1FNTc

Crystal structure of the 20s proteasome from yeast in complex with the proteasome activator pa26 from trypanosome brucei at 3.2 angstroms resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
198
Chain Sequence
AALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALRESPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGTDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASOME COMPONENT C7-ALPHA
publication title Structural basis for the activation of 20S proteasomes by 11S regulators.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase activator
total genus 65
structure length 198
sequence length 226
chains with identical sequence d, e, f, g, h, i, j, k, l, m, n, o, p
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
c PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1fntc01
3JTLO 3JSEO 3JRMO 3IPMO 1YARO 1AVOB 1FNTc 1Z7Qc 1YA7O 1YAUO
chains in the Genus database with same CATH superfamily
2V3CC 2KYHA 5TJ5E 2L7AA 1G4WR 4PK4A 1NLXA 1JPJA 3TOLA 3DMDA 5BQGA 3TK0A 4CDYA 4XPWA 2R7OA 2OCCC 3C18A 2KQ9A 1ZHXA 2LCHA 1M57C 4JTCB 5AGFA 3W8HA 3FAPB 1LS1A 2QUPA 2JX0A 2KW3C 3ZTMA 4CSAC 5KYUA 3R2PA 2J8WA 5DQTA 4BG0A 3LS1A 3SZRA 3T6BA 2TMVP 1IW7F 5F5FA 3IQCA 2Q00A 3HTKC 2WZFA 2YL1A 3U8VA 1APCA 1QPUA 2IOQA 3B0PA 3DE9A 1HW1A 2VCAA 1KTMA 3C7JA 4KNWA 4U5BE 1MNDA 3NRHA 1Z23A 4PFPA 3ITFA 4WABA 1ORJA 3UMIA 1A7VA 2Q9BA 3K33A 3SP1A 3ZG1A 1T6UA 2J9UA 1NZEA 1VB5A 1OXBA 1WN0A 3EGDA 1D1BA 3FXHA 4O6YA 1Q0GA 2RSEB 5DLJA 4O79A 3TJ6A 3GODA 2VH3A 1OCOC 2PP4A 2XLHA 4OINF 4N4WA 1JPNA 4Q7CA 2JPUA 2CGEA 1FMWA 3NKDA 1HMOA 1I5NA 4P9FA 3S9OA 1LVKA 1Q0MA 1T9KA 2HJ3A 4FX5A 2R7XA 2Q9AA 1ORYA 3WG7C 1O5HA 5E3AA 5L0HA 2Q7RA 3N0TA 4NTAA 1DOWA 1SYQA 3MYIA 4JJFA 4PJMA 2HMZA 3H2VA 1WGWA 2XRHA 3KKBA 3MX3A 2BE5F 3SYNA 5B3SC 2YRFA 4RDAA 1YA9A 3H65A 2WB7A 3UGPA 1BBHA 1L3PA 3M15A 1MQVA 3U3FA 1U89A 2HSBA 4EHPA 2PX0A 3KL4A 3G4XA 3E9VA 4NQFA 1HE9A 2W9YA 4CIHA 4CIPA 3U0CA 4BJ6C 5HV9A 1E84A 2NSFA 1VLTA 5JUAA 1MNEA 1YLMA 1Q0FA 1Q0KA 3NKEA 4JZAA 3SXMA 4IARA 3V5YA 3RVZA 3A11A 1CGME 4Z9IA 3HNIA 4O6NA 3EJNA 4JTAB 5B1BC 4DBQA 4JURI 2F22A 4CDVA 3GEEA 3HLZA 1OW6A 4I1OB 1Z5ZA 3ZDLA 3POVA 4QI2A 4BEJA 2EPMX 1PCXA 2ASRA 1AUEA 4AK9A 1FMVA 5D91A 2P6VA 3LAYA 2A0UA 4PFOA 3L34A 3RFYA 4DRHB 2OEVA 2NG1A 3VF0A 1TFKB 1U6HA 1OCCC 3MBGA 4J32B 2HMQA 4YT2A 2PBEA 5L0IA 4OIPF 2BC5A 1CPRA 2MYSA 2GAQA 3UMHA 1CPQA 1YVIA 5COFA 4EWCA 5HSWA 4LLEA 