1FO0H

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALLOGENEIC H-2KB MHC CLASS I MOLECULE)
publication title Crystal structure of a T cell receptor bound to an allogeneic MHC molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fo0H02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1fo0H01
1R3IL 4AIZA 5ITBH 5A43C 5EU3B 5ENWA 2ZUYA 3LEVL 4I3RL 1GGUA 1MRCL 4BYHA 4AMKL 4KMTL 4Y1AA 4WTZA 4XPTH 5TE6H 3JSSA 3RY6C 1QRKA 2XTJC 3AROA 1E6JL 5DURB 4P5TD 3VGEA 4ZPVA 2PR4H 3VGHA 3DGGA 4GQ9L 3MUY1 2HLFC 3BZ4A 3AAZA 3MRJB 3FZUC 2YD2A 5IHUH 5HYIA 4D3CL 3KPSB 5CZKA 5F70A 1T21A 1KPVB 4AL8H 4EKXA 3GK8L 3LS4L 2Y06H 3ALPA 1Q9OB 4E41A 1EVUA 2IALA 2CGRL 4L8BA 2BMKB 1LMKA 1ITCA 4L4VD 3C09C 1WZ1L 4HWBH 5EBWA 2OK0H 4OI9A 4DN4H 1PEZA 3MJGX 3QRFM 5HDLA 4XNUH 1MCIA 2VITB 4Z7VE 3IVKA 2FZ3B 1JZ8A 4RRPG 3L3KB 3DPBA 3O9WA 1AGFA 4K07A 1YQVL 5FKAA 4KJYB 2ZUXA 4UILH 3ARBD 2Z0BA 2XOTA 5TFSL 5B39A 4ZFGH 2E6PA 3HAEG 1MHHA 2EDKA 4JAMA 4FABL 1SBBA 1HWHB 3HUJA 5GGSY 5BVPH 5T33L 3KLHC 1GGYA 2FL5B 4UDTA 1JFQH 3HZVB 1G1YA 4OCRL 1YPZE 1Q1JH 2QTEA 4Z18A 1VEOA 4UQ3B 1XGPA 1S9XB 2VLRB 5I1CH 2ICWJ 3V79C 4X80L 4HS6A 4PJ9A 4HQQH 5MEQB 1KXVC 3KNBA 4HKXB 1CE6A 2NX5E 4OFIA 3V5KA 5FYKU 5BW7A 3EFFB 5GJSH 4M6AA 1KCGC 3ULUD 3DSFL 1QRND 5TDOB 3I2CH 4Q9RL 1LK2B 1U58B 1QSVA 4JZJB 2QADB 3IKCB 4HPYH 4Y5XA 1H3GA 1Q9WB 2AKRA 3IU3A 2HRLA 2D4DA 4LLQB 3L3DA 1KJ2L 4I3SL 1KJ2B 3O9WD 1D6VL 3AREB 1P4BL 3PL6C 1BAFL 3P0YL 2B20A 5IG7A 5IT2L 4JGUA 5A2FA 1JGLH 3EO0B 4G6AD 2VLKA 2R56L 2P8PB 1F4WL 5MENB 4NZRH 5C8JA 4TVSa 5A1AA 3ARDA 3V7MA 1GIGL 3O4LB 2NQCA 4PGEB 2YD4A 4MQXC 1KJ3L 3ARQA 3MLXL 4Q0XL 25C8H 3D18B 5JZ7C 1DEEB 4YO0A 2P48B 3BVNB 4PBXA 4DKEH 1LO2L 4UINL 3WL9B 4AEIL 1C7TA 3C5ZA 4O58L 4K55A 4R0LC 4OF8A 5HJ3B 1ZHLA 3BKMH 3FB5A 1I9IL 2AK4A 2FO4B 5EB9A 2BVEA 1QLRB 1FFOA 4OD1H 3SO5A 3MRKB 5DA0B 4O9HH 5KSVA 2A2QT 3ZDZE 4NJAL 4X99A 2VC2H 4BA8A 2NY5C 1P7QB 4Y8AA 2EDFA 5EA0L 3VFOA 3ARFA 2VXTL 2I26N 4UU9A 1Z0MA 1UWGL 2AJVL 5DSCA 4CVZB 1BM3H 1NUDA 4HHAA 3STLA 3HE6A 3PDGA 2ADFH 4J4PC 1OP5K 5F3BA 2ZUVA 5IF0B 4PGCB 5H2BA 3VXMA 1NCUA 3SCMC 1NMCC 5T5NF 3HE7B 3BN3B 2HTLD 4LOUC 3DV4B 4V1DD 5GRJH 1T1YB 5I16B 5J1AB 1SEBA 3D39E 1JN6A 4PJEB 1NFDF 1PG7W 1PAMA 2UZYB 4NSKB 2AK1H 3D48R 5DUPH 3CDGA 2QKIA 4Q9BA 3VD4A 3MJ9H 1I7UB 5GGRA 4N5ED 4G80A 3SDXE 5KW9H 2JJTC 2EZ0D 4R4BB 1G6RL 1AGBA 1G6RB 2NTFA 3OHXA 2P7TB 3HMXA 2AXJA 3ARFD 2I07B 5BMFH 2CMRH 4QTHA 3SE9L 1G9NH 3QHFL 2CK0L 1ZHKA 1TTGA 2MJWA 4KGJA 3OG6B 4ZYKA 4RIRB 1XCQB 2EE2A 2C1OA 1MNUL 3EZJB 2P45B 1AFVL 1KTDB 1FNEB 5MI0B 5ID1A 3OKDA 4BQ9A 1KBGL 4PJ8C 1FG9C 1BEYL 5EO1A 3QQ9D 3ZHKA 2IF7A 2BRRH 3GMMB 5ISZB 5E2VL 1S7XB 3R8QA 1IAIH 4U7KA 2Y23A 4POZD 1CU4H 1LK3H 4PUBH 3O3DA 2ITCA 1GL4B 2AQ1A 1U36A 4XB7A 1R3LB 2R0LH 5L2KD 1E4XI 2EH7H 5I6XC 3AXLB 4PRIA 1Q9LA 2DQHL 3QIWA 1CTOA 1RY7B 1TPXB 3EJYC 5DJ6A 3PWVB 3FT2A 5CUSL 3NCYP 4KAQL 4KVCH 4S1QL 3S5LG 1P4LA 3I84A 5DJ8B 3S37L 5EBGA 3FOMB 4PRHB 4TTDD 3CFDA 1KXQE 3D3VE 1FL3B 4JZNA 1QR1A 1RZIA 1S3KL 4HKBA 3F7VB 2QBWA 5LGHL 3L3JB 4PJIA 1JE6A 4X6FA 1IEBB 2X4OA 1NAKH 1BZ9A 2A83B 2JLLA 1DSFL 5HD8C 3DO7A 4QF1B 3ZDYE 3I75B 4M7JL 4GKZA 3CFKB 2A0LD 5FV1L 4LLYA 1TNMA 3SGKA 2Z35A 4NM8H 4PJFF 5IROC 2BY1A 3MRLA 3UAJC 3L5WB 1OW0C 4KFZC 5D1QB 1YPZA 5DUBB 3EGSA 2FHFA 3QNYB 4W4OC 1QVOA 5ILTH 1NGXB 4FQJL 4JRYB 1B90A 4G6MH 4LSUH 3T0EC 5M95B 3S36X 1S9WA 2G9HA 2UUDK 4EN3C 5E4EC 2C4FT 5INCB 3HC4L 3WS3B 1T2XA 3QDJA 5DD3L 5I17B 1U93A 2BDNH 3MBEC 3EDFA 4K94L 1JPFB 3U36B 43CAA 4EOWH 2C5DC 5MEPB 1MH5A 5FO9B 3N85L 2A9NL 4IOIB 4KXZI 1RURH 2VERN 4YBHA 2YPLD 4X5LA 3JXAA 4L4TB 5B3JF 5D1ZC 5EUKA 3MV9B 3EYFA 2E6QA 2PETA 2W65B 2Z91B 5KJRH 2BC4B 1EX0A 1UB6B 3PP4L 2R8SH 1S7SB 1FFPA 5BVJB 1LILA 1J0JA 2AEIT 4X6CA 2FHBA 3F62A 2HFGL 2OI9C 2R1XA 3QUZB 4XMPL 4QKXB 5FYKE 2BZDA 4C83A 3ABZA 5LCVL 3HHRB 4M7KH 1D9KB 2V5TA 1FNFA 3VWKB 3OAZK 1JF5A 4YXLL 1JF6A 2XWTB 4QGYA 3ZYZA 4LLAA 3RGHA 1JPSL 1BOYA 4PJDA 4ZXBC 4U1SB 1I1FB 2ICWB 3QDJD 1KENH 2E8ZA 4F3FA 4NRZB 3TNNB 1K4CB 3QHZL 2EYTA 5F21B 2HKHH 1ZV5A 1YN6A 1XGTB 4U1KA 5HGDB 4QHNA 4HIEB 3IJYA 4PJXB 3LEXB 1J5OH 4NO2B 3S7GA 1JGVL 3GMPA 2W9DL 2CH8A 4S0SD 4H1LB 2X7LB 3C8KB 3D2UD 4GBXC 3S35H 5KSUB 1D5XA 2ZG1A 3WUWA 3M8OH 5BZWB 5TQ2H 3ILPA 2IH1B 2HTKC 4LLMA 3MYJB 4PJGB 4TQEH 1GGBL 4MJ6B 4NQDB 4UNVA 3MMEA 