1FO0H

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a T cell receptor bound to an allogeneic MHC molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords PROTEIN (ALLOGENEIC H-2KB MHC CLASS I MOLECULE)
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fo0H02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1fo0H01
3IGAB 4NRZB 2YD9A 1TVDA 5F88A 2EC9T 2JJWA 5IB3B 1NCDH 3KYMB 4U6HA 2R0LH 1HQ4A 3WL9A 2IAMD 2X44D 4KI5E 4HF5H 3WFEL 4C4KT 5IGXH 3MXVL 2EEBA 2A6DA 1A6AB 3EO1A 3WFZA 1M4KA 4X4MA 2JE8A 2ITDB 3HE6C 2XKNA 2BRRH 3CDGB 1OARH 2XN9B 1LO4H 1R24B 4BH7A 3RPKA 1YUHB 3U30C 1KXQE 3VGEA 2NNAA 1S7TA 4MAYB 3IETB 2X4TA 3DRQB 1YN6A 3EZ8A 1BWMA 3MR9B 2OR9H 1OGAB 2QQKL 2EE2A 1Q9KB 4LL9A 4PIRF 4JKPH 3OG4B 4UUJA 1CE6A 1EEQA 1JTOA 3BVNA 3KXFA 3VRLF 1NFDA 3QB7C 4FTVD 4CL7A 5SWQB 2CK0H 5GJSH 3CH1A 2FJGA 2Y07L 3WFCL 2OBGA 5D96C 3BEVA 3L3IB 4D8PB 1F4XH 1I9IH 4XVTL 3BW9B 5HYSB 4JFFD 1UWGH 3WD5H 4JFQB 5J3HD 1CL7H 2A6IA 1K9TA 4OF3A 3F12A 1NGWA 1AGEB 4LCYA 4JR9H 4XMLL 3UYRL 2Q8BH 3GSRB 4JANA 4KJPC 3HNSL 4D9QE 4DUWA 4DOHB 3P9MB 2EKSA 2RFXB 4RIRA 4QNPF 2ZUQC 1U8PB 2HN7A 4NIKB 4R9HA 2AJXH 3RBSA 1GGYA 2NXZD 1L9MA 5DA4A 4RGMC 4OF5A 4ENEC 3LV3A 5D70H 5EN2A 2BRRL 3ARSA 3IDYC 2KZ1B 1GYAA 4FFWC 1MFAH 3P11H 3KPPA 4G5ZL 3BT2H 4XI5D 5CEZE 1FIEA 2WWKO 3MA7A 5IMKB 1OAQL 1I7RA 3QQ3B 2YHGA 4G6FD 1ZGLM 2QV2A 2P24A 3SKNA 1SJEB 2WUBL 1XH3B 4PJAE 2R4SH 5CBEB 2A6JB 3VG9B 3VXUD 2NX5A 2GSGA 1QFOA 4QT5A 4OD1L 5MENE 3T4YB 1I8KB 1CXLA 5BZDB 4YE4H 5HGDA 1U8KA 4DN4L 5DQJB 4CMMA 1QSEE 1OTUD 4JZJB 1IAIL 5GSRB 4O9HL 1NCUA 5IG7B 2O61B 1Y0LA 3PV6B 1N64H 3MRFB 1C16B 1DFBH 2A1WH 2JJSA 2C5DC 2YZ1A 3L3GB 4K23L 3WEXB 3L3KB 4K8RH 3O4OC 3W2DL 3IKCA 1U8IB 2CDGA 1IAOB 1NFDE 5HYJB 4HJGA 4NKDB 1U8OB 2WBWB 3GHEH 4ENED 2C9AA 5JHLL 2VR9A 1I85C 1FZOB 2C1PA 4NJAL 3KPQA 3THMH 2WIIB 5HYIA 5E8DL 3PP3H 5T3ZL 1XEDA 4KHXH 5D71H 4ZFZA 3RWEB 5HI3D 5ACZB 2A73B 3O45A 3VFSA 1KCVL 4G8GE 3SDDA 4XP4L 5A2LH 3I6GB 4PGDA 3ZYJA 2VERN 2Q8AH 5DJCB 1I1YA 3ZL4H 2EYTB 2EECA 4NGHH 4PJ8D 3OKKA 5J06A 2OX5A 5D6CA 3WJLC 3HRPA 5HPMA 2AK4B 4G7YL 4XP5H 3RTQB 3I9GL 1B6DA 3QO0A 5JW4Q 4JFFE 3ORJA 1U3YA 5EC1B 3AGVA 5FB8B 4Z76A 5I2IB 1XF5A 1LP9E 3T04D 2DM4A 1T22A 5E1AA 4DKFL 4L1HA 5KJRH 3ARDB 1KOAA 2X1XR 3GSWB 1URLA 1RUKL 4WU7A 1S78C 2IBZX 3MLWH 3KLSA 1H5BA 4CRPA 4PJGE 5EU6B 3DSFH 3NA9L 2BNRE 5JPMB 2A9MH 5DXWA 5ESQA 1NMAH 1G9NC 3SDYH 4JQVC 3UTQA 2NXYD 5IW6B 1DTUA 1QSFA 3GRWL 4HXBL 1T5WA 5CJQL 2FL5A 3JWDC 4RZCA 3UYPA 1CT8B 1JGEB 5D71L 1P2CB 4R0LC 2HLAB 3I50L 3CPLA 3OKDA 4JO1H 1ED3B 5IT2L 1MCRA 1ETZA 2VLJD 2A6DB 5D96B 4EKXA 3W9DB 1W72H 2AAVA 2NZ9C 2AXGA 1U0QA 4WTWA 5I0DA 3D0VB 5TF0A 4QXGH 1QRNA 3ZKXB 2DQFB 5TE7L 3EDDA 4H8WC 3ULUC 2DS4A 2R0WH 1NGPL 1C1EH 1LE5B 1NGYA 1ZEAL 4LPWA 3DX8B 3DV6B 4XMPH 1VACB 5KJRL 1N4XL 1MCEA 2QSTA 5DD5L 4PRHA 1I3GL 4ELME 1WIOA 4EUPB 5E8NA 1HQRA 1FLRH 4DK3A 5L0QB 3UTOA 3HUJB 3SQOH 1KJVA 3FOMA 4OFKA 4AEHL 1K4DB 2DD8L 3BW9A 4K3GA 1M6OB 1I9RH 3QXTA 4J12A 4ZFFB 4QGYA 4PLJD 2CGRH 5A16B 3L6FB 2KZWA 3KPNA 3SO3B 3ROOB 1U6AL 1MREL 2VLLA 2NX5E 4X98B 1R3HB 4M6AA 4MNGA 2VZ1A 5JNYB 2C26A 1JF6A 1V7ML 2IAMA 4K94L 4PJIE 5DK0B 5IK3B 3SDAB 4F7EA 1PZUB 1S9WB 2VZSA 4KUCF 3P9WB 4NNXB 3W0WB 4A2MA 4UIMB 1A3QA 3MLPA 2NY0D 4KRPB 2VWEC 5ID1B 3MV9E 4QHUA 2ICWA 5EZIL 1DUYA 3CFEA 4JFPA 4X5LA 1UM4H 2N7BA 2DM2A 3VFRB 4TOYH 4KTEH 2DKSA 3VGDA 5M94B 3W39B 1NCDL 4QRRB 3WHXB 1N4XH 2ICWJ 4UV7L 2Z0BA 2ZCLH 2DQCL 4HCRL 5EO0A 4JPWL 4P23B 4RGNC 1VFAA 1MFEH 3VXMB 1EX0A 3ARBD 4F7PB 2C4FT 3BPCB 4GAFB 3SKJL 1F3JB 2VLKA 1KIQA 3BMVA 4YO0A 3K80A 4B0MM 4KMTL 1FVDA 3F7PC 1JBJA 3GMNB 2QHLA 1M1SA 3H7LA 3TVMC 3RWFA 3RPIB 5J57B 5C0BA 5DS8B 5I30H 1Q1JL 3OKLA 3RVTD 5F9JB 2D31B 3FONA 1PYWB 3QDMD 5FM8A 4NKDA 4PJAA 1RUAL 5CP3H 1QFPA 1F5WA 5MENB 4G42A 2JCCB 1HQ4B 3BIKA 3QQNA 4TSCL 2Y36L 1DE4A 4S1RH 5K59E 5JDSB 1N3NA 2ADIB 4LSRH 2WM0A 5KS9A 4OLVL 1FVCA 4L4JA 5T5FL 5SWZE 2CUHA 1XGTA 2Q3AA 4GLRH 3T8XA 2X1PA 4WI8A 1M7XA 3FOMB 5ENWA 4JM4H 4DGYH 3MUJA 3CXHJ 2RCSH 4HAGA 5F97E 3TEUA 2GTZB 5C9JA 5HHXL 2I60H 4PBVC 4Y4HB 3SDCA 3SKMA 3MJ7B 4HD9A 4HDIA 1INQB 3OR6B 4XXCC 2MHAB 5TQ2H 1C7TA 2C1OA 3WN5B 2XRAL 1F6FB 1T20A 3MGTA 4MNGB 1IM9D 1AXSA 2X4RB 4PV8A 4RGND 3GHBH 1WZ1H 3SKJH 4XVUD 2J8OA 3X12A 2Q1EA 1K3IA 3D69B 4FS0A 5K93A 3VRIB 1NBYB 3DSNA 4JGUA 4PG2A 2XQBL 3E6HB 5D7JD 2R2HA 2YD4A 5GQBA 4WFGD 4BFIB 4HPYH 3PGCA 1ZTXH 5I19L 4JY6A 1K6QH 1CIDA 3TPUB 2OMNA 5E6ZA 1A7QL 4G8GB 2MKLC 5CSGA 5D7LD 1A1NB 3G6DL 2X42A 1CL7I 3QNYA 3K1KC 4KHTH 4HH9B 1A6TB 1F90H 2FL5B 4HJ0C 1JGUH 5BVPH 2ATPA 3HCVB 1DP0A 4JGMA 1T1ZA 2Z35B 3HZYB 3OR7A 5GJTH 1QFWH 5ILTL 3OBAA 4DEPC 5J1AB 3QDGD 4UAOB 3TO4D 2PTVA 2FX8H 3VGFA 2B20A 2V7HA 3AUVA 3BH9A 2RCSL 4JFDA 5J8OA 2BY1A 3QQ3A 4GS7B 3KJ4C 4U1LA 3T0ED 4LLUA 5F9WB 4NKIL 1AFVL 2DQEH 1B4JH 5FGCB 1MI5A 2EYSB 2VZUA 4LVNB 4JRXE 2AEQL 4KRPC 5JW4M 5IW6A 4M1GL 4ELMB 1S9YA 3V79C 2Z91B 5L2JB 3VGAB 3W2DH 1P2CA 1P4IH 4XPBL 4C59B 5DA0B 3D3VD 4IJ3C 4OUUB 4PB0L 4BUGA 4E41A 1KIQB 3IDXL 5GRWA 5C8JA 1F58L 1QFUH 5DJYA 4ZXBA 4IRSC 5HHVL 1T1YB 