGBA 5EU7C 4TVSa 1YN7B 2BC4A 5DK0A 3ZE2E 4HJJH 3ZDZE 2X4RA 5C0AD 1NC2D 3QPQD 2R8SL 1CDGA 3QUMH 3PWJA 3RL1A 1P7HL 2IPTL 4PB9L 4ZAKD 5JORB 1RUPL 4M4RA 3CX5J 4B50A 1T1ZB 2Y72A 1HWGB 1F6LL 2VIRA 5BV7L 3FB5B 4WENB 4UIMB 3ZKSD 2AJSH 5IJVB 1N59B 4OIBA 2QQQA 2UVEA 2AEQH 1H3VA 4H25A 3W9EB 5KVFL 2EXWC 1MHPL 1IC4H 2ITCB 5F70A 2GK0B 5KN5B 5AYUL 4PRPE 1MI5E 4Z7VE 1FFRA 1J0IA 1MCHA 4P23C 5EZIH 3BE1H 4MHHG 1AJ7H 3RPIB 5KTEL 4JFHD 4Y5YC 3GMMA 3QT2A 4X99A 2OL3A 4NGHL 1VFOA 2UUDH 4GW5A 4Z78B 4IOIB 4QHLA 4QCIA 4Z7VB 3TIEB 3KPQA 3X12B 3UTQB 4Z7WE 4ZNCD 4OLVH 2XOTA 3U36B 2VISA 4IDJL 1TETH 5I8KH 2KH2B 5BOZG 2NCMA 5KAQG 4OV5B 4WTZG 4OCRH 4HK0A 5EU3A 1UXSA 5I1IH 4XAWL 4EJ1C 3PQYA 4XRCA 1KLFA 1CG9B 3O2VH 3NCYP 1QRNE 2WANA 4HF5H 5EBWB 4E42B 4ESKA 1HQ4A 4LAQH 4C83B 2DWDB 2Y23A 4B41A 2BNRD 3IGAA 1TNNA 3BQUB 4YH6A 4MB4A 3MQIA 3TIDA 1CFVH 1H5BB 4BK5A 1HCVA 5MENA 5BW7C 2MWCA 3ZTJH 5HYJB 3AREA 1NGWB 4BELD 4C4KT 2AEIT 1Y6MR 4H1LA 2PO6A 1QZ1A 1VENA 2YD8A 1QHOA 4DCQA 5J1AB 1ADQH 2FL5B 4BFEA 1XIWB 3GSWB 2HFFA 4E5XA 5IG7A 4XGZA 2X40A 3G5ZA 1JZ6A 2UYLB 4KK5C 2IC2A 4ZFOA 3CLFL 4R4ND 5DJZA 3HUJA 3JWOL 5TJWK 4YXHL 1HHJA 1KPVA 3O4LD 2Z92A 2NXZB 1CK0L 1XGYH 5JMRA 4X6FA 2VDMH 5C09D 1EEYB 3BHBB 4NO2A 5F71A 5F88A 2YBRA 3SDAB 4JLRB 4L3CA 2OR8A 3LCYA 3OJVC 3EYSH 4JAMA 4WJ5B 4M61A 1QBMH 4ZS7H 1GXEA 5H37G 4MDJB 5ICXA 2HYMA 1KYOJ 5I1DA 1JE6A 4RRPA 1I7ZB 4FOMA 2FIKA 4KK5D 3QQ9D 4N90D 3MNWB 2RR3A 4JFDB 2FLBT 4OZFH 4PJIA 1OL0A 3S37L 5IQ7L 1Y0LB 3AMKA 1SVCP 3DUSB 4RIRB 3FZUD 4GXVL 2QEJA 1JRHL 3AU1B 4K7PH 3L3IA 5GRJH 4X7EC 5LWYH 4EVNA 3GSQA 3MRGB 3MRMB 5C0AE 3U7WH 4LFHG 2PR4L 3NVQA 4NQEB 3OKKA 1T66C 2L7UA 4NP4H 1CLCA 2VB5A 3FONA 4TVPH 5SWQB 1G7IA 4TTDC 4QWWC 4LCYB 2HT2D 5ID0A 3GHEL 4JFED 2DTML 5FA3A 2EC9T 3O45A 1CN4A 4S1RL 3QG7H 4FQPA 3AM8C 5AD0B 2XY1A 5FAAA 5B22A 1HXYA 4DUVA 3QXTA 2Z8WC 4HS6A 2BFVL 3RJDA 4HIIB 1TZGH 3C5JA 3LRGA 2VLMD 4L8SC 1KTDA 4FQJH 3MACH 1AC6A 5IJKC 3PL6D 4ZO8A 3BFOA 1CGVA 4J7RA 4GAGH 4PJ5D 3V5DB 12E8L 3GK8H 5IROC 4UTAH 1BJ1H 2GUOB 3GSXB 3GO1L 3UTZB 1K85A 2AK4A 2RIKA 2DQTH 3VDBA 9CGTA 4BFGA 5HYEA 3DV4A 2AJZB 5TH2B 2YPVH 1H15B 3ARBC 3TBVB 5ANME 7FABH 4ZXBD 4ZO9A 4TNVK 4X9FA 5JHLL 3QWRD 3VFRB 4M1CD 4JQXC 4JZNB 1NGPL 1YEGL 5TQ2L 4FP8L 1I7RB 3CK0H 1BAFH 4RAHA 1MELA 5FDWB 3R1GH 1MJUL 3QIBC 3SCMA 1ULVA 5JOPD 4L1DA 4WW2F 5C8JB 4S1SL 35C8L 3BIKB 5DFVC 4TUJA 1HHKB 4FG6C 4Q9BA 2DLFL 4XNQA 3G5VA 4IS6B 3PGFH 4NHUA 2NTFB 3IYLW 2DD8H 4G9FD 4CU6A 4A6YH 4NWTH 4Y2DB 5J56B 5BVJA 4PGDB 4GRWF 3I2CL 3JWDC 1FG2A 1SBBA 3HE7C 1B9ZA 3ZE1E 3C60D 4KVCL 5L7XL 3INUH 3RIFK 1EK3A 1M71A 4PJGE 1KJVA 1G0YR 3HR5B 4MAUL 3VXME 4WW2C 4NWUH 5GS2H 1AD0B 1QUNA 3TJEH 2WM0A 1DE4A 1R0AL 3V4VH 4GRMB 3FN0H 5JXEC 1WCQA 4NOFA 4PV8A 4X5WA 1EERB 4HIEA 1J1OL 4L3AA 1LP9E 5EPMB 3O3DA 1L7IL 1QSFE 1OGAB 4CVXB 1FIEA 4NSKB 5TF1L 3LN4B 5D7JC 1SM3H 3VWKA 4P57B 4K8RC 2BDNH 5DEGB 3VA6A 3PE9A 2HFEA 4XVJL 5TGBB 4XAKD 1CFNA 4JFQA 3W5MA 3HA0A 1DQDH 4YO0A 2DLHA 5SV3A 3OXRA 2CKBB 3H9YA 4PIRF 1KB9K 1V5JA 3SDXE 1FFOA 4U1SB 3LHPH 4FFZL 1U91A 5GQBA 1TTUA 1MCPH 3LMJL 5IBTH 4UTBH 4X4XB 5D9SA 2H1PH 