1FO0H

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALLOGENEIC H-2KB MHC CLASS I MOLECULE)
publication title Crystal structure of a T cell receptor bound to an allogeneic MHC molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fo0H02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1fo0H01
2C3GA 3T4AA 5FYJH 3QCVH 1ZT7A 2FZ3B 3ARGB 1B3JA 1OAKL 5CZXD 3V0AC 4M61B 4P46D 4QTHB 3BSZH 5E8NB 1A7NH 3T0XA 5ACZB 5ID0A 5T5FH 2XA8L 1X4ZA 1JGEB 2X4OB 4NN6C 3W81A 4K23H 5DUBB 5MENB 1WITA 2J7LA 3MRFA 4K8RD 4O58H 4NRZA 4M7LT 2YZ8A 3BP5B 2J1KA 4HUKB 4X7FC 4UV4H 3MCLH 2AQ2A 1ZT1A 1P9MC 4JFQA 5CFHA 1IC5H 4X4XB 3PWLA 4RBPK 4YWGL 1CD1A 3GHBH 5J12B 5E56A 3SGEH 1S7UB 4K7PL 5I1DB 2P45B 4LDLB 1HDMA 2AJ3B 4KRPB 4GMTH 4Y8DC 5IB2B 1JPGB 4M1DH 3MNWB 3L3KB 2E8ZA 4S1SH 5E2JA 3QEQA 3I02A 5HHMB 2OLDA 3P2TA 5E95B 5GGSY 3ULSA 3ES6B 5DA0B 3ARDB 3SE4C 5ILTH 4Z76B 3W2DH 5I16A 4Q58C 5EFIA 4YJZL 3S88H 3E8UL 3QFDA 4UT7L 5IOPA 1QVOB 4M43L 3RGVB 1D6EB 3IGAB 1OAKH 3U0PB 3O2VL 5EIVA 5JHDD 5ICZB 2XA8H 4GRLC 3NAAH 4TOYL 1T04A 5T1KA 2XTJE 5E4IA 4ZAKB 4CADB 1N4XL 5I6XC 4UBDD 3V6ZB 3WJLC 2EICA 1T2JA 4PJCB 2EDXA 3H6JA 1RZJC 4B7IA 1SJHB 4YPGA 5ALBL 3U6RB 2FYYA 3PF2A 3BZDA 4K7PH 2Q8AL 4Z6AT 3HN3A 1DVFD 3E6HB 2FIRT 4X8JA 1G1CA 4N90E 4Y4KB 2F74A 2ARJB 3QDJD 5IVZB 3BKCL 5FEBA 4CU7A 4X6CF 3LEVL 1WJ3A 3UTOA 1A1OA 4IIQC 1IGML 2F8OA 1JF1B 1MWAB 1CDCA 5J0BA 3ZDYE 4KJPD 5EBGA 4UT7H 4WTXA 3NN8A 5IM7A 1MHCA 4WWID 5GRZA 3RWFA 5DK2B 4R7NB 5FECB 3C5ZC 3O2VH 3MJ6A 1L7TL 3OGCA 4RISL 2AV7B 4NNXB 3VXSE 5BW7C 4BH7B 2X10A 1ZLVH 2KKQA 1ITBB 1CF8L 4KJQC 1UACL 3RVTD 3VXOB 5ALBH 1Z9SA 3MA7A 5H37G 3CLFH 4LKXB 2Q8AH 2XFXB 1P4LB 4NUJB 1QSFB 1UA6L 1U93B 4GAYB 2XV6B 1A0QL 3BKCH 5E00A 2VWEC 3OQ3B 3LEVH 5DZOA 1Z0NA 4DTGL 1XR9A 1JUFB 3MOAL 4PV9A 2DQFB 2XN9E 3O4OC 1RU9L 1S7QA 1MCBA 5DJCA 4JQXA 1FYTE 1N8ZA 1LVEA 1VADA 1ZA6A 1J0KA 1PG7X 3KVQA 1L7TH 5C0RL 5E70A 4RISH 3GMLA 1CFVL 5IESL 2IBZY 2P5WD 3QCTL 1WBZA 2P8MA 4OLVL 3G08A 5E94A 3BP6B 1RVFL 3UEZA 1CF8H 1T89C 4QRTA 1UACH 1YMMD 1JHTA 3LKSA 2CLRA 3DJ9A 1LE5A 1P7QA 5CEZL 5L2KE 1BZQK 1IGTA 4HGWB 1QSEE 3D39A 2QQNH 32C2B 2DJUA 4LGRB 4R4FL 2YSSA 5EZIL 5DMIL 3C5JB 3H3KA 3BWAA 3NIGE 4ETQA 1A0QH 3NCYS 2F53A 3PL6D 4JO4L 5FYJD 2EIBA 3RTQA 3F62A 4LHUG 5MEOA 3P3YA 4JY4B 4WCYL 2LABA 4GQPH 3VXMB 1OAYL 3WJJA 3RWHA 3O11A 4U1IA 4XI5C 2X4RB 3HI5L 2G75B 3KPQB 3FFCD 3S37X 4TTGA 4Y4FC 4HHAB 5D2LB 3EYVA 1K8IB 1CFVH 1P2CA 5IESH 5EU4A 5BOPA 3QCTH 1GC1L 1N2RA 2NLJB 4OLVH 1X6LA 1OF2A 3EYOB 3GGWB 1RVFH 5EU7E 4KMTL 1I7UA 2F54D 1HYSC 5C08A 3RUGB 4DZBB 4QRRB 3FT2B 4Y89A 5LCVL 1L0QA 1KULA 2WWKO 1A9BA 4YHYC 3T3MF 4MDIA 4MNQE 4R4FH 2RCSL 2PO6B 5EZIH 5DMIH 4EI5D 1N6QL 4TTDC 1KV3A 5JA8B 3NBNA 3QA3A 3QXWA 1EEYA 1I1YB 3OF6A 4JO4H 4KXZH 5D93C 3V8CA 1CN4A 2AJZB 4AYFA 4WCYH 1TQBB 3HZKB 1TQCC 1OAYH 5E2VL 3VI3E 1S9WA 3FRUB 2WBJD 2BVOA 4H25A 1TETL 3HI5H 4UNVA 4PJHF 1IKFH 4WO4A 4KZEL 4DGIL 2FRGP 2OYPA 4EDXA 3LRHA 3NFNA 2WLYA 5CINL 5DD5L 1JZ3A 2X4TA 4X6DA 1OSZB 2RJMA 2QEJA 4L9DA 1S5HA 4C58B 2V2WB 1GC1H 2Z8RA 1CTNA 2F58L 3WO3B 1C08A 5ADOL 3SQBA 3UC0L 1GVIA 1OWRM 1A9EB 3RWEA 1RUML 5KG9A 5L0QB 3HKFA 3BPNC 4XZUA 5HI5D 2C3VB 4JRYA 1IEAB 1I9RL 3B5HA 4PP1C 1FAKT 1CTOA 3BD3A 4L3ED 1DBAH 2XT1B 4OFKA 2R2BB 4DQOL 2OJZL 4F33A 2RCSH 2CDFA 5C0CE 2DIJA 1A21A 1YN6A 4IJ3C 5B38B 4M02A 1NCDL 2Q8BL 4WUUD 4OBRA 4P5KA 3MRMB 5D1XB 5FM5M 3IRZA 2NTFB 4Y19E 1AD9A 1MFDH 2WAHA 4BH8B 4E42A 1AGEB 1MHEA 3I6GB 1J86A 1IAIL 4LPTA 4JJHA 1BHGA 1MCWM 3X14B 5GGVY 4KZEH 3VFTA 1NCCL 2HLFD 4HUVA 3WDJA 4X7TA 4OI8A 1VEOA 1LO4L 5HTSA 3X13A 3QDMB 1F42A 2QQLL 4Z7WF 4P2OD 1AC6A 5ADOH 3UC0H 3MACL 3N1FC 3GMNA 4FFEX 3W5NA 1KEML 3RAJL 1RUMH 3QFJA 4ZOAA 1IILE 2QSCL 5H2BB 1BJMA 3QIBC 3VMNA 1I9RH 5IHUH 2ED9A 1S7VB 4QY8A 3C6LD 4NQEB 2NY6B 1NGYB 3K3QA 3ILPA 4Y2DC 4DQOH 3TA3A 2PYED 4PJ5D 5J8OA 3EDEA 4JGMA 1U91A 1EEZB 4MJIA 2Q8BH 4Z7UA 4UQ2A 1WUNT 4JKKA 4L29B 5D6DA 4ZS7L 2ADIA 1B0GB 2FHFA 5I17B 2RR3A 1NEUA 4LLWB 3TJHD 4ERSH 5E5MA 1KCLA 3B9KC 4S1QH 1KF9B 1NFDA 2KDGA 1JPFA 3FQRA 1NCCH 3KYOB 4I4WA 1H5BA 2VLKE 1WBYB 4MMZC 5IMKA 2BNQB 2HKHL 3SJVE 4KROB 2QQLH 1XR8A 4MZ3A 1J0YA 3EYQC 3ZDXE 2AQ1A 1Z5LA 1R3IL 2QSCH 5C7XL 1Q9LB 5A16B 1Q1JL 2B1AL 3RZCC 3UJTL 3QO1A 5K33A 1NEZA 2R0LL 3DVNB 2A6JA 5F9AC 3UMTA 2NZ9C 4P59L 4D0CB 4F9LC 5F9JB 3B8SA 1ZHNB 4RWHA 2IBGA 5HPOA 1OW0A 1J12A 3ARDD 3RIAF 1YY8B 4ZS7H 3S36X 1CT8B 1B4JL 1XF5B 1FSKC 3D87B 5K9QI 4F7CA 1ZEAL 2IAMB 2QKIA 1EBAA 3OAYK 2GIYA 3BKJL 3FO2A 2DL9A 4LIQL 2ZSWA 1RZIA 5DVMA 3S9DB 3SDDA 4ONOA 3IXTB 3PP3K 1FIGL 1NLBL 4PD4K 3MRQA 3SDAC 5KSBE 5SX5H 3FT3A 3MV8D 3TFKC 4Y1AE 3CFBA 1R3IH 3U2SB 3PDOA 1T0NB 3PWPB 2W60A 5C7XH 2EYSA 2NY2C 3GIZH 1Q1JH 2ADGA 5SX4H 4Q9CA 4FQ1L 5ICYA 2R0LH 4J3WA 3TNMB 4KJYB 4QWWC 3TO4C 1AGDA 4P59H 1U2HA 4YHPA 2QADD 4ELME 1B6DA 4RQQA 4O5LH 5ERWB 5HHOA 4L8CB 4LLDA 3FFDA 4FQ2L 5LQBL 5FK9B 1SVCP 1UWXH 1AQKH 2BSSB 2EDEA 2R39A 1HCFX 1B4JH 1YA5A 4HBCH 3TT3L 5CJBA 1ZEAH 3QIWC 4GSDL 3L5HA 2PXYA 4MS8A 3BKJH 4HWZA 3IS1X 5F3BB 1HXYA 1NC2A 4LVOB 2FO4A 5I66B 4ZTPL 1FIGH 1NLBH 