2E9BA 1JZ6A 3L7EA 5CEXB 5DQ9A 1HE7A 1IGCH 4CJ0A 4RMQA 2YA0A 2KPNA 1F4YH 1IGJB 1A6WH 3EGSA 3IS1X 4N9OB 3W9DA 1WBZB 2OL3B 4FRWA 4YDLB 4RA0C 3VXSB 1CGSH 4XBPB 4LEOB 1QLFA 5JORA 5D5MF 4ZOAA 4U6VL 3KPOA 4GMTL 4OQTH 2BOBA 2E5EA 3NIFF 3JXAA 3UBXI 1CT8A 1MJ8H 5LQBH 4MWFA 4D0DB 1GZQA 1C16A 4JO4L 1I7UA 5D7JA 3QH3B 1FNGB 1G9NL 4XWOD 5HHPA 4AT6A 3I2CL 1CZ8L 2NCMA 5HYSG 3X3GL 4N5ED 1AFVH 2DQEL 3K1DA 4P46B 5F1KC 2NY1D 1A6VL 3K7UA 3T0EC 4FXGB 4U05A 4ZPTB 1LK2A 4O02H 2V17L 4U3HA 3UTPD 4PJIA 1N59A 5INDB 4DCQA 2K1MA 3GHEL 1WSST 5BV7B 4EEEA 4QWWC 1TNMA 3IDMB 4KKCD 3RHWF 5BXFA 3H7BB 4HJ0D 3SKOA 5FM5O 3SE4C 2VLMD 1JRHH 4LPYA 5KSAA 4C56A 4PRHB 1MHEA 5C2UB 5DMJB 1XGUB 1ZVSB 2BSRB 4HMCA 2MPAL 1KNOB 4Y5VC 1XCQB 2IEPA 2JB5L 1NFDF 1AD0A 5IHLB 1YYLL 2DIAA 4N90D 1KCVH 3IFPA 1MWAB 4P4RB 4P23C 1CIUA 4RGNB 1ZANL 1TCRB 4XVSH 1DN0B 3QQ4B 4HEME 3OR7B 1BZ9B 1J1OL 5EBWB 2P5WE 4ZSOB 3ARBA 1S7RB 1G7MA 4MJID 2CD0A 3VD3A 3K74B 4U1NB 1IKNA 1KEGH 5A40E 1PG7H 3MNVB 4K8RC 3DHJA 1X6NA 3OX8A 2YS4A 5HHOD 3B9KD 2HJLB 4JFFB 1BREA 3VA6A 4EOWH 4DTGH 5IROA 3MGOA 3BQUA 4N1HB 4CN1A 3Q3GB 3TO4B 3QDGA 3QI9C 1T1WB 2XWBA 1WBXA 1YEIH 1U3HD 2VXSH 1KC5L 1M05A 3VWKA 5HYSA 4PJAB 3DX9A 5I15H 4OF7A 1SM3L 3CK0L 1VFBA 3FZUC 4MSWA 1KN2L 4TNVF 2C3VB 3MA9L 5E9DD 3RWHB 1NANH 4PYHA 5ADOL 2EIZA 1YY8A 4R96A 4OIIL 3NZHL 4WY7H 5D7SH 5I1JL 1S5HB 3E3QC 1UM5L 3DWTA 3V0AC 3QJFB 5BZWB 3WIHA 2VDNH 1EZVX 2HFEA 2WUCH 1E4XH 4PJIB 3CH8A 3ARDD 2R1XA 5FUZL 5ENWB 5LXGL 5IMLB 1OGTB 3LS5L 4PRIA 2GT9B 1RK0B 3VXPA 1LE9A 3P9LA 2XTJE 3RKDC 2AV1A 4AM0B 3FB8A 5DHXB 1J1OH 2B0SH 2OJEB 3LS4H 4NPYB 4YK4B 3DLQR 4IHOA 5CD3B 1OCWL 1IC5H 4HG4J 1FNGA 1HHHA 3ZDYF 2I25N 4MMZC 5DJDB 2YD8A 4ZUUA 1K5NB 4ODXA 4R97B 2NW2B 5HHME 1I3RB 3T4AB 5CZXC 2D03L 4OTXH 4A6YL 4MNQB 5DD5H 3DX7A 5KVGL 1A1NA 2QTEA 4YHOL 4J2XA 3TVMD 4EIGB 4OIAA 1HYSC 2W0FB 3MOQA 3SQBA 3G5YB 4JY6B 5I8OL 2W60A 2X10A 5T1LA 3JWDH 1IQDB 3VWKD 1NAKL 4AIZA 5EBWA 4CGTA 3H3KA 3QIBB 3H9YA 4PJCF 5H35A 2X4OA 3HHRB 4OF0A 5E7BA 1V7NH 2VLJA 3BWAA 1L0XA 1DBML 1OLZA 1P5UA 2VDQH 4YFDB 3EAKA 1OPGL 4MS8D 1WGOA 3O2WL 2VQ1A 2A9NH 2QQLL 5E5UB 1YC8A 2DQUH 4KJYA 1MNUL 2AABL 2DQTH 1LNUA 4M61A 5TDOB 3DV4B 1Y0LB 4MQSB 1OTTD 1YECH 2Z8SA 1DBJL 1RY7B 3T09A 5CEZH 3PL6C 3OWEA 3TA3B 4UQ2B 1R3IL 3ZLQC 3GGWB 5HY9A 5KSUA 4TVPE 1MFBL 1FIGH 3FFCB 3OKNA 5DEGB 1T89C 1SEBA 2CKBA 2ED9A 4H1LA 4MAYD 4P59H 4Q7DA 1TMCB 1VGEL 4Z8FL 4PP1C 3V4UL 4JRXD 3T1WA 4H5SA 4OKVB 4O58L 5C70A 3HE6D 3BYTA 1CGVA 1HXYB 5JR1H 3OJMB 3DMMC 5EU5B 1Z9SA 3QEQA 2ZPKL 3OAUH 1HHIA 5GS3A 3QWRD 2RBLA 4UDTA 2YK1H 3GB7B 3LOWA 3MACH 3OJ2C 3RGVD 4ODTL 5T1KD 3RPIA 1YY9C 3LY6A 4RA3A 2NY5H 3V5KB 1CLYH 4X6BA 4C55A 4I4WA 4LDLB 4POZD 4APQC 4P57A 1MY5A 4RGOL 1YMHB 5ELIA 3BJLA 4M6OH 1I7ZA 5I1CL 5GXBB 1P1ZB 4Q9BA 1CDGA 3RNKB 4I0CC 3WMSA 4FFYL 3TH4T 1IJ9A 4KHTL 5SX4H 3IU4H 4JFXB 1RIVH 5JIKA 4JN2B 3E6FB 5IVNA 2A73A 4OZGA 3TBSA 1D9KD 5CHNB 5FHAH 4J4PC 5JDJA 2GI7A 2X4OB 4QRUA 4ZUWA 5DZOA 5KZCB 5JHDE 5DUMH 1OSPH 1IQDA 4NCC2 1U2CA 3L3IA 3U0WH 3EJZD 4LHUA 5D9SA 4R0LA 1IGYA 2XTJD 2DI7A 3KXFB 1NSNL 4LBEA 1UZ6E 4PGCA 3WO4C 1H8NA 1WEJL 4GH7B 1R3KB 3LN5A 5F9AC 1BZ9A 5DVKA 4M7KH 1W0VB 1BM3H 1JMZA 1NEUA 2CLZB 3UPRB 4JKWA 1PSKL 3BE1L 3MO1B 3DMMD 2QSCL 1UXWA 4QRPA 3T2NH 3TT1H 5IESL 5AWNL 4JQIL 4M43H 5JZ7D 5C07E 1U2HA 3OXSA 5MP6H 4YDVA 1YA5A 4WCYH 4YH6A 3DUSA 1NFIA 4M9PA 3KJ6L 5I16A 3B2VL 1KIPB 5ALBL 4IRSA 2F5AH 4PJHF 3QIUB 3UO1L 4X9BA 4M6OL 4HUXB 2FRGP 2FDBP 5I74B 3VCLB 3BZEB 2WQ8A 1G7MB 3AXLA 5ISZD 1HEZA 3S5LB 5BRZA 4WWID 1E27A 4HULB 1RZ8A 3GSQB 2RHEA 2XZAL 5DJ2A 4OI7A 1F4XL 3G5ZB 3IKCB 3OX8B 3LKPB 4L3AA 4NZJA 2XZCL 3WEXA 5IEHA 4A6YA 5DUML 1XH3A 1JN6A 4JFEA 1XCQA 4PJEA 1FGVL 1GOHA 3FQWA 8FABA 3QWQB 3VI4F 3KR3L 1YMHA 1PFCA 4K3EH 2D7TH 3QNXB 4XTRC 4DGIH 1A6VH 2EEAA 4ZS6C 5IF0A 1HXMA 3QDGB 1KEMH 4Y1AE 2X70B 3L1OL 4YHZH 4HWZB 3FFDA 3TJEL 5SWSD 1NDMB 4M43L 2VXTL 4P5TC 4Q6YA 4F7EB 4GMSH 4NCC1 4AG4L 1KCUL 1KB9K 1LMKA 2C3XA 4MQ7A 4K7FB 4KI5C 4PB0H 3OHXA 4CN4A 1IKFL 3Q5TA 4LVNC 4HCRA 4L9LA 3TN0C 3I6LD 4TQEL 1NLDH 1VB9A 5I8CB 2FH6A 1S9XB 3I85A 4JRXB 4ONGL 5JPNA 3U7AA 2FHCA 2VXVH 2HLFD 3PGFH 4PLNC 3G9AB 2F8XC 1MSPA 4APQD 1CGSL 5FB8A 5BVJB 4ZAKD 5IR1B 3QA3A 1CFVL 1D5IL 4UDUB 3UC0H 2P43B 3G5VB 4LDOB 1U3ZA 4ORGA 3QRGH 3G04B 2LVCA 1ZT4B 4JO4H 4NO2A 4FQJL 2B5IB 3LN9A 1KEGL 4D94A 3X11A 2CKBH 5HHMD 3T1FA 3VXRA 1D5XA 5J6GA 4EUPH 1QHOA 1E4JA 2CXKA 4QRRA 3BP7B 4P46C 2JK5A 2BXZA 2DLIA 3QIBA 3GIVA 4V1DB 1DBKL 4XCCL 1UWEL 1X5LA 2VXTH 4JJ5A 3QJHB 1A2YA 3PL6B 4WUUD 3U6RB 1DDHB 1XR9A 4I0KA 4WENB 2NXZC 3D2UD 4LSPL 4JB9H 3ARDC 3FQRA 1T6VN 1TJHL 3RWDA 5EFIA 5D2NA 4JPKL 1AGDB 2BK8A 1X6LA 3TF7A 4U7MA 4Y5XC 1TTUA 3SGKA 2NY4B 4X99B 3SDXA 4F9PC 2M26A 4UINL 32C2A 4PP8C 3CUPB 4J4PD 4PDCE 1A6UL 3QIBC 5JIHA 3HC4L 1T3FA 1UA6H 4L8CA 3T2QA 1IGTA 4W81A 1V3LA 3RY5A 4YR6B 4Q97A 2JLLA 3KDMB 4YX2L 3MV01 1B0GA 3FT3A 3D3VE 4U6YA 1Z9LA 1A9EB 4R97C 3JV4B 5DUPL 1GJIA 3CSPA 4LSSH 4LFHD 4CU8A 4KPHL 1CDIA 2XOTA 4OLEA 3RY4A 4N8VG 2FYYB 4EN3A 1UKQA 5CLTA 4OCMC 5LGJB 1NCWL 1K2DA 5ICZA 3U0PA 2VLLB 