2P46B 2DKMA 5BZWB 2NTSP 3T0XA 5B8CB 1EA9C 2FX8H 2RQ8A 1WISA 1PX3A 8CGTA 1DQQB 1K4DA 3UZQA 1CTNA 1S7QA 2RAMA 3EOAB 2QQKL 3BVNB 2CO6B 4QRRA 2OL3L 4X6BB 3UBXG 1X4ZA 2MKLC 32C2A 4KZDH 3BYYA 3CVIH 4JDTH 4HQQH 4XP6L 3TH4T 2HLAB 4KKLC 1WBYA 2J4WH 4MXWH 3QNZA 3L9RA 5DVMA 2W60B 4PJCF 3GDBA 4LLAA 1G9EA 2NY1D 3QZWA 4UUJA 1T89A 1P5VA 1JYWA 2VC2H 2NZ9D 1JGDB 3RWFA 2FRGP 2V17L 2BCKA 3GBLA 4WTXA 4LIQH 4I2XB 2I9TB 4OUUB 3HPJA 3ZL4L 2ZJSL 3WIIH 4PLNC 1XT5A 4ZOCA 1JF1B 5CJXA 4XNXL 1ZXQA 3QDGE 3MRQA 5IGXL 1MVUA 1T22A 5JW3L 1SYSB 1N4XL 4U2ZA 4L29B 1BIHA 2IQAB 3HS0A 4ISVA 1A21A 1PY9A 1R5WA 2VJXA 3UBXA 3OJDA 1T5XB 4EN3C 1PQZA 3NIFE 2P7TB 4PR5B 2UY7A 5C0RH 3BT2H 4LVEA 1XF1A 4IOSD 1G6RB 1S5IL 2X4UA 3P9LB 2QSCH 4KAQH 3WSQH 3UPRA 5L9DH 1TCRB 3VDCA 2WBJC 4AEHH 3ZDXE 3A67L 3SGKC 5DJAA 3EIFA 1A6WH 2AXHA 1IMHC 2J5LB 4OCLC 2VOTA 1CVSC 2QBWA 5D7IF 3TZVB 4D9LL 1NAMH 5BRZA 4GT7A 3QDHA 1X9QA 4XP1L 3VD4A 4PRHA 4M6NH 5JQ6H 1TJGH 5HPMA 1SJEA 1EJ6A 1U6AH 5HHNB 5T1DL 5DD1L 4PJGA 5CEXB 4RX4A 3CH8A 2A6JA 3QUXC 5IFJB 2WZPD 2COQA 5GGSA 2J88H 1XR8A 3BKYH 3ARXA 3RVVD 3VI3E 1L6ZA 3OGCB 1U8PB 2BSTA 4XNMB 4NBYB 1U8HB 3MOBL 3O4OC 4XAKE 4OCXL 2BOCA 3BDBA 1EX0A 4OZFB 3NA4A 4G80A 1KXQE 5L2JA 3GSOA 2VABB 5DJ2A 3WE6B 2IQ9H 3RWDA 1CU4L 2VL5A 4QRQB 3PIQA 1T0NA 4OGXL 1JRHI 4H26B 1J0KA 1GSMA 4PTUA 2BVQA 3D5OF 1LEGB 3OR6B 4HKJB 3QI9D 3VXSB 1M7DB 4PS4H 2C3WA 4JFYB 3KYMA 4H8WH 1CD1A 3FOLB 3BP5B 1OT2A 1U8JB 2DQUL 5HSFA 4NQSA 5DMIH 1RJLB 1JZ2A 2R4RL 4TUKL 4Y19E 1FGNH 3T77B 5T1MA 3UPAA 1IQDB 1JNLH 5A2KH 3SEPA 5DJ6A 2BY3A 3C6SB 3SGDH 3TM6A 5C0DA 4ODWB 4F7EB 1WBZA 1IEBB 5DHVB 5IFHH 5E6IC 2D4FA 1QSED 1YZZA 1VEMA 2CKNA 2CMRH 1JUFA 5KJRH 4X9GA 3O9WB 5DDHB 1I75A 4JJHA 2VLLA 3TCLA 5F6IC 4IMLA 4P2OA 4PBXA 5CEZE 1OPGL 1A8JH 2GTWA 2DQCL 2HT2C 4BQCA 5CHNA 1CXEA 2JB5H 2DBLL 3KG5A 1DQJA 4JRXE 4Y5YA 2GJZA 1T66D 1ND0A 4D0CA 3DRQA 4WFEE 5DHXB 4G8EB 1RZJC 2M2DA 1KIQA 3NA9L 1E4KC 3MOAH 3O3BA 3QXVA 4H1LG 5GS2D 1CT8B 3LS5L 5EIQA 2ZUXA 1KELH 2JTDA 3N9GL 5D1QA 3V5KA 1CLOL 1LK2B 2FYYB 2NYYC 4MNHB 4X98A 2W1NA 4PUBH 3TN0B 3K7UA 4NPYA 1QFUL 4U1JB 1RUPH 3SE4C 1A9BA 5E8NB 4JO3L 3PHSA 4HCRL 4RQQA 2A6KB 3MV9B 2WWKT 1GOGA 3MJ9L 3PV6A 4LHQB 4UIMA 4U1HA 2F5AH 3VFWA 1BZ9B 1NSNH 1YUHA 3MLVH 4OI7A 4DOHB 3L3DB 4QYOB 5TPWL 3AAZB 3S37X 4IRSA 3BEVB 1JN6B 1KPRA 4OGYH 5D2NC 3CFCL 1C5BL 4NOBA 2XPGA 1I8KA 3KXFE 2X4PA 3R06A 2PYFA 5E2TH 4NGHH 5CP3A 1OGAD 4N9GA 5EZJB 3QUYC 4Y5VB 1UJ3C 5I8OH 3H0TB 3IAPA 1MLBB 3SE3A 3FRUA 2KQNA 1OCWL 2VDPL 5C86A 3FQRB 4M1GL 5T3ZH 1TETL 1RZIA 5D2NB 4ZODA 4AK1A 4JFOB 4U49A 1KCRH 1FRGH 2P45B 2QQLL 1GOHA 3GFUA 1XF2A 5AG8A 4XC1L 3HPLA 1AQKH 5I0ZA 4UOW1 1F3JB 4KZEH 2Z93B 2QADC 5JQHC 2B5IB 4LLDA 3C09B 1DVFC 4PJCA 2G60H 2VDLL 1I9JL 4LQFL 4QXUL 4CRPA 5ITFB 2X4TB 2X4RB 3WO4C 1NJ9B 2D7NA 5I75B 1J8HA 3ARRA 5ISZE 1MF2L 4E9LA 2GTZB 3ARUA 2IPTH 4PB9H 5DRWA 2WQ8A 4WI6A 3P2TA 1IGJA 4AG4H 4LF3B 1ZHNA 2VIRB 5CWSB 4ZUSB 5T3XD 4HW6A 1FO0A 2I5YL 5IIEA 2V9TA 3LPWA 4K7FA 4XCEB 4D0DA 4OZGB 5IMKB 1NEUA 5KSAC 3IVKA 2GY5A 4LRIA 5E9DA 3MZGB 4I9WE 4ZFOB 2Z8RA 5GZOD 2ID5A 5FK9B 3CDYA 4QXTA 1RUAH 2Q8AH 