5F6IC 1CU4L 4WY7L 5EOCH 1CXIA 1BZ9A 1YJDH 3JWDL 3T65B 2YD3A 1AHWB 5C8JA 3MYZA 1QQDB 5IVOA 4Z7NF 5ESQA 1T7ZA 2MQ3A 4NC1E 3G5VB 4FQ1H 4W6YB 1BP3B 1HHHB 3B6SB 2RGSA 5TDOB 1PYWB 2YC1B 4YO0A 3STZB 1J8HE 4FQJL 1KC5H 4LGSB 5FM8A 4ENED 3MRCA 4BK5A 3V7AG 3RDTA 4FQ2H 1DEEA 2H41A 3UPRB 1NAKL 2OM5A 5JIHA 3DTXA 4JVUA 3TT3H 3T0WA 2CDEB 2IPTH 4GSDH 4E0RB 4LP4A 4R9HA 3IDJA 1NGPL 4NJAL 1N3NA 3CZJA 5J06A 4FTVB 1RJLB 4NN5B 3GFUA 3HG1E 1QLEH 5IEHB 5J7CC 4WY7H 2AJYL 2Z8WC 3MRGB 5KTEH 3D85B 4Z7VB 2E7BA 1B88A 2UUDK 4L8DA 4PREA 4EDWL 2FWOB 3OHXB 4Z0XA 3MRDB 3D3VE 2VUOA 3FO1B 1CICA 3F7VB 4FXKA 4ONFH 3T4AB 3F7RA 2EE3A 3IDYC 2I25N 1ZT7B 1OGAA 1UT9A 3TH2T 5IJVA 4FQJH 5C9KA 3TN0D 3QG7L 4G7YL 5ID0B 4NQCE 1VGKA 1YZZA 3BZFA 4HJ0C 2A0LD 3NIDE 5B4MD 1E4WL 4PJCF 3MRFB 4D2NA 4PRIA 3QDHA 5CKAA 2ZPKL 4XP6L 5D71L 1G9MC 1ZT1B 4L9LA 4JFQB 1N0LA 1NGZA 1P6AB 3PWLB 3KHOA 1CD1B 1NGPH 4NJAH 4ZFGL 2VITB 3SDXE 4R2GC 1SYVA 1HDMB 1D5IL 4ZSOA 4GMSL 3VXUE 1L0YA 3W39A 2AJYH 2YWZA 3BIAX 5SWZA 2Z31D 3R1GL 4B53A 3QEQB 3I02B 4K3EL 4YBQC 4DAGH 4EDWH 3ULSB 1KCGC 2O5ZL 5J4MA 5IGXH 1LWRA 3ESVF 3IU3B 5GS0C 5I16B 4HC1L 1I85C 4P23C 5IOPB 3OKDA 5IQ9A 4N1EA 1EK3A 1REIA 4PLOB 5IROC 4FQQA 3QG7H 3KPSD 1AXSA 3HMXL 3PJSA 1JJUA 3BN9D 3C5SA 3P4OA 2NYYD 4DJMA 4MXWL 1T04B 3STLA 5HHVL 2ZPKH 4YHOL 2GTZA 5T1KB 4XP6H 2HFGH 3JXAA 1INEL 3ULVE 4X8XA 3SE8L 1KIUA 3EOAA 3W82A 2YOCA 4YPGB 2FYYB 3TPUE 5C9JA 2LV4A 3PXHA 4N5EC 1JYVA 1D5IH 4XHQA 4X8JB 4GMSH 5EA0L 5EZJA 5DEGB 5JW4M 1IJ9A 2NXZB 4IOFD 3MZTA 5T1DH 3ROLA 4WWKA 4K3EH 3RWGA 1A1OB 2YA1A 3QBTB 3B8YA 1D5MA 1UH2A 2NW3A 1E28B 4NGHL 4HC1H 4EIZC 4IRJC 2D0FA 3PWJA 3NN8B 4KMLB 5IM7B 1MHCB 2ZCKL 1IFHL 2P24A 4F3FA 3RWFB 5DXWA 2IAND 1NSNL 2YEZA 3OGCB 3RI5K 3LS5L 4HEME 2RFXA 4HT1L 2BHZA 5DVLA 1G7QA 4FXGA 1EFXD 3FOLA 5D7IA 4OQTA 3OZ9H 4MXWH 4C4KO 4YHOH 4AEEA 3KJ6L 3PUCA 4YXKH 1INEH 4JKWA 3MLWH 4KKCC 3SE8H 2FEEL 2XKNA 3QDMD 4HMCA 5J3HC 1PKQE 2YMXL 3MA7B 3TNNA 3QI9A 4NM8H 4OZIF 3KLDA 3BIKA 1TIUA 4L4TA 4G43A 4PUBH 5C0BA 2WV3A 1FO0L 5E00B 5IBUG 5EZLA 1BMGA 5CZXC 4P46C 5F1IA 1XR9B 4TRPH 5I8EA 4PV9B 5F7EL 5D2LF 3V52L 1TVBA 4MQXD 1O0VA 3D69A 5CZKA 1S7QB 2AJXH 3C2SA 1T1XA 5DJCB 4K8RC 2ZCKH 1IFHH 2EYTA 1X5FA 1NSNH 1ZA6B 3S3JA 4O2FB 4W4OC 1NAMA 3LS5H 3GMLB 4HT1H 3DWTA 3L6FB 3SEPA 2IC2A 3ZKXC 4AG4L 3U0TA 1WBZB 4OZGE 3RUGF 3WFCL 2P8MB 3G08B 3H9SD 5E94B 4LU5L 5HBBA 2GEEA 1RIHH 3KJ6H 4GRWB 4QRTB 1JHTB 2DQCH 2CLRB 2LVEA 3LKSB 1P7QB 1LE5B 2R4SL 1IGTB 1JWSA 2KH2B 4ORZC 2YMXH 4HSQA 3O2DA 3VXRA 4WW2C 3D39B 8FABA 3VFWA 4XNYL 3F65A 2R4RL 4RGNE 2YN5A 1QFWM 2YSSB 4PGCA 3OJDA 1FO0H 3BWAB 4ZOEA 4HDIA 2F53B 5DJYA 3RTQB 1FFQA 2ZNWA 4S0SD 5MEOB 1HSAA 4LHQB 2VYRE 4J1UA 5EH1A 5F7EH 1KJMA 3RWHB 3O11B 3V6FA 4U1IB 4RRPG 1GGUA 4XP9L 4K7PY 1MELA 4LFHD 2BFVL 4UBDC 1MHPH 1P2CB 5FHBL 5EU4B 4AG4H 4NKDA 1MFBL 1N2RB 3E3QE 1YMHA 4PB0H 5GGTA 1OF2B 1Q38A 2IAMD 4NOFA 1DVFC 5C0DA 1I7UB 4I2XE 4G3YL 5C08B 1T03L 3MRBB 5K9QG 2R4SH 4TQEL 3NCEB 2R2HA 4PG9A 3NIFF 4H8WC 2XZAL 3EGSA 2IG2H 4U6HA 2X5PA 3EKCA 4XNYH 4YX2L 1Q9OA 1A9BB 1BOYA 1ULVA 2R4RH 5T3XL 3WXWH 2UWEA 2QR0A 2XICA 3IB4A 4KJPC 3EFFA 5K9JL 3VWKD 4Y2OA 1FFNB 5DJDA 3S4SB 3QA3B 1GSMA 1EEYB 3D48R 3DROA 1CGTA 1KLFA 4ORGA 3UROR 5EBLB 3JV4A 4X80H 3H9HA 1X7QA 3QJHA 3UYRL 2XNAA 1KPUA 4RFNB 3KLHD 2BVOB 2MPAL 2XA3A 4H25B 4GUPA 4EN3A 3UZQA 2R0WL 3GMQA 4OIAA 4MA7L 2BFVH 4EDXB 3EDKA 3NFNB 2X4TB 4X6DB 3SE3C 5FHBH 4JRXE 1AGCB 1S5HB 2C4FT 3RVTC 2NW2A 1CR9H 3UTQA 1C08B 1A7PH 3V6BR 3UDWA 3BQUC 3WHE1 3RWEB 5KG9B 2GSIA 4G3YH 5I9QC 1U8HA 1OQOA 1F97A 1K6QL 2UY7A 4JRYB 2JJUA 4XNZB 3DGCR 5F7HA 1H9VA 1ZTXL 3RGHA 5I73B 4JO1H 3RJQB 2ESVA 2C1OB 2LU4A 2XZAH 1Q94B 3HR5A 2Z8SA 3DMMB 4YX2H 5T3XH 4F33B 2CDFB 2JK5B 1QG3A 1YN6B 5T1LD 3HE6A 2DLGA 1H8NA 5CJXA 2BNRB 3PHSA 2QQQA 2W0PA 1OLLA 2XI9A 6FABH 5HYJE 4P5KB 3EOTH 1ZLUH 3DX6A 1AD9B 3DVGA 1MCKA 4HLZH 1MHEB 4JKPL 4OM1L 5TF1L 1T22A 1YEFL 2UVFA 2MPAH 3ARFA 4KK6D 4OSUL 5KN5A 4N68A 4MCYA 3MFGB 2R0WH 2VDLL 5ANMA 3U48A 3VFTB 4MA7H 4HUVB 4X7TB 4YXHL 4XH2A 3VG9C 1WGOA 1V8HA 5A2LH 3DI3B 4HK3J 4N9GA 3X13B 3G6DL 5EDXA 4R0LC 2VAAA 3T04D 5GRVL 1NUGA 4WDIB 3GMNB 4BSVA 2I07A 3IJHA 3FCTA 1JWMA 4ODWA 4X6FA 2FATL 3QFJB 3HA0A 4N8VB 2YD6A 2VLME 4R90L 4FTVD 1NCNA 1ZTXH 4G8GA 4QY8B 4X99A 3PL6C 4OUOA 4HS6A 1ZS8A 1BEYL 1U2CA 3DVFA 3ILPB 1S9YA 3HC4L 4JPWL 3GNML 2IMMA 1HQ4A 3TA3B 4P4KB 5I75C 1U91B 4MJIB 1A14L 3SQOL 1KSRA 1MJ8L 4Z7UB 4UQ2B 4DN4L 4NFDA 2FSEA 3H3PL 2ADIB 3RBGA 2OK0L 5AWNL 3LHPL 2X05A 4OM1H 3BZEA 1BQHG 1HEZA 2IMNA 4OSUH 1S9VA 1WLHA 2VDLH 5E5MB 1BFOA 2IPKA 3QRFM 3FQRB 1JPFB 2BVPA 4I4WB 5T5NF 3WSQL 4YXHH 1H5BB 1J05A 1IQWH 5IMKB 5KBNC 4D8PA 4LNVA 3DXAA 3ZMRA 3G6DH 1FNGA 3SHSA 1WWWX 3CH8A 4QHKJ 5MP6H 2N1KA 1XR8B 1Z5LB 4UIKL 2BX5A 3BP7A 2FATH 4OLEA 4R90H 4PG2C 3O45B 1IM9A 4L3CA 3QO1B 2H32H 4AH2A 1NEZB 4G6KL 2A6JB 4FQXC 1ZGLM 5L9DL 1BEYH 1DBML 3HC4H 4JPWH 3CFKA 5FO9A 3GNMH 2WBJC 4PLKD 5B3JE 2VLLA 4O00A 3V6OA 4HFUL 3SQOH 1BWMA 1C5BL 1MJ8H 3ARBA 5B8CC 4JN2A 3EYSL 2EECA 2IBZX 5EIIA 2OK0H 5EU6E 2QSVA 4OGYL 4UU9A 1DL7H 3DUHA 2VDNL 