1IAOA 5HYJA 3MRBA 1TZGH 1MI5E 1XF3B 1J0ZA 2P8LB 1XGRB 2IALB 2X4RA 4PV8B 5J6HB 2G2RA 5E5MA 5F7MC 1RUQL 1WFNA 1BFVH 4UAOC 3MREB 4NM4L 3S35H 3S36H 1H15A 2OSLB 4GJTB 4DGVH 1PZ5B 4LVHB 2OS7A 1YEDA 4HIHB 4IS6A 5JW3H 1T2QL 3CMGA 1GIGL 5FYKU 2ZSWB 5IMOA 4I18B 5D2LF 4Y8DC 3T1FB 3VXRB 3TBWA 5GS0H 5K9OB 2GSIB 3NAAL 5F7DA 1J11A 4DN3H 1M7DB 2FEDC 3UPAA 1A6UH 1CS6A 3JSSA 1D6VL 4OD2A 3LEYL 1CDYA 4K7PY 3NZ8B 2ED8A 2X4NB 5FEBA 4YXLL 4U0RB 3BZEA 4LPXA 3PNWB 4NKOB 2HVJB 3BP4A 5TE7H 2FECI 1MHCB 4LKCB 1FPTH 3TH3T 3VFWB 1NAMA 2FZ3A 1I75A 4QF1B 4NNPH 4HK3N 4UILL 4G9DB 1JHTA 4MCYA 2RGSA 2Z92B 4M7LL 4OTXL 4A6YB 1P7KB 4GAGL 1DVFC 3QUKB 5I17B 1R5IA 3WXWL 1HWHB 1PG7W 4G42B 2DL9A 2FHFA 1CLZL 1S8DA 2JCCA 2VLJB 2V5TA 3MTRA 3LKOA 3VXSA 1E27B 4UTBH 4ZO7A 5KS9E 2HH0H 1T5WB 4YLQT 4K94C 5D6CB 1KJ3L 2XFXB 2BVYA 4I3SL 1R3JA 4PBXA 3TCXA 4PY7A 2DB8A 3MRCB 5GS2D 1UACL 3ZYIA 4N0FA 4ZXBB 3RWIB 5DTFB 3ULUD 3R06A 1F4WH 5ISZE 4KY1L 1MPAL 1TVBA 2A1WL 5BOPA 1RUML 2FEEL 2E6QA 5KVFH 3CUPA 1X4YA 1FHGA 1AKJD 4ZSOE 3RWFB 2VL5B 5IBLC 1JNNL 5JORB 3TVMB 3ZTJH 4LMQI 3MV7E 4PRDB 4YHLH 4CU6A 1KPUA 3SBWC 4ORZC 4KTDL 3NPZB 4GXVL 1BD2B 1BLNA 5E4EB 2FGWH 4U6YB 4NHUA 4FFZH 5F7WC 1YNTB 2J8UB 4IMKC 2CSPA 1CICA 5TH2B 1WC7B 1IM3B 2AW2A 2OP4L 2W0LA 3CDCA 5E9DE 1DQJA 4JAMA 3PDOB 3WXWH 3R1GH 2WP3T 2VITA 3SPVA 4D8PA 2CUMA 5J56B 4KC3B 1L7TL 1S9XA 3AREC 4LQFL 4WNQA 4X6DE 5DLML 3PP4H 1AD9B 3LEXB 4P57B 5I1DA 1E28B 5CGTA 4O2FA 2AV7B 3QNZA 3HE6B 3L6FA 4MJ5A 4UQ3B 1MHHB 3P11L 3WLWC 1DLHB 4GRLD 3KJ6H 4PRAB 2ZUQB 2Z31A 4K3JH 2OXHA 5DHVA 1EO5A 4CMHC 1I9JH 2Y72A 3JV5A 5I1HL 4L3EA 3DROB 3EO0B 4HWZA 2JJTC 3E6HA 3HR5A 5FV1L 2D2OA 1MCBA 4LASL 4H25A 4KKLD 1ITBB 5HYJD 3K3QA 5EBGA 1GPOH 3O9WD 5HI5D 3GO1L 3O2DL 3PWLA 2JB6A 4RDQF 1TNNA 5GS2H 2XZAH 1M71A 1S3KL 1G7IA 1I3UA 4RMSA 1OQXA 4X4ME 3NA9H 3BP7A 4CMHB 2A9ML 2FJFA 2WWMD 3KLDA 1ONQA 3MQIA 1I4FB 2XA8H 2OLDA 3LRSA 4MGXA 4PV9A 4DWHA 5TGBB 4KJQD 4LSUH 3C5ZB 3OL2A 4L8SA 4MJIB 1J0KA 4WO4B 3F62A 1WZLA 1GL4B 3GMLA 3BDXA 3QEQD 2M8XA 2RB8A 1QR1A 3WKNA 4JJHA 2XWJB 3R1GL 3BE1H 4MAUL 4JLRB 5IESH 5A2KH 1LDPH 4OZHA 1U9KA 4LPCA 1BAFH 1DJSA 3RTQD 1CWVA 3EJJX 2HAZA 4G7VL 5CS7A 4KROC 1OGAE 3W5NA 5I1HH 1ZWIA 2R0WL 5FGRA 3ZSSA 2HJKB 4OM1H 2I9LB 3GSOB 3L3JA 2BZDA 3OTTA 4XMPL 2V2XB 1GPOL 3IFNH 4IRZL 4P3CL 4X7SH 2VN4A 1HH6B 2BNQD 3VFGL 3BPCA 3ET9F 3RVTC 1OQOA 1GZQB 3STBA 3FFDB 1FORH 2XI9A 1YMMD 4WWKC 4NO5A 3FT3B 5HGAB 2DQGL 3FMGH 4EDWL 2IANB 4XAKD 5IP4A 3F7QA 3HPJA 1E28A 4WUUA 3QNXA 3BSZL 1A3RL 2OL3A 3NABH 3MRRA 1NDGB 5SWZB 1S7XB 1PKQB 3B9EA 3JWNC 5SWQA 3BEWB 3LEVH 4CDHA 3MLXH 5DUBA 1P4IL 4HIXH 1XR8B 2X4PB 4PTTA 4X6CA 3HMXH 1FYTE 1KJMB 4MWFB 4D0DA 1CLOH 3LIZH 1NMAL 2VJXA 1FL6A 2KBGA 1RUPH 1F2QA 5DK2A 5E7FA 3DARA 1XF4B 1UM4L 1I8LC 5EBMA 1U8NB 4KTEL 4KQ3H 4KVCL 1JZ3A 5LAXA 1AC0A 1N5AA 3PP3K 1UM6L 5TJWK 4JDZA 4JHAH 3ULVF 3BGMA 1UA6L 1JK8B 3CSGA 2JCCE 5J1AA 2IH1A 3T0AA 4PJDE 2B2XL 2VZOA 1HNFA 1CD9B 3L95B 1RIHH 2GSGB 3JWOH 4JFED 5T3XD 3CMOL 1IGFL 3F65A 1C8PA 4ZTOL 2HJKA 3CLFH 1I4FA 1INEH 2Z91A 2BXYA 1C5BL 1AD0B 3I6KA 3LKSB 3CC5B 2AK1L 4UT9H 4L8SB 4MJIA 1MJUL 4M6NL 4B5EA 5IG7A 3LD8B 3TBYA 3QDJB 4NDMB 2LFGA 3NIDE 4OAWB 5CBEA 4YUEH 5DQJA 4U33A 4JHBA 1EFXB 5EZJA 2C7UB 3LKRB 1OP5K 3FN9A 2G5BB 4MJ2A 3RGVB 3V8CA 1KLFA 4AL8H 5L2KE 3BZFA 3ZTNL 5TFSH 2HMIC 5ACMA 1MRDL 2AJYH 5IB5B 3I3BA 5ISZA 4Q9QL 3KPRB 3VD5A 4UQ3A 1CFTA 1KULA 4Q0XH 3T65B 3OZ9H 4K7PL 4LRNH 1IMHC 1D6VH 2OTWA 1L7IH 2HWZH 4P2OA 3EYFB 5F7EL 1X5XA 4LVEA 3GSWA 4JFYB 2ZOKB 5C7XL 2G2RB 5E5MB 5F9WC 3VRLE 3MV8E 5GGVL 1YNTA 4PFEA 3ECBB 1U92B 2CJUH 2XYCA 1FSKB 2YZ8A 4ALAH 3R8BB 4XPHL 4KI5F 2AK4A 4ISVA 5FCUL 4HG4K 3LAFA 4XNXL 4DTGL 1OW0C 4QXTB 2WWKT 4JG1H 3K4AA 4P9MH 1KB5L 1YQ2A 3QSKB 4QXUH 4M7ZC 1MIEL 5IB4B 5F3HA 4S1DD 3SKOB 1NH6A 4GUPB 3EOAB 1ND0B 4P4KA 5JA9A 4YUEL 4M7JH 5C0DB 4J8RA 4X7CC 2VZVA 4ODSH 1TJIH 1UFUA 5TE6H 3F5WA 1I9EA 3NFPB 3D85B 2IH1B 4QGTA 4EJ1C 2IQ9H 3GSRA 1IM3A 4JANB 3RQ3A 3NFSH 5FDWB 5D2LE 4M7LT 2VWEE 5CILL 4Z77B 1NBZB 4JFZL 3V6FB 1DQML 3CDFA 4MHHG 1DQLH 2R29H 1RJZA 5HPMB 2XN9E 4WO4A 1K8DA 3VXUA 1U91A 4S1RL 4WDIB 5F6IB 1EDQA 4PJ8B 4KJWC 4KKLC 4ETYA 3SCMC 1L7IL 2HWZL 2X70A 2AKRA 4WTZA 1S7SA 2X9WA 3D0LA 4PR5A 2AJZA 5CKAA 3LS4L 4G9DA 4GRWE 4MCYB 2W9EH 5BJTB 2FEDD 3N06B 4P5MB 1F58H 1HH6A 3DVNB 2XWTA 1U8MB 4K2UH 5I17A 2MCPH 3CVHA 4M7LH 2DLHA 3NFNA 2VO5A 6CGTA 2C3WA 2XFXA 1F11A 3O3DB 4XAWH 4N0CA 1CLZH 5GS0D 1AH1A 2CK0L 1QSED 5GJSL 5H94B 3RX7A 2H2PC 2VLKE 2Q76A 3TA3D 3MUHL 4UDUA 1LQSR 4KU1A 5GS0C 1IL1A 1HDMB 4E41E 3C60A 3RVUD 4BZ1H 3N85H 4JFZH 3HI6L 4UDTB 4AK1A 3IJSA 1RU9H 5KSBA 3NCJH 5T3ZD 1EJ6A 3NIGE 1WC7A 4LSTL 1DBJH 3KPNB 5DC4B 2YD1A 3W11C 3MYJA 1BD2D 4H26B 2Q6WB 2X9XA 3DI2B 2OM5A 4FTVB 1LEGB 5I18H 4L4VA 1XFPA 2APWA 4HKJB 1FBIH 4PJDA 3ES6B 3MJ9L 2O5ZL 5BMFL 4Y5XA 3MUGA 3IDJB 2J2ZA 4YJZL 1MQ8A 5GGSB 2AJVL 3GJFA 5DFTA 1OAQH 4C58B 4FABH 4OCWL 2FO4B 3HS0A 3BD5A 1YNKH 3OMZA 5D7KD 5GGRA 1FVDB 5MI0B 4R4BA 5DVOA 4XNYH 3QWOA 1CXKA 4X6CB 5AG9A 4M1GH 4P2QD 2AQ2A 1QHPA 4LSDA 3DXAE 4P2QB 4L8BA 3REWB 5EA0H 3I75A 