3D39A 3VG0L 5JW4M 3U48A 4Y16C 5KZCD 3DXAD 3BUYA 3OKNA 4I18B 4FZEL 3VRIA 3SDXA 4CU7A 4GAGH 5DK2A 5DEGB 3JTSB 3VXUE 2P47B 2DRUA 4QRTA 5HHMD 3VXNB 5TGBA 2M1KA 5DYOB 1C1EL 3HNSH 5EC1A 2O5ZH 3DSNA 3EAKA 2EYRB 1HXYB 2DOCA 2FSEA 1XCTA 3NPSB 4N8PA 5DGRA 3LVEA 3VXQA 1BJ1H 4X6EB 1HKLL 4HS3A 4Q74A 3BPLB 1GRWA 3K4AA 2YPVH 3QFJD 3LKOA 3FQRB 5HHOD 4S1RH 3Q6GL 2G2RB 3LDBC 5BJTB 5LGJB 4HGKC 1BIIA 4U6XA 1EUTA 5DEFB 4P9HC 4LCIL 3OAUH 1UXSB 5CSBA 3BPOB 4YQXL 3O6FC 2MHAA 3VWJB 3SN6N 4Z7WB 1CFBA 5C07D 4YHLH 5IVXE 1BFTA 1YYLH 4W70A 1A3LL 4WRLA 1T20B 2ARJA 3ZT7A 4JPVH 4XMKH 3CCHA 1OQXA 1TJGL 1YJDL 5K9QG 3KHOA 2CUHA 4EI5B 4YHOL 4K3DL 3MSPA 2VXVL 3RKDC 4WUKH 5FO7B 4D9QD 4ZUVA 3HNVH 4KI5C 4BELD 4PRPB 4NNXA 2NY0C 4JHWH 5CIPH 3D3VA 3H42L 3NCYS 2RFXA 3DX7B 4DZ8A 4Z7UB 5ESQB 1JGDA 3UZQA 2E7MA 3VXOB 4CRPA 3CX2A 4LCWD 4QXUH 3FFCB 4WUUE 4HD9A 5C08E 3HI1B 2VDQL 4JDZB 2D7TH 4QCIB 1MCCA 1A9EA 1CD1B 3MREA 1A3RL 3ZDXE 5JXAH 2E9BA 4JM2B 4DQOH 1T0MA 4JQXC 4H26B 5DZNA 3TA3B 1T1XB 5HI3C 3RY4A 2R2BB 4FQQB 2JTDA 2FLRT 3UYRL 2A74B 3S36L 2Z31C 4RDQF 4PIRF 4FQHA 1HDMB 4LLDA 3QDGD 3P30L 2I27N 4YHIA 1U92A 1T80A 2VKWA 4LF3B 3DUHA 3CC5A 2DIJA 2IH3A 3GHBH 4KRNA 5F1KC 2EECA 4M3KB 3EO1A 1PDKA 4X7FC 2OTUB 5C9JB 5JIHA 2F9BT 4C58B 2KUTA 3SBWC 2AXFB 2B1HL 5CMAA 2B4CH 3VFUB 4OLUH 1EGJA 1M6OA 3IJHB 2PCPA 3KYKH 4LSDA 4ZAKC 3FB7A 3KGRA 2EKSA 5GS0C 3I50L 4V2CB 3V4UH 4XP1H 1R3HB 5T5NG 1CBVL 4PYHA 4ELMB 5GGUA 1IC1A 3UJTH 4H0IA 4DK6A 4Y5YB 3RGVA 3VJ6A 3GJEA 5I9QC 1DQDH 5DZLA 3GEWB 3FN9A 1QBBA 2G60L 5I1KL 2AERT 2AEWA 1XH3A 1BP3B 1YC8A 3U0WL 2AJXH 1HHJB 1PKQE 3DX9B 2D4FA 1I3GH 1S7RB 1GOFA 2BVOA 1HSAB 2IQAA 3RI5F 3PQYB 4M7ZB 1G7LB 5HHQA 3TP4A 1LP9E 1WWAX 1UJTA 1SQ2N 1T04A 4JQVC 1S7WA 3DUUA 2OZ4A 5IOPA 1G7IB 4QTIH 1IM9D 1E27A 3LPWA 4LRIC 2HJKA 4P2RB 1MI5A 2P24A 1A5FL 1TZHB 1DTUA 4P57A 4E5XA 2F15A 2X5PA 5HDOA 15C8L 4G8EA 3CD4A 3BH9B 4M1GL 3RGVD 5TE4L 1EEUA 5GGRY 3BIBX 4UBDC 3O6KL 2AJYL 3BGMA 2X9XA 1J8HA 4OJFH 1FVEA 3VXUA 2WBJB 1EHNA 4M4RA 5F7EL 5E8OB 1WWCA 3RVUD 4P2QD 5DMIH 1LE5A 4HG4K 4ZO8A 1WCBB 5BRZE 4QRQA 1NAMH 5GZOD 1N5AA 1X5ZA 5IEKA 3VU2A 4J2XA 4G8GA 3I6GA 1P53A 3T3ME 3VFGL 3ARRA 1HCVA 3GRWH 3R06A 4G5ZL 2BOBB 4X8XA 4IIQA 4JFXB 4YHZH 5CKAA 1F2XK 1U3HC 5IM7A 3TYFB 3TO4B 1QNZL 3GJFB 1ZLWH 3TBSA 4N8VB 3QDMB 1RUML 3MQIA 5E5MB 1MI5D 3VFMA 3MJ6A 4AG4L 4JDVA 5JXEA 1CLOH 5D2LE 3QYCA 3CXHK 1LO5B 3C87A 1JPTH 2DQGL 5IQ7H 1FZJA 1J8HD 4JCMA 3AC0A 1N6QL 5KSAD 4UV4L 5F7YC 1IM3B 3V5DA 2AABH 1CXLA 5DD5L 1RUPL 4M03A 4TRPH 4XI5C 5FOBA 3K2UL 3CU1A 4KKBD 3OKLB 4G8GD 4NQCD 4TSBL 2DD8H 4LCUA 4K3JH 3MNZB 2OP4L 2OR7A 5E8PB 1KIQB 2V7HA 1QA9A 3TBTA 2YKLH 4Q9CA 1CDCA 4HZLB 1H5BB 4R2GB 1CXIA 4HS8H 4NWUL 3MLPA 2YOCA 2JJWA 3MLZL 3L3OA 3O45B 3FO9B 5HPOA 3FRPA 1D3CA 5LVEA 1F13A 4ENED 2P4AB 5IEHA 1CS6A 1TMCB 4O2CA 4FXKA 3B8YA 1F8TH 3WNNA 3FQXB 2E7LE 4U6HB 3CX5J 3TYGH 1SBSL 4M48H 4LHUG 1U8PA 1RZFH 3GSRA 4NCC1 2H32B 2DTML 3NZHL 1YEEH 3WIIH 3P2TA 5I8KH 4ZDHB 1VPOH 1E4WL 5DO2C 5GISL 2XKNB 2D9QB 4IRSD 2P8LB 1AP2A 1F3JA 1FH5L 4OZGB 5GGSB 1A9BB 3Q5YA 3KYNB 1A6WL 3MXWL 2Q76A 1AXTH 3W39B 3QEQE 5ITBL 1VFOA 2EIZB 4PP2B 4HWUA 3ARGA 1R24A 5EU4A 3H0TA 4MB4A 4RQQB 1ZT1A 3G9VA 3QUXA 2OLDA 2VWEC 5JDJA 5DS8A 4XPTL 5TE6L 3BWAB 4JZJC 1KB5H 1T2QH 5JA8B 5K59F 5E99H 2X4SB 3KPMB 2PR4L 5C0GB 3MLTB 3AREC 2CDEB 3WS6C 2H41A 3HS0B 2J8OA 2H3NA 1MCNA 4LPXA 5I1LA 5I0ZA 4N0CA 2R2HA 3D0VB 3NN8B 1ZHBB 4Z9KB 4F58H 5F1IB 5IV2A 4JREB 4AL8L 4M1CD 2H6PA 2C1PA 2FX9L 2Y06L 5C0RH 3LV3A 4J8RB 4PYGA 3RTQA 4WWKD 5C0CD 2JCCB 4N1EA 1OTTD 3MBXH 4Z95H 4R8WH 3MJ7A 4YDVB 4HWBL 1AHWB 4DN4L 4R6UA 1BX2A 3DECA 2E7CA 3B4NA 1R3KB 1U8IB 1QLFB 1PKQA 2XFXA 4L9DA 3QG6A 3WFZA 1QSFD 1D6EA 4DW2L 1IGJA 1C12B 4X5XB 1CGYA 1EAPB 3QUXD 1WGOA 1K6QH 1I85C 5IMLB 4O51A 5DJ2A 4M9OA 2CQVA 2OMBA 3H9ZA 4KJWC 4WFHD 3SEPA 3VFPB 3MRDA 4PY7A 3SDCA 2CKBH 4KTEH 3AM8C 4FTVD 2PKDA 4MS8C 1E4JA 1FGVH 4RAVA 4N9GA 3B9KA 2WK2A 4GKOA 2X1OA 4N0CD 1EIBA 3C2AL 2GUOA 2UY7A 5GRYA 4NQXA 5FECB 3HE7C 4HQQL 1KACB 1N0XH 4U7MA 5JORB 3S3JA 1B2WL 2MQ3A 3OKOB 5GJSL 4O02L 1DQTA 4GXVL 1DBJH 3MR9A 3C9NB 3QWQB 2LAGB 3I2CL 3DYMA 4PJEF 3RVTC 4NKMA 1T5WB 3BP4B 1BD2E 4FFYH 3SKJH 4WW2B 4S10A 4HPYL 3K4DA 3ROOB 4K8RL 1N5YL 4LARH 3UZVB 3SDAC 2CDFB 3WXVH 1JGLL 3K81A 1YEGH 4RFOH 4D0CA 3SJVA 4NZRL 4KKLC 2VN4A 5T1LB 4LLVB 5BQ7A 