3KPRA 4APQA 4F7CB 4HIIA 1MI5A 1I3VA 1TVHA 2BRRL 3FO2B 1FZMA 5MENE 2E7CA 4XB8A 4GLRI 2X1WL 4Y5VC 1J5OL 2ZSWB 1RZIB 1NJ9A 5HI5C 1TLKA 1ZMYA 3SDDB 1LNUA 5EG6C 3P30L 3CX2A 3MRQB 1CE1H 4XAKD 4ZMAT 5BVJA 1OL0A 3FT3B 5EZOL 3CFBB 5JW3H 1BZ7A 5F7YC 4JFYA 4DWHA 3IDGA 2W60B 2EYSB 3N1QC 4KVNL 2HFTA 3MV9E 3FOMB 2ADGB 3UO1H 3D18A 2B1HH 1NBVL 1P84J 5ICYB 2OJEA 4PRAB 1AGDB 5L9DH 4UAOC 5GS1C 4KMQA 1DBMH 4YHPB 4HS8L 4EUPG 4RQQB 4D3CH 2PTUA 5HHOB 4BFBD 4HFUH 4LLDB 1C5BH 3G6JA 4OIIL 3FFDB 5DT1L 3WE6B 2HLFC 2HVJA 3EYSH 5DR5L 3QEHA 2MCPL 4WU5A 1QFPA 1Q0YL 2MQ0A 4P2OC 3CH1A 2VDNH 4OCXH 5JW5A 1G7HA 2PXYB 3P0GB 2BRRH 2YD2A 3QDGA 4HWZB 1CFTA 2PR4L 3O4LA 5I8KL 2IGFL 4EI6B 4Z7VF 3RJDA 1J5OH 1HXYB 1LK2A 1NC2B 2FO4B 3BPLB 5F1SA 3P30H 4JGUA 5DJ6A 1Z9OA 3C6LC 5L8JB 1ACYL 5JPMA 2FIKA 3DRTA 3OKEA 1BZ9B 2WW8A 4M5ZL 5EZOH 3QWRD 3QQ4B 5C8JB 4K3DL 2EH7L 3ALXA 5ESQB 5AYQA 5T3XD 1NBVH 1MVUA 1YEKL 2APBA 4J3TA 5HD8D 4OUUA 2X4UA 3LKQA 5FHAL 2FR4A 5AZEL 3FN9A 4YO0B 3V79C 4FG6D 4HS8H 2VE6A 3UPCA 1T5XA 1QFWL 4LRNL 3TJHC 3MRCB 1AO7A 3VGHA 5DT1H 4R97C 1LP9E 4XMKL 1DEEB 3F7YB 5DO2D 5DR5H 4XP1L 3WKMH 2MCPH 1PX3A 3DTXB 2R69L 1KENL 2RQ8A 5A1AA 5E08L 4DEPC 4EBQL 4A2LA 3RHWK 1CDBA 3IDJB 3D2UD 1N3NB 2PR4H 4WHCA 5I8KH 2IGFH 2JIXA 5J12C 2OXHA 4OB5H 3QQNA 5F6HJ 3PWUA 3QCUL 1DBKL 5IBLD 5FKPA 4OKVA 4IMLA 4HUXA 5ABDE 5IP4A 4HK3N 1P7QD 2QBWA 4MB5A 4NCC1 3WXVL 2EH7H 4DVRL 4L8DB 3VFNA 4PREB 2DKUA 4Z18A 2XXCB 4Z0XB 1UCBH 2F5AH 1CICB 3KPOA 1NMAL 1T1ZA 4FXKB 1QSFE 2R1XA 4GAFB 4L3AA 2GTWA 5AZEH 1OGAB 1OSPL 5IJVB 1CGUA 3V0WL 4F15B 2F53D 3BZFB 4LRNH 3RTQD 4PGDA 3VGAC 2NY0B 4WFHE 4ESKA 1B4RA 3HS0B 4XMKH 1MUJA 4PRIB 2PNDA 2R8SL 4XP1H 5JNYA 2R69H 1KENH 4WFFE 4L9LB 1NGZB 5EO1A 4NCC2 4EBQH 3P0VL 3VGDA 3ORJA 4OCYL 4RAVA 1SYVB 4ZSOB 1KELL 4JKLA 4X9FA 4EXKA 3W39B 4XP5L 3M45A 1F3RB 4CMMA 5FUCC 4GAJL 3WXVH 2Z92A 5SWZB 2QADC 3O41A 4LPWA 1CLYL 3IFOA 2JJTA 4RMVA 3MLTA 1HHJA 3H3BC 3TYGH 2Y5TA 3IJYA 1NMAH 2OI9B 1MVFA 4NKIL 4H88L 1ZGLB 1X6NA 4OLYL 5IQ9B 1FL6B 3VXSA 1OSPH 1U9KA 3V0WH 2IF7A 3C60D 1AXSB 2YPLE 4WFGE 3PJSB 1GC1C 3M8OL 4ZXBD 3C5SB 3P4OB 4G7VL 4PGJA 2R8SH 2H8PB 3STLB 2GTZB 1E6JH 5AZ2H 2SEBA 3EOAB 1BBJA 3K74B 3P0VH 1EX0A 2HJKA 2EEDA 1CWVA 5C9JB 1BVKA 3CAFA 4LHUA 4N1CA 4OCYH 4XC3L 5GSRA 3T0AA 3QRGL 3BKMH 5EZJB 2CXGA 2XN9A 4AT6A 4XP5H 1CDGA 2NY7H 4JLRA 2BERA 4QXGL 3ROLB 4WWKB 1OLZA 5C09E 3S5LG 1E4KC 3RWGB 1CLYH 1FYTA 3NVQA 1D5MB 4ENEC 1J10A 2NW3B 5CGTA 3DMMD 1CL7I 4RDQG 1K5NA 1R6VA 3PWJB 4NKIH 4F7TA 4Q6IA 4OLYH 2R29L 3QHZL 2P24B 4F3FB 4XHJD 2BNRD 4QRQA 5F1NB 1FH5H 3MMEA 4GRWF 5FF6A 2QSTA 4XWGL 1G7QB 4FXGB 5L2KA 1YEGL 3FOLB 1I8KA 2COQA 5D7IB 15C8L 1T83A 4RIRA 5L2JA 1WAAE 1MCEA 1QSEA 3H42L 2XKNB 4XVSL 3CSYA 5DJXA 1UM6L 2OZ4L 4KV5F 3BWUC 3QI9B 3TNNB 3Q0HA 3BIKB 5CEXA 2DKSA 4L4TB 4G43B 4XC3H 4YLQT 3U9PL 3UTSD 1RZFL 5C0BB 4X4ME 4KPHH 5DDHA 4NO0D 5EZLB 3OJ2C 1RIUL 3B4NA 4BUGA 5F1IB 3TN0C 4UB0L 5I8EB 5B4MC 2BVUA 2A0LC 2HLAA 5MHSD 1TVBB 4XCYA 4LEOA 1T1XB 5E9DB 2EE6A 2R29H 3QHZH 3V4UH 1I3UA 2EYTB 4P4KD 4DGYL 2OX5A 4GG8A 1MAML 1URLA 2QL1A 2ATKA 4WHTA 4XWGH 3HZYA 3U0TB 4ELKA 1KCRL 3IXAA 4HWNA 1YEGH 1IMHC 5ISZB 15C8H 3DOSA 2OTPA 1I7TA 3N50A 5DQJA 1OAUH 2X4NA 4JG1H 4KI1A 2D0GA 3H42H 1FZOA 1MIEL 4MNQA 4BQ9A 1JWSB 1KXVC 1UM6H 2OZ4H 2Z31C 3VXRB 1H0DA 3VFWB 2DQEH 1F4YL 3NTCL 3U9PH 4XRCB 1RZFH 4PGCB 1IARB 3OJDB 4HDIB 4NIKB 4XCEA 3DHMA 3G9VA 3P4NA 1RIUH 5FOBA 5DJYB 4TUKL 3HE7A 1UADC 3SKNA 1HSAB 4J1UB 1KJMB 2YRZA 4X6DF 4ZYKB 4JAMA 1TQBC 3V6FB 3BN9C 2BK8A 1NUFA 5E4EC 4TNWK 2NYYC 3MGOA 4KVCL 4LCCA 1MAMH 2AXGA 4NBZB 4AL8L 4NKDB 2VNCA 3MUY1 4NQDE 3IVKA 4LCYA 1KCRH 2J8UF 1YMHB 4P2QE 5DD1L 2AABL 2ED7A 3JUYA 1GL4B 2CRIA 3ZZ1A 5HYSG 4LEXL 2UZYB 5D9SA 2QTEA 5C0DB 2WNGA 4OQTL 1T7YA 4QNPE 4OF8A 1HWHB 5L0QC 3F12A 4AY0A 1GRWA 5C0CA 5AD0A 4IOFC 4S1RL 4Z95L 5IUSA 4PG9B 3SDDD 4U7KA 3A0OA 3ZSSA 1J7VR 4U6HB 4U6YB 1F4YH 3NTCH 1Q9OB 1WF5A 4JZOA 5C07D 1KFAL 2UWEB 4Y19A 2GK0A 3B5GA 3EFFB 3VRLF 2R56L 2VXVL 4G6FB 5DJDB 4DOHE 3DROB 1KB5L 3DARA 3B3IA 4ORGB 4LCUA 4TUKH 3QUYD 3JV4B 1A4JA 3H9HB 1X7QB 3QJHB 3ARPA 2XNAB 4V2BA 4XPGL 1KPUB 3F8UB 4GUPB 4EN3B 3K4DA 3DHJA 3WLWD 1G0DA 3GMQB 4JZJA 3WDIA 4H1LH 1LK3H 4LVEA 1CD8A 1A8JH 4GJTB 2HTLD 4AL8H 3UTQB 4TSCL 2NW2B 2ICWI 4JFFD 3SKJL 5IFHL 2AABH 1NCBL 1J1OL 1U3HD 5BMFL 1FG2A 5J9PA 1YJDC 3L3JA 4LEXH 4YPJA 4OQTH 2PXYD 2GSIB 3SO3B 4S1RH 1OTUD 4Z95H 1R3LB 2ESVB 4Z7UF 4YC2B 2GYSA 4F37K 3O2DL 1KFAH 3PWPE 4MQXC 4OLZL 2CPCA 3MBED 3KS0J 4LNRA 4LSPL 5FUOH 3N1MC 1KB5H 1JZ7A 1NMBL 2DQHH 2AK1H 3MRNB 3DX6B 1A6ZA 3DVGB 1DN2A 3QXTA 4XPGH 2VLKA 2AK4D 1T22B 5KN5B 3ARFB 4P5TD 1F6FB 1MH5A 3SJVA 3VMPA 4MCYB 4GKZA 5ANMB 4Z7QE 4L4VE 5DRWA 1RJZA 4XH2B 1JGDB 4N9GB 3I2CL 4TSCH 4YFEA 4M8VA 3GSOA 1WEJL 2VAAB 5IFHH 1NCBH 1J1OH 5BMFH 1PZ5A 2JF1A 2I07B 4BSVB 3IJHB 2AEQH 3FCTB 1JWMB 4ODWB 3I75A 3QUXA 3GSVA 3ET9F 3KWWA 1X44A 3QULB 3EYUL 1F02I 4G8GB 4X99B 1ZHKA 3UBXI 3IFLL 4CVWA 1U8OA 4HS6B 1ZS8B 2EXWD 4PLJD 1S9YB 4KZDL 5ETUA 2VDML 4JKMA 5D7KE 5DMYA 2W1NA 4OLZH 1HQ4B 1CIUA 1JMXA 4LSPH 4FQHA 3WBDA 1NKRA 1PD6A 