4OGYL 3F8UB 3BIKB 4QOKB 1CK0L 1AKJB 3BWAB 5FV2A 5SWZA 1MJ7H 4R7DA 3F5WB 1AP2B 4TSBH 4LCWA 4WI3A 2VDML 3IJYA 1VKXB 3N85L 1KENL 4FFVC 4XVJH 5CP3A 3KPRE 5E9DB 5L8LB 4Z76B 2KQMA 4ELMA 3WIIL 2BNRD 4D0CA 1SJHA 2YPVH 3IU4L 4IEFB 5I74C 1XGPA 4PJXA 2EDTA 3PV7A 2R56L 3O3BB 4G9FE 3S97C 4L8CB 3TYFB 4DOHE 4OQTL 5ERWB 1NFIB 4EDWH 2F54E 1YC7A 2R8SH 1T2XA 5DRNA 3UAJC 3O9WC 4U1JB 5I76B 5MEND 1MH5A 1KTLA 4GRMA 4LLYA 1KC5H 3KLAB 3U4BL 2V5SA 4YDLC 9CGTA 3NCBB 2B39A 4KK9D 1CZ8H 3ARUA 4LSUL 4IOSD 2X4TB 2E8ZA 4QY8B 1X4ZA 3RRQA 4QRRE 5D1ZB 4HUNB 4UNTA 4LLVA 1UC6A 4NP4L 4D0BB 1DN2A 2W65A 5ANME 4I18A 5ISZB 1JHKL 4GRWH 4M8QA 3BPOC 5HHNA 4MA3B 2YBRA 4NO0B 1SY6L 5E6IC 3Q6FB 3MV9A 1AGCA 7FABH 4OD3L 4HKJA 5F21B 1EHLL 2VLKD 3H3BC 1OL0A 1WTGT 2HFFB 3NA4A 2N4IA 1MHPL 3MV7D 3STLA 4S2SB 3P77B 4OLXL 4JFYA 2VXUL 1UH4A 3TA3C 1H0DB 4WW2C 1J1XL 4K7FA 1EO8H 5I1EL 1S9VA 5DYOA 1UCBH 2DTMH 3OJDA 4R4FL 4Y88A 5F7DB 3DBXA 4OD1H 4JHAL 4OF8A 4N5EA 1V5JA 5IB4A 4LSVL 1GOGA 1S9YB 4G8GA 2IC2A 3QIWC 1HINH 4HBCH 1QFWI 1AC6A 3VWJB 1SBSH 2Y25A 3MLVL 2ZKHL 1BFOB 5KG9A 1Q9WB 4DVBA 3OF6A 3B6SA 4ZPVB 4PGJA 2FECL 3VXTA 2IMMA 1VHPA 2V9RA 2W1NA 4X98A 1FL3A 4PJ9C 5E70A 2A6JA 5A2FA 1M7IB 1GHFL 2VZ3A 3QXVA 3SGEI 1JGDA 5FYKL 4I5BB 1WQVT 3BPOB 3CSYA 2BHUA 1JHKH 3AS3A 4WFHD 4HIXL 3I50H 4P0DA 3OSKA 1OAKL 3V4PL 3FO1A 1W2KT 1N6VA 3TYGL 3G5XA 4N68A 5T3XH 5BZDA 3M1BB 4QRSB 2NYYD 1FIGL 2EC8A 3IS0X 3U48A 4NUGL 1HHJA 1GOFA 4ONFL 5LJYH 4WDIA 3JV6A 1VCAA 2VXVL 4JDTH 1NCNA 1RZIB 4POYA 4XC1L 3V0VB 1EO8L 5INCB 1X5GA 5I1EH 1CICB 5IEHB 1O7VA 1UM6H 3C6LA 4DW2H 5LBSL 3OAUL 4LLQA 4JM2C 3C5ZD 4IOIA 4O51A 3T0EA 3UJJL 1D5IH 1A64A 4R26H 4Y5VB 5J6HA 4PRDA 2Z4QA 1MCSA 4AEHH 1Y18B 1E4KC 3IXAB 2BOBB 5TPWH 4KAQL 3U9UB 2CK2A 3UTTB 5FFLA 4X99A 4CAGA 1BZ7A 1IC1A 1JV5B 1KJ2B 3B3IA 3QUZA 43C9B 1S7TB 5EZOL 4KZDL 3MCKA 2EO9A 3UEZA 3P0GB 5DQ9B 5I8OH 5GSVB 2RAMA 5CWSA 3DETD 4UT6L 2OK0L 2Y7QA 3K4ZA 3FB6B 1D9KA 4OCSH 1Q38A 2KQNA 4L8SC 1MWAH 5T3XL 4NYLB 4DVBB 4OZHE 4JZOA 1YEGH 1DBMH 5EULV 4OGAD 3NN8A 3ZTNH 3PG2A 3I02A 3H9HA 5CKGA 3QIWD 2PO6B 1F97A 3V7MA 3VXSD 3LRHA 5E1AB 1RURL 4YHIA 4MD5A 1T0NA 4TOYL 1ADQL 5E6YA 2IF7A 2PR4L 4M3KB 4K9EC 4PJXE 4NBZB 4X80H 4CVZB 43CAA 3UAJD 2GJJA 5EUKB 2P5EA 4ORGB 5KN5A 4WFGE 5ALCL 3D69A 1RFDH 3RDTA 4YX2H 4D9LH 1JHTB 5IMMA 3Q3GA 3NZ8A 2C4FU 1JUFB 2VR5A 3V9FA 3SDDD 4Z5RB 4Z8FH 3R4DA 1J8HD 1Q1JH 2FX7H 4EDXA 5E2TH 4NQCB 1YEJL 2IBZY 2ORBH 3RIAF 3VFUB 5C0EB 4Y4HD 1OAUH 1B3JA 1QLRA 4ODTH 1U8LA 4UT6H 3SJVB 2NY4C 1I7RB 4PLKC 4ZSOA 3DYOA 3FFCA 3OKNB 4HIJA 3K81A 3T0EE 4KQ4H 1WWBX 1D7FA 4BELD 3IXTB 3RP1A 5DRNB 3K46A 3OKYA 5DD1L 4AYFA 2JJTA 3IDYB 2JJVA 4U6XB 1PW3A 3SE8L 3VE0A 5BQ7A 2AJSL 2YUWA 5K33A 1WV7T 5B3JF 1CLCA 4RGMB 2I60L 2GEEA 3CZFA 2H1PL 1AGCB 3NCJL 3LRGA 2OQJA 3WIHH 1JWSA 4LCUB 3P30L 3BUYB 3WE6B 4RSVA 3MLRH 4D3CL 1AQKH 2R69L 3IKKA 5GS1C 3IU3B 1B0GB 3BESR 5ALCH 3VFNB 2EIDA 5C0JB 4PJFB 3EYUL 4XX1E 2QADB 3MJ9H 3DGCR 4F7CB 2WBJB 1QA9B 3CXHK 3PDGA 2HT4C 5ICYB 3O2VL 1EMTL 2P8PA 4KVNL 5E8DH 3BPNC 4JE4B 1MFDL 3L7EB 5CEXA 5KW9L 4NPYA 1RJCA 1DUZA 3LQZB 5T3ZH 3M07A 1DL7H 3P4NB 1U8NA 1F3RB 2J7LA 2Y5TA 3EFFA 4XGZA 1IGTB 5GGTH 1YEKH 1GC1L 4NZUL 3IFLH 1FO0L 1J87A 2QQNL 4LDEB 4OGYH 4KROD 5L2KB 4MS8A 3ZDZE 4PRID 3VFOA 4G5ZH 1NBVH 4XZUA 3L5IA 5HGHB 2GAZA 2VMFA 3BZDA 4MA1B 1WWAX 1INDL 1CU4H 2NZIA 2R1XB 1JI2A 3ZE1E 3SE8H 1ZKAA 2CQVA 3LN5B 5IV2B 3OKEA 3TNNB 4FTVA 1VSCA 3UTPE 1HCVA 4HKZA 1CG9A 3TFKD 4P23A 5F44A 4RFOH 3KHOA 1OP9A 4NQCE 2H9GA 2AV7A 1MIML 2DIBA 2VDRH 4H5SB 3AAZA 2P45B 3T0XA 2DMCA 3S8WA 3JV6B 3VFWA 2PCPB 3MXWH 4YE4L 3BP4B 3ARDA 4HGMA 1OD7A 1WCQA 3SY0B 2ZCHL 1IAKA 1D6EB 2ZP0T 3GRWH 4HUMB 2FGWL 2H6PB 4HXBH 4O00A 1OWWA 4R4NC 2V9TA 1K85A 4KTYA 1DFBL 1TJHH 4AJ0A 3WKML 1ZMYA 4WFHE 2H8PB 2EE6A 4B50A 1C5DA 3CXDL 4N9GB 4R4ND 3LCYA 4Q74A 3HAEG 4J1UA 1WZ1L 2CXGA 3ARBB 5DZNA 1CK0H 3TN0B 2X4QA 1IBGH 1SEBB 4OD3H 3LHPH 3D2UB 3OB0H 3MGAA 4WU5A 3TNMB 1BX2B 1OW0A 3ZE0F 3GSNH 1ED3A 3RWIA 4JZJA 1TZHA 1ZTXL 4Z0XB 1CXFA 4QTIH 1ZEAH 4HS3B 3FN3A 3EZJB 4PTUA 5I9QB 3V7AE 4XCNB 3A6BH 1IZKA 4WO4D 1HILA 4KHXL 5CEYB 4OGXL 5D1ZA 2B4CL 4FZ8L 2GJ6D 1U8OA 3SDAC 5BVPL 1KIRA 3MNZA 1L9NA 1SYSA 4YHYC 1NCTA 2IPKB 2XV6B 1T0NB 2O5XL 2LE9A 3AVEA 2PO6D 5A3ID 1UVQA 4FQHA 5LVEA 1T83A 4PJ9A 2QKIA 4ZO9A 4KDVA 3DUSB 4WUUB 1N6QH 2JIXD 3FB6A 1F3DH 3OV6A 4NO0A 5EORH 1JYWA 3FOLB 2WV3A 1S5HA 1EV2E 4OZFB 3WCYA 5DJ0A 3RVXC 3IDUA 3U7WH 3MLWL 3FO2A 3N9GL 1KPVA 1V7MH 4MAUH 1UWEH 3SDAA 3W82A 2PCPA 1X5YA 3L3DB 3BP6B 3GKZA 1R3HA 2EH8L 1G1YA 4XPAH 1NC2B 4PJBB 2J3SA 3C09B 2YUXA 4W4OA 3SGDH 3UMTA 3QG7H 3ZT7A 1KLGB 3PABB 3T2OA 1UXWB 1YZZA 5IBUG 4EI5D 5HVHC 5LAXB 5DJ8B 2R1WB 2NW2A 3ZO0A 1U8MA 5GZNC 4X9GA 4OLXH 4ZUWB 1MCFA 4ZUUB 3PHSA 5I1KL 4I3GA 1TFHA 4JKKA 5CUSH 1AHWB 5D7IB 1EEYB 2W0PA 4HCRH 5C0FA 1R5VB 2QLVB 3B8SA 5LBSH 4LBEB 4ZO6A 5GZND 1FNLA 3F58L 3LSOA 1FRGH 4J23A 3S36X 4OUUA 1PEZA 1FFNB 3EYQD 1XIWC 1W0WA 2W07A 4RFNC 3QUML 2DQJL 5K9KB 2ZUTA 1CE1H 1EGJA 1FJ1A 1N6QL 1JP5A 4GOSA 1T0PB 3LEVL 5BS0D 2F54B 1KCLA 5EOTB 4K7PX 4TNVK 3GB7A 2ZNWA 1M71B 