3MUGB 3QUMA 2WNGA 3GMRA 2BSED 1DQJA 25C8L 5FIEA 5IMMA 5MI0C 3IXTA 2XQYK 4XBEL 3QEHB 3W0WD 5KAQF 5HGHB 4HULB 1RJCA 4YDLB 1W72L 4KUCD 1W72B 4LEOB 2W9LA 3UTSA 3BKML 1KG0A 5A16A 5I76B 3UTTE 2YHGA 3WV0A 4OD1L 1IGML 3QI9C 4O9HL 3IDUA 1EXUA 1KJVB 4PJ7E 1RZJL 3MRMA 4PGBA 2VC2L 3NA4A 4LASH 5IHZB 3P9MA 1EZVY 3IDNA 2LV4A 5EUOE 4E9LA 5FOJA 2HN7B 3QUYD 2GJ6B 4ZSOE 2DQDH 4WO4B 2QJDA 4HH9B 1WITA 4XNXL 3F6IA 2A1WH 4FQLL 4JKLA 1FAKT 1TPXC 5B3NA 3QQNA 5J11C 5DRXA 5IGXH 2BP3A 1MELA 5CD5D 2BJMH 2RJMA 3VD3A 3SJVD 1A3QA 1ZLVK 1VSCA 1KTKE 1MJ8H 1IGTB 5B22A 3VFRB 1YNTB 2IMNA 1CQKA 4QT5A 3SE3A 1Z9LA 3MA7A 4MXWH 4GO6B 1AE6H 3SGEI 4HEPG 3MO1B 1WWWX 2J8UB 5GRJL 1UKTA 3RI5K 1X4XA 2GSIA 4PP1C 3GIVA 5E94A 5I8CB 3ZE1F 1FVCB 2ZOKB 4TVPE 1I3RA 3UTSD 5DUPL 4WV1A 1YMME 3IS1X 3ARXA 5KW9L 2EYSB 4HWNA 3EKCA 2VL5A 1Q0XL 3VXTA 2ZSWA 5INDA 3DMMB 3TNMA 1X3DA 4EBQH 2N1KA 5F7LB 1J0KA 2XTJD 5BMFL 4U31A 4U1HB 2MQ0A 2YZ1A 1H3UA 3HI5H 2VXUH 4YNYB 2OSLA 1M4KA 2Z93A 4LSVL 1PZUB 2HLFD 3RZWA 3MA9H 1K8IA 5JW5A 1SYVB 3P4NA 2WAHA 4WHDA 2C3VA 1X5YA 3QULB 5EOTB 5E9DE 1BBDL 4NO0B 1KT2B 4BSVB 1LD9B 2P5EE 4B7IA 2BRRL 4HH8A 3U4BH 1IZKA 4C56D 1IAIL 3ETBF 2F74A 4Q58C 1CU4L 1ZS8B 2ADJA 5IFJB 2FIRT 4HKJA 1DN2A 5GSRA 2P46B 1U2CA 4UTAH 2D0HA 3V4VL 4J1UA 2R0LL 2ZUQB 3PABB 4HLZH 2EH7L 2O5YL 3OZ9H 4MNGB 5F44A 5IP4A 3VRLF 2BNQA 4H5SB 5L8JB 4U1JB 2XPGA 5SWSB 4XB8A 3QUZC 2YD7A 4FMFA 4KVCL 4PB9H 4ZS7L 4OKDA 1NEZG 3KLHD 5FA4B 3WKMH 5FYLH 1P5UA 3O3UN 5C0FB 2VIRB 3FQTA 1JHLH 2EEBA 4MA3B 3O41A 2V9RA 4Y5VB 4J3SA 3MUJA 1HQRB 3BZDA 4WNQB 5FM5O 1UKSA 2BY3A 3RX8A 3RUGF 4F15C 5AD0B 5J56B 5TDPA 3OB0H 4HKZA 1TVHB 4RA3A 1KCLA 1QHPA 5DMGC 4BKLA 2HKFL 3MRIB 1CDUA 1JP5A 1QHOA 4S2SB 1E28B 3G6DH 4FQXB 1ZGLM 3SPVA 4IJ3C 4K7PX 4G6ML 3ZKNC 4LSUL 2P42B 3P77A 2CO7B 4XCNB 1FAIL 3LRGA 5GIRB 4MLIA 4ZO9A 5DRWA 1FORH 4LSRH 2WM0A 4PJGF 2HFEA 5A2KH 1PD6A 3MGOB 3P4OB 4J3TA 5E2TH 5JQHC 1OP5H 4JANA 2CLZA 4HCRH 2CUIA 4HUUB 4HJGB 1A6ZA 4W6WB 2BDNL 5FB8A 1BD2A 1U95B 5JZ7D 4ZOCA 1IBGH 3RRQA 5AYQA 5IB5B 4P5TB 2VB5A 4DTGH 3VFSB 3E3QE 1ZT4A 4JHAL 2W1NA 12E8H 4J3XA 4C4KO 5K9JL 1NQBA 1WIOA 3HRPA 4WHCA 5ITFA 1AKJA 1QQDB 4ONHB 5C0BE 5F3HA 1LGVA 3BPLC 4I77H 5TPWL 1I7RA 3KPRD 5EU5A 4L4VB 3S4SA 3VFVB 5IB4B 5ETUB 1ZA6B 3N06B 4BH8B 2XZCH 3Q3GB 2IAMA 3QEUA 5EZJB 1FNGB 5FHBH 4J4PD 4M7KL 3UTTA 3VWJC 2YPLE 1U8KA 3OF6D 4PJ7A 3KXFD 3SCMD 1NKRA 4F9LA 2HFFA 4Y2OA 4Z7WF 5EUOA 4LOUD 4MXQC 4UV7L 3B5HA 4IMLA 4R7NB 4ZSOA 2HKHL 1E4XH 2IAND 2VQ1B 4PGDB 1KN4L 1OOAA 4ZPVB 1G7JA 1J1OH 3MCKA 3E2HA 4RGNE 2JF1A 3DGGB 4JFFD 3BZ4B 3AAZB 2NR6C 1J5OL 4OLXH 3G08A 4YIQB 4Q9QH 3GSWA 2Q3AA 1J0IA 1T21B 2ERJB 2R1WA 1TJIH 2GJZB 2D31A 4LDOB 3BD4A 3M8OL 5E0QA 3MOBH 4XBGA 3RVWD 3L95A 4NQED 4Z7UF 3JBG7 5C7XH 3ULUL 5DQ9A 3T4YB 2OCFD 4NRYA 1YMMA 4BUGA 3KJ4C 1QD0A 4PJ8D 3IVKB 3PGFH 4LNRB 5CBAA 4EDWH 4JM2C 5HSFA 3HNSL 3O9WB 1AGFB 2O5ZL 5FKAB 4B7LA 1BLNA 3TA3C 2H1PH 4JM2F 1YZZA 5B39B 4P2OA 2KL6A 4WVRA 5E00A 4JAMB 2QQNL 3EYQC 1ACYH 3HUJB 4S1DC 5CSZA 3ZO0A 2EO1A 4UDTB 1JZ2A 5LGKA 4C59B 1INQB 1KB9J 4MAUH 2NY3D 4PY8J 4OFYA 4LLUA 4S1RL 3B6SA 4Y0GA 3NIGF 5E9DA 3SDDC 4M6ML 4U1NA 2D3VA 4CJ0A 1I1YA 1RSFA 1FZMA 2P5EA 3FFDA 4HS6B 4PJ9B 3O0RL 2HG5B 5F9WB 3KNBB 1CE6B 2XZAL 1VGEH 3TM6A 2G75A 3OAUL 4HUXB 4CADA 4RNRA 4L8SB 3BKCL 1BGXH 4GRLA 5SX4I 4XRCB 3EJJX 3AB0B 3RU8H 5HI4C 3MX0A 3S8WA 2F54A 4MGXA 4JO3H 2E7HA 4KXZH 1GAFH 1GZQA 4XMKL 4N1CA 4NZJA 3U46A 1JK8A 1BFOA 1CIUA 4Y5XB 3NFPA 3EDEA 1RUKH 3IU3B 1JGEA 1JPGA 3TPUB 1IFHH 4Q97A 1FYTD 4WUKL 4F37F 3HNTH 1AO7A 1XGRB 2FHCA 2Q20A 3VDBA 1EHLL 4OZ4A 4IRZL 3HFMH 3X12A 2R0KL 1NCCH 4IMKC 4JHWL 2P5WE 3QIUA 4ELMF 1SY6A 3QPQC 3UAJD 4OFYD 3PWLA 4FFEX 5D5ME 5E8DH 5JHLH 4YO0B 4V1DB 1AXSB 4ZOEA 1BVZA 4GMSH 4K23H 3C5ZB 2Y72A 1JWMA 3O8XC 4DEPB 1ZHLB 5BS0E 5I1AB 2I60H 5ALCL 4PJAE 4M7ZC 4F7TB 5KSVB 1QSZA 2CLVB 1XGYH 3T0AA 5JXAL 4DQOL 5D8JH 3MPCA 3VFOB 3ARFB 4UU9B 5I66A 4JFHD 2L4OA 1WFTA 2DKMA 4MHHI 1EJOH 3P73B 4JPKL 1QLEL 1CLZH 4K9EL 1KTLA 1KGCE 3DX8A 4LCWE 5GSVA 1AO7D 1II4E 4OTXH 1F4HA 1JI2A 5DI8B 4ZTOH 2KZWA 3MRQA 1KYOK 1OSPH 3HZKA 1YNLH 1DBBL 1MJ7H 5E56A 5DD6B 5IJKC 3P11H 3WE6A 1GVIA 1NKOA 2ARWA 5JOEA 3E3QA 1JN6B 3VE0A 5KOMC 5GGRB 5L2KB 2B5IC 1RJZA 5CP3H 4ZXBD 2QQLH 3SKOA 2ILLA 3QDGE 1A6VH 5E6YA 2NTFB 3SE8H 5F8RC 3EO9L 3K1KC 5ACLA 4N90E 4PLJC 4XP6L 