2FSEB 2P5EE 4D9QD 1DUZA 4HMEA 2PTTA 4K9EH 3BZEB 1KBGH 1HEZB 5FYJU 1S9VB 2ZUVA 1BFOB 1S7TA 4NRXA 2IPKB 2IAMC 2BVPB 3C87A 3HPLA 2NY0D 4Y1AA 1J05B 1YC7A 4HPOH 3JWOL 4ODSL 4PRID 4D8PB 3I2CH 3DXAB 1FNGB 1MJ7H 1CXEA 1HH9A 2DN7A 1XCQA 1JYNA 3H0TA 3PV7A 1UCTA 2X1OA 5L88H 3U30C 3CLEH 1CFNA 5JLZA 5A2KH 3NMEA 4M7LL 4ODTH 4PRPE 5GSVA 5TQ2L 1BFSA 3VXQA 4ELMA 3EYUH 4M6ML 3VWKC 4NQVA 4TUJA 4L3CB 2YWYA 3EAKA 3KJ4B 4AH2B 4GKOA 1ZANL 3WCYA 1GAFL 3AS2A 3IFLH 3U7YH 4PJIE 5IFAL 3WO4C 4KZDH 5HHXL 2VXTH 3CFKB 2VDMH 4PBWD 5FO9B 2FJFA 3KLHC 2YUZA 2ZNXA 4Q9BA 1TTGA 3ARBB 3J8F7 4JN2B 4U1HA 3ELAT 2ICEA 4LLMA 3MPCA 2CMRH 4JO3L 4UU9B 4FFZL 3PQYD 1FGVH 1X4YA 3KPRB 4APQB 4HIIB 1UKTA 1MI5B 1TVHB 3SGEI 3VI4F 3O6LH 5SWSD 1FZMB 1E6OL 3OKKA 5KAQF 4C56E 3JWOH 3KHQA 1NJ9B 1LNUB 4J3UA 5BVJB 3TPKA 2YPVH 1BZ7B 4JFYB 3IDGB 3U4BL 4OZ4A 4JVWA 1CD0A 3MRKA 5TQ2H 3AMKA 1AHWC 1J8HA 1A3LH 3D18B 4M6MH 5DGQA 2E7MA 3L5IA 3FT4A 4IMKC 4HXBH 2OJEB 1ZANH 5CSBA 1GAFH 3KPPA 3CGTA 1JGVL 4YBLC 3T3PF 5IFAH 1KG0B 2AI0L 5HHXH 4Z7OF 1XGYL 3JBG7 4FABL 2Y07L 4OFPA 2E9BA 4K7PX 4KK6C 3E2HB 4XAWH 1SM3L 2Y25A 1OGTA 1ACZA 2APTA 2D7PA 3G6JB 2VDRH 2RBLA 1F58L 2HVJB 2NR6D 2DAVA 1Z9LA 3ILQD 5HYEA 1NC4D 3TZVD 2MSPA 3QEHB 1E4XL 3NPSB 4YFDB 4JO3H 4WU5B 4FFZH 3CH1B 5JW5B 1G7HB 5EULV 4POYA 3HG1A 3QXDA 4PB9L 1YEEL 4XMLL 3T8XA 5HHQA 3ZE1F 3QDGB 1CFTB 2GJ6D 3O4LB 5E1HB 3W0WE 5J13B 4ZS6D 1SJEA 2NXYC 5DJ6B 1A6VL 2WZPD 2XZCL 1QFOA 3D3VA 5JPMB 2FIKB 1HNFA 3DRTB 3OKEB 5K59F 1UH4A 1WZKA 3CDYA 1YECL 1FFOA 5F7NC 3BRGC 1UQSA 1MVUB 3CSBA 3LQAL 4YIQA 4YXLH 4NQCA 1INDL 1JGVH 1P6FA 4OUUB 2X4UB 3LKQB 2FR4B 2XTLA 1MJUH 1N6UA 3GJEA 1XGYH 4FABH 2Y07H 1T5XB 2Y36H 4BQCA 4WI7A 1SM3H 4HZAA 3B2UD 1T66D 2EKSA 4OM0H 2OR9L 5CAYB 4PJ8A 1XIWA 5HJ3A 5TE4H 5E9DD 2I26N 5DD6A 4JFDE 3MCKA 3SCMA 3SDXA 2E7HA 4NQXA 4LAJH 3VXUA 4M7KL 1YEEH 4XMLH 3FL7A 3HR6A 5ISZD 3O3UN 3PWUB 1QOKA 1A6VH 5IJKC 5FKPB 2YHGA 4OKVB 2XZCH 3PG2A 4W4NA 1A1MA 2J4WL 4IMLB 4HUXB 1HYRC 1X5IA 4MWFA 3S3PA 3VFNB 1HHGA 3CUPA 3VXPA 4HGMA 3RVWD 2BHUA 4MD0A 4PLKC 3LQAH 3KPOB 1T1ZB 1INDH 2R1XB 4P5MA 3SGKA 2GTWB 2Q87A 3WUWG 1MCSA 3GSNH 3I85A 1UFUA 4RA0C 2XTJB 2DTMH 3QIUA 4PGDB 5BS0A 1MLCA 5INDA 1IBGL 2BOBA 3K4AA 1DN0A 5JHDE 3TJEL 4N0CA 3TPUA 5JNYB 3SDCD 1K4CA 5EO1B 4LVNC 2WUBL 4M7KH 3FO0L 1TZGL 3A6BL 1LDPH 4Z77A 1C12A 3VWJA 4RAVB 1MJJA 3CX5K 2J4WH 1MEXL 1X3DA 4CMMB 5C0IA 2Z92B 1AE6L 1MHHA 2FX7L 3O41B 3IFOB 1GGTA 3X17A 4UT9L 2VKWA 3MLTB 5ACMA 1HHJB 2VN4A 2Y5TB 4PRDA 3SGDH 1AFVL 2FJHA 3VXSB 1V3MA 5D7IF 1DE4A 4G6FD 4YEFA 4YQXH 1V7ML 5IW6A 3WS3A 3NCBB 4QF1A 4D9LH 1CDUA 5BV7B 1PKQA 1WIOA 4AK1A 5HVGB 5IW1A 1U8IA 4V3DB 4JE4B 3U82B 1DFBL 4PJFE 2SEBB 4XBEL 1QNZH 2WUBH 1BBJB 1FN4A 3FO0H 1TZGH 3A6BH 1BX2A 2HJKB 1BVKB 3GK8H 3INUL 4LHUB 4LQFL 2ZCHH 5GSRB 1PEWA 4I0KA 4ZNCD 1KEGL 2Y23A 2XN9B 4AT6B 4KXZI 3DURA 1MEXH 1KCUH 4KUCF 4RRPA 5HD8C 3Q5YA 4JGJA 3GB7A 4JLRB 5HY9A 3THMH 1VA9A 1SY6L 1YNLL 2FX7H 4FG6C 3CSGA 4EZMA 3WIIL 1FYTB 4G8IA 1RJCA 5SWQA 1K5NB 4JN1H 3ZT5A 4F7TB 5DC0A 1VDGA 4Q6IB 1LQSR 1AFVH 2WBWB 5DO2C 4UNUA 3K81A 3GMPA 4QRQB 5C1MB 3MR9A 4JQXC 5HSFA 3MMEB 1FVEA 5F9WB 3QO0A 5FF6B 2IEPA 2KUTA 3IFPA 5L2KB 3BH8B 4BA8A 2CGRL 1A5FL 1I8KB 3ARTA 4RIRB 2P5WE 5L2JB 1G6RA 3RKDD 1QSEB 2VZSA 3GMOA 3GRWH 5IBLC 5JQHC 5KVDH 1DFBH 4XBEH 5CBAA 3CSYB 1DANT 4RMUA 5DJXB 2F19L 1ZWIA 3MROA 1B90A 5CEXB 1A6PA 2CUIA 1KEGH 3MXVL 5JW4R 4GFTB 1MY7A 4X83A 3GEWB 5DDHB 1A6AA 1SY6H 5T33H 1YNLH 1I8LA 1OAXL 4ONGL 3WIIH 2WUCH 4RCAA 5E6ID 2EXYD 3RTQC 5C2UB 2HLAB 4XCYB 3BAEL 4LEOB 4LKCA 5FYJE 1RFDL 3NCJH 4NKMA 2XKSA 3KPLB 5IIEB 3RI5F 5IMMA 5E8DL 4XNMA 1H3TA 3VFVA 3E3QA 1LD9A 4GG8B 3OAZH 5EBMA 3ZSTA 1FPTH 2ATKB 5HYIA 4WHTB 4I2XA 3L1OL 3FFCE 3HZYB 4ELKB 3U4AA 3IXAB 2CGRH 1A5FH 3AS0A 5EC2A 1FRGL 3CNKA 3O3AA 4KRLB 1FGNL 5DQJB 1I7TB 5BV7L 2HH0L 2X4NB 5F7LB 2UWEF 1FZOB 4MNQB 1KIPA 4O4YL 2BSTA 2M8XA 2GSGA 3BZ4A 1QBLL 3ARXA 3EBAA 4OV5A 5DJ8A 3VD4A 2CK2A 2JCCE 1YEDA 1MSPA 1IKNA 1QPXA 3NH7L 1M7IA 4XVUD 3AB0B 4WTWA 1S5IL 4XCEB 3P0YH 5CGMA 3P4NB 2C5DC 4NM4L 4WGWB 5FOBB 3HE7B 5L8KB 4ONGH 3C60C 3SKNB 2Q3ZA 4K3JL 3LD8C 3BAEH 4JAMB 1G0XA 5GRUL 5D72L 4ZXBC 1NDMA 2CO6B 5E8DH 4YE4H 1DLFL 4RFNC 3MGOB 4UOW0 4IDLA 2DM3A 2E3VA 4LCCB 2A9NL 4JM2A 4U3HA 2AXGB 3DRQB 5TE7L 3L1OH 4KFZC 3IVKB 2HYMA 4LCYB 1EEQA 5BZDB 5FO7A 5JOFA 4APQD 3ARED 4FZEL 5D9SB 2ZOKA 5F93C 4XVTL 1NFDE 4POZD 5IHLB 3KPTA 1HXMA 3F12B 5C0CB 5AD0B 1BBDL 4O4YH 3MNZA 3WNMA 2DOCA 4XNZC 5I73C 3ABZA 4ODHL 1QBLH 5DK0A 3NOIA 5HYJA 5IEKA 1I1AD 3S8WA 4JZOB 4Y19B 2GK0B 3DMMC 4EOWL 3NH7H 4L3EE 4MJ5A 1BQHA 5LBSL 4N8CL 3AS1A 2CR3A 5HI4D 4NM4H 3B3IB 4XHJC 3O9WD 4LCUB 1WT5C 5CKGA 1HE7A 1M05A 4K3JH 5JO5A 1A4JB 1ZV5A 5H35B 4WUUE 1FVCA 3A6OA 5GRUH 5D72H 1QFUL 1DLFH 3BPCA 4ZNEE 4JZJB 1RY7B 2O93L 3BUYA 4KKNA 5TE7H 3AU1B 3CCHA 4F2MA 4Y16A 4EQ2A 2VSDA 3O8XA 1FG2B 5J9PB 1NKOA 3PABB 3L3JB 3BPOB 5DQDH 4FZEH 5SX4I 4LL9A 3QDGD 2ERJB 4MA1B 5ID1A 5JHLL 1BBDH 2W0FA 1H15A 2OSLB 3FN0L 2APFA 1GHFL 5HGDA 3VU2A 3OKMB 3TGXA 4F9PA 2DTSA 3PWNA 3I6LD 4HUMB 4YK4B 4P4KC 7CGTA 3UTZA 5BCAA 