4G8IA 1RIUH 4UV4L 2BJML 3VJ6B 3BDYH 2OK0H 4H0GA 1CLOL 4Z7UE 5IHZA 2VE6A 4ETQA 5KAQF 1OP5H 5DK3A 4JHZA 5F72S 1I9RL 1X5JA 4Z7OF 3ZT6A 1XF1A 1RZKC 4N8VA 5KOVC 4WV1C 3C5ZA 4KTDH 1E4WL 3P0YL 1MLCB 4XBEH 1BEYH 4KKBD 4X7DC 5D7IF 2D4DA 2E7LA 2ESVD 4OLUH 1VGKB 2P7TB 1EJOL 2RR3A 5EZLA 5E2VH 5JQ6H 2GJ6E 2JK5B 2F19L 4JFDD 1EZVY 4R7NB 4U1SB 2MHAA 4WV1B 3V4VH 3GSUB 2VLRA 3LPFA 3VFVA 4Y4KC 3U7YH 3UBXG 4Z78B 4I9WE 2XACC 4NBYB 3S37X 3WV0A 1S5IH 3QQ9D 5F89B 2W9LA 3FAWA 1I1AC 2BSRA 2ZG2A 2Y23A 3OHXB 2CDEA 1BGXH 4UT9L 3G04A 4XNMA 3LKNB 3VRIA 5IR1A 4Z77A 5ICXB 4ZG1A 4EVNA 4UT7L 3V6OC 2QR0B 3C6LC 2FBJL 2BRQA 4XHJD 4I3SH 3MPCA 1YPZB 5EG6C 2LAAA 1A4KA 4MLIA 3QZWG 3UTTE 1GGCH 4Y4KA 4P4KB 2V2WA 3RNQB 4OZFG 3MZTA 3BD3A 3MOAH 5TDPB 1KTLB 4GRMB 5I8KL 1N5AB 3PHQA 4RWYL 4LLDA 4WWKD 3ARGC 3V4UH 4B7LA 4AMKH 2CLZA 4FTVE 3EIFA 5C0ND 5EUKA 3UTSB 5KN5B 1YEEH 2PTUA 4YHYB 4O2CA 5IQ7L 3OZ9L 1E4XL 5FAAA 4LSRL 2HRPH 3VXMA 2GAZB 1CTNA 5I73B 3TCLA 1OAYH 5F7EH 5FDWA 2F19H 3TT3H 1PGRB 4LLMB 4GW5B 3IDXH 4EI5B 4ONHB 1FN4B 1ZVHA 2NY6C 3CSBA 4MSWB 4NM8L 1JNLL 5E08L 1NMCB 4WI9A 3HI1A 1KB9J 3DX9B 1JYVA 1KLUB 1T3FB 4OSUH 4HH9A 1YQVH 5E2UH 1NUGA 1CTOA 3O8XB 4O5LL 4FQXB 1E0OB 4P2RE 2E9IA 2P44B 5IVXB 5IFJA 2R39A 4XPGH 4N0YL 3FQXA 3MR9A 2CRMA 5HHPB 1BQLH 3BPLB 4BZ2H 1NCAL 5KANI 1K8IA 4LQFH 3GHBL 3SGDI 2HFEB 3LH2L 4Y5YA 3BZFB 3JWDL 5E8OB 5CINH 3NVQA 5TE6L 1N7MH 4XH2B 1XMWA 5CP7A 4RMUA 4WWKB 4F9LA 2XQBH 3ARTA 4K3JL 5GZOD 4HC1A 3GMPA 4BQCA 1DBAL 5EU7E 5HYQA 3ARED 4QHMA 5I6XB 1NC4A 2ZOLB 3EO1B 3VXTB 3PIQA 5E2WL 2BSTA 4X8XA 3DOSA 2F5BH 1Q0XL 3HC3L 3T65A 4C56D 1X5ZA 4IBLT 4NUJA 5EUOE 2XZZA 1Q0YH 5GGRB 3HUJF 4LSQL 3AB0B 1F02I 4MA7L 4N0UA 4KGJA 4XP6L 1VADA 4Z9KB 3VDCA 3H0TA 4QTHB 4Q9RH 5FGSA 1PEWA 3ULSA 4R4BB 3E1F1 3O6LL 3QNYB 2F5AL 4R2GB 3MYJB 5GGQH 4HKBA 5TDPA 1AXSB 4R2GD 5JXED 2YD5A 1Z5LB 3MA7B 3FB7B 1JF5A 3B8YA 5INDA 2UZYB 4N1CA 1DL7L 4BSJA 1HH9B 4L4VB 1G1CA 3IVKA 1P7HL 1FO0H 2QQNH 1MEXH 3BAEH 1TPXC 4MXWL 3RIAK 4EVNB 2X4SA 1IGMH 2OL3L 3CLEH 2F58H 3ARPA 2VL4A 4GKOA 3OKEB 4FG6C 5C07D 5C0CA 5JQHC 2X2YA 4MHHI 2EXYC 1JGLL 2VR4A 5AG8A 5GGUB 1T80A 1AXTL 1JPGA 1FZKA 1QD0A 2A6KA 3P0VH 3QCTL 3S7GA 3T08A 5IQ9B 4PBWD 1QBBA 4LLYB 1Q0XH 1HIMH 3WUZA 3QUZD 1MIMH 4IRZH 4P3CH 3K4DA 1QTYT 4M7ZB 1AGBA 4RMTA 4JJ5B 3RUGA 4ZFOA 3MRDA 5IMKA 2LTQB 1KT2A 1I9IL 4Z7NF 3C5JB 3M17B 4YPGA 4BYHA 4JM2F 1CI5A 4N0RA 3RZCD 4UZGA 2Y7QB 2VXSL 3Q1SL 2FWOB 5T5NF 4RMWA 4S0UC 4WNQB 5CP7B 1RQ5A 3SGJC 1AGDA 5DHYA 2R1YA 2CLVA 1FAIL 1KN2H 1WEJH 5GIRB 2JTDA 4WEMB 4DK6A 3IRZA 3ULVD 4JKLA 4KZEH 3Q6GH 3QCVL 5IHZB 2VL5A 4XHJC 4NC2B 1QLFB 5EUOA 3BAEL 4MXWH 5FYJE 1JZ7A 4D0BA 4XP4H 1Q94A 1NPUA 1VFBB 5JXAH 2BVUA 2BVEA 4Y1AA 4MZ2A 5LXGH 4PJDF 2YD7A 1CFNB 2EYTA 2EDHA 3GZKA 4HBQA 2J5LC 5DJCA 3E8UL 2VDMH 3D5OF 5FO7B 4DUVA 1QVOB 3I9GH 2IMNA 3KYAA 4PJAF 5MEPA 4XVJL 3KPSE 2MKWA 3RL2A 2R2EB 4XPHH 1KTDB 2JB5H 3NH7L 1C08A 2YPVL 5HDQH 5E24E 3L7FB 5C6PB 3GMOA 3V0WL 5F89A 4LRIA 4MAYC 2Z8RA 2Z8VC 3PHQB 5JTWA 1GAFL 2J6EH 3O45B 3E3QE 1J05A 4W6YB 1LQVA 4I9WD 4EBQL 5IIEA 4EIZC 2NY2C 2QJDA 3DMMA 4WHYH 5C0GA 1G7IB 4XCEB 5H2BA 4KRPD 5CLWA 1BQHB 2HJFA 1FZMA 1MCPH 3RTQC 4ZS7H 1Z9OA 2AV1B 4KZEL 1EBPA 1MAMH 4OD2B 1H3PL 4U1MB 4PJDB 1ZLWH 4LP5A 1CBVH 4NQCD 5TGBA 4CKVX 4W6WB 1Z3GL 2ICWI 5BV7C 5EUOF 3F6IA 3B5HA 1QRNB 5JPMA 4UOW1 5LGHL 1G84A 4LCIH 4WUUE 1YYML 1TENA 3D0VA 3MA9H 2NX5D 2OR8A 2VN7A 3GMMB 5IKCB 1IM9A 3TIDA 4CU7A 1KSRA 1JCKA 3O6MH 4OLYH 2R0LL 3GUTA 4OLUL 1T1WA 1NCWH 5HGDB 3REWA 3MRMA 4HF5L 3IF1A 4NDMA 4NO0D 3MCKB 4KK5C 3MGTB 3ZZ1A 1RHFA 1WIUA 4H1LB 1KJ2A 3WS6A 2BSTB 4XNZB 2XKUA 4KXZH 2WP3O 2FIRT 2DJ4A 1T6WA 4XNUL 5EDXA 1CFQA 1BZQK 5CSZB 4YZFE 1NL0H 2YPKA 1U42A 3QHZL 3V5HB 4HH8A 2BVOA 1FL6B 3H9HB 5D72L 4XNQB 5IJKA 1V8HA 4TUJB 4U7KA 3S4SA 1C08B 2YN3A 5FYKH 4JAMB 4S0SD 2R2EA 3ZT5A 4F8QA 1FV1A 1SYVB 1NC4B 5E00B 4G8FB 2CIIA 3E6FA 5DURB 4CBPA 3N1FC 1TQCB 2DKUA 2DOCA 1NAKH 1NAML 1L0QA 5TQ0H 2NW3B 4NO2B 2BOCA 2FR4A 35C8L 4GW4B 1QEWB 3U0WL 5CJQH 2UWEA 5DD3H 2UVFA 4FNLL 4J3SA 2Q8BL 4QHUB 2LVEA 3GM8A 3LQAL 3I6GA 4PGDB 3L3KA 1S7WB 1YPZE 3QFDB 1B88A 5ACZA 1I3RA 4M5ZL 3V2AR 2VB5A 3CFIC 3ZE1F 3KPSD 1BF2A 1UEYA 5JHDD 3KJ4B 1MFEL 3SGKC 4P99A 3RVVD 5TF1H 3UJJH 2CIKB 1OWRM 1MFCL 4I13B 2NY6B 4YHNA 5EA0L 4WW1B 1CDCA 1MCNA 3W39A 2LABA 2W92A 4UIMA 2YA2A 4QRQA 4HX1A 4Y4KB 4BSVA 1B0RB 4GXUN 5EFIB 3CX5K 3OKOA 3ZKXC 4WU7B 1S9WA 5DI8B 5EB9A 1UADC 1VERA 1ORQB 4K9EH 2JKXA 4C83A 2J8HA 4IM8A 4XPTL 2P47B 5JOPE 2X4SB 1NGQH 2ENYA 2B5IC 4LPUA 4WW2F 1FZKB 4YFLF 4LHUB 4XBPA 3RAJH 2NY0C 4OLVH 2V2WB 4KK6D 4FQ2L 1QNZL 1JNNH 2CDFB 5CBAB 5C6TL 4F3FB 3RWGA 1P7QD 4OQTA 3LRSB 2R8SL 3CFBB 4I3RL 2SEBB 1HXYA 1TPXB 1KCKA 1PY4A 4N8CL 1M7IA 1KELH 3T0WA 4K71C 1U6AH 3KR3H 2BNRB 1C5CL 2H2SC 3U0PB 4M93C 4AENA 5E6IA 1KJVB 1HKLL 4XXCA 4ZD3H 4PJFA 5SX5H 1WWCA 2VDKH 4JGJA 4MVBC 3K2UH 3JBG7 2QSVA 1IZJA 3MLUH 1CFTB 5FK9B 3BX7C 1FBIL 5DLMH 4YXLH 3DIFA 3GSVA 4MQ7B 1H15B 2DI9A 3DX8A 1GGTA 1UGNA 3MRKB 3O6LH 3BKJL 3ULVE 1I9JL 1X5KA 4QHMB 4PREB 1N3NB 2ADIA 5KS9B 4JY5H 1L6XA 3RZCA 5HHOA 1K6QL 