3V4UL 3RNQA 4XP1L 3B5TA 3ERYA 5HGAB 2DWDA 5J1TC 4I5BA 1ZHKB 4WTXA 3RL1B 3NOIA 1JI1A 2ENSA 1MCPH 4ZYKB 4B41A 5C0JB 3K80A 2C1OB 2YEZB 3VGGA 1DQDL 1AH1A 4XCEA 1T7YA 3OKDB 1UVQB 2NW3A 1KC5H 1QBAA 5EO1B 5AZEH 2DMCA 3WSQL 2HTKD 5JW4R 3VMNA 4OB5L 4XTRC 3T77A 3I85A 3O3DB 1ZXQA 4HDIA 2HP4A 4PG9B 4Y16D 2ITCB 5E24E 4HIJB 1VFAA 4RMVA 5E8NB 1JNLL 3X3GH 4B5EA 4GSDH 4QTIL 4PRIB 1U8HB 4XXDB 1KEGH 1SYSA 4HV8B 3QIWB 4R26H 4YDIH 2L7JA 4CMHC 3DV6A 4EXKA 2B2XL 1AGDA 3PWNB 3WMSA 2UWEB 5DTFB 1M7IA 2R4SL 4RFNB 3CFBA 5JO5A 1P4LB 2DLHA 5CEYA 3T2QA 3RWFA 3CFDB 4JZNB 1QR1B 4KZEH 5IB2A 2QHLA 1RZIB 4HF5L 4OJFL 4G6JH 1F4YL 4PJIB 1DCLA 1CFQA 4OCNC 5C09E 3W81A 2X4OB 5IWLC 1YNKH 1CLCA 1NGYA 2CR3A 3STBA 5DMIL 3NCBB 3K74B 2Q8BL 1B4JH 1CDGA 1LEIA 3O6FD 4HAFA 4GKZB 2APVA 1QKZL 4JFDE 4UIMA 3ET9F 4P46C 4LLYB 2NY5H 2Z35B 3GRWL 2BNRA 4XNQA 3NVQA 3CK0L 3MRLB 5AZ2H 1LEKA 4EXPX 2DQIH 3EGSB 3KWWA 3PV7A 1QVOB 3WFEL 2OBGA 3EDKA 3MYZA 4X9GA 4OZGF 5EFIA 5IB3B 3RKDD 1BREA 3PJSA 4P2QE 3IRPX 4KI5D 1HIML 2NY0D 2A77H 1JPST 4WFGD 3QDJB 1YEFH 2GKIA 1U93B 5IQ7L 1H3XA 4TSAL 4YBLB 1H15B 43CAB 1QO3A 2CDGB 5DEZA 3KPPB 1I8MA 2XA3A 3RWDA 3TJEH 3QPXH 4TRPL 1CDJA 2R0WH 2X9WA 4L3ED 5FCSH 4JREC 1KJMB 1S7VB 3LHPH 4Y2DC 2GHWB 4H1LG 5B8CA 1R0AL 8CGTA 2DLFH 5E6IA 2P5WA 4K3JL 4UTBH 3FO0L 3D0LA 5CBEA 1FZOA 1Z9OA 1FFPB 2BVTA 5D5MA 2JCCF 4X6CB 4MDIA 5HI3D 1YC7A 2R1XB 5KZCB 5ICYA 3DXAB 4C83B 4XGZA 2QV2A 2X1PA 2Z31D 1JUFB 1LDPL 4HS8L 5IBUG 3LN4A 2UZIH 5H37H 2DM7A 3QWOA 4ELKB 3ESVF 1ODAA 3QNXA 2R29L 43C9A 4J7RA 4PJDB 1J05B 3CFEA 5HHMB 4LPTA 3UBXA 3VDAA 1IL1B 4F7PA 2EIDA 1F8TL 2EYTB 2W9EH 4QRSA 4NKOB 3U6RA 4M48L 1QPPA 1YN6B 3FKUS 4BJLA 3NAAH 1BWMA 3MLRH 5K9QI 4QHNB 1RZFL 5BO1L 1JTOA 4FZ8H 5FYLE 1YEEL 2R2CA 4GFTB 3GMPB 3QFJB 4KWUA 2WUBH 4NC1E 4F57H 3ZSTA 5IJVA 1DEDA 5FHAH 1D5XB 3L3GB 3VMPA 3F5WA 4CNIA 5GS0D 1AXTL 1GYAA 5LAXA 4ONGH 3ILPB 1SJEA 4R9HA 4KKAC 4LLMB 2VDKL 2VH5H 2NXYD 4OD3H 4PD4K 5MERA 3A6CH 5I1IH 5C07B 4JFEE 3BUYB 4EIZC 3U7YH 3OKNB 1KB5L 1T2QL 1KB5B 4WW2C 2PO6A 4QHUA 5C0IB 4DN3L 4XCYA 5DK2B 1VACB 5ICZA 5J6GA 4WW2F 5T3ZL 3NH7H 4K8RC 3CLEH 4QRTB 5F7FA 5TGBB 3H9SD 3OGCA 4FP8H 2ED9A 3EOTH 2X44D 5EC1B 1QSED 4HJJL 4F58L 3EOBA 1BQUA 1HHIB 5DMJB 1XCTB 1N2RA 1BBJA 1F3DJ 3TCLB 1TQBC 4WDIA 3MBXL 4Z95L 4R8WL 3LKOB 3G5VA 2CK2A 1CZ8L 4YDLC 1KNOB 2EEDA 4U6XB 3VXSE 5D71H 1OT1A 3L3IA 4HIHA 1RZJC 4Z77A 5TDNA 4LKCA 2MHAB 4LK4A 2GAZB 1K6QL 5CJBA 2W07A 2OR9H 1BZ7B 1H0DB 1D5IL 4UBDD 3PGCA 2PO6D 5C0CE 4U1IA 4DUVA 4LSTH 3CCHB 3HR5A 2HT4C 1C16A 3O3AA 4MQ7B 1ZEAL 1FGVL 1Z5LA 4XHJC 4AIOA 3BZEB 4QRRE 4ZS6C 3WDHA 5HYJD 2K3TA 4KPHL 3OBAA 2MWCA 3OMZA 4ZUVB 1UG9A 3U9UA 4NNXB 1N0XL 3BH8A 4NM4L 3CZFB 3I9GL 4POYA 4I0CC 1RUQH 5IHBA 2HMIC 5EU7C 4NIKB 1RU9L 1U3HD 3B83A 1F6FB 2PW2A 4KQ3L 4G6KL 3ZKQD 1JGDB 2J8UF 1DBJL 3ULSA 1PG7H 2QSTA 4QHLA 4RRPA 4X4ME 1I7ZA 3CSYA 3SKNA 4FTVE 1J9CT 2VQUA 3B9EA 4KQ4H 4JFDA 1RIVH 3HAEA 1PEWA 3L9RA 1UC6A 1A9EB 3MREB 5L88H 4LARL 4XBPB 5KVGH 1IRAY 5DURD 3HCVA 1RFDH 1S5HA 1T0MB 3T2OA 2P44B 1YEGL 4RFOL 2ZCKL 3V7AG 1IGFH 4X4YA 5EZOH 4ORGA 4MD4B 2XA8H 4XI5D 3IFPA 4YHMH 4HT1H 2IPUK 4LLDB 2FATH 1VGKB 2DQEL 5JHDD 2VDRH 1U92B 1WFOA 3NZ8A 2YMXH 1AY1H 4ZTPH 4S11A 2IH3B 3FO1B 1GGCH 4Z78A 1KFAH 4A6YA 1IMHC 2ZOLB 2HRPH 5E2JA 5F9JB 4LASL 3H3PH 4N0YH 4PGZA 4OQ1A 4DKFH 2ZUQC 3Q1SL 1IKNC 4GRMA 3U7WH 3WNLA 1FNSH 1NLDH 5E70A 1S7QA 3QXDA 4OF5A 3MLSL 3U4EA 1EGJL 1H3TA 1VA9A 4GXUN 1M6OB 1IM9B 1AR2A 2W0KA 3GJFK 3TO2A 2PCPB 5C70A 5IGXL 2BJML 5IW6A 4QXGH 2H2PC 4ISVA 5I74B 5AUMB 2X4UA 3L6FA 3DURA 2OJZL 4X98A 5GGUB 2BRQA 4X9IA 1HQ4A 4JJ5A 5E2WH 3RGVB 4TUKH 5DO2D 4AK1A 2VLRD 4FXGA 3N1MC 2GI7A 1DBKL 2RQ8A 4W6YB 2F8OA 2WUCH 2G5RA 2VYRE 1RHHA 5HDBE 4DWHA 1NLBH 1NC4A 2ATKB 4P9HH 3RFZC 4LSSL 4MLSA 2OX5A 4NQVB 1S5IL 4MD0A 1S7WB 4FQXC 3DUUB 2HLAA 3HI5L 2ATPB 5IOPB 5JNYB 5ELIA 3ARED 4NJ9H 2FRGP 2XQBH 4XH2B 1TZIA 3ZKMC 4KK9C 1MI5B 1NDMB 5MEND 2P24B 4UB0H 4DZBA 1CXEA 4G8EB 3RX5A 4OZHF 3U4BL 4JFEA 2FR4A 4UT9L 4P5TC 1J8HB 5KSAB 4P48A 4D8PB 3RWCA 3TLRA 5J9PA 3W9DA 1EO8L 5E7BA 3JTTA 4HXBH 2ARJQ 1X5IA 4ZOAA 4QRQB 1N5AB 3OZ9L 5IEKB 4JZOA 1EHAA 2H26A 1P7QD 4G8GB 1QOKA 2GT9A 4PRDB 4NQCB 3I6GB 1EMTH 2C3HA 4TSCL 5L0QB 2IADA 3R06B 4KJWD 3RA7H 1FSKC 1HH9A 2YD9A 4JRXD 1FRGL 5E1AA 1I4FA 4MAYA 5IM7B 1GPOL 3WKML 5GGQH 1YDPA 4MS8D 1CFTA 