4YXHH 3CXDH 4XPAL 3IJYA 4GW5B 1HIMH 4Z7VA 3ULVH 3ESVF 3TIEA 4WO4B 4JLRA 4H88H 4LNRB 5K9KA 4IDJH 2R1YB 3CFJA 2BJMH 4JFFE 1FNEA 1UZ6F 1MHCA 3IJHA 3ZO0A 2YD5A 3M07A 3TH2T 2M1KA 4POZC 3D69A 3BXNB 4NN5C 1T2QH 2NW3A 4P9HH 4BUHA 4TOYL 4LSUH 4FFYH 3H42L 1LE5B 4BFIA 1NAKH 1S7SA 1YMMA 1GJIA 4DVBA 4M9OA 3LH2L 1HQ4B 4GG6F 2XYCA 1RJYB 3BD3A 3M8OH 4U1LB 3V6FA 4GSDL 3K1DA 1XFPA 5HD8D 3WIFA 3B9KC 1G1YA 4LCCB 4Y5XB 2CIIA 3SDDC 5JW5A 1HEZA 5GRJL 5I76A 4JDVA 3PWVA 4K3DL 4PGBA 4L5FH 4DCQB 5DTFB 4XP9L 1MY7A 1ADQL 2XKSA 5KSBF 4QRRE 5SWQA 3D2UB 2G75B 5BJTB 1T6VN 4EDXA 4ZPVB 2NY0B 2XNAB 2YUXA 2AJXH 4N0FA 1YY9C 3GM0A 1X5HA 1TJHH 2JB6A 2IH3A 3SKOB 2R1WB 4LEOA 3SQBA 3CC5A 1QA9B 5IM7A 1J12A 4W70A 4L9LC 2KDGA 2BSSA 5HI4C 3VWJA 4B7IA 4CMHB 4APQD 1HHJB 2DQHL 5A16B 1P4BL 2AW2A 2H2PD 3OB8A 5HGHB 3QIUC 3K8MA 3MLZH 3SJVD 2ADIB 4GRWH 5F88B 3BMVA 3MJ8B 1UH3A 5IF0B 1CD8A 4PP1D 4ODUA 3MACL 2J8HA 1U9KA 1XCQB 2XG4A 4JKPL 5D2LE 1EFQA 4Q97A 5ICXB 3UDWA 4UQ2B 3O2DA 4XI5C 1LWRA 5DJ0B 4K94C 1LK3L 5D7LA 3I3DA 1BX2B 2YN3A 4JZJA 4KMTH 1TTGA 3FO1B 1RZ8A 2ICWB 1LP9B 3WS3A 3E0GA 1AR2A 5B3JF 1F3RB 3QWQB 1CI5A 1RUQL 2XZCL 1A1OB 2GT9A 3MRGA 5I1CL 5C6TH 3G5VB 4G7VL 2ZOKB 1C7SA 1GC1H 4RA0C 4N5EC 3EJJX 2JJTA 1CWVA 2ZCLH 2HFGH 4LCUA 2L7JA 1SYVB 3T2PA 1A2YB 4Y2DA 3T4AB 4DK6A 4GRLA 4O2EB 2R4SH 3U83A 2Z31A 3BP4A 3OB0H 4KVCH 1KBGL 3U0TA 1ZEAH 3QUZD 3VFTA 1ZLWH 2B4CC 3L3HA 3HR5A 3L5WB 1KCSL 4EDWL 4GG6B 3FAWA 2KBGA 4YXKL 3UYRH 2MCPL 4KVNH 5HHOD 1OTTD 1KIPA 2Q1EA 3PNWA 4JPIA 4H5SA 4Z7WF 1CFTB 5CSBA 5IVXB 3JV5A 3O2DL 3B2UC 2R2BA 2O5XH 1R5IA 2NMSA 5JHDE 3UTPD 1N0XL 2DQJH 2LVEA 4KK6C 4A2LA 4KWUA 5LCVH 4OB5H 2P4AB 2PCPB 2XTJC 3VXPA 4XP5L 2HWZH 4HGWB 2BDNL 2LU3A 3P9WB 4QRTA 1GZQB 5CLWA 1A7PL 3UBXI 5I1HL 5H35A 4KQ4H 1ZVHA 4RFNC 4BSVB 3OAUL 5IQ9B 4S1QL 2NZIA 3KAAA 4PJXE 1YECH 3NN8A 2YPLE 5D1QC 3AY4A 2XN9D 3KPRD 2JJUA 5M94B 1NGYB 2YD2A 5FDWA 1A3QA 3MR9B 1V3KA 1MHEB 35C8H 4BQ8A 3OPZH 3J8F7 1OSPH 2A9NH 3KJ6H 4HHAA 4PLJC 5FO9A 1UQSA 3MLYL 1E28A 1EUUA 4IS6A 4N1EA 1Q0YH 3PGFL 2BC4B 3RZCD 2NTFA 1FVCA 3D85B 2P43B 3QCTH 3VFPB 2R29L 3LMJH 3FOMA 4HGMA 4HT1H 5MHSE 4AEFA 4K3EH 1YEJH 1I8LA 3OJMB 4QLRA 1RI8A 3WHXB 3C2AL 5D1ZB 5CJOH 1NEZB 1KFAH 3BKML 2VITB 4WEUD 3MYJB 3QHFL 2PW2A 4R26L 5CGYD 4POYA 3TFKD 2VSCA 2A74A 2ADJB 4F7TA 3ZDYF 3LQZA 5E2VH 4GRMA 3ARED 2UV3A 1ZVYA 2P8LB 5IVOA 4I3SH 2BSRB 2HT4C 4PV8B 5I71B 1KLUB 2FB4L 5EZIL 1NLBH 3SE3C 1UWGH 2PYEB 1IZKA 3QNZB 4GJTB 1JWSA 3BWAB 1NFKA 1P6AB 1RIVL 1CL7I 2HAZA 5KAQF 2CR3A 4P5MA 2HFEB 1MCLA 2O5YL 1CDYA 2V17H 1NBYB 2V5SA 3AUVA 3EJZC 3VI4F 3RGVA 4P4KC 4U1IB 5IB2A 1KEGL 3GJFK 5FGRA 3ZL4H 1I9RL 1WVZA 2DIJA 1T4KB 5F9OH 1CVRA 3QO1A 4MJ6B 4HLZG 3V0WH 3GIZL 2BRQA 3H9HA 4RISH 4NRYA 1TZIA 4M8QA 4G6AC 4OBSA 2RCSL 3MLTA 3SDDD 3TIDB 1NGXA 3P4MB 3WL9B 4LCWE 5GJTH 4M7JH 2H26A 4NKDA 4PB0H 2HN7B 1JVKA 4PJ9A 4QHMB 5DRNA 3RHWF 2NY2C 4Y0GA 3BZ4B 5F1IB 2PO6B 2XZQH 4J8RB 1NBVL 3PP3H 5B8CC 5J6HA 1TENA 5I73C 3E3QE 1Z9LA 1BHGA 1KPUA 4KUCD 5C08A 1RUKL 1Z9OA 2ED7A 2Q76B 4LP5A 1KSRA 4NO0B 4XC3H 3PV7A 1MWAH 3LOWA 4TN9A 3KGRA 1KV3A 1F8TL 4J6RL 1JTPA 5B4MD 