3JZ7A 4QCIB 4UUJB 2ZCLL 5SWSE 5FECB 5BRZE 3BOVA 4XT1C 2XXMB 4N0YH 2VAAB 1JF1B 3G6JB 2Q7NA 3GO1H 1OAUL 3I6LE 1KPVB 2A77H 4RBPH 3S88H 2E9JA 7CGTA 1IQWL 1CFVH 1DVFA 1N7ML 4Y4HA 4FQCL 1PLGH 1NGWB 4NQDA 2I9TA 3ME0A 3B2VH 4NKMB 4QHNA 4YHIB 3L5WA 2YMXL 3DNKA 2YUVA 1S7UB 1MRFL 1T04B 5CFHA 1KBGH 3TZVB 1KELL 3BPLC 2UWEB 4PUBL 5D8JH 3P4NA 1IGIL 4FMFA 2BCKA 1HIML 3WIFB 3JUZA 4YIQA 3MLRL 5CWSB 3CVHB 4NT6B 3EO9H 2P5EB 1QKZH 3MO1A 5DFVD 1KPRB 1G7QB 3BQUB 2X1WL 3RWDB 1MLBA 3PWJA 2FJHA 2X4PA 2BX5A 3PWUA 4JQXC 2Z31D 2AS5M 5E0QA 4YEEA 2GCYB 4TTDC 4YDVB 1PYWA 3EYSL 3UYOD 2OJZH 3MRCA 1DDHA 4NN5C 5L8KB 4FQQB 1AE6H 5D5MA 2DLGA 2AERT 3QWRA 4J3OC 4M48H 4K3EL 5HDLA 2G9HA 1K8DB 3WFDL 1F3JA 2VLKB 5IFAH 2D9QB 2EDFA 3IETA 3BKCH 1KEML 3BISA 4LAQL 4XC1H 2YD3A 4NSKA 3B83A 1T7YA 1X7QB 3IDGB 4U3XA 2VIRB 2YPKB 5IT2H 5HI4C 3OPZL 1KIRB 4JQXA 4L4VE 2IBBA 3GMMA 5IKCA 1ZHKA 1A4JA 4NQUA 1D5BB 1G9NH 2WW8A 4QHLA 1C1EL 3U79A 4Y2DD 2MFNA 2A0LD 3OXRA 1LD9B 4L3CB 5DMKB 3SHSA 1CQKA 1F00I 1E6JH 1KTRL 2COQA 3V0WH 4MAYA 4MB4A 1QKZL 5M7QA 4GQ9H 4R8WH 4WI7A 4PJEB 4ZPTA 4OZFA 1F6AA 2ZSWA 4X83A 2CLRA 2R9HD 2Q3ZA 2X4UA 4XAKE 25C8L 4KV5F 3HNTL 1OB1B 4OV6F 1A14H 1JMXA 1MI5D 5IVXF 2DQHL 3JTTA 4Y2OA 3PNWA 3MOBH 3WKMH 1XGRA 2QADC 3KPRA 3NTCL 2NR6C 4P4KC 5I66A 3HR6A 4AEFA 3K8KA 1OTUC 3CXDH 5B38A 1YEDB 4UBDD 2EIEA 1LDPL 1CVSC 3PGDB 4BFIA 1L6ZA 1Y6KR 1BAFL 4HGKC 4Y5XB 1FNEA 3HB3D 2ZUWA 5CSBA 3WDHA 1DN0A 1FH5H 3TM6A 5KSUB 2QHRL 1RFDL 3ERYA 4F15C 3GSNL 1BFTA 3ARBC 4XC3L 4J7RA 1YYMH 1W72A 1WFUA 3BZ4B 3JUYA 1FNSH 1IKNC 1W0WB 2ZCKH 4L8DB 1C5BH 5D1XC 3WN5A 3MC0A 4K71B 4AIXA 3M45A 5E2TL 3IFNL 5C08A 5EIIA 4YQXH 4GO6B 2KDGA 2PYEE 5E9DA 4HV8B 4UB0H 3SE3A 5B39B 3S96A 2X09A 4MXVE 1UXSB 4PJCA 4HWUA 5D7IA 3VGHA 2NY0B 4L1DA 5JA8B 4P9HC 5E6IB 5DR5H 2PETA 4JZNA 5DDHA 3V6FA 3GMRA 5TFSL 4WFED 2MOVA 3GK8L 5HVFB 2DQHH 4Z7VF 5D1XA 2ENSA 4IIQA 2CIKA 3QULB 4V1DD 4LP4A 2OMBA 1V3MA 3BO8B 4I48B 3SJVD 5KVFL 3ZKNC 1LGVA 3SE3C 2BVQA 4B41A 1QR4A 2P5WA 2HFGL 4PR5B 4PY7B 4ZMAT 3KYMA 4U6HB 4M8QB 2EH8H 1BBDL 5HGAA 3H42H 3P9LB 1Y18A 1ZGLP 3EYUH 4XH2A 1J7VR 1GXEA 3SN6N 5LGHH 1YN6B 4UTAL 1YMMA 3KAAA 3HMWL 3STZB 1ZHNB 5C0NC 5JW3L 4HFWB 4X6FA 3BJ91 3OAYK 4L5FL 2MPAH 3H9SB 1IRAY 5F1OB 1MHHA 4U1JA 2MQ0A 4WI5A 4KXZI 3MMEB 5D1QB 5ITFA 4LLWA 5C07B 1FL3B 4XCYB 1SYSB 4GAJL 5IGXL 4TVPD 3QXDA 5EWIL 3UX9B 3QHTC 1JFQH 1KV3A 4PPTA 4C56B 1HYRC 4PJ7E 3BXNA 1A47A 3DYPA 1VFMA 4ODSL 3DGGB 3UP1A 5FYJL 3QCUL 5AUMA 1FPTL 3C8HA 3HRZA 3FOLA 4LCCA 3WJJA 4DVRH 4KRMB 1SMAA 5DEFA 1SVZA 3G6JA 3B2UC 3CFDA 1S9VB 4NQEB 5C08B 5JNYA 5EU7C 5CD5D 3TBWB 5TDOA 4L8DA 4PRPE 5SX5K 5ANMB 3QEGL 3D25A 4Y5YC 1JPFB 2X5PA 1JK8A 4YBLB 3U46B 3OAZK 2BVPB 3ISWA 2CRYA 3WFBH 4R2GC 5JXEC 3TBTA 4GKNA 3HG1A 4WJ5A 1XGQA 2IADA 35C8H 5D93B 3LDBC 5DD1H 5K9OA 5C2BH 1FG2A 3ARFC 1WWWX 5DURD 5D5ME 1ZA3A 2H2PD 2GKIA 1EVUA 2EDNA 5I1JH 3GKWH 5EPMB 4DAGH 1ZHKB 4DKEH 4OCRH 1AQKL 1F42A 1I8IA 1IEBB 1AO7A 2WUCL 1QLRB 2F9BT 4E42B 1T21B 4PV9B 2ED7A 3AS0A 1S8DB 4QOKE 4XMKH 5IFJB 5JIIA 5L7XL 5E94A 2VTFA 1FYTA 3WO4B 3S5LG 1OARL 3FQTB 2NPLX 4PJ5A 2DJSA 4OM0H 1U93A 3U4EA 1F6LL 2AXGB 4DVRL 5T1DL 1ETZB 4APQA 3KG5A 2JB6B 3WNOA 1R0AL 1T03H 3P73B 2X7LA 3HI6H 3HN3A 1BGXL 3CCHA 3M1BA 4G9FD 4GG6B 3TN0D 4WFEE 4C4KO 2ZUVA 1KCGC 2ARWA 1YEKL 3MJ9A 2BFVH 4OB5L 2GJ6A 3O81A 2DLEA 3V6OE 4CVXA 5JUEH 5MEQB 5C6TH 1I8MA 3DPBA 2B4CC 2FX9H 3ECBA 2O5XH 4FQCH 4BA8A 3TZVC 3L3JB 1BQUA 4ODUA 4NHCL 4ZXBD 4G6JH 3TO2B 1LK3L 4HZAA 5D8JL 4NSKB 2BNQE 4FABL 1OAXL 3PDOA 2DQTL 43C9A 5L9DL 1D9KB 1ZLVK 3S37L 1F13A 3S34H 1I1AD 2IANA 5DJZB 2F74A 4HQQH 3UZQA 4JPVL 4XMKL 4X9IA 1R3IH 4R0LB 2BHZA 5FO8B 3BGFB 5IBUB 3IAQA 3MNWB 1GVIA 5DK0A 1OSZB 1JNHB 1P1ZA 4ZODA 2N56A 3EDEA 2I5YL 5CJBA 3FQUA 5LCVL 2GYSA 3TBTB 3T3PF 2XXCB 4S2SA 2F53E 5ALBH 4OSUL 4XCFL 5AD0B 1T03L 3QAZC 3IYLW 5J13B 2R2BB 5C0RH 1BVLB 5D1QD 1I8IB 1QUNA 2E7CA 1FZJA 3QZWB 4BQ6A 2ATPB 2MSPA 1ZLVH 3TPUE 1NCAH 3PWLB 4DJMA 5HVGB 1S7UA 1GH7A 2EDKA 3OPZH 2VDLL 5JO5B 3D3VB 5IJKC 3CVIL 3HR5B 3CFCL 1UWXK 2EDWA 4GRWB 1DEDA 1MRFH 1DBAH 1K4CB 5JOFB 3PL6D 3GI9L 3WDJA 3O3EA 4OBSA 4O2CB 4O9HH 1HHIB 5FKAA 1YNLL 3PWNB 3AS2A 1XCTB 3NFNB 2WK2A 4L4TA 1JGDB 4H8WH 3RZCC 5J11C 5F1SA 4YC2C 3GBNL 5B4MC 4M6NH 4WHTB 3C6SA 4U1IB 3EHBC 3HFML 3PUCA 4GQ9L 4R8WL 4HFWA 4GKZB 2DDQL 2MQCA 3ZDXE 2X4QB 1NDMA 1ZA6A 1AGBB 3RUGB 2O5ZH 5BMFH 1FVEB 2B1HH 5FM4A 2ICEA 1SJXA 2X41A 4NOBA 2VQ1B 2A0LC 4OFYA 2F54D 1A6ZA 3VFTA 1CDBA 1ZE3C 2ERJB 3CAFA 3C08H 3VD9A 3BO8A 3P0YH 4XP1L 2V7NA 2APXA 4ONGH 5KANG 1OAZH 1WBZA 4OF6A 4QWWD 2XY1A 1N5YH 4NHUE 2YRLA 3C2AH 2XG4A 4PGBA 4F15B 5HI4D 2DN7A 3HRZB 1UCBL 2DTML 4MJ4A 4R4FH 1MCJA 2APBA 1EPFA 4KMLB 2CO7B 3GMRB 3ARZA 1T20B 1ZHNA 3AU1A 3CLEL 4PJGA 5DQDL 3FQUB 3RWJB 3SOBL 4HS6A 2C1OB 5SWSB 4QXGL 4S1QH 3AB0C 1JNHA 3RVVC 1R3KA 5C0BD 5DMKA 2VABB 1G7PA 1UH2A 4M03A 4X8JB 4LLWB 4MD5B 4J4PA 4M4PA 4UBDC 3D39A 1IAIM 3MRQB 3WIIH 4H8WL 1JV5A 4TTDD 1ORQA 3FB5A 1WUNT 2NQCA 3RY6C 1WITA 3J8F7 4GKSA 1R5WA 1U92A 1YEHH 4HK0B 4NWUH 2ARJA 3CU7A 4NN7B 1JZ8A 4ZFFA 4OFYD 2ADFL 3ARFB 1NUNB 