3VXSA 3VXPA 3TZVA 3VFMB 5I1GH 4JFOB 3SGJA 4M93B 3HE7D 3V6FA 3OJ2C 1L7TH 1NGZB 1ZLSH 2J12B 4HFWA 1FZJB 1UB5A 4OUOA 3QCVL 1ZTXH 3NFNA 2DQFA 1FPTH 4ZFZB 1X7QA 1ADQA 3RVTD 4QRRA 4HC1H 5FOBB 2ERJC 1NC2A 2HJLA 1OTUC 4IRSB 2YXFA 3G5XA 4WU7B 4YE4L 4C4KT 1JYVA 3S5LA 1X6NA 4BFIA 4LCUB 3LKQA 3SDAD 3MRRA 5GS0H 3SGEH 1UXWA 2V7HB 3PWJA 3IETA 1HKFA 4KKLD 2QHRL 5HHNB 3T0XA 3ULUC 2VDOL 5EH1A 4XNZC 3TV3H 2FX8H 3BDXA 4MD5A 3ULUF 1GGIL 2OJEB 3H3BC 2DLTA 2XT1B 1B0WA 5CJOL 2X40A 4LU5H 5AAMA 3O9WC 4MCYB 4JPIB 3L5HA 4G7VL 12E8L 1F2QA 3LOWA 5IEHB 4WFEE 3MV11 4O2CB 4FXKB 3HG1D 3QI9D 3MRNA 1OY3B 4BZ2H 4PV9A 1MJUL 4JKKA 2NY4B 1X5KA 3GSRB 1M7XA 3HUJF 4WWKB 1EDQA 2BVQB 1AR1D 5IW3A 2M26A 4PJ9C 1UA6H 4OLZL 5F9WC 4ZUTA 1AP2B 2JIXA 4R4FH 5DRNB 1G9EA 4PP8C 4L1HA 2XIDA 4XAKD 5BW7C 2Q76B 1UYWH 2X4QA 1QSFB 1R24B 3AB0C 3X14B 4FRWA 5EU4B 3H0TB 1UH2A 4RAHA 3QUXB 1U8QA 1Y6MR 5DS8B 3DX6A 5F7KC 5F89A 4M00A 2ICCA 4Y5XC 4PP1D 1Y18A 2X09A 1J1OL 1XMWA 1WK0A 1X4ZA 3WLWD 4L5FH 5FV2A 5GRWA 3A6BH 5GRUL 5I1LB 3FOLA 2R2HB 4ZFOL 1EUUA 4ZFOB 2WINA 1TJIL 2H6PB 1NH6A 3OAYH 4HXAH 1D5ZA 4U0RB 3RTQB 1CG9A 4G8FB 3UC0H 1G0XA 4YR6A 1HHHA 5DK3A 4WEBH 3ZTJH 3MJ7B 1OGAA 3F7YA 3C5ZC 1NFDE 2WP3T 1A0QH 1CGTA 2JIXD 5DRZA 5C7XL 1BX2B 4G3YH 5ACZA 4Y7MA 1AQDB 2W0FA 1FIGH 1R3IH 2GITA 3GSUA 2XFXB 2EZ0C 3QG6B 3LEVH 5SWZE 1MRCH 2CPCA 3PGFL 4AMKH 4KMTH 5A3IC 3ARFC 4QYOB 3SE4A 4O51B 5DJ2B 4JFYA 2CD0A 4UZGA 5DUMH 7CGTA 5D7KD 3MRDB 1X5XA 1QEWB 4PY7B 3D25A 4K9EC 3SDCB 3HE6C 1ACYL 3ULVE 3EFDL 5T1KA 4L4TD 2GIYA 5EBMA 4Q7DA 4D3CH 5EBLA 1QFWI 2VZ3A 4ODHH 1ED3B 1WF5A 3BMVA 3REWA 3LS4H 3BX7C 3BGAA 4NQXB 2G5BA 5I73B 2CGRH 5DQJA 1F90H 1T22A 3TJHA 1BQHB 3KDMB 4TUJA 1WISA 4I8DA 5IVZA 1J87A 1OGAD 4DGIL 1IQWL 3MR9B 1ONQA 4GMTH 2NXZC 5FAAA 4NKMB 4G6FD 3QUYB 2EXWC 3BYTA 4ZD3H 2X4NB 3CVHA 1IFHL 4RWHA 3S35X 5C0DA 4O4YH 3M07A 5TFSH 2FECI 4NYLA 2J4WL 3SJVB 4D0CB 2FH6A 2BSTA 4JFQA 1NCCL 3BEVA 3MGTA 4WWID 5DMGD 1VFBA 3QUML 5BQ7B 4NNYA 4D0DA 3IDXL 4AT6A 4OCRH 3UTQB 5FDWA 2OR8A 5IMMB 3GMRB 2LVEA 3RWIA 5DMKA 5E8DL 5JHLL 3IXTB 4X80H 4GG6A 5J0BA 4GMSL 2F58L 3TIDA 3H9YA 3QO0A 1UH3A 2V2WA 3BSZH 3UTSB 1KG0B 5A16B 4GW1B 3CFIC 4NQDD 2I60L 1ZLUH 5TF0A 5IB1A 5IW1B 3PG2A 4P9ML 4L8CA 3DSFH 3LMJL 5F7DA 3QB7C 1KIRA 3CSPA 3MRMB 4PGBB 4PJFE 4Q9RH 5CEZD 4AEEA 3IDNB 4W6XB 1XGYL 3DWTA 1E4KA 2PYED 2XTJB 2Z4QB 5KBNC 3MRHA 1IKFL 3CFJB 3FT4A 1F4XH 3ZE0E 5HYSG 1MVFA 3QIWC 4I3SH 1KJ2H 3BEWA 5E2UL 3CX5K 1P4BH 1TZGH 4BZ1H 5D7IA 1BAFH 5DRXB 2Q86A 1IZJA 4N0UA 3IXAA 4CU8A 1RZGA 3MRCA 2D7PA 3BYYA 4ZTOL 1XZ0B 3T0EE 3TBYB 4BQ8A 1L0QA 4QT5B 3WIHA 1YNLL 4NBYB 3OKYA 4OGXL 1U8JA 1A4JA 4C56B 3C09B 4NWTL 2NYYD 4P3WA 1LO2H 4UINH 3LCYA 3P11L 4K7FA 4O58H 2GSIB 2YPKA 1Q0YL 5E94B 2WV3A 4PGJA 1JYNA 4PJIF 3FONA 4RWYH 2V2XA 2FBJH 4WV1B 1IC4L 2C9AA 3VWJD 4NCC2 3VXTB 2QQLL 5CGMA 3SGKC 3IB4A 2J6EA 3TNMB 1K8DA 3LQMA 1ETZB 2UZXB 3DLQR 3SE8L 4EI6B 2EC9T 5FM5M 2VXTH 1KLFA 3QR2A 2IG2H 1F6LL 2AJVH 2OSLB 3FQUA 5HI5D 4MQSB 4U1LB 4OT1H 2NR6D 1K8IB 1JMZA 5JW5B 3SY0A 1MCPL 4DGVH 2J1KA 2C3VB 2W92A 1JMXA 5CAYB 4U2ZA 4PJ5E 3A67H 1KC5L 1CFSA 1AD9B 5DHVA 5AZEL 2PN5A 2VL4A 5TJWK 2IBGA 4IS6A 4Y4KA 4YBLC 3TESA 4LSQH 1UZ8B 2FJGA 1AQKH 3IS0X 3UX9B 1ES0A 4XPHH 1FO0A 4YAQA 5A2JH 5JPMA 1MHEA 2R15A 3FFCD 4HKJB 5GSRB 3JV6A 3RZCA 2W0LA 3PXHA 1WCQA 2RAMA 1EEZA 1SVZA 2OXHA 4I0PA 3OKEB 1A4KB 3QQ4B 2VQTA 4GSDL 2Z92A 3GMOB 1KEGL 3ZMRA 1DDHB 5C0AE 4JM2D 2BNQB 1Y0LA 3TT1H 1TNNA 3KPTA 3EYSL 2YR3A 1I1RA 3GM8A 4X7DC 2ADIB 3QHFH 2DAVA 4MJIE 4S1DD 3HPLA 4X6CF 1MNUH 1F42A 3F58L 3ZE2F 4KZEL 2A6JA 4U6VL 1REIA 3SDDD 5SWZA 2X42A 1BEYH 3BDBA 2YWYA 2RCSH 1U91A 1YNKL 3U9PL 4LDLB 4PJDF 2AJZB 2VN7A 4Y4KD 2V5SA 4UNUA 1B4JL 3D85D 1KEMH 2EDTA 2HYMA 1RVFH 1MCRA 5TDPB 4HKZB 5CWSA 4CUCA 1PKOA 5HI4D 2NY5L 3S97C 4BFBD 4YXHH 4OQTH 3V4PL 4BKLB 2CUMA 2HVKB 2E3VA 3IFNL 4YHNA 3KPRB 3VXRE 4NQSA 2A38A 2DQHH 2KH2B 2Q1EA 3IDJA 3BXNA 3TF7A 2YRLA 4KAQH 3P77B 4MJ2A 3EYOB 2JK5A 5DJXA 1AC0A 3DOSA 1DANT 5DRWB 4RA0C 1MWAA 3SKUD 5EU6A 1INDH 1FLRH 3QO1A 3KXFB 4JANB 2C4XA 1A6ZB 1S3KH 2FX7L 1ZT7A 5FB8B 1B0GB 3TPKA 1FBIL 5LGHH 4HWZA 3GM0A 1FV1B 1BJ8A 3SDXF 1NBQA 5H35A 4K3GA 3TJEL 1ZT4B 2CXKA 3O8XD 3QPXL 4JFFB 5MEOA 1OF2A 2R0WL 4M7JH 3LHPL 1ZAGA 3BD5A 2JELH 3QXAB 1QPXA 1CDHA 3X13B 1LO4L 4R7DA 1M05A 2ORBH 4WFGE 1T66C 2DYPA 2F8VA 1BQSA 