2OKUA 3FVYA 4XEFA 4L6RA 2XXAB 2HJMA 4AL1A 1ZHWA 3ABMC 3S27A 4JEAA 4BJ5C 2EPLX 4W8PA 2R7SA 4DJ9A 5BQHA 3A9CA 2D4UA 2VCBA 3CZ6A 2DI3A 2IYLD 1W2WA 2LIGA 3EFOB 3TQOA 3IQ5A 4EBBA 2A69F 1BZ4A 3E70C 4LERA 4E7SA 5DS6A 2YZSA 1H9TA 5E2QA 3DM9B 3VAYA 4J7YA 4MTFA 1GGQA 1GM5A 3QW0A 3LESA 3DZAA 2HZ8A 3TJ5A 5FCLA 3B0UX 2CYDA 3AG4C 3FMSA 4MVMA 4OD5A 2R7VA 1FFHA 256BA 4U5EE 3LJBA 4DRIB 4I44A 4Z9JA 1O3UA 1YZAA 4XEKA 1A41A 1OR3A 1Y4CA 2BL2A 1WTYA 2Q3TA 1VTMP 1NSGB 5JT4A 2J7PD 1IZMA 3DE8A 4MVUA 1OKKD 1FR0A 3W8IA 1MMDA 1CGNA 3JZ0A 4YWQA 1EI7A 1BR2A 1R5ID 2DB4A 1VYKA 3L1MA 3Q6NA 1BR1A 2Y3BA 4N6HA 4P9TA 4XTKA 3N2ZB 1H6GA 3OWTA 1TKNA 4O7GA 4RD9A 4D4XA 3BRJA 3Q6MA 2IXOA 1C17M 3EH2A 3FOPA 3LLIA 4FWVA 4QDLA 5DS5A 1LKXA 1RKCA 2A6EF 1OQCA 2EIKC 2V26A 3KPHA 1OXKA 4GEHA 3G50A 4H4KC 4U5DE 3AGTA 2EILC 2P7VA 1VK5A 1T5OA 5KYXB 3EGXB 2LFDA 1TWGA 4LDQA 1ZHTA 2GFHA 2LSEA 3SXZA 3JTLO 1ZHYA 3WODF 1MMGA 2AU5A 3IPMO 5F28E 4E0IA 5K0IA 2OJQA 3AG2C 1E83A 1L7CA 4M63A 3EHNA 4NTBA 4I3MA 1LE2A 1FTSA 2G3KA 3C8GB 4AE4A 4EBKA 2DYSC 4OIQF 4LACB 4RBNA 5D92A 3HNJA 3RW0A 2HV7A 1EQ1A 1NU7D 1M56C 2J7PA 3JSZA 3O10A 2Y39A 5T1DB 1C03A 1OKKA 1RXQA 1V74B 2I8BA 2OG2A 3EHMA 2NSGA 3J06A 3RQFA 3M4CA 3EFOA 3JSEO 5JLIA 1DOVA 4MVZA 3R7CA 2L6FA 5F5HA 3EZIA 4WJ0A 4XLNF 4IJJA 1KU2A 4UDVA 2Y3DA 3LUTB 4K1OA 3HNLA 3GM3A 3KYIA 2FGYA 2G62A 4LLCA 4U5CE 4YN0B 2YL0A 5EHHA 1PD1A 4JJGA 3C8GD 2J45A 3DJUB 3VRCA 1XWJA 3OEOA 3EPVA 2KSFA 3T9OA 3QW1A 1OR2A 1I4ZA 2C03A 2XL4A 2R7RA 4CSAA 2CDQA 4EKWA 1Z3IX 1ZW2A 4D4NA 1UG7A 4G78A 4JRZA 1VYIA 2GDCA 3C8ZA 4XPYA 4XQ1A 3RQGA 2LFFA 3K1IC 1OW8A 1Z7Qc 5DQZA 4U5HA 5BUOA 3OA1A 4XPXA 3X2QC 5BQIA 2Y3GA 4OIOF 4ZLCA 3U5SA 5L3VA 2DGJA 2EPOA 3W4YA 1K04A 5KYXA 3EGXA 1C02A 2QLAA 1H9GA 3V5XA 4NTFA 1YZCA 2CCYA 4BJ1A 5L0CA 2IXMA 5KYYB 4R32A 4MVSA 3I5PA 4YL1A 3NDBB 4A2NB 1O87A 4OD4A 4MW3A 3U2LA 2HV6A 4EBJA 1J8MF 4CX9A 3C8GA 1V54C 2A1DD 1I4YA 2J9BA 4ULVA 4EIYA 1BR4A 3T6GB 4CBEA 3JYHA 2XS1A 2LK4A 4I1MA 4KI2A 2UUHA 3RIPA 5KYNA 1E86A 2NUTB 4HE8D 3B71A 1LM3B 4PACA 2IBFA 3K1IA 3ZSUA 2YQYA 2XXAA 4C3DA 2KJGA 4YT4A 5L0GA 3B9QA 2YL7A 3O6XA 4MTOA 4CS8C 1ZZPA 3ABLC 1D1CA 4IGGA 3JRTA 3SXYA 5L0DA 4U9DA 1V4AA 3V7OA 4CDAA 3HKKA 2PX3A 2R9RB 3FDQA 1LPEA 1TR2A 2WVNA 1EA8A 1RJ9B 2H7OA 2L6HA 4BJ6A 2YKZA 4CS7A 3F47A 3NMJA 3MYFA 3Q7LA 4ONSA 3IEEA 3PDMP 1TFOB 4PJJA 4QI0A 4JE9A 1SMYF 2CNWD 2W45A 3LEVA 3M4BA 4J30B 2NPUA 4NCQA 1A0BA 1QQ3A 1Z63A 2KGOA 5L0FA 4MTGA 4E0HA 