4Y4FD 5CMAB 4Z7VF 4HC1L 5ANMA 3KLSA 5T1DH 3T8XB 4YHOL 1A4JA 4BZ2H 3IFLH 3QCUH 1NMAH 1G0DA 3VGHA 3WN5B 3U6RB 1JNHB 3DWTA 5DZLA 1TVHA 5T33H 1JGVH 5DURD 4LOUC 1T20B 3WFBH 3TNNA 4J1UA 4KROC 2JCCF 3OX8A 1N4XH 4WTZA 4M9PA 3KLHD 1QPXA 2VXSL 4Y8DC 4HKBB 5MP6L 1DANT 2VDOL 5A2LH 5L2JB 5D5MA 2E7CA 4LHUD 4M6OH 1T5XA 1YMMD 3VE0B 5D72H 4FQ1H 5C6PB 4PBWD 1LEGA 3OR6A 3GSQB 5D7IE 2WLZA 2UZIH 5ISZD 3SKUD 4APQA 2DMCA 3D3VA 2P44B 5EO9A 1O7VA 1H3TA 3TYFA 4HG4J 2RJMA 4NBXB 4DN3L 4ODHH 4BSJA 2B0SL 5TDPA 1PSKL 5F89A 2J8UF 4HWZA 1MCOH 1VGEL 4NN6B 4KDTA 2YPLB 4PJIF 4B0MM 1D5BB 4Z6AT 4B7LA 1KJMB 1KJ3L 1VFMA 5HTSA 5IFHL 1G7JB 1VFAB 4NZRH 3ZSTA 3RHWK 4ZS6C 5GS0C 4QOKB 2DDQH 3IAGC 5AD0A 2G9HB 4G3YL 1Q0XL 1MIML 4ODXA 3MLSL 5HHOB 2BZDA 1SJEB 4NNXB 4MWFB 4FFWC 2X6MA 3VGGA 3KLAB 2GTWB 1FLRL 3ZLQC 3QRGL 4XPFL 4L8BA 1ROWA 5INCB 1Q9KA 3A6CH 4HZLB 2PXYA 3UTZA 1F4WH 1Z3GL 1BVLB 4GKNA 1ZK9A 3D3VE 2A1WL 3MOAL 4PLKC 3IFPA 4XH2B 3SBWC 4R8WL 2YPVL 4UIKH 2H6PA 3LS5H 4NQCA 4C56B 1FVEB 1NGPH 1U8NB 3GMQA 3FFCB 2FYYA 2AI0H 2X89D 3NCYS 5LJYH 3CX2A 3AXLA 4Q2ZB 3AFLA 4JRYB 1KGCE 3TN0A 2NY5L 5JLZB 1P7QA 3SPVB 1EFXB 3OKEB 1ZLVH 3LKRB 2EIBA 5IHBA 4JQVA 4OKVA 4QRUB 5HVWA 3MODH 4OQTA 5DLML 3T77A 5FOBA 5FIEA 1YUHB 3MLVL 2XICA 4WDIB 3I2CH 3O9WD 1DDHA 1OAYH 4MX7B 1GZPA 5LXGL 1L7TL 5D7KD 3KPSE 3PGDA 5DYOA 3X3GH 3C8HA 2NLJB 1G9NC 4PTTB 1OARL 4K3JL 4Y4FB 4NT6B 4GW1A 2Y5EA 3PWUB 2D31B 4QHKJ 3FQNA 5F7UA 5C0IB 5D96C 5F7NC 2DIBA 4QO1A 1KB5H 4G7YH 4ZOEA 1BF8A 4MCZB 1INQA 4DZ8B 3C6LB 3C5ZC 1S7VA 1XGQA 5GIRB 1I3RB 4PRPB 4DUXA 3H0TA 4UDUA 1W72H 2DQIL 4JJ5A 3NPZB 4XX1G 4DWHA 1AE6L 3L5JA 5EU7E 3VI3F 4Y89A 4O00A 3GMLB 5GJSL 3S96A 1SM3L 4KXZH 4QF1B 3GJEA 3D2UD 15C8L 2X4OB 2DM7A 3LDBB 1U58A 3M45A 1IILE 4IRJC 1PYWB 4XVJH 5E8EB 4ELMF 4HXBH 4W6XB 1NCDL 3I3BA 1HYSD 2Z93A 4X6DA 5HYSA 2ESVB 3MBEA 1CICA 1ZOXA 1OWRM 5EU4B 1HXMA 1G7HA 2DKUA 5L2KA 3QZWG 4PRAA 1DJSA 4K71C 1A9BB 5E8NA 1JHTA 2WUBL 3DVFA 1S3KH 2ED9A 5CWSA 4ENEC 3PHOA 1VSCA 3FO9A 3TV3L 2E7BA 3VG0H 3LDBC 3OKMB 1P2CB 1S7QB 2IMNA 1UA6L 2AKRB 1QRNA 2HTLD 3MUZ1 3QNXB 1QSEA 4HV8A 3W0WB 3HMWL 4KRMB 2Q8AL 4UI2A 3DX6A 2XPGB 2NY6C 4X6BA 2LQRA 3MV9D 2RGSA 3DO3A 2KKQA 5DMYA 1J1PL 2ARJB 3S6CA 3FKUS 2YD7A 3SQOH 3UJIH 1SJVA 3O8XB 4NUJA 2OTWA 2YMXL 4MQTB 1C12A 3EBAA 3MBED 4N0UA 1F02I 2C3XA 2XKNA 3OKDB 5BO1H 1UZ8B 5SWSE 1N5AB 4ZDHB 2B1HL 2GJ6A 3U4AA 1WGOA 5BRZE 4MD0A 1AI1H 1JPFA 1DBKL 2B1AL 3H42H 4MJID 5D2NE 3EJZD 4XPTH 3ARFC 5DD0H 4O51B 5HVFB 5KW9L 1U3ZA 1JGEA 4P2QE 3FQWA 2WWMD 4OAWB 2VLKA 3CH1B 4YHZL 4YDLC 1AXSA 3B9EA 3IU3B 3RDTD 2P5WE 4XNXH 2WBKA 4KDVA 3IRPX 3HFML 2X44D 2GYSA 5EOTB 4KXZI 4MQSB 1D6EB 3ARZA 4IIQA 5F8QC 4YPJA 4LF3A 1A02N 3PDDA 1AXIB 4E0RB 2GQHA 5C7XL 5BCAA 4EI6B 3GSNL 3PWVB 4K3DH 4JHBA 3ZT5A 1EO5A 2Y07L 5DTFA 4OLZH 5LQBH 1DBML 4MQXD 3PXJA 1GYAA 5IMKA 5IMMB 4K94H 1DFBL 2AJXL 3BZFA 4F58L 4LEOB 5H94A 5KBNC 3G9AB 4KAQL 3WSQL 1QFWH 5H2BA 5CSZA 2WP3O 2WIMA 3RTQD 1ZANL 2B4CL 2Z35B 3W39B 3F12B 1VPOH 1LD9A 4WUKL 2BNUB 4AQOA 1L0QA 3LN5A 2IPUK 1TZHA 4GW4A 4YHLH 1IE5A 3E6HA 1J88A 1PBYA 1OP9A 1AFVL 1N3NB 1OSZB 4OM1H 4PRHB 1Q9WB 