1T1WB 5EU5B 3S4SB 5DDHA 4FQJH 1MQKL 4LDEB 4NQEB 4GKSB 4GKNA 3PWUA 2IAMB 3T2NH 5KVMC 5LQBL 3L5JA 4W4NA 5JDSA 4J3OC 5I1DA 3GZKA 1KCVL 3UCRA 2WMPA 1RI8A 1U8KB 4DKAA 4PJ7B 4PJFA 5EU6D 5DD3H 5FUOL 4NHUB 1JYXA 3Q5TA 2APTA 4M3JA 3QA3A 5T3XL 1UADC 5IVNA 3PF2A 5TQ0H 1IAKA 2W9EL 4GRWB 4WI2A 1NGPL 3U1SH 3G5YA 1G7JB 3FRUA 3MCKB 3E2HB 1OTSC 1KLGA 4XPFH 1ZKAA 5I1EH 4TTGA 2ESVA 1T0NA 3G08B 4I3GA 4AENA 4JHZA 2ADGB 1WC7A 2NY3B 2WUBL 3GSWB 1FNHA 3T0EA 4JO4L 1MCWM 1HINH 4JFPB 2XN9E 4WEMB 1GJIA 2WZPD 3MV8D 3QIBA 2GYSA 4PLJD 2LU4A 2EDLA 2QQQA 2HFGH 3QDMD 4BH7A 3L95B 4OD3L 5I1IL 4LPUA 4TVPL 3G6JA 1WV7T 4NRYB 2OMNA 4JE4B 4QOKE 4G9FE 4YXLH 2E9IA 5F1SA 4U1MA 1N4XL 2Q3ZA 1JPSH 2EH8L 4LHUA 3NH7L 3CLEL 3GIZL 3VCLB 1DE4A 3EOTL 2XNAB 2ICES 3N0PB 1CD0A 4OCSL 1BLNB 1FYTB 3BUTA 1A6TB 4FOMA 2EEAA 2EC8A 1QBMH 5E00B 2F19H 5CSZB 2W60B 2ESVD 1N8ZA 2KDGA 1MHPH 1XF1A 3B6SB 3W9EA 4U1NB 3T04D 1WIUA 1FZMB 2VSCA 2K7PA 2MKLC 1LE9A 2R0ZH 5D71L 5GGTA 1EEYA 2G75B 3KPQA 3RIAK 4R97B 5E4EB 3RWGB 3T1FA 4NO5A 1BVKA 3CFCL 4JN2A 4HX1A 5I75B 5CEZH 5K9KB 3LRHA 3DTXA 5FUZL 2GTWA 1IGYA 1R5WA 2F54B 4R96B 3TBWA 1GZQB 1V3KA 3BISA 2BVPA 4LSTL 1BFOB 5D7JA 3NFPB 4KI1A 1JPGB 3QEGL 4QXTA 4DK3A 2QSVA 5I74C 4F7MA 1ZGLB 4M5YL 1AO7B 1H3PH 5B38B 2OTPA 1U6AL 4P46D 1HKLH 4J3UA 3RGVC 1SY6L 3Q6GH 3PWLB 4XNMA 4QGTA 5FCUL 3GSVA 1PG7L 3JWOC 3T3PE 3VH8G 1VKXB 3RVUC 2DN7A 4LCIH 1MUJA 5FYJU 5E03A 4KQ4L 4YQXH 5HYJE 3IAPA 2FJFA 4URTB 5L88L 1A3LH 3MV7D 4M6NL 2DTSA 3CXDH 1RFDL 3WEXA 1NSNH 3VXRA 1TJGH 1IGFL 5I66B 2ZNWA 2MTPA 2EDYA 1T3FA 5EZOL 1OB1A 2VXVH 4HT1L 5GSVB 4Y2DD 3U79A 2UVEA 5BCAA 2VDRL 4I2XB 3LQAC 2YMXL 5CZVH 1AY1L 3R0MA 5FK9A 4PRNA 5L2JB 1S8DB 3KLAA 4ESKA 1ZOXA 2HRPL 1WQVT 4HGWA 3IAQA 5KSAC 5ID0B 2VLLB 5IK3A 2DIBA 1E6OL 3U7WL 5DQDL 1FNSL 1CXFA 5DF0A 1NLDL 1RJZB 4KKBC 3KPSE 4NC0B 1QZ1A 1KCRL 3LKNA 2NNAA 5CP7A 3SKOB 5L0QC 3RBGA 3PIQA 1ZLWK 2BVYA 3ZZ1A 4QXGL 2DLEA 3RNQB 4YHKL 1GOGA 1NFIA 4NCDA 3MGAA 2CSPA 4D94A 4I5BB 4AH2A 3NIFF 3S36H 4TUKL 2NW2A 5CHNA 5JXEC 2FYYA 3DIFB 3QNZA 4XCEB 3LDBB 1FG2B 4Z0BH 1UH4A 2NW3B 1L6XA 2K9UA 4FNLL 3UZEA 1NLBL 2AW2A 2A9ML 4KKAD 4MJ4A 5D6CA 3WFCL 3O6FB 1X6LA 4HDIB 4JQIL 4MDJB 1VFAB 5CGTA 4XPBH 3KPNB 4LBEA 4PV8A 2VLRE 4HUVA 4K8RD 3VMOA 2Q87A 2XN9A 2XQBL 2LFGA 4Z76B 3I50H 4PJBA 2OL3H 4UB0L 1L9MA 1AGDB 3ZKSD 1CBVH 1KB9K 1M7IB 5BXFB 4Z8FH 3UEZA 3NCJL 4YFEA 4EUPH 2NY0B 5JO5B 2WBWB 5DFWH 2V2TB 2YK1H 2PYFA 1JCKA 5K59E 1JIBA 2BXZA 1SM3H 2BY2A 4OFVA 1ITBB 1RHFA 4G9FA 2YD5A 3RWFB 3TVMA 5IB2B 1CTNA 1J11A 2QQKH 1NUGA 2HAZA 1CFQB 5EPMA 5GZND 3U0WH 1UCBH 5DJZA 4I48A 2DI7A 4XX1E 5F6IC 1UQSB 5MENE 3BHBA 4M1CC 4I1NB 2NY4C 3RDTA 4UIMB 1P6FA 1EMTL 1IC7H 3IJSB 3MXVH 3O4LE 1HILA 4NO3A 2BNRB 4XNQB 1LNUA 1LEKB 4WI6A 5I2IA 1EK3A 5GGQL 1U41A 1ZA3A 4XHJD 1WVZA 1X5FA 2APBA 3ARGC 1NUNB 15C8H 5I1GL 3PJSB 3DARA 3FAWA 3WHXA 3MNWB 3QUXC 4YK4B 1MWAH 1L7TL 4M1GH 3QXVA 5TE4H 2HMID 4ODWA 3O6KH 2AJYH 4JQVA 3TVMD 4MNQD 4OI8A 3CLFL 4QY8A 4J6RH 4PRAA 1W0WA 4KROD 4HBCH 1MLCA 5F7EH 1WFUA 1FPTL 3CMGA 3GSNA 4M7LL 3QH3A 4JO1H 3ORJA 2GQHA 3OR6A 1I8MB 2XTLA 3RWDB 4PDCE 3C8HA 2NTSP 3MRBB 4HC1L 4N0CC 4OGZA 1ULVA 3M1BB 2VNCA 2YBRB 2JE8A 3RDTD 4N0FB 3OXSA 3RTQC 1A6PA 1NEZA 3MRGA 2P5WB 1WEJL 4YFDB 1FZOB 1NCAH 1MIEH 3NACL 3BRDA 1QNZH 3GNMH 1RUMH 2NXYB 4PJEE 3V0WH 4X0KB 2FX8L 1JF1A 5ICYB 1A7NH 3AGVA 4XGZB 3QJHA 1RZ7L 1QBLH 3WJLA 3KS0J 3BQUA 3LN4B 4O2EA 3HR6A 3ARSA 3GSQA 3QWOB 4LU5L 4LVNB 43C9B 3BFOA 3BPNB 4CU6A 4LCCB 2DQGH 3H9SB 5MHSE 3MOAL 5A2IH 5T1DL 2LU3A 3KVQA 1XF5A 5CD3A 1N6QH 3SDCC 1QSEB 4QRSB 2EE9A 3L7EB 4GOSA 5DD5H 1RUPH 2DIAA 3MUZ1 3B9KC 2AEQH 1TXKA 4ZODA 1CK0L 2UVFA 5I73C 1UA6L 4TSBH 3NIDF 4R4FL 5IJVB 2ZCHL 2OP4H 3CMOL 3O3EB 5ISZE 3F5WB 4CNIB 4KUCF 1SJEB 2ZSVB 1S7UB 2RR3A 2J88H 1J88A 1U3ZA 2VLJE 5MERB 3MRJA 1SMAA 2CRMA 4NWUH 1G7HB 3BQUD 4KK6C 2PO6B 4QHUB 3KPSA 5AWNL 1KPVA 2WY3A 4L5FL 3RPIA 4WENB 1CVRA 4Z7NF 5CD5C 2DICA 4OZIA 4QRPD 2BMKA 1Y6KR 1SBSH 4WGVB 1FNLA 4ETYA 4MX7B 1RUAH 1ZMYA 2H32H 4HXAL 2DTMH 3NZHH 1BBJB 5D72L 3LKSA 4PRHE 1E4WH 3LPGA 3UC0L 4FQXD 3A6OA 1TCRA 4WDIB 1R5IB 5GISH 2DMKA 4WEBL 1EH9A 3G5VB 2YS4A 1U3HB 1A0QL 2KKQA 4G3YL 3ZKMD 3MXWH 8FABA 1CD9B 1BOGA 2QSCH 2X70B 3L3IB 5CGYD 3MRFB 4M43L 5GRVL 5TDNB 2XI9A 4Z0XA 4OSUL 1NCWL 1J10A 3EUUA 2FL5A 5CLWA 1I8KB 3WCYA 2ZUUA 4HUWA 3PGCB 1INEH 5DUML 