5A6BD 1Q0DA 3U9JA 4DRJB 4XLPF 3L8JA 3QTHA 3QVZA 2ZXPA 4IAQA 1HE1A 3DI5A 3AOUA 4X0RA 1HW2A 4E17A 1A7DA 4KNVA 4MS2A 4W8KA 1G8XA 3G4ZA 3RVYA 2XLWA 2ZXWC 4HFFB 4CJGA 3DM5A 1JRAA 2YEVA 1SF8A 2P1AA 4J7TA 2XSEA 1LS4A 1TWAA 3RQEA 2L6GA 3GM1A 3RYLA 1VOMA 1AEPA 4EUKB 5AC4A 4CS8A 3RKOF 2IM8A 3AG1C 5JVEA 5COMA 2DYRC 4G7ZF 2KC3A 4MVOA 4JKVA 2A68F 4P6IC 4ANJA 4PR9A 4A4AA 4G7HF 4JVSA 1LI5A 2P0NA 3O39A 3S28A 2IXPA 3TOMA 4DVZA 1KNYA 1PD0A 2FFHA 3MFNA 5JSLA 3FOOA 1RMVA 2XLOA 2XS8A 2B0HA 4BJ5A 3DWWA 1S7ZA 4CJOA 4N6CA 2CNWA 1T6QA 2ETSA 1V55C 5E33A 2NUTA 4YK5A 2YL3A 4G0HA 4XWJA 1GS9A 3ZVRA 4C3EA 3O55A 4Q5SF 1EKYA 5A6BA 3CAXA 2EIMC 4C7OB 4LDKA 1ORSC 3U2MA 3EGDB 1M2VB 2A0BA 4PJNA 3GEIA 3IQTA 3U8PA 2UUIA 1FFTC 4WGZA 3HJCA 4WGYA 2C04A 3ZIBA 4DVYP 2YLDA 4JTDB 5EK0A 3PCVA 2Y3HA 2XL6A 1HMDA 1RJ9A 2A6HF 2AVKA 2NUPB 3V5ZA 4C3BA 2AWYA 3AJMA 2YLGA 4NC3A 1RKEB 5B1AC 1YYXA 2L9JA 4G7OF 1R4TA 1ZU4A 1M2OA 3GWNA 2HFIA 3Q7GA 1Y6DA 1A7EA 2GA0A 3DAFA 1LE4A 3PMRA 5CI9A 1YDIA 2E87A 3JT1A 1N1CA 1MMAA 2O9XA 1H7IA 2R7QA 1ZU5A 3K7DA 5AC5A 3EG9B 3SNHA 1BDJB 4Q4ZF 3FHDA 2R02A 1NU9C 4MW8A 5A69A 3PHF2 2VB6A 1QVXA 3NMIA 2OEXA 3NYMA 3AG3C 1Z6AA 3T4RA 2HSQA 3WHNA 3S84A 2WL8A 3VYWA 4GYTA 4MVRA 3QVYA 2Q9CA 3NG1A 3VM6A 3JYYA 4DXWA 5JP7A 2PNOA 1PV3A 4K0DA 3NYLA 5IY5C 4PJLA 1MMNA 3DJNB 5A6KA 1B68A 3TD7A 3CEXA 2R7TA 5COGA 3SEOA 4KC9A 4JCZA 5JS5A 3AGUA 2YHSA 3LS0A 3UMKA 4B6IA 4BPMA 4JCHA 2Z15A 1QZXA 3K66A 3DAGA 3FAJA 1FNTc 3GEHA 2RD9A 3LLKA 5CIVA 2LP4A 1UFBA 3S0XA 2I15A 2M4EA 1TWCA 5GPGB 2HUJA 2LD6A 3S29A 1M2VA 2R25A 4JW1A 5A6JA 3RF3A 2ZD9A 5CI8A 1GQAA 4IB4A 2VASA 2H7VC 3W2VA 1CGOA 1WOLA 2EINC 3SXKA 5KYWB 2FAPB 5A6AA 4HFKB 2R7UA 2EPKX 2NUPA 3KYJA 4MVQA 1U0BB 4OIRF 3UR3C 2XLEA 4NY3A 3US6A 1RKEA 5DVWA 5JRAA 3K1HA 1NBBA 3ABKC 2AWCA 2PF4E 2J0WA 3ASNC 3IHUA 3IQ6A 1OW7A 2HS5A 3EZHA 1NFOA 3LNMB 3KMIA 4U5FE 2VC9A 2EIJC 2J9VA 4LDRA 1YJGA 3LNRA 4ULWA 1AVOB 4DBRA 4AX2A 4C7OA 2GWWA 2WZGA 3EG9A 3QZCA 1XZPA 2QE9A 1ZHZA 4CS9C 1NFNA 1D0YA 1TQGA 2KK1A 2PFDA 3GWLA 3K6BA 3KH2A 3ZQYA 2WVQA 2WZLA 4YT8A 4ER9A 2Q4FA 4JIOA 2D5RB 1WASA 1JOGA 3X1OA 5L0JA 2YLIA 3ASOC 1WWPA 2XLMA 3GM2A 2X0CA 4N06A 3ZC4A 1J8YF 1D1AA 1S05A 4MNDA 1K40A 2LQGA 4F4BA 2OOCA 2EPNA 2WVOA 3M1CB 3C63A 3S90A 2YVKA 1SZIA 1ST6A 1ZYRF 4BEMJ 4YL3A 2W4BA 2XL8A 4AL0A 3UGOA 2AP3A 3ZWIA 1ZVZA 2Y69C 3ECSA 2ZXRA 3W2WA 2VCCA 1YARO 4H54A 2W4MA 4IRUA 2IXNA 1E2XA 2H8AA 2MWQA 4IAOA 4HEAJ 4FAPB 1LI7A 3C62A 3U3BA 3B0VC 