1VKXA 3NFPA 4TNWF 3PIQB 3QUMH 3QEUA 4YDKH 5ECJE 3EDJA 3WJLA 3ZHKA 1EEZA 1ZT1B 4P2CG 4PP2B 4PRPD 2EDRA 2YOCA 4D0CB 5ID1A 3KWWB 2F8VA 3DI3B 3O4OB 3QIUC 5IFHL 4UINH 1YEEL 4YHZL 4HUVA 3PGCB 1RULH 5FOJA 4PS4H 4APQB 4L3ED 4LLUB 3WNMA 3VDAA 3RL1B 2PW2A 4WHYG 1EERB 1EHLH 3GJEB 1FYTB 1YN7B 4TQEH 2K3TA 4HUXA 4NZRL 2W9EL 4ZQKB 2IPKA 3PV6A 2XN9D 4V3DB 3R0NA 4JQVA 4BKLA 3PXJA 4K2UL 2PUQT 2ZCKL 3MRDB 2FLRT 3KYKH 4JVPA 5DJAB 3T0BA 3CC5A 1A5FH 1H3TA 4J3UA 5HDQL 3TH2T 1KFAH 3AM8C 3OAYH 2GQHA 4XCNA 3RJDA 4QO1A 2DWEB 5AZ2H 1RZ7H 3UC0L 2A74B 2C1PB 1MF2H 3N1PC 4RNRB 1CXEA 5GGVY 1AI1H 3L3OA 4AEEA 2C7UA 1HI6B 3QPQD 2F53A 5JHDA 4HS3A 1FVCB 3FO9B 3U30B 2YPLE 3MRMB 2CGRL 1ACZA 3BQUD 2Q76B 1A0QL 4M93B 2BNQA 3ES6A 1MREH 1AXIB 3T3PE 4MXQC 1RUAH 3RU8L 1MCOL 2VQUA 4FHBD 4NRYA 5FDYA 1KB5H 5GRUL 4KK6C 5T1MA 4G8EB 4GBXD 4H88H 2ICES 5IOPA 4JFOB 4XCYA 2FJGB 4LSQH 1IL1B 1OAKH 3V4PH 2FBJH 4NC1E 4L9LB 2X4NA 4JDVB 3B5GA 1U36A 2LU7A 1UZ8B 3IJSB 1OSPL 5F96H 1B4RA 1GGCL 4HAFA 3RKDD 5DJDA 3DVIA 2NY5C 1F3DJ 4Y0GA 5EOQL 4LGPB 5IBLD 4E0RB 3N0PB 1YNKL 5C0BE 4UILH 3UTSE 5JO5A 4DKAA 3GKWL 5JMOC 3TJHD 4KI1A 5DI8A 4NWTH 4RAHA 2OSLA 5LWYL 1FZJB 3QZWA 2Q86A 5DJ8A 4XCEA 5CIPH 4QRQB 5F7KC 4FQXD 4UTBL 4NKQB 5D7KE 1RZJH 4L4TB 1ZT7A 3TJHC 3MX0A 4I0PB 1NCBH 4KK8D 5IV2A 3RVWC 5JIPA 4QRPD 1P53A 2FSEB 3A67L 2ESVB 5I30L 2NXYC 2WMPA 1A1OB 2R4SL 1AR1C 2B8OT 2EDBA 4HX1B 4KY1H 1MCOH 3OXRB 4GG6E 2P48B 4QOKA 4CNIB 2EIZB 4R3SB 5CMAA 3HKFA 3DTXA 2R4RL 2X9YA 4HK3J 2R2BA 3A0OA 5C0AD 1AJ7H 4P46D 5D1ZC 4LEXL 3L5HA 1D9KC 4YDIH 4TNWK 3TGXA 4PRPB 5F9OH 1KPUB 3B3IB 3QUZB 5C8JB 1S7RA 4X6EB 2V7NB 1QBML 4JHWH 1BZ7B 4DAGL 1QPXA 3BIBX 5HJ3B 3PQYB 4Y8AA 3PWVB 5GGTL 3IRPX 3NIDF 5TF1L 1XR9B 3V5KA 1OF2A 1KCUH 3E0GA 3L3GA 4EN3C 1BX2A 3MV7B 1KCSH 3P73A 2ITCB 4WI4A 3D2UA 4CJ1A 4G6FB 2AJVH 2JCCF 4JEGB 2PTTA 2YRZA 2ZOLA 3QAZB 2OI9A 4AEIH 3C6SB 4YBLC 3FO9A 1PQZB 1HZHL 2OYPA 2OR9L 3CDYA 1TDQA 4H25B 2CR6A 3DROA 3EO0A 3VGBA 1MELA 1A1MB 4KKAD 3O0RH 1JZ4A 3ARFD 5GRJH 3PHOA 4O2EA 3BDBA 1P4LB 5AAMA 3ZL4L 5IMMB 4FXGA 3CFCH 1CN4A 4LF3B 3WFHA 2A6IB 4NHCH 4WIQA 2G60L 3PXHA 5IW1A 2CMRH 4HIHA 3FHAA 3LZFH 4L29A 5FO9A 2E7MA 4LEXH 4QRTB 1RAMA 5DYOB 2VAAA 4Z5RA 3MCLL 3BEVB 4L9DA 1Y6NR 4MXVF 1FN4A 3QIBD 1EFXD 3L3HB 3GJEA 2ARJB 2IBGA 2NZ9D 4OKVA 1DQTA 5J1TC 1FYHB 4XB7A 4ZPVA 1N59B 5E8PA 1MCKA 1UG9A 4RMRA 3QDAA 4PJ5D 3MROA 1JYNA 4WO4C 1MHEB 3NIFE 1IBGL 4OJFL 2R0ZH 2W59A 3BGAA 1JRHL 3KWWA 1CGTA 1YDPA 5FCSH 5F6IC 4I2XE 1H3VA 1H5BB 2DYPA 2OP4H 3HI1B 5C0RL 4F2MA 1WFOA 2E27H 3PWUB 3U0TB 1RV6X 1U58B 4KH2A 3WS6C 1F45A 3OJVC 2B4CH 3QI9B 4KJPD 5A3IC 1WZMA 2VC2H 5F9DC 4GAYA 3D87B 4JO1L 1JWMA 1MH5B 1UZ6F 4WW1A 3GSNA 5EBLB 1DR9A 3NCYS 2FO1A 2KUTA 4EN3D 4XNUH 2FEEI 3U9UA 1NC2D 2PKDA 1J8KA 2PYEB 4QKXB 1T7ZA 4KPHH 4GBXB 4XWGL 3ZYZA 2CRIA 3LDBB 4JPIA 1U8QB 4U4BA 5IB2A 3FO1B 5L0QC 4H0IA 4M4RA 5IHUH 4BH8B 4RFEA 4YAQA 3O8XC 1NKOA 3O2DH 3RY6A 4V3EB 2W38A 3AREB 2Q7YA 3N9GH 3MXWL 2PW1A 4KDTC 3A6CL 5GRZA 4GRLB 2XWBB 4HLZH 1RZGA 2DD8H 5B4MD 1A6PA 1LO3L 4X5WB 3C9NA 3WNNA 4CN6A 4PD4J 2IFFL 1EK3A 3GMQB 4D2NA 4HZLA 1BVKB 5F1NA 5D7JC 3D39B 4PGCB 1ZT7B 1UM5H 4KVCH 4OZ4A 4KWUA 1J8HA 3TP4A 4R7NA 4TTGA 3ZKSD 1KG0A 1HH9A 3KPMB 1FCGA 1FRGL 1ZSDB 1JE6A 4KROB 4MDJA 5L2KD 3VXSE 3P77A 4GRWF 4G6KH 4W4NA 4RAUB 4JFDB 1JPTL 3NCEB 1WZKA 3QDME 5HHQB 4NN6C 3VI3F 1Q9LB 4G8EA 2DQJH 4TN9A 5KVEH 1EGJL 2ADGB 4NNPL 4PY8I 3HTLX 1CD1A 3ZE0E 1FNEB 5KOMC 1DCLA 3TWCH 2ORBL 2W60B 1H3XA 3QNZB 1FORL 4Y16A 5SWZD 1ONQB 5FA3A 1BMGA 3MV8D 1JGEA 3RAJL 3FJTA 4MD4B 5C0IA 1LO3H 3HZKA 4CW1B 4H0HB 1IAII 1G7JA 3HNTH 4S0TD 4JDZB 4JFEB 5I1IL 4PJHB 3RBGA 3QFJB 4MS8C 5D7SL 1J1PL 3O6FD 3O9WA 5DJAA 2WANA 4MJ6A 1CF8L 3DX6B 5BW7C 3U7WL 4X6FB 4X6EA 1KN4H 5I6XC 4D3CH 2D31A 3FONB 4P9HH 1QSFB 5DEGA 4TYUA 3LKQB 4HDIB 3EFDL 5E2VL 5C0AE 4H20H 4LHJB 4JRYD 4JG0H 1HXMB 2GUOA 4GRLA 1YEFH 4NZRH 4QEGA 4N0CD 3ESUF 4Q2ZB 4DGYL 1KACB 4P59L 2H3NA 4X5WA 3LQMA 4FQXC 3QPQC 4W4OC 3BMWA 3G6JE 4JPIB 4M5ZH 3G08A 4U0QB 3U9PH 3IDGA 5J6GB 2CIIB 5BW7A 5FO7A 4LPTA 4P9ML 4X80L 2E7LE 4PGZA 2ZUXA 4XPFL 1ROWA 5GIRA 1X5FA 1CFNA 3STZA 3MZGB 3QDGE 5J89A 3WXVH 1PKOA 5C0DA 2BNUA 2FIKB 3MJ7A 5CIPB 4X6BB 4Y4FC 1IVLA 4JFDE 2ATKA 1J88A 3V5DA 3VXRE 3MOAL 4GFTB 3WNPA 1MUJB 5I1IH 5K59F 4NO3A 3LVEA 4P5KB 3KS0J 4JY4B 2NY1B 4XPTH 2RJMA 5I8EB 3WS3B 4WHDA 5D7LA 1BVZA 1NBZA 3BH9B 5I8CA 3WUWG 3X11B 3AM8A 3VG9C 5BO1L 3TZVD 4LARH 3GUTB 2IAMC 3O4LE 3X13B 1OAYL 4H20L 1IEBA 1BJ8A 4FQ1H 4JO2L 5GGUA 2J88H 2VSDA 2FX8L 4ZUSA 1DUYB 1SY6A 5DJXB 5HDBE 3ESVF 2BY0A 4HV8A 1J10A 1KIUA 4M48L 4NNXA 3MROB 2HTLD 4UV7H 3EJYD 3C5ZC 1HKLH 4WU5B 3S6CA 3TNMA 2DQCH 2ZPKH 4GKNB 3NCFB 2GFBA 2R69H 1IM9B 4WEUD 4U1LB 3O3DA 1RJLB 2G5BA 2J4WH 1BQLL 3ARWA 1YPZF 1JI1A 2QL1A 4J1UB 5FA3B 2FWOA 4V2BA 5CCKL 2Q87A 1NGXA 5CINL 5GGVH 4TVPL 5JW5A 3MBEA 3MRNA 4OLZH 1LWRA 2FATL 1QFUL 2YWYA 3GSQA 3SBWA 3DRTA 1HKFA 4IMLB 5I1LB 1AO7B 3VRJA 3C60B 4Q2ZA 1DQQB 4BZ1L 2V2TB 4P2QE 1MVUB 5EPMA 4NN5B 4ZOBA 2AP2A 1T7VA 1RZGB 1X3DA 5SV4A 3ULVL 1YJDH 4M1DL 4KRLB 5IVZB 5T33H 1RIVL 1TZHB 4X6DA 4RQQB 