3Q0HA 3T08A 2XWJA 3C6SA 1MCHA 4UQ3A 1S9XA 5KG9B 5MEQA 4JRYE 4HKXA 1Z5LB 4MNHA 4ODHL 5KSBB 4UIKL 1EHXA 2FX9H 3PV6A 3SE3C 4WFFD 3HC0B 5JHDB 2XKUA 3UTPE 1F90L 3KLDA 1JZ5A 3PWPD 2R39A 3VDCA 4XVJH 1Q9WA 1T83A 4WV1C 5D7KE 5F97E 4GMTL 3CSYB 1A6UH 4DW2H 2RB8A 3EO0A 4L4TE 2DI9A 4Q6IA 2ZWLT 3MV9E 3VRLE 2VDMH 3TFKA 4BSJA 4AEHL 3HAEB 4Y1AD 4ZD3L 1YQ2A 4MVBA 3L9RB 3O4LA 4XVSH 4YHYB 4U6TA 4O4YL 3IDYC 3UJIL 1Z3GL 4X4YB 5HJ3A 3X11B 3C2AH 3V8CA 4WI8A 4DFHA 1OTUD 4E41D 3NZ8B 4IRJA 4RX4A 3BSZL 1B2WH 1I85A 1KIPB 2WANA 2X2YA 4HMDA 4O02H 1WJ3A 4A6YL 4GXVH 5ANMA 4A6YB 2VTFA 1OP9A 5JQ6L 2WSKA 5JUEH 4PJXE 1TFHA 4NRXA 4L29A 4LMQE 4GRMB 4ZFFA 1S7QB 1F4XL 3QXDB 3N1GC 1F11A 4LPCA 3TFKD 4PGCA 3BT2L 4HJ0C 1N64H 4MVBD 4K8RH 1TZGL 3RX7A 4BZ1L 1N5YH 3TO2B 5IBTH 1XIWA 1SJXA 4G42A 3RNKB 4PJGE 1OGTB 2X4UB 2X89A 3GI8L 4NQDE 4Y19A 1MQ8A 5J1AA 3QT2A 2LAAA 2BVUA 2QR0B 2H45A 3F6LA 4NSKA 1DLHB 4JJ5B 4TNVF 4IBLT 4N8CH 1T7XA 4FXGB 4XBEH 2LQRA 4PJ9D 1W72H 3OB0K 5KS9E 1G6RA 1RHHB 1MFAL 4RX4D 4RWYL 2P7TA 2FBJL 4HLZG 1ZVYA 1IGMH 5FGSA 1RZJH 3B43A 2YA2A 2QSQA 1PY9A 4RIRA 2FBOJ 3GSXA 3U0TB 1AJ7L 2IG2L 4XNXH 2HLAB 4JRXB 1WBXB 3CUPB 3E6HA 4FQLH 3KAAA 5D7LA 4GAYA 1I8IB 1MAMH 4OT1L 1S9VA 3WN5B 4WIQA 3GMMA 3O4OC 4DGVL 1IEAB 5BZDB 5F88A 2VLKD 2X89D 3ARDD 2WQRA 4Y19D 4ZUWB 3CDCA 3A67L 4Z7WE 4TOYH 2VLJA 3N50A 2VDLH 2FLBT 2NY7H 3AY4A 5HGBA 3R1GH 2FR4B 1R3LA 4LSQL 1G9ML 3C8DA 1AQKL 3AXLA 3SKMA 4XPHL 3C5ZD 3RP1A 5E7FA 2AK4D 3RWCB 4E0RA 1C08A 3W9DB 3MLVL 2DQUL 5EIIA 1C5BH 4TULL 3IT8D 1Q0XH 3QJFB 2F8XC 5C0EA 1I7TB 1MIML 1MHCB 1FLTX 1J1XH 1LWRA 3S88L 4PRPE 1TIUA 1QUNA 2GT9B 1EAJA 5A3ID 2H2SD 3FOMA 3TT1L 3FB6A 2DQJL 5ADPL 3SDAB 4D0BB 3K0WA 1P5VA 3I3EA 3RVWC 1P69B 3F7VA 3KPLB 4X5WA 4Z7UE 5E1AB 4LSVH 4X7SL 3HE6D 2IAMC 1FC1A 1IEBA 4MAYB 4KTYA 1YDPB 1CFTB 3WLBA 3KR3L 3FFCE 3CZJA 4QF1A 4PTUB 1JWSB 1BBDH 2I9TA 3VXMD 1P7KB 2GK0A 4F9LC 1VDGA 4LIQL 4TUOA 2RCSL 3V6FB 3C08H 4PJ7F 3KPOB 4U3CA 1A1OA 4DCQA 4PRBA 3L5WA 5D1QA 1KEML 2VUYA 5DUBA 5EUOF 4HFWB 1RVFL 1BWWA 1CE1L 1OHQA 1UB5B 3HG1B 3QI9B 3E2HC 2L0DA 3NFNB 5GGVH 4OCYH 4GRWF 1NGXA 1IAOB 3V4VH 4YXHL 5DJ0A 2NXZD 1ADQL 1X7QB 4OQTL 1QTYT 2NY3C 3GI9H 1W2KT 2O5YH 2EXWD 2XACC 4S1SL 1T1ZB 3G5XB 3B8SA 3WS3A 5I17A 4M1DH 5J11B 3MRRB 3U36A 3GMQA 5FGRA 4ZS7H 1ORQA 1INDL 1FLRL 4P23A 5HXMA 5JOPE 1AGEB 3BDYH 4J3VA 4IOIA 4MD5B 5DLMH 1Z2KA 2IJ0C 1IQDA 4Z7VA 4GAJL 3H3KA 3MV9A 1KXTB 1B6DA 2CIIA 4MZ3A 3WO3B 1B88A 1MRDH 4EQ2A 2J3SA 2BC4A 3FMGL 4Y4FA 1UB6A 3VRJB 1Y6NR 1MF2L 1S7SA 5BVJA 4P2OC 3V7AE 2IBZX 1CFVL 3CU7A 4PV9B 2JELL 2Y5TA 4ELME 3IAGC 3L1OL 1HHKB 2HT3D 2HKFH 2ORBL 4HK3N 1D9KA 4PRID 3VWKA 4LGRB 3GBNH 3QIWD 3MLWL 4U1SA 2HWZH 1I1FA 2NX5A 4ZUTB 2MCG1 2JIXB 4CVXB 4DOHB 3T2NL 1YEHH 3GMLB 3TNNA 1FAIH 1K4CA 1MCQA 3W11C 2X4QB 1CCZA 4R97C 3GKZA 5I75C 1XGTA 5GGVY 3PQYE 4HIEA 4P23D 3T0WA 3I6KA 1B6UA 1MVUB 4PJXA 5IFHH 5HY9A 1S7TA 4NO2A 2VJXA 5F89B 5TQ0L 1OARH 3AVEA 2DB8A 1Y18B 2AJUL 3U1SL 4H1LA 3C8KA 3UTOA 4JHAH 4XPFL 4Y4FD 3FAXA 5I1EL 1RK1A 2X6MA 4ODXB 4P2RE 5AAWA 4BQBA 5K9JH 5BZWA 3FOLB 3RVXC 2WINB 3QIUC 1HINL 5FXCH 5TPWH 1BQHG 4I18A 1CG9B 5HPMB 3Q48A 1JNHA 1WLHA 4YR6B 5MP6H 1HHHB 1TLKA 3JTSA 1OGAB 4OGYH 5KS9A 5DRZB 3QZWG 5ACZB 3ROLB 5DYOA 3WNMA 2GITB 1CGSH 3V0AC 4DVBA 3GSUB 4G6FB 3U2SB 3T0DA 5D9SA 1OAQH 3Q6FB 3RUGB 5I15L 2MFNA 4X6EA 5BOZG 4UV7H 2NZ9C 2X4PA 4JFYB 4M5ZH 3MFGB 4POUB 1KN4H 4F15B 2CLRB 5LGJA 4IOFC 1QBML 3D25B 2F19L 3QDME 5DEFA 3WD5L 3JTCA 3BOVA 1MHPL 4P3CL 5EBLB 2A6KA 3WO4C 3REWB 3WNPA 4XZUA 2EE6A 2R0ZL 4IJ3B 5DQJB 3IFOB 3K2MC 3OJDA 1T22B 4TUJB 2BOCB 3W2DH 4MXQA 4FMKA 3KYMA 3G5ZA 5EWIH 3E3QC 3O2DA 3ULUH 1FCGA 3HZMA 1R5VA 4EI5A 3LQZB 5CEZL 5EO0B 1ONQB 1KN2L 5FUCE 1DUYB 4DKDC 1LO3H 2PYEB 1X5JA 3V0VA 3GUTB 3RJQB 3U4AA 4EDXA 2NY1C 3CVHL 3CVHB 5C0DB 3DX7A 3SQOH 1H3PL 4FQ2L 4NYLB 3GGWB 2QQNH 4JY6A 2WIIB 1WSST 1IT9L 1HHGA 1OAZL 3VXOA 3BEVB 1VFBB 3T09A 2RBLA 4NNYB 4D0DB 4AT6B 3HI1A 5FDWB 4YPJA 5SV4A 5CJXA 4JDZA 4M6MH 3RWIB 5DJYB 5DMKB 2Y25A 4GG6B 3VGAB 3O0RH 1CD1A 3MROB 2XZAH 2MPAH 3SGDI 4ALAH 3BKCH 4KDTA 2DQCH 4R4NC 5TE7H 3TWCH 3D39D 3TA3A 4ERSH 1T1XA 3QG7L 4RGNC 4L8CB 2GEEA 5IBLC 1YY9C 5FF6A 2EICA 4JR9L 2R2BA 4UOW0 4FQQA 3B3IA 1WTLA 3CXDL 1ZVSA 2A74A 1NSNL 1HDMA 5E1HB 3MRHB 3FT4B 5T3ZD 1FIEA 2APWA 2Z9TA 3BJLA 5LWYL 4NZTH 1OWRM 5HHVH 4OZGE 3P0VL 