1VLSA 3EQLF 3MLGA 5B3IA 1ZW3A 2B0JA 2OU6A 4GQHA 4IWBA 3AQBA 2ZPAA 4CS9A 4E18A 1LIHA 2ICWG 2P61A 2CW0F 2OJED 2QY9A 2XLDA 5KYUB 3N24A 1F1MA 2XM0A 5KYWA 5KYYA 3GORA 1D0ZA 2J0XA 4KBLA 4Z9HA 2R03A 3ZQVA 4AE4B 2JD3A 3I5QA 5FZTA 2L81A 3GANA 2QNLA 3ATPA 3L8IA 1D0XA 2R05A 3B29A 1JR8A 1HY5A 2OQMA 4XEVA 3H2UA 3LEOA 3L0IA 3U9MA 3UNGC 2XLVA 1RCPA 4U9EA 2J9WA 1TWHA 3DKAA 3ZTZA 3JRMO 2HKVA 2QTVA 3BEHA 2KNHA 1YYJA 3F46A 3RH3A 3DD7A 3T6JA 1NG1A 2MHRA 1G5ZA 1T6IA 3HNKA 3QMKA 5E3CA 5DS4A 5T3WA 1T01A 1JAFA 4JC7A 3EH1A 3I4UA 4YJWA 1FAPB 1E85A 1QLEC 3TULA 3AQCA 4YL0A 1G4US 3JCUQ 1OCZC 3CSKA 2X51A 3DXJF 2ZXOA 2H7BA 2M64A 4O6MA 4BJTA 1XZQA 4ZLDA 1K05A 3NMKA 4K7BA 5T3TA 4DOZA 4E7ZA 4JEBA 1WATA 4U5GA 1QKRA 1SR2A 1YAUO 3CQZA 4FESA 4YT5A 1M6TA 5EGYA 5L3QA 3WAQA 2J46A 2YWAA 3M79A 2R7WA 1JMWA 2XM4A 1VMAA 1OCRC 3NYJA 2G3VA 4MQ9F 1YA7O 1QSPA
chains in the Genus database with same CATH topology
3JTLO 3JSEO 3JRMO 3IPMO 1YARO 1AVOB 1FNTc 1Z7Qc 1YA7O 1YAUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTL O;  3JSE O;  3JRM O;  3IPM O;  1YAR O;  1AVO B;  1FNT c;  1Z7Q c;  1YA7 O;  1YAU O; 
#chains in the Genus database with same CATH topology
 2V3C C;  2KYH A;  5TJ5 E;  2L7A A;  1G4W R;  4PK4 A;  1NLX A;  1JPJ A;  3TOL A;  3DMD A;  5BQG A;  3TK0 A;  4CDY A;  4XPW A;  2R7O A;  2OCC C;  3C18 A;  2KQ9 A;  1ZHX A;  2LCH A;  1M57 C;  4JTC B;  5AGF A;  3W8H A;  3FAP B;  1LS1 A;  2QUP A;  2JX0 A;  2KW3 C;  3ZTM A;  4CSA C;  5KYU A;  3R2P A;  2J8W A;  5DQT A;  4BG0 A;  3LS1 A;  3SZR A;  3T6B A;  2TMV P;  1IW7 F;  5F5F A;  3IQC A;  2Q00 A;  3HTK C;  2WZF A;  2YL1 A;  3U8V A;  1APC A;  1QPU A;  2IOQ A;  3B0P A;  3DE9 A;  1HW1 A;  2VCA A;  1KTM A;  3C7J A;  4KNW A;  4U5B E;  1MND A;  3NRH A;  1Z23 A;  4PFP A;  3ITF A;  4WAB A;  1ORJ A;  3UMI A;  1A7V A;  2Q9B A;  3K33 A;  3SP1 A;  3ZG1 A;  1T6U A;  2J9U A;  1NZE A;  1VB5 A;  1OXB A;  1WN0 A;  3EGD A;  1D1B A;  3FXH A;  4O6Y A;  1Q0G A;  2RSE B;  5DLJ A;  4O79 A;  3TJ6 A;  3GOD A;  2VH3 A;  1OCO C;  2PP4 A;  2XLH A;  4OIN F;  4N4W A;  1JPN A;  4Q7C A;  2JPU A;  2CGE A;  1FMW A;  3NKD A;  1HMO A;  1I5N A;  4P9F A;  3S9O A;  1LVK A;  1Q0M A;  1T9K A;  2HJ3 A;  4FX5 A;  2R7X A;  2Q9A A;  1ORY A;  3WG7 C;  1O5H A;  5E3A A;  5L0H A;  2Q7R A;  3N0T A;  4NTA A;  1DOW A;  1SYQ A;  3MYI A;  4JJF A;  4PJM A;  2HMZ A;  3H2V A;  1WGW A;  2XRH A;  3KKB A;  3MX3 A;  2BE5 F;  3SYN A;  5B3S