4PJ5E 1A6ZB 3CMOL 3O6FD 3OAUL 2VLKB 1KCVL 1MH5B 3SJVB 1QFUH 1S9KC 4GKZB 4OCMC 1D3CA 1H3VA 1G9NL 1IC4L 5DRWB 1RJZB 1P9MA 3OB0H 1KB9J 4YUEL 1KCSL 3VJ6A 3GSOB 3ZE2F 1ZAGA 1PZ5B 5GGRA 1BVZA 1UZ6E 3MV01 4ODBD 3OG6B 3I75B 4MD5A 1CQKA 3QUXB 3GSVB 1OAQL 1A02N 3TCLA 3KWWB 4EUPA 3EZJB 1RUKH 4OD3L 4PJEE 5JHLH 1YNTA 2J6EA 3ZDZF 2JE8A 3L5XL 3TBVA 1GHFH 1A3RL 1U8OB 2NY3B 4NWTL 5I71B 1ZHBA 4MAUL 5ETUB 5CP3H 3SE4A 3ARWA 4F7PA 1SEQH 3EZ8A 4FQHB 2HRPL 2L0DA 2WWKT 4U0QB 3S96A 2VRAA 5I1HL 2IJ0C 3CMOH 1PZUB 1DUZB 2HFEA 2PTTB 4GRLA 3FQXA 4PGBA 4E41E 4WI2A 5E7FA 1X4XA 3AS3A 2IALA 1KCVH 4PJ7A 2CK0L 5KSBB 4NRXB 3TYFA 1A6TA 3HPLB 1G9NH 3D0VA 3PIQA 4Y1AB 1C5CL 4QHUA 5KVEL 3P11H 1EVUA 2ICCA 4IRSD 1OAZH 1AR1D 3MV9A 4OZFH 1HH9B 1KCSH 1XCQB 4YUEH 3H0TB 3SDDC 3O6ML 2X2YA 2Q3AA 1CFNB 1JNJA 1OAQH 4ZUVA 5JLZB 3ZE0F 1FJ1A 4N90D 5GSVB 3MV8E 5JOPE 2E27H 4ELMB 1FE8L 5I74B 4NQVB 4TUJB 3MLVH 5I1LA 1TENA 3G6JF 1A3RH 4KWUA 4NWTH 4MAUH 3QUYC 2N4IA 4IIQA 4NN7C 2P8PA 2FJFB 5E7BA 1GOFA 3QDAA 5FUCE 3CVIH 5JPNA 2HRPH 3WLWC 1CDIA 2YA2A 4XCCH 1MFCL 1S7RB 4U1HB 3TO2A 3U1SH 2DIBA 2ICEB 4LLMB 2HTLC 3VFMA 4UTBL 3KGRA 3MV11 2B20A 2XWTA 4G59A 1BF8A 3ZKMD 1OQXA 4K3GA 3MUZ1 5BW7A 4MX7A 5I30L 1U3HC 4P9ML 3KXFD 4NDMB 1VFMA 3OKKB 5KVEH 2PXYC 5BXFA 3LN9A 5JR1L 1K2DA 3KDMA 3BPLC 2BJML 1OTUC 2VIRA 5CZVH 1M4KA 4KDTA 4Y4HA 5D5ME 4OZ4B 2MJWA 3MRKB 5HVHC 1J8HB 1F2QA 1FE8H 3MBEC 5LXGL 4QHNA 3FT4B 5HI3D 2FH6A 1RZGA 1KGCE 3BP4A 5IHBA 2XN9D 1LP9A 3D0LA 1I9JL 2XZQH 4CN4A 2J5LC 4MXVE 1ADQA 2MMXA 4P5TC 2D03L 3GM0A 5DJAA 4KHXL 1OGTB 4IDJL 3B9EA 5TDPA 5GS2H 2UZXB 1MFCH 3EFDL 4ZUSA 4WEUD 3O81A 3ALPA 5LGKA 4MXQA 3T2NL 2CXKA 2J8HA 2C9AA 4L1DA 1C8PA 5F9DC 5J6GA 3LZFL 1YPZE 1QD0A 4QT5A 5I30H 1KNOA 2VERN 1WISA 4P9MH 1HOCB 3HG1B 3QXDB 1IEHA 5HHQB 4H5SA 1XH3A 3J7HA 5DURD 1T89A 4LRIC 5JR1H 5I0ZA 1SJEB 4JHWH 4ZPVA 4I0CC 2BJMH 3Q6GL 3QAZB 3D3VB 1JZ4A 4HUUA 2ID5A 3QUML 2N7BA 2EXWC 4PLJC 2FH8A 1FFOB 5E0QA 3EOYG 1UQSB 2VR9A 2NY4B 4K07A 5LXGH 1MRDL 3G9AB 3VGEA 4NQCB 3T0ED 1MY5A 3TT1L 3CZFA 4HMDA 2BVQA 2OTUA 4OZHE 3GJEB 3G5ZA 4GW5A 4I18C 3ZYIA 2D03H 4U6TA 3LEYL 3T2OA 2EDBA 3UJIL 1YQVL 4BUHA 4IDJH 1RJYA 2EKSB 2NY0C 1KTLA 1XIWB 2FHCA 4Y4FA 5HJ3B 1NPUA 5EU3A 1EGJH 1CFSA 3MCKB 4LCWE 3SDXB 5E8PB 3LZFH 3P9MA 1T2XA 4NQXB 3ZL4L 3FN3A 4L9LC 3VXUB 4ZQKA 3FQWA 3ZDYF 3S5LA 1MQ8A 1YYMH 5FO8B 3LS4L 4EKXA 3Q6GH 4RX4D 2G2RA 1A1MB 4FFWD 2PF6A 3BKYL 1FLRL 5GGVH 3QUMH 3HUJA 4I5BA 5FIEA 4AEHL 4MWFB 1HHGB 3CUPB 5D7JD 4ALAH 4QRPD 4MD0B 1YNKL 3GHEL 3E1F1 1MRDH 4MA8L 2FB4H 3TT1H 1UEMA 4NCDA 4DN3L 2YPLA 4G8EA 1XF1A 4P5MB 1TMCA 1KTRL 2OI9C 3HI6L 5KZCD 1DBJL 3RU8H 1A7RL 2E9WA 2APXA 4J4PA 3HE7D 3QIUB 5C0AD 1YQVH 3HAEH 1BVLA 1MLCB 5INDB 3KPSE 3O3EA 2BOBB 1EAPB 1DN0B 3RBSA 4WW1A 5E8EA 3TPUB 4UV7H 3EDJA 2GUOA 1K4CB 5D70H 3ZL4H 3NA9L 1FFPA 1BREA 2CLZA 5DHYA 5IBUB 1QPPA 4P2RD 4F57L 1QACA 4G9DA 4Z77B 3KYMA 5K9OA 1C12B 3VWJB 1MPAL 4OTXH 4Q9QH 1MJJB 4LCIH 1BIHA 4NNPH 1NMCB 2VOTA 3BEVA 1A4KA 4KJWD 3AC0A 2F9BT 1FLRH 4DKEL 5JXED 3CU7A 5C0IB 5C0CD 3HNSL 3BMWA 3DX9A 2I9LA 3SDYL 1MCFA 2OMBA 3U79A 1YNKH 1EBPA 3GHEH 2OTWA 4PRDB 4ZOCA 2VDKL 4DN3H 5A43C 2GI7A 5MI0C 4Y19D 2FJHB 2NR6C 3HI6H 3ILQC 4HS3A 1DBJH 1DE4B 3TZVC 1A7RH 1S7XB 4YFLI 1WAAA 5IW6B 1TCRA 4QF1B 2IANE 2DQIL 2A2QT 1PKQB 2PTVA 3OX8A 3NIGF 4ZS6C 4FMKA 5IW1B 4HCRH 3W9EA 1U8IB 3NA9H 1FN4B 1J87A 4NHUA 1ZLWK 4X4MA 1BX2B 4F57H 1LO5A 2WIIA 1MPAH 4ZO9A 3QIBA 4X9GA 5K9KA 3LKRA 3DURB 4JANB 4DKEH 3T0BA 5HY9B 3GB7B 4Y2DA 3HNSH 2AJVH 5EC1A 4H0IA 3SDYH 4BZ1L 1ED3A 1XT5A 4G8IB 1R3JA 4WFEE 1SEBA 2VDKH 5SWQB 3B2UC 1T66C 5E2UL 1Q72H 2D7QA 3WNKA 1CVRA 4OZGB 5GS2D 3WNPA 3CVHL 5HYSA 3GMPB 4QRUA 3KYNA 3MR9B 1ZOXA 3U46A 1FVEB 3QO0B 4JR9L 1WK0A 3DYMA 1LO3L 2ZG2A 3IFPB 2DQIH 3B9KA 2VLKD 5D1ZD 2BVEA 3HRZA 3ULVL 4M5YL 4LAQL 4QEGA 1YN7A 2V9QA 3H9SE 3EW3B 3GMOB 4NZDA 4RGNB 2XQBH 4LP5A 5CBAB 3NABL 3VI3F 1XGRA 1ZWIB 3OJVC 3HLAA 1W72L 3MROB 3RVWC 3RZCA 5JXAL 3P4LA 3X12A 4ZFZA 3QUXD 4JDVA 3KS0H 5HVWA 5E8OA 1JWUB 4JB9L 2CLVA 1A6AB 3OXSB 4F9LA 5I1CL 4BZ1H 4K9EC 4I9WD 2D2OA 4LKCB 2ADJA 4NKMB 5E2UH 4LBEA 4NQDA 4XNMB 3VFVB 3CVHH 4P2QA 5CD5D 3SDCC 5EBMB 2V7HA 2K7PA 2CKBA 4JR9H 4PPTA 4I2XB 1LO3H 4OFVA 4FFYL 1QBAA 4PP8C 3F7QA 2EDOA 4LLAA 3ULVH 4QRSA 5EC2B 1WSST 4M5YH 4YHKL 1I1CA 1CGVA 3L5WA 4RGMB 4LAQH 1NCTA 4AQ1B 3ZT6A 3DSNA 5FYLH 4UDUA 2LTQB 3SDAA 1KIPB 4HJJL 3HI1A 3NABH 2BSTB 2GSGB 1X5YA 3MV7D 3BZ4B 4OV5B 5DJ8B 1W72H 1YEDB 1IVLA 3QNXA 1M7IB 3ULUE 5J11C 4OFYA 3TO4A 4I0PD 8CGTA 3WFHA 5DC4B 4G9FA 1JTPA 2ZZUT 2WANA 1AKJB 4D0BA 4KAQL 3GJFK 5KSAD 5I1CH 1XGPA 4NP4L 3QPXH 3IJSA 1HIML 2CUMA 4PJGE 4JRXB 1NDMB 5KS9E 2PW1A 1X5LA 2VTFA 4TSBH 3VXTA 3UJJL 1NL0H 4LSQL 4JM2B 3JWOC 2VDQL 3QIWA 4MVBD 2E6QA 4FFYH 1IL1A 4QOKD 1RUPL 2P44B 5FO7B 4LFHG 5JOFB 4YHKH 1JYWA 3QISA 4TPRL 4R4ND 2ZOKB 1FDLH 4MAYD 2KQMA 1HXMB 1J9CT 2W92A 3MCG1 4HJJH 1S3KL 3MNZB 3FB8A 4C4KT 5BO1H 5GZOD 5FGBC 3C8DA 5J89A 1JFMA 5DK0B 4KRMB 5HYJB 5IEKB 3DX7A 1G0YR 4JFXA 4YC2C 4CNIA 4YHNB 5ENWB 2DI9A 4MJ5B 4KK5D 1BQHB 3RY4A 3LAFA 1J8HD 1WCBA 1R0AL 4IHOB 1CLOL 