3QAZB 5CP7B 2EIDA 3TVMA 5HPMB 4OKDA 3BH8A 4P9HL 4OZ4A 4X7SL 1SY6L 4OT1L 4Z7UE 3UEZA 4OFYA 4AT6B 3ARFB 3QIWA 3LH2H 4HJ0C 5F1NB 4K23L 5I1EL 4PRIA 1ACZA 1DL7H 2Y36L 4WY7H 3HKFA 1PFCA 3A6BH 5AWNH 3TWCL 4CBPA 5D2LB 3MOBH 3B9AA 3A6OA 5KZCD 1RPQA 3RX7A 3JWDH 4AM0B 2CUIA 2BY1A 1HSBA 1ZHLB 3JUYA 4D0BB 3MRFA 2ZCLL 5BJTA 5JPNB 4S2SB 3VXSA 1K4CA 1A6AA 5L8KB 4P46A 3FOLA 4GRWE 1BD2D 3O8XD 1U8JA 2DQUH 3BP4B 5J0BA 2ICWJ 4J3VA 2YSSA 5HDBF 4DEPB 4A6YB 4RAVB 4R90H 3CVHL 3VFNB 1G9MH 5LGKA 1ITBB 1IM9D 1KXTB 4FTVA 1GL4B 1WBZB 4IHOB 4HUVB 2EC8A 3G6JF 5HHPB 3HAEH 3TCXA 1D5ZB 2FCBA 3M1BB 4H5SB 4J2XA 1XCQA 5E99L 2AS5M 1BBDH 3EHBC 4UINH 5DJXA 5ESAA 1R5IB 1JZ7A 4GMTL 3ZKND 3G6DL 3V5HA 1IFHL 2PCPA 4S1DC 2CPCA 1CGWA 5DR5L 3VXPB 1ZHKA 4Q6IA 3EZ8A 2JB5L 4R96B 3H3PL 1DBBH 3GM8A 2XQYG 4UT7L 5GRYA 2BOBB 4XCCL 3SN6N 4D0CB 3X13A 2VWEC 3OAUH 4XI5D 5HHXH 1U8IA 3VXMA 2PW1B 4U6VL 3S5LG 1NCAL 4OD1L 5JIKA 1OM3H 1OAKL 4IJ3C 2VL4A 4P59H 5JIPA 3FHAA 3FCTB 4XHJD 4YR6A 4MJIA 4F15B 1DANU 5TE4L 2GJ6D 2XI9A 3NTCL 3SJVA 2AABL 1NANI 4YXLH 2HMID 1RU9L 2EDDA 3Q5OA 1UEMA 2DQGL 5EUOE 5FM4A 3O11B 2J8OA 1YMME 2R56L 3WHXA 1MCSA 3AC0A 3ECBA 1YMHB 4XTRC 2IANB 1FZOB 4NQUA 4IIQC 3DO7B 3HAEB 1YY9D 1ED3A 1I85C 2F5AL 3I6GA 3VFWB 2ZUUA 4EDWH 2ADGB 3EJYC 3NAAH 3QEGH 2ZUVA 5F3HA 5IHLB 7CGTA 4YLQT 3P40A 3DBXA 4LSVH 3MMEA 5GS1C 5EWIL 4XXDA 1K3ZA 4HWBH 4XPGL 5CJQL 1RZGB 2W0FA 4IRJD 1IAOA 2BSRA 2R2BB 1NFIA 1KPRB 2I24N 3IDMA 2Q6WB 1HYRC 3ROOB 1AGCB 4Q6YA 5CD5C 5EUOF 2C1PB 4O02L 1NPUA 4L4VD 3TA3A 3VGDA 1MCDA 3MA7A 3DPBA 4XP5H 1A7RH 1ZT7A 3ARFD 4PYHA 4P5MB 1B88A 3VU2A 1D3CA 2AV7B 2DQFB 4YGAB 4PD4J 3I02A 1QVOA 2P48B 5D70H 2QQLH 5IB2B 3TO2B 1DLFH 4P3DA 1YJDL 4ERSL 4HMDA 2DQDH 1V3LA 1V7NL 4YFDB 3QXWA 4HKXB 1FNGB 2C7UA 5LBSL 2UUDK 3VFOB 1K5NB 5E8PB 5KSBA 1YYLL 4MNGB 2HKHH 3D85A 3QCTL 2DJ4A 4Z5RB 4HS3A 5LAXA 4HT1L 1QEWB 1GGIL 1N5YL 3QDJA 1S9XB 2VZ1A 4OD3L 3P4MA 4QTIL 3EGSB 1EJOL 4LAJH 3UTPE 5JHDD 3O3EB 1CL7L 5E0QA 3EO1B 3VXRA 3I50L 4HFWB 3RTQA 3WNMA 3OTTA 4YK4C 1MJ7H 4TSAL 2K7PA 3C08H 5GS1B 1AXTH 1I3GL 4Q9QH 3ARDA 3IETB 4JG1H 5E03A 5EG6C 4DW2H 5DK2A 4YBLB 1W72A 1D5MA 5FUOL 1IAII 3PDOB 3BD5A 2QQNH 1UYWH 3V6OA 3ZKQD 1MCWM 4M43H 4F2MA 2V9RA 2Z8VC 3DJ9A 4YFLF 4LCWB 4O5LH 4J6RH 3I9GL 4FQXA 4WW2A 1L9MA 3OG4B 4RFOL 2F5BH 4AEEA 3MRLB 4M5YL 4X8XA 2WMPA 4BZ2L 1RZKH 5EB9A 2BJML 4CUCA 5JPMB 3MRJB 4R4NC 1OWWA 4YAQB 3MLXL 3WKNA 4X80H 3HC0A 2CD0A 2OJZH 1KNOB 5LGJA 1T1WA 3IDGB 4JFEB 1JTOA 2CGRL 4XBPA 4LLYA 1NUDA 1S7SB 4EZMA 1J10A 3LKOB 3MA9L 4WHYH 3X11A 3JV0A 4CADB 3HG1A 4WI2A 3NZ8A 3V6FB 2VDOH 3FT4A 3S4SA 4JFXB 5DJ8A 2QSTA 3U0PB 3DX8A 1T2JA 3QJHA 4OCWL 4XWOD 2JIXD 3CIQA 5GGUA 4ZG1A 3E6FB 2H26B 4PB0L 3CLEL 4LARH 2EZ0C 4KHTH 1F00I 3MXVH 3UTTD 3IDYC 3NCEB 3RY5A 3T0DA 1S7TA 4MNGE 3BGMA 5EO9B 2DIAA 5C0BA 5I66A 1QOKA 1VADB 2PO6C 3CC5B 4NO0A 4XC3L 1AGFA 3KLHC 4PJAE 1B4RA 2R0WH 2AJUL 5I0DA 1CFBA 2WV3A 1MIMH 1WLHA 3MLSH 1RZJH 4R4BB 3MJ8A 1NC2A 5ELIA 4LLWA 1E27B 3W9DA 3C5ZB 5D8JL 3QRGH 4GOSA 4L4TB 5CD3A 4RFNB 1CR9H 5BZDA 4O58L 4YDKL 5J9PA 5F7MC 3FO0H 4HIHB 4NNPH 4TTGA 1NFDE 3GI8H 3WIHH 1WZ1H 4IRSC 