C;  2YRF A;  4RDA A;  1YA9 A;  3H65 A;  2WB7 A;  3UGP A;  1BBH A;  1L3P A;  3M15 A;  1MQV A;  3U3F A;  1U89 A;  2HSB A;  4EHP A;  2PX0 A;  3KL4 A;  3G4X A;  3E9V A;  4NQF A;  1HE9 A;  2W9Y A;  4CIH A;  4CIP A;  3U0C A;  4BJ6 C;  5HV9 A;  1E84 A;  2NSF A;  1VLT A;  5JUA A;  1MNE A;  1YLM A;  1Q0F A;  1Q0K A;  3NKE A;  4JZA A;  3SXM A;  4IAR A;  3V5Y A;  3RVZ A;  3A11 A;  1CGM E;  4Z9I A;  3HNI A;  4O6N A;  3EJN A;  4JTA B;  5B1B C;  4DBQ A;  4JUR I;  2F22 A;  4CDV A;  3GEE A;  3HLZ A;  1OW6 A;  4I1O B;  1Z5Z A;  3ZDL A;  3POV A;  4QI2 A;  4BEJ A;  2EPM X;  1PCX A;  2ASR A;  1AUE A;  4AK9 A;  1FMV A;  5D91 A;  2P6V A;  3LAY A;  2A0U A;  4PFO A;  3L34 A;  3RFY A;  4DRH B;  2OEV A;  2NG1 A;  3VF0 A;  1TFK B;  1U6H A;  1OCC C;  3MBG A;  4J32 B;  2HMQ A;  4YT2 A;  2PBE A;  5L0I A;  4OIP F;  2BC5 A;  1CPR A;  2MYS A;  2GAQ A;  3UMH A;  1CPQ A;  1YVI A;  5COF A;  4EWC A;  5HSW A;  4LLE A;  2OKU A;  3FVY A;  4XEF A;  4L6R A;  2XXA B;  2HJM A;  4AL1 A;  1ZHW A;  3ABM C;  3S27 A;  4JEA A;  4BJ5 C;  2EPL X;  4W8P A;  2R7S A;  4DJ9 A;  5BQH A;  3A9C A;  2D4U A;  2VCB A;  3CZ6 A;  2DI3 A;  2IYL D;  1W2W A;  2LIG A;  3EFO B;  3TQO A;  3IQ5 A;  4EBB A;  2A69 F;  1BZ4 A;  3E70 C;  4LER A;  4E7S A;  5DS6 A;  2YZS A;  1H9T A;  5E2Q A;  3DM9 B;  3VAY A;  4J7Y A;  4MTF A;  1GGQ A;  1GM5 A;  3QW0 A;  3LES A;  3DZA A;  2HZ8 A;  3TJ5 A;  5FCL A;  3B0U X;  2CYD A;  3AG4 C;  3FMS A;  4MVM A;  4OD5 A;  2R7V A;  1FFH A;  256B A;  4U5E E;  3LJB A;  4DRI B;  4I44 A;  4Z9J A;  1O3U A;  1YZA A;  4XEK A;  1A41 A;  1OR3 A;  1Y4C A;  2BL2 A;  1WTY A;  2Q3T A;  1VTM P;  1NSG B;  5JT4 A;  2J7P D;  1IZM A;  3DE8 A;  4MVU A;  1OKK D;  1FR0 A;  3W8I A;  1MMD A;  1CGN A;  3JZ0 A;  4YWQ A;  1EI7 A;  1BR2 A;  1R5I D;  2DB4 A;  1VYK A;  3L1M A;  3Q6N A;  1BR1 A;  2Y3B A;  4N6H A;  4P9T A;  4XTK A;  3N2Z B;  1H6G A;  3OWT A;  1TKN A;  4O7G A;  4RD9 A;  4D4X A;  3BRJ A;  3Q6M A;  2IXO A;  1C17 M;  3EH2 A;  3FOP A;  3LLI A;  4FWV A;  4QDL A;  5DS5 A;  1LKX A;  1RKC A;  2A6E F;  1OQC A;  2EIK C;  2V26 A;  3KPH A;  1OXK A;  4GEH A;  3G50 A;  4H4K C;  4U5D E;  3AGT A;  2EIL C;  2P7V A;  1VK5 A;  1T5O A;  5KYX B;  3EGX B;  2LFD A;  1TWG A;  4LDQ A;  1ZHT A;  2GFH A;  2LSE A;  3SXZ A;  3JTL O;  1ZHY A;  3WOD F;  1MMG A;  2AU5 A;  3IPM O;  5F28 E;  4E0I A;  5K0I A;  2OJQ A;  3AG2 C;  1E83 A;  1L7C A;  4M63 A;  3EHN A;  4NTB A;  4I3M A;  