3VFUA 4HF5L 4G6JH 1M05B 4KAQH 1U36A 4L4VA 5JO5B 3ZDXF 4TNWF 2AV1A 1HIMH 1FVCB 2AW2A 4ZOBA 1NCWL 4NSKA 2X7LA 4GG6E 3BPCB 4HWUA 3V6OE 4LSQH 3RKDC 5F7UA 3MNVA 2IADA 4P4RA 3BUYB 2VDQH 3FMGL 3CCHB 4F2MB 4Y16B 1RUPH 5T3ZH 3G6AA 5IBTH 3WIFA 5DQ9A 3O8XB 4JG0H 3KPRE 1K3IA 2DLHA 2EDKA 3VW3L 4TPRH 4YHZH 4EVNA 1UWGL 2UV3A 5T1MB 2OS7A 3TF7C 4BFGA 1QP1A 5E5UB 5MEQB 5ID1B 1EFQA 1S3KH 2W0FB 3K2UL 1MFEH 2FNBA 5DRXA 4OT1H 3OKNA 5HGDB 3D3VD 3GMMA 5E6IC 2EXYC 4OKDA 3PWNB 1U8QB 2P5EA 2O5XL 3V0VA 3RRQA 3BGMA 1X5GA 3M1BB 4GQ9L 1EJOL 2APVA 3TLRA 1CLOH 1UZ8A 3UTZB 5KSBF 4HF5H 4NQCD 4U05A 1VFAA 4PRNA 3T0DA 3QXAA 4NN6B 4ODUA 3GJFA 1NCWH 4NZJA 1NGQH 1BIIB 1EO7A 1QLRA 5ICXA 4K71C 3FMGH 5AEAA 1XIWD 4GKNA 2ZJSH 4PRPA 4QXWA 4ELMF 3VJ6B 4GKSA 1RZKH 1WTLA 4L8SC 4X7EC 1N26A 4MB4A 1QRND 5GGRB 3VW3H 1K85A 4NWUL 1UWGH 4A2MA 4MD5B 4PJIA 3VXUD 1FNFA 1U3ZA 2J12B 3TCLB 4OLXH 4EUPB 2CR6A 5JIIA 4LSTH 4XVUC 4HWEL 3LQAC 4F37F 1YNTB 3K2UH 3TBVB 4MJ4A 2ITDA 1ZHBB 4N0FA 2FECL 1L6XA 2FHBA 2O5XH 4YHIA 4NQUA 5EU6B 4B0MM 4F7PB 4GQ9H 4P23A 3RNKA 5C0EB 3S96B 1RMFH 3PV6A 1OD7A 2HFEB 2N56A 1IAKA 3MBXH 4GRLB 3FQXB 4PGBB 5TGBA 3K80A 5D1QD 4C56A 2FLBT 2IALB 2XACC 4AM0A 3Q1SL 4B5EA 5DWUL 1A6TB 1AO7E 3AREC 3TYFB 3ULVD 3D0VB 3PIQB 4QHUB 5I6XB 2Z93B 1A7BA 4POZC 1OCWL 5B39G 4KQ3L 5FYLD 4L1HA 3MV9B 3U0WH 5JDJA 1SYSA 2JB5L 2D3VA 4NWUH 4M03A 1TJIL 4N5EA 1D9KD 1I1AC 4MQ7A 3CFJA 4ZUVB 3OJMB 4XAKE 1FJ1B 2EH8H 1RULL 3JV5A 2GFBA 4HWEH 5I1JL 4DW2L 5HI4C 1WIUA 3O9WC 3OTTA 4AEFA 2P8PB 1W2KT 4AENA 1BFVL 4IRJA 5KANI 3BEWA 5JPNB 4M93C 4XXCC 2X9XA 3E2HC 3LPWA 3WLBA 1OPGL 2EO9A 1BF2A 4X6CA 4Y5XC 3VFMB 4I48A 2XWTB 2WINA 2B4CL 3W0WA 2VZOA 3BH9B 2Q7NA 4MX7B 5I15L 2QJDA 1OP5K 5DWUH 5IB4A 2EEAA 2R2EA 5BXFB 1E0OB 1OCWH 4YWGH 1K2DB 2R23A 3QZWG 4KQ3H 3KDMB 1W8NA 3CFIC 2VIRB 3CDCA 3IAPA 3CU1A 3BT2L 4G6AC 3NIDF 2GAZA 1TJIH 4Y4HB 3MRLA 3WUWA 1N0XL 1T2QL 4XP4L 1OP3H 4QHNB 3VRIA 1RZGB 3BP4B 3SN6N 5E03A 4UQ3B 3QPQD 2J6EL 4P46A 1LP9B 1KJVA 3D0LB 4I13B 4OGXL 3TVMD 3O6FC 3E8UH 3O4OB 4JFDA 4M43H 3SDXF 4NZRL 5DJAB 3U36B 1V3JA 5TDPB 1MAJA 1INQA 1YEJL 4ZUSB 1OPGH 5C0FA 4WI6A 4TOYH 4W4OA 4WI4A 1U42A 3LRGA 2B4CH 4KGLA 5J6GB 4PJBF 2BXZA 2B5IC 1WTGT 3MO1A 1KNOB 1N4XH 5T3ZD 3P77A 1XH3B 2VR5A 4ZPVB 2VL5A 2VLRE 4JREC 3BT2H 4LSRL 4HUUB 4FRWA 4RGND 4WW2A 2YD1A 1D5ZA 1T2QH 1WZLA 1AY1L 4GXUN 1CDYA 2DICA 4XP4H 1JCKA 1QRKA 1A1NA 2LVCA 4EUPH 1IAOA 3CZFB 2F15A 2AJUL 3V9FA 3ULVF 1IGMH 2BVQB 2OTUB 2J6EH 4HKXA 4OGXH 3LPGA 3VFRA 4BSWA 5C2BL 5JHDA 2YPKA 4UIMA 3G5ZB 4PYGA 4GW5B 4IRZL 5E6ZA 2XWJA 4PRHD 5C0JA 3VRJA 1RJYB 3FB5A 1YEJH 2X41A 1X5ZA 2XQYG 4Y4FB 4AIZB 2X4QA 3NFPA 3T77A 1GIGL 4NO5A 1CFSB 2K3TA 4HLZG 5CSGA 5EOTB 4HULB 4JFED 4IRSC 1AR1C 3P9MB 1RIVL 5EBWA 4PY7A 1CXFA 2ICWA 5LAXA 3FQWB 1UXWA 3G5XA 3S5LB 1T6WA 3GKWL 3V4VL 1GCFA 2Q7YA 3BD4A 2G2RB 3Q48A 4LSRH 4WTZG 1PW3A 3HUJB 4I5BB 2RHEA 3Q3GB 3B9DA 2VXUL 4YHYB 5KJRL 1UA6H 5F1KC 2QSQA 1AY1H 1A7OL 1FQ9C 4WI3A 2JJTC 1BOGA 4DTGH 2EC9T 5D93B 2YPLB 4G8EB 3MOAH 1AXIB 4GBXC 1RU9H 1IC7L 5C2BH 2EDJA 1TQCB 4X9BA 2CKNA 1MWAL 2BY0A 4IRZH 3ZKMC 3E0GA 1AKJD 1DDHA 2X1XR 4CBPA 5HYFA 1ADQL 1BVLB 2NY1B 4PJFA 5C0RH 1VACA 3O3EB 5CUSL 2FDBP 4JRXD 5DTFA 1GIGH 2UYLA 4WW1B 5E8EB 4Q6YA 3S6CA 3WNOA 3HB3D 3RX5A 5JQ6L 1RIVH 3VDCA 2GUOB 3QR2A 5FM4A 3VFSA 1FFPB 3L5JA 5DHYB 2HT4D 1Z0MA 1MIML 1HWGB 1W0YT 3BQUA 1T21A 5F96L 5CEZH 3RVXD 4G9DB 3CJJA 1FNHA 3KYMB 2ZUWA 4LPCA 5C09B 5K9OB 3GKWH 2G60L 3CDGA 3V4VH 3RWJA 2P46B 5C6PB 1A4KB 3C9NA 1Y6KR 5HI3C 43C9B 1V05A 1N5AB 3LDBC 2VXQL 3DX9B 4OZGF 5KJRH 2I9LB 3UTTD 4JDTL 2IFGA 4Q9RL 1EPFA 3DUUA 2OTWB 3O3DA 1QHPA 4HS3B 4Q6IC 1IC7H 2O5YL 1MWAH 1UG9A 2P5WA 1OARL 2BCKA 2DB8A 4PY8J 1TCRB 2KQNA 1ADQH 3S4SG 5DUML 5CUSH 1C5DA 1K8DA 3OX8B 1ZA3A 1YMMA 2A9ML 3W9EB 1OVZA 5IMLA 5DJ0A 4R0LA 5C3TA 5DSCA 4KMTH 5BRZD 1OM3L 4BFEA 4NHUB 4MCZA 5F96H 1DCLA 5FGCE 2WIIB 3QIBB 1E4JA 3GBNL 1BD2E 5LCVH 3T0EC 5K9KB 3LKRB 1JZ6A 3PL6A 3UTSE 2VXQH 3MC0A 4GW4A 5EC1B 1N6QH 4JDTH 4Q9RH 1ED3B 1DSFL 1IAMA 3EDFA 1SEBB 4PD4J 1ZLVK 1C7SA 3FFCA 5E5RB 5E2VH 5MHSE 2O5YH 5HYSB 1L8JA 4QRUB 3KYNB 1TETH 1M6OB 1OARH 1OY3B 2ZUXA 3U46B 1HKLL 4RSVA 4QO1A 4ZFOA 4DGIH 5EU7C 1YY9D 3B9KB 1JRHL 4X5WA 5CINH 5DD5H 2ARJQ 5DUMH 1JYXA 3HRZB 3UXFA 3ERYA 1YN7B 2F58H 1EAJA 1B0RA 1F6LL 2JCCA 4FFWC 1ND0A 1ONQA 1OM3H 4MMXC 4UDTA 1MNUL 3X3FL 1XGRB 2Z35A 3UX9B 3HLAB 3IKCA 5D7JC 4PG2A 3GBNH 4MQSB 3X12B 2DLFL 5ALCL 4ZFZB 5IFJA 4JDVB 3FQTA 2OJZH 4FQXA 5E8OB 1TTFA 3GMRA 2HFFA 2CLVB 4ZO6A 1IC1A 3AB0C 4NYLA 3EJZD 3MLSL 3W9DA 4JM2F 1NCDH 3JV6A 4N8VG 4CVXA 3HE7C 1UVQA 5J57B 2ADJB 4LBEB 5B8CA 4NQDB 5EU6D 4P2QB 3ARGD 1G6VK 3L7FA 3ME0A 5IB5A 3DGGA 1IAIH 1FSKB 2CKBB 2ENYA 1HKLH 5IVXE 3CD4A 4YH6A 5MEND 1JRHH 2FGWL 1LO4H 1WIPA 4QRSB 4Y5VA 3U9UA 4V1DE 2VABA 3MACH 4KJWC 5GIRA 1QSVA 1KEMH 5F44A 3SDAB 2Q86A 3RAJH 4QXTA 3C09B 4BYHA 1KIRA 4L3EA 5I2IA 3QP3A 5JXEC 5TDNA 3MV9D 5TH2A 3C8KA 4DOHB 4M4PA 2NY2B 3QNXB 1FC1A 3OR7A 2DLFH 3R06A 4KRPD 1AIFA 4WUUA 5I76A 3TO4B 1VERA 5CWSA 3WFHB 5GS1A 1A2YA 1VEPA 2MFNA 5HHMD 3MLSH 4D0BB 4ZNEA 4GT7A 5DMJB 