2A1WH 3ARGA 5J3HC 2J2ZA 4EQ2A 3VXUB 1I8MB 2NY6B 4HUXA 2Y06L 4X0KA 2DYPB 1MNUL 5CCKL 5FV1L 3EYVB 3EYFB 3PWPE 2FJGA 1NKOA 3FFCA 1WT5A 2C4FT 3ARWA 3HI5H 3ULVC 1BEYH 1A1OA 1U2CA 4IOFD 3WS6A 1H0DA 3QH3A 3MGAA 2ZOLA 4Z76B 5FYKD 1AGEB 1I1YA 5E6ID 3D3VB 4LNVA 3OKEA 3AS3A 3TESA 2EEDA 4KV5E 4P2RA 1A1MA 4U1GB 5HHVL 1KB5B 3CPLB 1SYVA 4AH2A 1U8OB 3ZYIA 3D87B 4J3WA 4HS8H 5ICYA 5EC2A 1B0RB 1C08A 1NBZB 3MRNB 4MX7A 4JZOA 1VFAA 5TE7H 3PP3K 1QR4A 2H9GB 3UYPA 1HKLL 3B2VL 1E4XI 1R3LB 1P69B 4DZBB 3L6FB 3Q1SH 5E5MB 3V52H 5DD5H 3P4NA 2VLJA 4R7DA 2D31A 1YEEL 4ZSOA 5EIVA 5C0IA 4G7YL 4GBXB 5DT1L 2D7QA 3BWUC 4TSCL 4ZUTB 1D9KD 3KNBB 2R69L 3EO0B 4YE4L 3P4OB 4HZLA 4HPOH 1GH7A 2PXYB 2O5ZH 1L9NA 1DLHB 2APTA 2V2XB 1BVLA 4OCYH 3GMLA 4JM2B 3UAJD 3GRWL 1A3LL 2KZ1B 5C0CB 1FNLA 1U3JA 3BJLA 1RIHL 4RX4D 1UG9A 5DC9B 3CSBA 4KQ4L 1PYWA 4J4PD 4I0PC 2FR4B 3HC4H 1WTLA 3BESR 5B4MC 4DQOL 1KT2B 3QPXH 1TPXB 3B8SA 1X3DA 4JRWA 1RHFA 5SX5H 4LPTA 5DD6B 4KC3B 1Q1JH 5JLZA 4HCRA 4HHAB 5L2KB 1URLA 1U8KA 3AM8A 1E28B 3V7AG 4GXUM 5FEBA 3VD5A 3ULUC 2PXYC 3O6LL 2EH7H 5I1LB 3NIDF 3T4YB 3HR6A 3FO9B 4DGVH 4DGYH 3MJ7B 3MODL 5DLMH 4ZFZA 1YN6A 5E4EB 1YA5A 5KSVA 3WLBA 5D1ZA 4R3SB 2F74A 3EYUL 3ZTNL 3SDYL 3PGDB 3ARPA 2AKRA 2NLJA 2ATKB 2PW2B 3T2NL 1QFHA 5CINH 2R2HB 2QR0B 2VQ1A 5IBUG 4J3OC 5GGRA 3FQNB 4F7TB 2P5EA 1AY1L 2I26N 4W4OA 4YBQD 1IGYB 4JG0H 1FG9C 1BZQK 2DL2A 1VGKB 3DROB 2XA3A 4KJWC 3EYOA 5DRXA 5IW3A 2X4SB 3RDTB 4FMFA 4Z7OE 1H9VA 3SQOL 2PYED 1G7PB 1CLYH 4HIXL 1DQLH 3QXAA 3RZWA 3TEUA 5KSUB 3BRGC 4LKXB 3UPCA 5E94A 3Q2CA 1A1NB 1LO3H 4WU7A 2P24B 1RIVH 1T1YB 5HYQB 3QQ4A 1OD7A 4QF1A 5CGTA 1F4YL 3KPRB 4QHNB 5EULV 4ZUUB 4JN1H 4XBEL 1RK1B 3EDDA 4ALAH 3C87A 4HXBL 3HNSL 2EXYD 2EKSA 5A40E 1XF3A 2ESVA 4OAWA 2FGWL 1FNHA 5L0QC 5D7KE 5EU4A 3VCLB 3QO1B 3NFPA 3D0VA 4P5KA 1FNSL 4NCDA 1JHKL 1HNFA 4JE4B 3ZE0F 4IIQB 3DYOA 1HHHA 4JVUA 3RL2A 5C7XH 4GS7C 5FM5O 4NN7B 1QSZA 1AP2A 4OQ1A 1FZKA 3ARDD 2XTJB 4RZCB 1CDUA 3LKSA 1EAPA 4HH8A 4FQHA 5MERB 5IMMA 4KGJA 3OKMA 4L9LB 3SDXB 5C07E 3TGXA 4OF7A 4F3FA 4KHXL 4TPRH 2V2WB 1ZANH 2B4CH 3VD9A 2IBBA 3OZ9H 1VPOL 4X99B 4OZIB 1A6UL 3MV8E 3KJ4C 4Z78A 3BPOB 4D8PB 2P5ED 3D9AH 2VAAA 1D9KB 3QXUA 2NY4B 3EFFB 4K9EC 2OMBA 3S35L 1FV1B 5ESVA 1ZMYA 5T5NF 1OSZA 2X70A 4OM1L 3DHJA 3JTSB 1HWHB 3DMMA 3JZ7A 4X5XA 4NQDE 3LEXB 5E8DL 3BGFB 2DMKA 1AR1C 4Z77A 5I1IL 4JY6A 3QCUL 3RP1A 3U6RA 1HINL 5C09A 3ARFA 4HF5L 3IFNL 3OB0K 2L4OA 4JQIH 5C9JB 5E7BA 5IR1B 3BAEL 3BQUA 4MA8L 3QR2A 5CZKA 5B38A 3ULVF 3L5HA 5D2LA 4M7ZB 4EN3A 4JM2D 4ZAKA 5I1GL 2X1OA 4FQQB 3QCVL 1AQDB 1M7XA 1WZKA 3RPKA 5T3ZE 4AM0A 4MQXC 2AJSL 3GSVA 5D1XD 5DQJA 2JJSC 3LZFL 3HI1A 3ET9F 3VA2C 4ZXBB 2ITCA 3EZJB 4S2SA 4X4ZA 1ZTXH 3O4OB 1FFPB 5H94B 5KOVC 4APQB 4F80A 5DJZB 4JFPA 4CDHA 1U3HA 2FGZA 1R3IL 2B0SH 5TDPB 4AL8L 1DR9A 2BNUA 3LRSB 5D96B 2VDML 2XXCB 3LN5B 1D5BA 4LPWA 3ZYJA 2ERJB 5EFIB 5KVMC 4TNWF 4CJ1A 3TF7C 1WQVT 2DTSA 1N3NA 4EUPH 1HI6B 3FFCD 1IGMH 5I17B 3DVNB 2YD6A 5CP7A 2P8MA 1NKRA 4MWFA 1XF4A 3WKML 2BNQA 2XFXA 4Y4KA 2Z8SA 4RNRB 3PWPD 4LPYA 4Z7OF 4LRNH 1T3FA 2FWOB 1CG9A 4MGXA 2ZKHH 1IJ9A 2F9BT 3H3PH 5F1NA 