1LE2 A;  1FTS A;  2G3K A;  3C8G B;  4AE4 A;  4EBK A;  2DYS C;  4OIQ F;  4LAC B;  4RBN A;  5D92 A;  3HNJ A;  3RW0 A;  2HV7 A;  1EQ1 A;  1NU7 D;  1M56 C;  2J7P A;  3JSZ A;  3O10 A;  2Y39 A;  5T1D B;  1C03 A;  1OKK A;  1RXQ A;  1V74 B;  2I8B A;  2OG2 A;  3EHM A;  2NSG A;  3J06 A;  3RQF A;  3M4C A;  3EFO A;  3JSE O;  5JLI A;  1DOV A;  4MVZ A;  3R7C A;  2L6F A;  5F5H A;  3EZI A;  4WJ0 A;  4XLN F;  4IJJ A;  1KU2 A;  4UDV A;  2Y3D A;  3LUT B;  4K1O A;  3HNL A;  3GM3 A;  3KYI A;  2FGY A;  2G62 A;  4LLC A;  4U5C E;  4YN0 B;  2YL0 A;  5EHH A;  1PD1 A;  4JJG A;  3C8G D;  2J45 A;  3DJU B;  3VRC A;  1XWJ A;  3OEO A;  3EPV A;  2KSF A;  3T9O A;  3QW1 A;  1OR2 A;  1I4Z A;  2C03 A;  2XL4 A;  2R7R A;  4CSA A;  2CDQ A;  4EKW A;  1Z3I X;  1ZW2 A;  4D4N A;  1UG7 A;  4G78 A;  4JRZ A;  1VYI A;  2GDC A;  3C8Z A;  4XPY A;  4XQ1 A;  3RQG A;  2LFF A;  3K1I C;  1OW8 A;  1Z7Q c;  5DQZ A;  4U5H A;  5BUO A;  3OA1 A;  4XPX A;  3X2Q C;  5BQI A;  2Y3G A;  4OIO F;  4ZLC A;  3U5S A;  5L3V A;  2DGJ A;  2EPO A;  3W4Y A;  1K04 A;  5KYX A;  3EGX A;  1C02 A;  2QLA A;  1H9G A;  3V5X A;  4NTF A;  1YZC A;  2CCY A;  4BJ1 A;  5L0C A;  2IXM A;  5KYY B;  4R32 A;  4MVS A;  3I5P A;  4YL1 A;  3NDB B;  4A2N B;  1O87 A;  4OD4 A;  4MW3 A;  3U2L A;  2HV6 A;  4EBJ A;  1J8M F;  4CX9 A;  3C8G A;  1V54 C;  2A1D D;  1I4Y A;  2J9B A;  4ULV A;  4EIY A;  1BR4 A;  3T6G B;  4CBE A;  3JYH A;  2XS1 A;  2LK4 A;  4I1M A;  4KI2 A;  2UUH A;  3RIP A;  5KYN A;  1E86 A;  2NUT B;  4HE8 D;  3B71 A;  1LM3 B;  4PAC A;  2IBF A;  3K1I A;  3ZSU A;  2YQY A;  2XXA A;  4C3D A;  2KJG A;  4YT4 A;  5L0G A;  3B9Q A;  2YL7 A;  3O6X A;  4MTO A;  4CS8 C;  1ZZP A;  3ABL C;  1D1C A;  4IGG A;  3JRT A;  3SXY A;  5L0D A;  4U9D A;  1V4A A;  3V7O A;  4CDA A;  3HKK A;  2PX3 A;  2R9R B;  3FDQ A;  1LPE A;  1TR2 A;  2WVN A;  1EA8 A;  1RJ9 B;  2H7O A;  2L6H A;  4BJ6 A;  2YKZ A;  4CS7 A;  3F47 A;  3NMJ A;  3MYF A;  3Q7L A;  4ONS A;  3IEE A;  3PDM P;  1TFO B;  4PJJ A;  4QI0 A;  4JE9 A;  1SMY F;  2CNW D;  2W45 A;  3LEV A;  3M4B A;  4J30 B;  2NPU A;  4NCQ A;  1A0B A;  1QQ3 A;  1Z63 A;  2KGO A;  5L0F A;  4MTG A;  4E0H A;  5A6B D;  1Q0D A;  3U9J A;  4DRJ B;  4XLP F;  3L8J A;  3QTH A;  3QVZ A;  2ZXP A;  4IAQ A;  1HE1 A;  3DI5 A;  3AOU A;  4X0R A;  1HW2 A;  4E17 A;  1A7D A;  4KNV A;  4MS2 A;  4W8K A;  1G8X A;  3G4Z A;  3RVY A;  2XLW A;  2ZXW C;  4HFF B;  4CJG A;  3DM5 A;  1JRA A;  2YEV A;  