5D2NC 1XGPB 4G6ML 3IJSB 3WUZA 1G7IA 4YDKL 5A2JH 2PW1B 3RGVD 4ZUUA 3PHQA 4JZJC 4P2OA 2QHRL 3QIWB 5KANG 1H8OA 1IL1B 5DFVD 1GOGA 1XGTA 3SKUD 2A83A 2HKHH 5BQ7A 3VD3A 4HIJA 1YEHL 4JFFE 1PGRB 5FGRA 5E24E 4ZAKD 5CEZD 1EXUA 3BPOC 1PSKL 1CVSC 1D7FA 5F6IB 1U0QA 3C6LA 4YGAB 2DM7A 3FB8B 2J8OA 4NNYA 2BC4A 3WNNA 2B1AH 4PJXE 4UINL 3E6FA 5HHPA 3UJTH 3DX7B 3QSKB 4JFXB 4PJ5A 2D9QB 4Y4HD 2W59A 1JE6A 4Y4KD 4RMQA 1WCBB 4YNYA 4HX1A 5IQ7L 4M4RA 4LVHC 3VFUB 3V7AE 4L4VB 4F7EA 5BVPL 2AV1B 4DCQB 4M61A 5E8NA 4G6MH 2Y6SD 5ACZA 1BFTA 4FS0A 5GS3A 3WV0A 1JGEA 4NSKB 2X7LB 5D1ZC 2XPGA 5ECJE 2AK4E 1JZ5A 1MCNA 1F3JA 4KKAD 3BP5A 3EYFA 4CVZA 4K7FA 2IADB 3HRPA 2EDLA 3NFSL 2DM2A 2QHRH 2OMNA 3T1FA 4LIQH 4MXQD 2CKBL 2DMBA 3G6AB 3WIFB 4PJEA 4WUKL 5DQ9B 1CYGA 2ATPB 5B3JF 4KUZL 4Z7OE 1YEHH 1PY4A 4EVNB 4MZ2A 4P3WA 4UOW1 2XY1A 3QUXC 2EDHA 5DRXB 3BGAA 4S11A 3OKNB 2WQ8A 3GMMB 4D0DA 3QNZA 4HZLA 2EKJA 5I71C 1QSFD 2P5EB 4KI5E 3MLZL 3V0VB 2QQKL 3BGMB 3PDDA 4E41A 3IDYB 5IQ7H 4GXUM 1UZ8B 3S34L 5CD5C 4CJ1A 4MNHA 3CSPA 4JM4L 1VFAB 2HG5A 5KAQG 1M7XA 4PRNB 3RX7A 5TF0A 4RNRB 1YDPA 3ETBF 3W5MA 3QXAB 5LQBH 4ODUB 3GJFB 5ICZA 2BSRA 3L3OA 2X09A 4JHBA 3WFDL 1QLRB 3CFEA 5JIKA 1QO3A 1LEGA 4H20L 5ICXB 3NFSH 4GKNB 4PRPB 1V7NL 3MV8A 3VFGL 4GKSB 2ICES 2NY5C 1NLDL 4KUZH 4U1SA 3BI9X 4ZTPH 4R2GB 1CU4H 4PJIB 1JFQL 5FCUL 2DI8A 3AY4C 4HK0A 3KAAA 2X4SA 2C7UA 3JWDH 2VZ3A 3EJYD 4I0PC 4JFHD 3CMGA 1KTDA 2W65A 2ITDB 4N0FB 5KSAC 4MA3A 3BGFB 3MLZH 2QQKH 4YHIB 1BLNA 1DUYA 4P23B 5EUOE 1HNGA 3S34H 1P4BL 1HI6A 4JM4H 4ONHA 2ZUTA 2X1PA 2YPLD 3PV6B 4WFGD 2FL5A 1IAKB 1U8PA 3VXMD 4MVBC 5TGBB 3REVA 2VLJE 4C56B 2P43B 1NAKH 4NRZB 2NX5E 2W38A 2V5MA 4J4PD 3WFDH 4AM0B 5SV3A 4X4ZA 4R4NC 3PQYE 2BRQA 2NY1D 3GUTA 3AROA 4MAYC 2ARWA 4P2CG 5D5MA 4QGYA 4ZTOL 4FMFA 5SWSE 1V7NH 1L9MA 3VFGH 3MOQA 5GZOC 1NLDH 4NC1C 1VGEL 2CH8A 1LP9F 3CFJB 1JFQH 4MQ7B 4LKXA 5FCUH 4JCLA 4KK5C 2GFBB 5C09D 4QRRD 3GZKA 2FO1A 5FDYA 3LH2L 1E4KA 1R5WA 4GAYA 1IQDA 1UB5A 4AENB 3UYOD 1F4XL 4XBGA 5EFIB 3QFDB 2PO6D 3PGDA 4IRJB 1QR1A 2D7TL 3BEWB 4MGXA 1YPZA 4G7YH 1P4BH 5LGHL 1E4WH 1PEZA 2DQTL 1QBBA 1PDKA 5SX5K 2WINB 3S35L 3W0WB 3HC3L 4D9RE 1NBQA 5D71H 3OKLA 1C16A 1FC2D 1S7SA 1F90L 5BS0E 5IB4B 4UZGA 2R2EB 7FABL 4NHCL 3BP6A 5ITFA 2FBOJ 4K94L 2R23B 4KTEL 5I1GL 2VC2L 4ZFGH 3CXHK 1MF2L 4LMQI 4YDJA 5CS7A 1G9ML 1C7TA 5DD3L 2VO5A 2GAZB 2W07A 3ARYA 1VEMA 3MRLB 1VGEH 1PBYA 4OZHA 3NCMA 2F74B 3SGDI 1GYAA 3ARRA 4ZD3L 4Z8FL 5KVFL 3R1GH 4JVPA 4XPAL 3VRIB 3QG6A 1MCOL 3P40A 2OXGA 2O5ZH 2V5SA 1KJVB 2H2SD 4G42A 3TN0A 4OZIA 2M1KA 3UP1A 3EUUA 5I1IL 3Q5TA 4JFDB 2CJUL 2D7TH 4TVPE 4LCWA 1JPST 4G80A 1N64L 5I1KL 1INQB 5DEZA 3ARZA 5D1XD 5LGHH 3Q6FA 5C0FB 3HMXH 4JFPA 2DQTH 1XIWC 1L0XA 2XG4A 4HHAA 3S35H 3K0WA 3HC3H 3H9ZA 5HHVH 3MO1B 4FOMA 5D7LE 4RDQF 25C8L 3GJFH 5AUMA 1F90H 2NLJA 4H1LG 7FABH 4NHCH 3UTPD 2V2XA 4K94H 2DF3A 35C8L 4KTEH 2VC2H 3HZMA 2VL5B 2HJLA 3MUHL 1UJ3C 5DD3H 2Z31A 4WW2B 43CAA 1D5ZB 5EA0H 3H8NA 3F6LA 1Q0XL 1KN2L 4HG4K 3HPJA 4ZD3H 5KVFH 1JI1A 4XPAH 1A1NB 4Y88A 1IAOB 1MCOH 4NQED 2OR8A 3N1GC 1UM5L 5IVNA 2NY6D 3WS6A 5BOZG 2ZOLA 4HKXB 4NGHH 3KPSA 3VFRB 4BSWB 5JHDB 2YPKB 5I1IH 5D1QC 1BJ1J 2CJUH 2XWJB 1ZE3C 1N8ZB 5C0JB 1VADB 3VRJB 3FB5B 4LLVA 3OMZA 2YUXA 3K4ZA 3ULVC 2X4QB 3NFPB 3T77B 4NO5B 4WHYH 5D96C 5EBWB 1HKFA 4PY7B 2ICWB 5L6YL 5LAXB 2V7NA 4XCFL 1D9KC 1UXWB 3G5XB 1GH7A 2BNQD 1KYOK 1A9EA 4KROD 2Q7YB 1G7MA 4FHBD 4NZTL 3O2WL 2AKRA 5DUPL 5JDSA 3AUVA 4WV1C 3O0RL 3VCLA 1Q0XH 4S2SA 3AM8A 5HYQA 4ETQB 3V8OA 4U31A 1BOGB 1A47A 1UM5H 4YR6A 1DEDA 4J2XA 2IANA 3V52H 4U1NA 3DSFL 2Q76A 1DTUA 1DDHB 4I77L 4JQIL 1EFXA 3O6KL 1VFBA 5F89A 4PJFB 1VACB 3MRJA 3EYVB 4K8RL 4KKBD 3IDNA 4U0RC 3NCFB 5DTFB 2UYLB 5KW9L 1T20A 2D7OA 3WFCH 3BYYA 2EYRA 4FNLL 4LU5H 1VESA 3VFSB 1IGJA 5L6YH 3LB6D 6CGTA 1CXKA 1T1YA 3BQUB 3TCXA 1T21B 3N85L 4PGEA 5I9QB 3CDGB 3RWJB 1WFOA 3C9NB 4NZTH 3OL2A 2BVYA 4CMHC 2EIDA 3QPQC 4LSSL 4MDIB 3X3GL 3TVMC 4XTRD 3PWPD 1X5KA 3O0RH 3IDUA 4GS7B 1F45A 3DUUB 1DQML 3V5HA 3O3DB 2A38A 3TIEA 3ARSA 1OOAA 1S9WB 2Z4QA 3DSFH 3KR3L 4L29A 4XP9H 2P5WB 2BCKB 3K8MA 4JQIH 4WO4B 1DR9A 3H9SA 3Q2CA 1QLFA 1IRAY 4IEFB 5GGRY 5GXBB 2IFFL 1C5DB 4RAHA 1JPTL 1K8DB 3VG9B 4P3DA 5CCKL 1MFBH 1ZA3B 2GY5A 4FNLH 5IMLB 5DJ0B 4R0LB 5DSCB 4RGNC 4XZUB 4MCZB 1T03H 4TQEH 4N9OB 3LV3A 3RA7L 5A16A 2E9IA 2HKFL 1NCAL 1I8IA 1AJ7L 3PL6B 4PTTA 4LSSH 4RBPH 3X3GH 2GT9A 2E7LE 5K9JH 4M6NL 1GGYA 3SO5A 1DQMH 4QNPF 1CK0L 1SJXA 3TP4A 3S7GA 3FFCB 2MTPA 3UYRH 4E42B 4KRNA 5DZLA 5DHVA 3KR3H 4YBHA 4CAGA 2AXFA 2B8OT 4JO2L 5BZWA 2AERT 4ZFOB 1RZKC 4I3RL 4X5WB 2IAMA 1JNHA 2IFFH 1JPTH 5CCKH 1UYWL 4J6RL 4M1GL 4WI8A 1B0RB 2JCCB 3RFZC 2IWGA 3PHOA 3RY6C 1ND0B 1ONQB 2LTQC 4OAWA 4UDTB 3MJ7A 2Z35B 1K6QH 3JWNC 3ARQA 4GRWH 5CEYA 3IKCB 3C2AL 4XB7A 5EIQA 5I19L 1I1RA 3VWKA 1OP5H 2HKFH 5IFJB 3FQTB 4FQXB 3GMRB 4PJGA 2HFFB 2AEPL 3D85D 5KS9A 4NYLB 4CN1A 3W9DB 5IF0A 5A3ID 4M6NH 4O02L 4PRBA 3JV6B 3JTTA 2I60L 1KPRA 1JHKL 1UVQB 5B8CB 2DLIA 4JKPH 5DMKA 5TF1H 1YEFH 3L7FB 5IB5B 3DGGB 1JI2A 3HB3C 4AMKL 1NFDB 1JK8A 2YBRA 3N9GL 2HT4C 4I3RH 3WN5C 1Z3GL 