5E00B 3HMXH 3MJ9A 4M5ZL 3A6BL 5AWNL 4RGMC 1NCAH 4OD1H 2YHGA 5L8LB 1HDMA 4K7PL 5IK3A 3IXAA 4O9HH 4UIKL 4G6JH 4GG8A 4M7KL 3PL6C 3WMSA 2JIXB 2OZ4H 4L4TD 4HEPG 3NTCH 3MRFB 3KYAA 4KPHL 4XGZB 5LKNA 1LO2H 4TRPL 4JRYA 1C5DB 3CFBA 1MJJA 5CZXD 5E9DE 2IPKA 3MGOB 4PJIE 2R56H 4R9HA 4HUUA 4JHAL 3SDXF 1HHIA 1N64H 4PJXB 4GRLD 4HIJA 3ZYOA 5FOBB 4GRWB 4BYHA 3CDGA 3OXSB 3MMEB 4IEFB 1RURL 5EWIH 5E8OA 3TC9A 4FQJL 2D9CA 4XX1E 5MHSD 5GRXG 2DLGA 4M6MH 4YC2C 2ORBL 3TN0C 1DQMH 1G6VK 1XF5A 5D6CA 3CGTA 4U0QB 3GSXA 3RVTD 5DHYA 4WUUE 4P49A 3ISWA 4MCZA 1ZV5A 4YDVA 5F8RC 4I77L 4CMMB 3BO8A 2CLVB 3MROA 1OF2B 3G5XB 3QO0B 3KPOB 3S36H 3DUSA 2F54E 5JHLH 5HHXL 1BLNA 5GJSH 3S96B 3ZT6A 5TQ2H 3RY4A 5D70L 3T65A 5A3ID 3DV6B 4P59L 2CRMA 2J8UB 4ODVH 1QBAA 4XPHL 2Z91B 3LKPA 1YN7A 2CUHA 3FONB 4FQXD 2J7LA 3IS1X 5A2FA 1U92A 2HJFA 1NDMA 2D03H 5EA0H 5FYJU 4KROB 1J1XH 4HDIB 4D94A 3UMTA 2R8SH 2EYSB 4NQCE 4PGDA 3O3EA 4GMSH 5K9JL 4JFZH 4LASL 1T1ZA 4NKIH 3VXRB 3ARBA 1A7QL 3SE8H 1FP5A 1OTUD 1ED3B 8FABA 5IJVA 4ONOA 3TT3L 5IMOB 5FYJE 3VG0L 5CBAA 4UT6H 1MHPH 5DEFA 2VDRH 1FE8L 3GMRB 3MOQA 1MH5A 2JF1A 2FH8A 1MCQA 3IDXL 4GAGL 3RWGA 4KJPD 3UX9B 1VEOA 1QSEB 4HV8B 3W0WA 4CU8A 1N0LA 3BE1L 2CJUH 1X5YA 3RUGB 4WWKC 1T5WB 4XWGL 3K46A 4YPGA 5EPMA 4MJ5B 1FFQA 4MCYA 5DO2C 4QXGL 4LVOB 1WWWX 4XCNA 2AV7A 2DQFA 3MREB 5E7FA 1KC5H 1CFSB 1YEGH 2FEDC 3QUYA 2FHCA 3UZVB 4YAQA 5FYLL 5BO1L 4YO0B 4OCRL 4XNUH 1Q9LB 3OXRB 4JRXA 5BS0D 5DRZA 4N5UA 4PJFB 3VRIB 4HKXA 5C2BL 5FYJD 3GKZA 4FFZH 2NW2A 5J57B 1R24B 1EVUA 5AAWA 4U6XA 4CN6A 5E56A 1CFVL 1QLRA 1CGTA 2X4QA 3QDME 4U0RB 5GGUB 2FX8L 3EO1A 2BNQD 4HFWA 3LKNA 3DETC 3SGJA 4FQ2L 3GMPA 3VFVA 1QYGH 5FA4B 3G04B 1MRFH 4U1MA 3MNVB 3UXFA 4JG1L 5C0BB 1T2XA 1MAML 4K94L 5FHBH 5E5RB 4HH9B 1NGQH 1W0YT 1DN0A 3KVQA 3ZKXC 1X4YA 3P3YA 5CBEA 2A6DB 4O2CA 5H2BB 4S10A 5F9JA 3SDCD 2R0WL 4P2OD 1RQ5A 3IS0X 1LD9B 5L6YL 3PWPA 4MYWB 5KSBE 3GBNH 4YHML 3S88H 5JUEL 2X9WA 4WI3A 3WS6C 3P11H 4NN5B 1JNNL 3EYSL 4JAMB 5JXAL 5HJ3A 1EGJH 2B2XH 5CD3B 1DQDL 4WEBH 4PJXF 4HIHA 3U9PH 5I1AA 1EHLL 1JF1A 4LHUB 1KNOA 5LGJB 3OKNB 4KI5C 3LD8C 2NXZD 3RGVC 4LLYB 1FBIL 3Q3GB 1MVUB 1NCBL 4L29A 1GAFL 4FZEL 1KIUA 2AK4D 3SOBH 5C08D 3CVHB 3MXWH 1EMTL 2Z4QB 3S4SB 5IBTL 2Y36H 4WY7L 1CXHA 3JV6B 3OJDB 4ZYKA 2EIEA 1PQZB 3E1F1 4LMQI 1FSKB 2NR6D 3L7FA 1FORH 4LVHB 1QNZH 1G6RA 1S5IH 3WUZA 1WICA 4JM4L 4RGOH 1L4IA 3RX8A 1S7TB 4NP4L 3VFMA 2VZOA 4BH7A 3SDDA 3IRZA 4LCYA 4Y4HC 1NAMA 5I1KL 1JF6A 1VADA 2BRRL 1NDGB 2BP3A 2NXYC 3PGCA 3GRWA 5IVZA 4FTVE 1C08B 3M17B 4QRPE 5FUZH 2IAMD 3LKQB 2BK8A 1R3LA 3VFNA 4Z7QE 5JXEA 4TVPE 4XP1H 1PLGH 2YK1H 3SE9L 1EPFA 5JDSA 4HS6B 4FTVB 1YYML 4Y1AB 4R7DB 2IALB 3BKCL 5FXCH 4F9PA 5F7DB 1VKXB 4D9RD 3IDNB 4Y88A 4Y16C 2HLFC 1Z9SA 2HMIC 12E8H 3MJGX 2J88L 4YIQB 3G6DH 4Z7WB 2AK4B 2FH6A 2HRPH 1WZ1L 5DR5H 4HFUH 4PJAF 4GLRH 1SYSA 1J8HD 3QFJB 2FSEA 4HUXB 4LPCA 4G80B 3X13B 5BS0E 1HN1A 4N8VA 3RBGA 5IEKA 3EYFA 1GHFH 3QJFA 4DQOH 2E9BA 3QFJE 1KENL 1HHGB 4U6YB 3D1MC 1LEIA 3WYRA 2IAMA 1C1EL 1XGTA 4LPXA 4BH8B 4NJAL 2ENSA 3QXDB 5HHOE 1YPZA 3UJJL 1VACB 3BPLC 3O6LH 3GSNB 2R4RH 3BUYB 3WNLA 3HZYA 3MRRA 