1SF8 A;  2P1A A;  4J7T A;  2XSE A;  1LS4 A;  1TWA A;  3RQE A;  2L6G A;  3GM1 A;  3RYL A;  1VOM A;  1AEP A;  4EUK B;  5AC4 A;  4CS8 A;  3RKO F;  2IM8 A;  3AG1 C;  5JVE A;  5COM A;  2DYR C;  4G7Z F;  2KC3 A;  4MVO A;  4JKV A;  2A68 F;  4P6I C;  4ANJ A;  4PR9 A;  4A4A A;  4G7H F;  4JVS A;  1LI5 A;  2P0N A;  3O39 A;  3S28 A;  2IXP A;  3TOM A;  4DVZ A;  1KNY A;  1PD0 A;  2FFH A;  3MFN A;  5JSL A;  3FOO A;  1RMV A;  2XLO A;  2XS8 A;  2B0H A;  4BJ5 A;  3DWW A;  1S7Z A;  4CJO A;  4N6C A;  2CNW A;  1T6Q A;  2ETS A;  1V55 C;  5E33 A;  2NUT A;  4YK5 A;  2YL3 A;  4G0H A;  4XWJ A;  1GS9 A;  3ZVR A;  4C3E A;  3O55 A;  4Q5S F;  1EKY A;  5A6B A;  3CAX A;  2EIM C;  4C7O B;  4LDK A;  1ORS C;  3U2M A;  3EGD B;  1M2V B;  2A0B A;  4PJN A;  3GEI A;  3IQT A;  3U8P A;  2UUI A;  1FFT C;  4WGZ A;  3HJC A;  4WGY A;  2C04 A;  3ZIB A;  4DVY P;  2YLD A;  4JTD B;  5EK0 A;  3PCV A;  2Y3H A;  2XL6 A;  1HMD A;  1RJ9 A;  2A6H F;  2AVK A;  2NUP B;  3V5Z A;  4C3B A;  2AWY A;  3AJM A;  2YLG A;  4NC3 A;  1RKE B;  5B1A C;  1YYX A;  2L9J A;  4G7O F;  1R4T A;  1ZU4 A;  1M2O A;  3GWN A;  2HFI A;  3Q7G A;  1Y6D A;  1A7E A;  2GA0 A;  3DAF A;  1LE4 A;  3PMR A;  5CI9 A;  1YDI A;  2E87 A;  3JT1 A;  1N1C A;  1MMA A;  2O9X A;  1H7I A;  2R7Q A;  1ZU5 A;  3K7D A;  5AC5 A;  3EG9 B;  3SNH A;  1BDJ B;  4Q4Z F;  3FHD A;  2R02 A;  1NU9 C;  4MW8 A;  5A69 A;  3PHF 2;  2VB6 A;  1QVX A;  3NMI A;  2OEX A;  3NYM A;  3AG3 C;  1Z6A A;  3T4R A;  2HSQ A;  3WHN A;  3S84 A;  2WL8 A;  3VYW A;  4GYT A;  4MVR A;  3QVY A;  2Q9C A;  3NG1 A;  3VM6 A;  3JYY A;  4DXW A;  5JP7 A;  2PNO A;  1PV3 A;  4K0D A;  3NYL A;  5IY5 C;  4PJL A;  1MMN A;  3DJN B;  5A6K A;  1B68 A;  3TD7 A;  3CEX A;  2R7T A;  5COG A;  3SEO A;  4KC9 A;  4JCZ A;  5JS5 A;  3AGU A;  2YHS A;  3LS0 A;  3UMK A;  4B6I A;  4BPM A;  4JCH A;  2Z15 A;  1QZX A;  3K66 A;  3DAG A;  3FAJ A;  1FNT c;  3GEH A;  2RD9 A;  3LLK A;  5CIV A;  2LP4 A;  1UFB A;  3S0X A;  2I15 A;  2M4E A;  1TWC A;  5GPG B;  2HUJ A;  2LD6 A;  3S29 A;  1M2V A;  2R25 A;  4JW1 A;  5A6J A;  3RF3 A;  2ZD9 A;  5CI8 A;  1GQA A;  4IB4 A;  2VAS A;  2H7V C;  3W2V A;  1CGO A;  1WOL A;  2EIN C;  3SXK A;  5KYW B;  2FAP B;  5A6A A;  4HFK B;  2R7U A;  2EPK X;  2NUP A;  3KYJ A;  4MVQ A;  1U0B B;  4OIR F;  3UR3 C;  2XLE A;  4NY3 A;  3US6 A;  1RKE A;  5DVW A;  5JRA A;  3K1H A;  1NBB A;  3ABK C;  2AWC A;  2PF4 E;  2J0W A;  3ASN C;  3IHU A;  3IQ6 A;  1OW7 