4C56D 5EU5A 3RVXC 4Y5VB 3U9UB 4JHZA 1UYWH 4M1GH 4JY6A 1YUHA 2UVEA 2VABB 3IDXL 4YDVA 4Z9KB 5GIRB 5F3BA 3O3BA 1WVZA 2Q86B 4QXTB 1ZXQA 1KIRB 4L3EB 5I2IB 3FQUA 5FM5O 1CFQA 4JY5L 5TDNB 5TH2B 4EI5C 3C8KB 1N5YL 3C2AH 5T1LA 4Z7QF 5I19H 3OR7B 3R06B 2GW5A 1TPXC 1AIFB 4WUUB 5I76B 3QEGL 4QTIL 1U95A 1VCAA 5CWSB 5GS1B 4GG6A 1A2YB 3CC5A 2X4PA 5FYKL 3QEQD 5FYJL 3QCVL 4KK8D 1A14H 1FLTX 1TZIA 4ODXA 1JHKH 4DN4H 2OP4L 4MYWB 2C3HA 3H3PH 1G7IB 1GOHA 5AWNH 3LHPH 4ZUUB 3PHQB 1CQYA 1WFUA 5F8QC 5F6HI 5F97E 3UPRA 2QKIB 4P2OB 4AMKH 1P7HL 1NDGA 2CQVA 2J2ZA 3WSQH 2DL2A 3SGJA 5J56B 3CFDA 4W81A 4NRYA 1XGTB 3NZHL 1IC5L 2V5TA 2A83B 3EO9L 2G9HA 4ZFOL 4PJ7E 5BQ7B 3FTGA 4HIJB 4U1JA 3ESUF 5T1KD 3MRIA 1EXUB 1C1EL 4FTVA 5GRYA 3IDXH 4ZUTA 5C71A 4UIKH 3C6LB 1D5BA 4CVUA 1ZSDA 3PDOB 2FX9L 3PGFL 4KKCD 5IEHA 4NNYB 2BC4B 4GMTL 4OF0A 3IF1A 5J3HD 3B9AA 3E6FB 5HHPB 1F11A 1GGCL 1S7WA 1IE5A 1R24A 4PJ5B 5CILL 4G6KH 2Q1EA 2FWOA 1IGCL 4F9PC 3QEGH 2NXZD 4QTIH 5CHNA 4EEEA 4HX1B 5FYKH 1MCCA 3I6LE 1NH6A 2L7JA 4F7EB 5B39A 2OP4H 2B4CC 4U1GC 3IDIA 4U2ZA 1YY9C 4R97B 1MCLA 3NAAL 5EWIL 5HGBA 4JFDD 4NKQB 2XPGB 4OGYH 2AXJA 1F3JB 3EYFB 4CVZB 5M7QA 4K7FB 4PJIF 2VZ1A 5E2WL 4DEPB 3T1FB 3NZHH 4WEBL 4PJEB 3EO9H 3BRDA 3LCYA 3RKPA 5DVNA 4HIEA 2VITA 1C1EH 4XPFL 5IJKA 4OI9A 2WM0A 1FO0A 12E8L 4P2YA 2FX9H 4ZPTA 3PGFH 4ODVL 5HGGS 4KVNH 1ZLUK 4JQVC 1PKOA 2XQYK 3OGOE 4OLWL 3EJZC 1GGCH 4D0DB 3QNZB 5CILH 4HZLB 5C86A 2YZ1A 1ZLSL 1IGCH 4Z0BL 4U6VL 2BVTA 3IU3A 4E41B 5I8CA 4NKOA 3IRPX 1H3UA 3ARGC 3RIFK 4GRMA 2PN5A 3FRPG 4MNHB 4I1NB 2VWEE 2HG5B 3RDTB 1YDPB 4OIIH 1XF3A 3QZWA 1NGWA 4YDIL 3VGAB 4G5ZL 1YYLL 2BSRB 3L3OB 5EWIH 4I3SL 1CGXA 1Q0YH 2C3XA 3CFEB 4Y5YA 1CGWA 1QO3B 5FXCH 1LEGB 5JW4Q 5E2WH 4HKBA 3QH3A 4NFCA 3MV8B 4WEBH 1G7JA 1Y0LA 4U1SB 1BQLL 1T0MA 3BESR 3CLFL 1ACYH 4XPFH 4HK0B 4M5ZH 2X4SB 2C7UB 3VD5A 2VH5L 3I3BA 5DZNA 4KRPC 12E8H 4K3DH 4XNQA 4ODVH 1DZBA 5DEGA 1KTDB 2HN7A 4OLWH 1BECA 2QADB 3D39D 2W65B 1MCRA 2YN3A 1H3XA 1YEKH 4MA3B 3VGBA 3ARDC 4QHMA 3GI9L 1ZLSH 4Z0BH 4U6VH 3HHRB 1BLNB 5FHAH 3CIQA 3VXNA 1DUYB 1E28A 1UB6A 4YHLL 3RGVC 4NT6A 3OWEA 3L3DA 1QFWH 4OD1L 1VGKB 3K7UA 5IW3A 1HI6B 4ONHB 3ZHKA 2N7AA 2FL5B 4LSVL 1U8PB 5F71A 5GRVK 2JKXA 4YDIH 3REVB 4G5ZH 1YYLH 5DFVC 4I3SH 2Z8VC 1VENA 4ZAKC 5E08H 3GUTB 5SV4A 5D5MB 1JF5A 3KXFE 3WIHA 2MHAA 3QWRA 1BQLH 1JGUL 3QCUH 1DBKH 4J12A 4KDTC 2QQNL 1I1FA 4Y4HC 3BQUD 2VH5H 5C08D 1ZGLP 3DETD 3UZEA 4DVRH 4Y4KC 1R5WB 3T2PA 1P69B 4FQLL 3G5YA 1IQDB 1ZHLA 1UB5B 3HUJE 5IWLC 4XBGB 2Y6SC 3GI9H 3OKDB 3PGDB 1QR1B 3GDBA 1I3RA 4YHLH 3P9LA 1F2XK 3QB7C 1TZHA 1YPZB 4FQQB 3OF6D 4PTUA 4OD1H 4KKAC 4LSVH 3NACL 1EO5A 4O2FA 2JJSA 2G5RA 4MXQC 2VLRA 2RIKA 2BHYA 3D2UA 3L6FA 4RMTA 3OKLB 1C16B 4WTZA 1S7SB 2ED8A 4WO4D 4WW2F 5ITFB 5IR1A 4YDJB 3QWOA 4PIRF 3K1DA 2PETA 3HNTL 1JGUH 4NBXB 1KELH 4OZHB 4PJDE 4JRYD 4GAJH 2FD6L 1OHQA 4FQIL 3QG6B 4PJAE 5FKAA 3EO1A 2V9TA 4FQLH 3RY5A 4OI7A 3TN0B 4G42B 5FYKD 4OZIB 4FXLA 3T0EE 4H88H 3RWCA 3I6KA 3QEUA 4LCWB 4G80B 2YS4A 5FUZL 5FB8A 2A6IA 3L9RA 4DKAA 2YEZB 2PCPA 2RFXB 3Q6FB 5GRXG 4QKXB 4JFPB 5TQ0L 2DLTA 1IKFL 2R15A 3M8OH 4H0HB 3NACH 2HT2D 1AP2A 4G7VH 4LGPB 4IBLT 4JPIA 3F58L 3D25A 5AUMB 2DIAA 4HPYL 2V2XB 2GQHA 3IKKA 3HZMB 2HJLB 3RP1A 3EJYC 3FZUD 4UNTA 2H32A 3MRBA 1P1ZA 3HNTH 2Z31B 3OAYH 43CAB 2WMPA 3QRGH 3QFJD 4NHUE 1DBAL 4NFBA 1VB9A 4QXGH 3HPJB 1VKXA 3V5KA 2FD6H 3PP3H 4FQIH 4WHDA 1FFNA 4QRPE 3S4SA 4PJFF 2ZOLB 3ZKSD 3C60A 3KPSB 3D69B 4FQXD 5EBLA 3TA3D 2C4FU 1J0IA 1MFDL 4ZXBA 3MRRA 1HH6A 5FUZH 4MJID 4J4PC 5E4EB 1CBVL 4LLVB 1NAMB 2LU3A 2NY1C 5TQ0H 5C0AE 3MODL 2WK2A 1I9EA 4S1DD 3OXRA 4HUWA 3VH8G 3FAXA 1AGCA 3F58H 1S8DA 2V7NB 2OR7A 4HPYH 1KLUA 2A77L 2FLRT 4XVSH 5JW4N 3KYKL 1CDJA 4ETYA 2AAVA 4P2RE 3EJJX 2VKXA 8FABB 1G7MB 2BY1A 2J8UA 5IHUL 2AKRB 5JDSB 2ILLA 2C1OA 1JP5A 3VCLB 4S2SB 1Q94A 2AVGA 2PO6C 5HYQB 3DMMA 3DPBA 4RMWA 4PYHA 1PFCA 2GY7B 2JK5A 4O9HL 4YR6B 3F5WA 4UB0H 3TV3L 2BNRA 3BDYL 1WT5A 2IANB 5DYOA 4TSAL 1WWAX 4R8WL 4U1NB 3TEUA 1N6VA 3FB7A 2DBJA 2Q76B 4DGYH 1AH1A 2R1WA 1I8MA 1EFXB 5F7DA 1VFBB 2V5YA 5F89B 1FHGA 1CBVH 4EIGB 4DZ8A 3MRJB 4NC0B 5D2NE 4ERSL 2DQGL 3IDNB 4S1QL 3MODH 1T20B 4YZFE 3SY0A 1IT9L 4U33A 2EYRB 1IGJB 3B5TA 1BD2A 3NZ8A 1T1YB 4UILL 3DX8A 2R0ZL 4WDIA 1MIEH 3UTSA 4PGEB 2A77H 5EUKA 2R2HB 3KYKH 4N8VA 4XXDA 4OZFG 2VQ1A 1I9IL 3EGSB 3DI2B 1XMWA 4C57C 1SHMA 4NO0A 4CU6A 1H3GA 5F1OB 2XKUA 2QR0B 2H2SC 3ZKQD 5C0GA 3LIZL 4O9HH 4KKLD 3V5HB 2X1QA 2DKMA 4P4KA 3TV3H 1I3GL 3BDYH 3TIEB 5D1XC 3OSKA 1JNLL 4TSAH 1SMAA 4R8WH 2Z4QB 1R3HA 2UUDH 4G9FE 1CZ8L 4KVCH 5HHOD 4F58L 2JCCF 3H9SB 1QLFB 4R3SA 2DQGH 5H94A 4P3DB 3M07A 1IGIL 3TH3T 1RSFA 1P53A 1NAML 1IT9H 5DD1H 3NA4A 2FJGA 4MD4A 4WIQA 1WV7T 1RI8A 1LGVA 3UAJD 2MKLC 5MERA 4MS8D 4NOBA 1U8HB 4UILH 2R0ZH 3LN4A 4YHML 4HUNB 1NC2D 2FGZA 4R6UA 4FFVD 3LV3B 2Y4SA 3GIZL 2XRAL 5IV2A 1I9IH 1I8IB 1I7RA 3HR5B 1W0VA 2NY6C 3O45A 3LKOA 5HPMA 4PTTB 3JZ7A 3AAZA 2GT9B 3HE6B 2R56H 2VXVH 1F4HA 4HWBA 4J3OC 3LIZH 4OF6A 4O5LL 3IU4L 1NFDF 3ZYJA 5IVXA 1I3GH 1JNLH 2FX8L 4I9WE 4E41D 5DHVB 1Z9MA 3BIBX 4P49A 1AQKL 4XGZA 2HMID 1CZ8H