4F7EA 5C0DB 3G6AA 4JZOB 5TE7L 3ARDC 1FZOA 2F74B 3ZTNH 4OI8A 4KMLB 2OQJA 1J0YA 4UAOC 1RY7B 3I6GB 4Y2DC 5L88H 2ESVE 5DD5L 4M4PA 2VLJB 3PDGA 1IT9H 5BW7A 3QIWC 3MRDB 4WUUB 3V4VL 4OCNC 1RZGA 2EO9A 1A6VL 3TJHD 2H2SD 3KNBA 3O6FC 1DEEA 1PZ5A 1Q9OB 2DICA 1AGCA 1DUZA 4AMKH 5DD3H 3DYPA 3FMGH 1F6AA 4WTWA 1X44A 4IJ3B 4O02H 3W11C 2FHFA 4U6TA 4BZYA 1FC2D 2P24A 1BD2B 4YHYB 2HTKC 5HYQA 3ULSA 4MXQC 4FXKB 5IW6B 3DOSA 4PJ5B 4JFHE 5L0QB 5HDOA 1YEIL 1KEMH 1RIHH 1IGFH 25C8H 5DQDH 1QVOB 4ODBD 4C4KO 4JFQB 3SGDI 1PVHA 3LSOA 4QT5A 3DRTB 5I71C 4HKJA 4CGTA 3MLWH 1M7DA 4L3EE 4X7DC 4DKEL 1J86A 4ZNEE 5LG1A 3NPSB 1HKFA 1OP5K 3DXAD 4WIQA 3TA3C 5KSBB 2B8OT 1YEFH 3MTRA 4R2GB 4I0CC 3SE4A 1JGLH 1GC1C 4G6FD 1RJLA 2IMMA 2VE6A 4K55A 3PV6B 4N0UE 3QDJB 4FXGA 1FJ1A 1FGNL 2OR7A 4ZFZB 1EJOH 1IGCH 4NBZB 3K0WA 5DJ6B 1U95B 2RFXA 1M1SA 1BQUA 5EU6A 2DF3A 1FVDA 4Z8FL 1HILB 1NCCL 3SDYH 1JWUB 1IBGH 1UWEL 4J4PA 3W0WD 2EICA 1KOAA 4G8FA 3VWKD 3T2NH 1AXTL 3RUGE 2PKDA 1J7VR 1AO7B 3HZKA 1C5BH 5JW4R 5E4EC 3PHQB 3OZ9L 4PG9A 4OZIA 1IGYA 4N9GB 2D7TH 5EZJA 3NMEA 4RMWA 2MQ3A 1OP5H 3HZMB 2W9DH 2NY7H 4X6CA 1PDKA 3ROLB 1G6RH 5CEZH 2VZVA 3PG2A 4WU7B 1JNJA 1CDJA 5EOCJ 3WBDA 1OP3H 1CXFA 1KCRL 3NZHL 4GAJH 4RFOH 3RU8L 5EIIA 4QHNA 2VC2L 5T3XL 5C9KA 1EXUB 1LVEA 4PJFE 4NC2B 1AQKL 1UKTA 6FABL 5FO7B 2EKSB 1N8ZA 5DMGD 1IEAA 1OAQH 4KTDH 4I2XA 2I9TA 4X80L 4PREA 1JK8B 1I9JH 4LQFH 2ZJSH 4QXUH 2AAVA 4YC2B 4YJZL 3NFPB 1H3WM 4V1DA 5IJKA 3MRQB 5IGXH 5EO1B 1IGJB 3MA9H 1QFPA 4Y1AE 2EDEA 3I6LE 5CIPA 2K7QA 5DVNA 5D6DC 3FT4B 2DKSA 2EDTA 4I48B 1Z9MA 2OR9L 4F57H 2P7TA 3ZE2F 1EHAA 1ZHBB 5I19H 1D5IL 3MUGA 5DQJB 2DRUA 5J89A 2W9LA 3UROR 4ZXBA 3C60C 3HE7D 1XGUB 4KY1L 1OTSC 5E4IA 5DSCB 2QSQA 4G42B 1CFQA 1H3PH 5J6GA 2HTLC 1WCBA 4XPAH 3SCMC 3ZDXF 1XR9A 3IJYB 1AGDA 4QGTA 4AL8H 5A1AA 4WI8A 3ZKXB 2XG5A 4IOFC 2JK5B 3TNMA 3EFFA 4P2OC 3U2SA 3FQRA 4M1GH 2VKWA 1ZS8A 2GK2A 4GUPB 4RBPK 4Y1AD 4M1CC 2JE8A 4WV1C 5JW4M 1YNLH 4QOKE 4Y4KB 4LGRB 4PJ7A 1A6ZB 1HOCB 3SKJL 2E9WA 1LE5A 1T3FB 1NAKL 1PKOA 2VRAA 4LKCB 4DVBB 4FQCL 2LTQB 3WFCL 1PG7W 3V0VB 1I7UB 5KSAB 1UFUA 3RNQA 5I74C 3CJJA 3FQTA 4U1LA 2MNUA 4JVPA 4M5ZH 1HYSC 1Y18A 2Y6SC 4WHTA 5B38B 3FQUB 3D39B 4JY4A 1HDMB 1CZ8H 4JKLA 3VXUA 4OZFA 5FYKU 3MX0A 1AQDA 3B5TA 1V3JA 4ZUSA 5HI3C 4X4MA 1FO0B 3TBSA 5ACLA 1MRCH 4L3ED 3OR7A 1A9EB 1SEBB 3DSFL 4MAYB 4XCEA 4D0DB 2B7DT 2BVQB 1BJ8A 3KPSA 1DVFB 4UOW0 3NCJH 5FHAH 1UB5A 5IKCB 3V79C 3C5SB 2QV2A 2IF7A 2R1WA 3RWJA 1FFPA 4MB3A 2I60H 4Q0XH 5IHZA 1LMKA 2E3VA 3E3QC 4P2RB 3WD5L 3QHZL 3OMZA 1DBAH 4TTDD 1DVFD 1N64L 2DLIA 1S9WB 3BP6B 4BA8A 1BBJA 4OV6F 3MLZL 4PG2A 5SWZD 4OD2A 1PKQB 5E1AB 5DHVA 5MEQB 4R97C 4Z7UF 2PUQT 1XGPA 4C56D 3GGWB 3B9KB 4WWKD 3MV7A 1KLGA 4C58B 2VQTA 2VLRB 4F9LC 4NZTL 5DWUL 1KN2H 4QY8A 4NQXB 3UC0H 3D69B 2RBLA 3QISA 3H7BB 5BVPL 4CJ0A 1P1ZB 4X4ME 1NFDB 3TO4C 3KHQA 3FB7B 2WUCH 3P0VH 3WV0A 1B0GB 1YEKH 1YMMB 3VXUE 1LK3H 4JY5L 3RZCA 4YE4H 1BX2A 4JZJB 1OTUC 2F53D 4GO6B 1RJYA 5I73B 3BIBX 1BMGA 1KIQB 4P2RD 2NNAB 2NX5B 4TULH 1GIGH 4LSTL 3H3KA 1ADQA 2QHLA 3LPFA 2D0GA 2Y6SD 4WVRA 3IXAB 4KKCD 5MEPA 4K9EH 2R9HD 1MFNA 2FJHB 1UACH