4KKCC 4Z0XA 3VA2C 5GS1B 3QO1B 5BO1H 3AREA 4LHQB 2QEJA 1KXVC 4GMTH 5HGGS 3VFPA 2XZCH 2VLME 1GC1C 1J0HA 4BH8A 3P3YA 2J88L 3MV7A 4QXWA 1JN6B 5JLZA 3BWUC 1DUZB 3VMPA 1FSKC 3O41A 1U3HB 2WINA 1A3RH 3F12B 4JR9L 4XMLH 1FGVH 1DQMH 5GRXG 5I0ZA 4DFIA 1P5VA 2BSSA 4RFOL 2FB4H 3WUWA 4YNYA 4NO3B 5DVLA 4N90E 1LP9F 2YPLD 1OF2B 4OCYL 3VFOB 3FN0L 3QA3B 2UUDH 4O4YL 4O2FB 5L7XH 2QSCH 5AUMB 2R23A 3HUJE 1BOYA 2YD2A 3GM0A 4GW4A 1X44A 4ISVB 1BVKA 2EKSB 4JREB 3V8OA 5JPNB 2A83A 2HTLC 5IEKA 1JPSL 5JW4N 4QRRD 1QVOA 5HHOE 5F3HB 3ARVA 4OZIA 4L8BB 3CFBA 1BQSA 1NC2A 4PJBA 3VGAC 1CG9B 3NACH 4OV5A 3R8QA 4MA8L 4AY0A 1ZT4A 4V1DA 3BP6A 3EYFA 5DTFA 2BFVL 1ND0A 2BY2A 4LIQE 1A6TA 2V9QA 4HC1L 2YD6A 1EAJA 5E8EB 5JUEL 4TUOB 1ZANH 4XVSL 4Y19B 3NMEA 2NXZB 1MCIA 5FF6B 3LHPL 4X6DF 1P7KA 3QRGL 1WIPA 1MI5B 2EYSA 3FFCE 1WTLA 1WCBA 1TCRA 3FO2B 3EUUA 1PG7L 4U2YA 1CE1L 3RI5F 4ZAKA 1REIA 4HPOH 5A1AA 1G7HB 3O8XA 5HDBF 3VMNA 4BZYA 4NZDA 4MB5A 3QI9A 2HTKD 1UWXH 4CUCA 3N1MC 1K4CA 5JOFA 4HJGB 2Q20A 2MCG1 2AI0H 4I4WB 4U49A 1IKFH 1O5DT 5FK9A 1I8KA 5CSZA 1QBLH 4X9HA 2WIIA 4QHLB 3BH8A 2FBOJ 1NFKA 4KJWD 1MHPH 1MRDH 4P23D 4YNYB 1BEYL 4ZXBC 1FFOB 4U1IA 1H0DA 4Y19D 3BKYH 1A8JH 1D5MA 3UTSA 2FGZA 2IALA 4JM2B 3NBNA 1HSBA 4K7PH 1DLFL 4JFOA 4OFDA 3MNZB 1G7JB 4JRYE 3GFUA 2NLJA 3HLAB 4XNZC 1W72L 4GXUM 1WBYA 4ODVL 3MRKA 5C9KA 4JY4A 1FL5A 3LMJH 5FYJD 5T1KB 3MLVH 1QSFE 2RFXA 5F7NC 4XC3H 1HSAB 4XX1G 1ZAGA 5CEYA 3S3SA 1T5XB 4XP5L 2P8LA 5K9QG 3PF2A 1A9EA 4LNVA 3EJYC 5J12C 2JELL 4YXKL 2C3HA 4UNVA 2DWDB 4HPOL 1YY9D 3SCMD 5C71A 5IHUL 4ZS7L 2W9DH 4KMQA 1RUKH 4PRBA 2NY1C 1TQCC 1EAPA 1H3PH 3O3UN 4Y2DA 2J5LB 3PABA 3MRJA 4K3DL 2AI0L 3WIFA 3DTXB 1MJJA 4NM4H 1ZVSA 2IQ9L 1U8PA 3UZEA 3NCMA 4S1SH 1BIIA 2VDQL 3MODH 1RZFL 2IFFH 5B3JE 4ELKB 3BN9D 1NFDB 4LVOC 1JJUA 3TLRA 5KAQG 2VXQH 1JVKA 4M1CC 5GS0L 1T2JA 3Q6GL 3IDMA 1DSFL 4E5XA 5DJ2B 1WK0A 3UTTD 4UV4H 4P9HL 5MHSE 1T0MA 5DWUL 2ZG1A 3AS1A 3QG6B 4FXKA 2V2XA 1IC4L 5CMAB 5DQDH 7FABL 3QDHA 3NCCB 3QEQB 2IPUK 5HD8D 4EQ3A 5CJ5A 3OKMA 1SJEA 4Y16D 2MTPA 1L4IA 2Y4SA 1AHWA 1E4WH 2WLYA 3EYVB 5D7LB 2P8PB 5KVEL 1NCCH 1TVBB 1ZK9A 1XGPB 4PJXB 3QHZH 3U2SA 1B0WA 4X9FA 5J9PA 1TZIB 3NH7H 5DF0A 4BJLA 1TLKA 3LQZA 1DEEB 3RIFF 2UZXB 3ARGB 4XPGL 5EWIH 1ZWIB 4JREC 3IXAA 2V2TA 5IROC 3DRTB 4MX7A 5T1KA 3RGVA 1RUQH 1B90A 1UQSA 2ADFH 1I1CA 1TQBC 3VWKB 3T0EB 2O5YH 2OZ4A 1TJGH 2BNQB 3QFJA 6FABL 3EHBD 1QSVA 4OZGB 5HHOB 4UIKL 3C6LB 4FNLH 3O41B 1JIBA 1LK3H 1S7QA 5A16A 4IDLA 1OP3K 3VFSB 3U4AA 1NLBL 5DJYB 1RJLA 2F53B 3FT2B 4FFWD 3LQAH 3WO3B 4FFYH 4GS7C 4HWBH 2BC4A 2OTWB 2YC1A 1KN4L 3CU1A 4F80A 4PS4L 1CDJA 3EYQC 1A3LL 4Y19E 1FNFA 5I66B 5DGQA 3TYGH 3KPQB 3B4NA 1HI6A 4MNQA 4O2EB 5C09B 4JO2H 1IFHH 3RNKA 4XWOC 3PWPB 3D85D 3H0TB 3WUWB 4AH2A 5I75B 4N0UB 5L88L 1G7LA 2YSSB 1X5IA 5EZLB 4OUOA 5KVMC 2EDDA 4BQBA 4D9RD 2CLRB 1LDSA 1NGZB 4EQ2A 4ERSL 1IEHA 3FB8B 2NY2D 3CD4A 1TCMA 2WNGA 4EDXB 3MUY1 2WBJC 1XF2B 1OB1A 2HRPL 5E2JA 1IEAA 3KGRA 1WCBB 4L3EB 5FKPA 3B6SB 1R3LB 2IANE 4LOUC 3B2UD 3V5DB 3Q2CA 5CCKH 5TDNB 1QNZH 4S1DC 3HC0A 1MJ7L 3CVIH 4HUKB 4WHCA 2XQYG 4TSBL 1BF8A 1N26A 3LD8C 2IH3A 1PDKA 1ZT1A 4GRLC 1UACH 5D72H 3GJFK 3GMLB 4U1GB 2XPGB 1A7QH 3P4MA 3DV4A 4NT6A 4PRPA 1QACA 2NYYC 5ESQB 4YIQB 1G7HA 3PQYD 1MVFA 3O6KL 3VXNB 5HXMA 5JDSA 1DEEA 1FG9C 3QISA 1RZJC 2A83B 4OT1L 1CGUA 3TBYB 4X7EC 1XIWB 3JTCA 1KYOK 4XP9L 5IBTH 3QUMA 1D5ZA 1G6VK 4GW5A 1Z5LA 3FB7A 4MX7B 4LLAA 5MHSD 1RJYB 5J1SC 3V5HA 5ESAB 3ZKMD 5B39A 4Y4FA 2V5MA 5D5MB 4CNIA 1CFQB 1MCWW 3C60C 3PQYA 1KXTB 1C12A 5B21A 1Q72H 2FB4L 3Q5YA 4XP1H 2AEPL 5L6YL 4KJQC 2W0KA 3C2AL 4Q6IC 2CLVB 2XRAH 3O4LB 2ILLA 3OF6D 3C60D 4XPBH 4M5YL 2VIRA 2HLFC 5IWLA 5DRXA 2Z4QB 3U1SL 2E3VA 5L2KA 1I1FB 1BOGA 3F7YA 3DUUB 1U41A 2DAVA 1W8NA 1QRND 3QDJE 3SOBH 4G7VH 2PXYB 1FFOA 2VOTA 1Q94B 1M05B 1NKRA 4L29B 5FO9B 4HPYL 3MRHA 5I19H 4JN2A 3QDMA 1GRWA 5F70A 4EUPA 1F4YL 3P40A 4HKZB 1DQDH 1NMCC 1DZBA 4Z7VB 3UXFA 1FL5B 1JFMA 1MEXL 1R3LA 4G6AD 1HOCB 2CUIA 1ZHLA 1A7RL 2G75B 3TBSB 2R1YB 2DWDA 2J8UF 3UJTL 4OLWH 4EBQH 3WHXA 5BVJA 2J8UE 1S7XA 1OY3B 2AXJA 2UYLB 4MNHB 3I2CH 4WJ5B 1YNLH 5DSCA 5BJTA 4P48A 4ZFGL 2FD6H 2DYPB 3FRUB 4WFFD 3VXRD 2AXHA 3B5TA 4Z18A 3MLZH 3MJ6A 3MRLA 5F3BA 4LNRB 1A22B 1T4KA 2DBLH 2AGJH 5FGCE 5I75C 1BIHA 4ZNEE 3L95A 4PJHE 5B39G 3CFKB 1RJZB 2VDPH 4UU9A 3L9RA 3BKJH 4J3TA 2OCFD 4LSPH 5B3NA 3SDXF 3W11D 1PAMA 1ITCA 3DVGA 4NQCA 1C5DB 4N9GA 3IVKB 4YFEA 3L3HA 1CGWA 2XWTB 4F33B 3KYKL 1UQSB 3FQNA 5JZ7C 4NFDA 4WEBL 4DKDC 2ZJSH 1GC1H 3VI3E 1NJ9A 4NC1C 4ODWB 4FZEH 4LCWD 2VISB 3AMKA 2UY7A 2YEZB 3RDTB 5JXAL 5GRJL 3IFOA 3MLYH 2BVTA 2IQAA 5KTEH 3LKPA 3RDTD 1K2DB 3LMJL 5ICZB 4OLWL 1MJ8L 5LQBL 5HYFA 1N0XH 4YBHA 12E8H 5J9PB 1I7UB 4EUPG 1IGFH 4PJIF 5H94A 4PUBH 1HEZB 3S5LA 5DHYB 1T83C 3BH8B 5TPWL 3NABL 3ZSTA 25C8H 4F57H 1KJ2H 3SJVE 1MRCL 1SMOA 1AGEA 2W65B 4LCYB 1R24A 4BH7B 5EORL 2FD6L 4LMQE 2HT2D 2WLZA 4ELMF 4EOWL 3HE7B 3UTZA 4P3DA 5FUOL 3UROR 4DZBB 1A7PL 2D4FA 5CJOH 3LPGA 3ROLB 3VXOB 3TJEH 5FIEA 4PJ9D 4PJXF 1G6RB 5F7YC 3ZE2F 1JTTA 4UNUA 1P9MC 5DRXB 2JF1A 4GW1A 3FO0H 3KPOB 1XF3A 1G0DA