A;  2HS5 A;  3EZH A;  1NFO A;  3LNM B;  3KMI A;  4U5F E;  2VC9 A;  2EIJ C;  2J9V A;  4LDR A;  1YJG A;  3LNR A;  4ULW A;  1AVO B;  4DBR A;  4AX2 A;  4C7O A;  2GWW A;  2WZG A;  3EG9 A;  3QZC A;  1XZP A;  2QE9 A;  1ZHZ A;  4CS9 C;  1NFN A;  1D0Y A;  1TQG A;  2KK1 A;  2PFD A;  3GWL A;  3K6B A;  3KH2 A;  3ZQY A;  2WVQ A;  2WZL A;  4YT8 A;  4ER9 A;  2Q4F A;  4JIO A;  2D5R B;  1WAS A;  1JOG A;  3X1O A;  5L0J A;  2YLI A;  3ASO C;  1WWP A;  2XLM A;  3GM2 A;  2X0C A;  4N06 A;  3ZC4 A;  1J8Y F;  1D1A A;  1S05 A;  4MND A;  1K40 A;  2LQG A;  4F4B A;  2OOC A;  2EPN A;  2WVO A;  3M1C B;  3C63 A;  3S90 A;  2YVK A;  1SZI A;  1ST6 A;  1ZYR F;  4BEM J;  4YL3 A;  2W4B A;  2XL8 A;  4AL0 A;  3UGO A;  2AP3 A;  3ZWI A;  1ZVZ A;  2Y69 C;  3ECS A;  2ZXR A;  3W2W A;  2VCC A;  1YAR O;  4H54 A;  2W4M A;  4IRU A;  2IXN A;  1E2X A;  2H8A A;  2MWQ A;  4IAO A;  4HEA J;  4FAP B;  1LI7 A;  3C62 A;  3U3B A;  3B0V C;  1VLS A;  3EQL F;  3MLG A;  5B3I A;  1ZW3 A;  2B0J A;  2OU6 A;  4GQH A;  4IWB A;  3AQB A;  2ZPA A;  4CS9 A;  4E18 A;  1LIH A;  2ICW G;  2P61 A;  2CW0 F;  2OJE D;  2QY9 A;  2XLD A;  5KYU B;  3N24 A;  1F1M A;  2XM0 A;  5KYW A;  5KYY A;  3GOR A;  1D0Z A;  2J0X A;  4KBL A;  4Z9H A;  2R03 A;  3ZQV A;  4AE4 B;  2JD3 A;  3I5Q A;  5FZT A;  2L81 A;  3GAN A;  2QNL A;  3ATP A;  3L8I A;  1D0X A;  2R05 A;  3B29 A;  1JR8 A;  1HY5 A;  2OQM A;  4XEV A;  3H2U A;  3LEO A;  3L0I A;  3U9M A;  3UNG C;  2XLV A;  1RCP A;  4U9E A;  2J9W A;  1TWH A;  3DKA A;  3ZTZ A;  3JRM O;  2HKV A;  2QTV A;  3BEH A;  2KNH A;  1YYJ A;  3F46 A;  3RH3 A;  3DD7 A;  3T6J A;  1NG1 A;  2MHR A;  1G5Z A;  1T6I A;  3HNK A;  3QMK A;  5E3C A;  5DS4 A;  5T3W A;  1T01 A;  1JAF A;  4JC7 A;  3EH1 A;  3I4U A;  4YJW A;  1FAP B;  1E85 A;  1QLE C;  3TUL A;  3AQC A;  4YL0 A;  1G4U S;  3JCU Q;  1OCZ C;  3CSK A;  2X51 A;  3DXJ F;  2ZXO A;  2H7B A;  2M64 A;  4O6M A;  4BJT A;  1XZQ A;  4ZLD A;  1K05 A;  3NMK A;  4K7B A;  5T3T A;  4DOZ A;  4E7Z A;  4JEB A;  1WAT A;  4U5G A;  1QKR A;  1SR2 A;  1YAU O;  3CQZ A;  4FES A;  4YT5 A;  1M6T A;  5EGY A;  5L3Q A;  3WAQ A;  2J46 A;  2YWA A;  3M79 A;  2R7W A;  1JMW A;  2XM4 A;  1VMA A;  1OCR C;  3NYJ A;  2G3V A;  4MQ9 F;  1YA7 O;  1QSP A; 
#chains in the Genus database with same CATH homology
 3JTL O;  3JSE O;  3JRM O;  3IPM O;  1YAR O;  1AVO B;  1FNT c;  1Z7Q c;  1YA7 O;  1YAU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...