5D7IB 3P0GB 5EG6C 5JLZA 1HXMA 1MRFH 2QLVB 2Q86B 4N0UB 2AV1A 3IXAB 4OZFG 2O93L 3MRCB 4MMZC 2IPKA 2M8XA 5ESAB 1EHLH 4IRZH 5FGBA 4P5MB 2R0KH 3RQ3A 1CT8A 4JM4H 5CZVL 3WIHL 4KI5F 2P8MA 3OR7A 4R3SA 1T66D 4OV5B 1HSBB 1U8JB 1A4JB 3MUHL 1SHMA 2AXFA 3AS2A 4EEEA 4ZMAT 5IFAL 2V6HA 2YPKB 4X7TB 5F9OL 5HVWA 4M8QB 5F1NB 3FONB 2V2XB 4LP5A 1P7HL 1Q94B 3RWEA 3HLAA 3KJ4B 5ALCH 4KRLB 4WHTB 3W82A 1R3HA 3V6ZB 4ELMA 5IMKB 1JHKH 2J6EL 2FJHA 3IF1B 2DDQL 4Y5YA 1EFXA 1BQLH 2JCCE 4NDMA 5F7MC 1ORSA 3DROB 4RMUA 4M61A 4JPKH 1QLEH 3BGFC 3FQUB 4K7PH 1OTSD 4K9EH 5D2NB 1FZKA 1VFMA 3SY0B 3BZFA 1HHJA 2F53E 1K2DB 3TC9A 4YK4C 2YD6A 3SDDB 4BSWB 4Z0BL 4LFHG 5DHYA 1CFSB 1EVTC 5DHVB 1DBBH 3D3VD 2YRPA 3T1WA 4IS6B 4Y4KB 1JNNL 3D85B 1RJLA 1G7IA 2YUWA 4MSWB 2VZ1A 3QQ3A 3JV6B 4XPBL 4P2RA 1MPAH 3V6BR 3EBAA 4I0PB 4NPYA 5B8CC 3C60A 3PDOA 5E6IC 1T03L 4WJ5B 4RBPH 4JVPA 3HMXH 1I1AA 2YUVA 3EO9H 5KVEH 4JKMA 4XP6H 2OL3L 2OL3B 2FWOB 4EIGB 2R2EB 4X7EC 1OSZA 2ENYA 2WBJA 2KZ1B 4Z8FL 2NXYC 1L7IL 2FEEL 3L7FA 4EUPB 1DANU 2YK1L 1ND0B 3HPLB 1SM3L 5FM8A 3PXJA 5DT1H 4JGMA 4Z6AT 1I9EA 1FCCA 1WCBA 4X8JB 5IQ9A 4LVNC 3BPNC 3J8F7 2QQKL 4LCCC 3JWDC 2UYLB 4LVOC 3WSQH 1UCBL 3O8XB 1CICA 2NY2D 2VZOA 4OB5H 1VADB 4F80A 3VI3F 4C55A 2DL2A 2HH0L 4APQA 1W0VA 5ICXB 5D93B 4K7PY 3TYFA 2XICA 3PNWB 3GJFA 3TO4A 2EDDA 1IC7L 1JNLH 3MXVL 4LHJB 2P43B 3VFWA 4YHNB 2FH8A 3C60D 1LO5A 1MJJB 3BXNB 3EYVB 4W81A 4OCWH 2B2XH 4AJ0A 1MFNA 5H37G 3CPLA 2JK5B 4F33A 2R4SH 5J6HA 1HH6A 2YD8A 5FYKD 1MWAL 1MWAB 5EU6B 1WWBX 3L5IA 1IM3A 3PHQA 2PO6C 5HHPA 2GJ6E 4HF5H 1F4YH 4J6RL 3HN3A 4HWZB 4HBCL 4JO1L 3B2VH 5H35B 5C3TA 3MNZA 4G8IA 1L0YA 2Q8BH 1CICD 1IILE 1G0YR 3V8OA 2V5RA 5E8PA 5GHWH 4APQD 2B5IB 1QKZH 1T0PB 2VDPL 1YEIH 2MKWA 4WCYL 4YDJB 1XF3B 1H5BA 4PTTB 3CK0H 3OKKB 4R7DB 5HVGB 3MV8B 4JG1H 1NCAL 1MIEL 5EU7E 2J8UE 4DUWA 3MJ8A 5DJCA 3GNML 3WFEH 1CGXA 4ZQKA 2YRZA 3V0WL 2PXYA 4GKNB 5HGGS 5I8OH 3PWUB 4M62H 1A7NL 1CQYA 1QFHA 1FL5B 3ECBA 1QBLL 1WFNA 2W59A 2YN5A 3O3BA 4L3AA 4RGOL 4U6HA 4PLKD 1HIMH 5I1DB 2X9YA 1HE7A 2LE9A 5IVXA 4TSAH 1RK0B 3DVGA 4ZDHA 3VXUD 3QA3B 3MRPA 2D9CA 5I8EB 5FGCB 2P8LA 4YGVA 4OZGA 1KLGB 1A9BA 5CINH 2ESVB 1T0NB 3W39A 2AEQL 1OAYH 2SEBA 4PP2A 4PG2A 1R0AH 4OKVB 1PW3A 3VD7A 5KSBF 1CN4A 1F02I 3FO0H 4Y4HA 4XPGH 4CMHB 3QIBB 2VISB 2X4SA 3K3QA 3FT3A 3ALWA 5I71B 5T1MB 2J88L 3B2UC 4UI2A 5C0GA 5JOFB 3MLTA 2C7UA 2PXYD 4WUUA 4J23A 5C08A 3G6JB 1NGQL 1LDPH 5E5UB 4P2YA 5JXED 3EIFA 1D5BA 3TN0A 4U1MB 3NN8A 2R29H 4MNGE 5F1IA 3G04A 5JW4N 1LVEA 3INUH 4YHYC 2YN3A 4GW4B 1DE4B 1R3JA 2BSRB 4IOSD 2XZQL 5B38G 5D7SH 5KN5B 4YDVA 4HLJA 5SWSE 4HWBA 1ZSDB 1AHWA 2NZIA 1RUAL 5BO1H 4P46B 1G7QB 5IKCA 5EO9B 4ZUSA 3LB6C 2F53A 1BJMA 4XVTH 4X5XA 1YUHB 1EAPA 5E8EB 4XPAL 3UYOD 5IMLA 1LE9B 1TVDA 4P5KA 3UTZB 2QSCL 2HFTA 4BQ6A 2VDKH 3KPQB 4RCAA 4U3HA 3O2DH 3D69B 1GZPA 4KZDL 4WUUD 4JN2B 4HX1B 1J0HA 4EVNA 2EDNA 3MV7B 2GTWB 1IGYB 4DN3H 3QWRA 1INEL 3TN0D 2F5AH 2AQ3A 5T3ZH 4RFEB 5FECA 1RMFL 5D7JB 4XVUD 2VR5A 3C5JA 4KV5F 1YMHA 1BFSA 4HMCA 1U8MB 4HJJH 4AYFA 4X4XA 2NY4D 4Y2DB 3AS1A 1NBYB 1OD7A 2Q8AH 3CAFA 4NT6A 2R4RL 3CDYA 2Y5EA 3DNKA 1T5WA 5TF1H 1LQSR 1CZ8H 4LVHB 4XNMB 3UDWA 4XVJL 1N0LA 1GXEA 2C26A 1TJHL 4H25B 1N6UA 3KYOB 4KKNA 2FB4H 3KJ6L 5E08L 5KANG 1A6UL 2N7BA 3ARGD 1DQQB 2A6DB 4PJHE 3FO2B 4LPVA 2VDML 5T1LA 4LAJH 1LP9A 5I1JL 4QHMA 4XVSL 2FJFB 1D5IH 4QXWA 5ERWB 4NC1C 3BP6A 4L4VE 3QEHA 3WN5C 2AEPL 5EC2A 1ZEAH 4LEOA 1T3FB 3LRSB 5I76A 4PJCB 3QXTA 3BPCB 4KPHH 1IGIH 2PTUA 1KJVA 1UACH 5IHZA 3RTQD 5CFHA 5J12B 4NM4H 3I9GH 1DFBH 1G9MC 5FK9B 2PW1B 4JLRA 4PRNB 1RU9H 1PX4A 4KQ3H 1K4DB 4G6KH 4WO4A 1WBYA 1CI5A 4HGWB 1EA9C 2J7LA 5JUEL 4NNPH 3T8XB 4DAGL 4UOW1 3GDBA 5DWUH 5BRZA 3JVGA 2FGZA 3RWJB 4JFZL 1N64L 2JJSA 1IGTA 1YNTA 4HWEH 5CP7B 2Y1VA 5DJAB 3PIQB 2JB5H 5IBTL 3RL2A 2N56A 2FGWL 2ZCKH 3MO1A 1S78D 3SDCD 4MAYC 4F8QA 1FVCA 3ULUE 2ZOKA 1QRNE 3LSOB 4AH2B 3B9KD 1YECL 1T89A 3MJ9A 1TQBB 3EOAA 4N8CL 2EYSA 2FYYB 5D2LA 3SGJC 2DQEH 1WIPA 3IDIA 3DMMA 4OLWL 4EJ1C 4WGWB 1IE5A 2EKJA 4FQIL 4RMRA 4UDUB 3GHEH 3IGAA 4YNYA 5HYSA 5D6CB 1T7WA 3HUJE 3Q1SH 2X4RA 4MA8L 1SYVA 1U2HA 1AC6A 1W8OA 3MCG1 3QULA 3EZ8A 3UP1A 3MLSH 3NABH 4KK6D 1AR1C 1QFWL 1EGJH 4G9DB 2YUXA 4NQTA 1MAML 3BN9C 4NO0A 1KT2A 4NC2B 4RDQG 4BSVA 2EDBA 1RJYB 1P9MA 1A1NA 4PJBB 1J7VR 2VABA 1Q9KB 1S9YB 1T7ZA 2OJZH 1ZS8A 4TOYL 5KTEH 3NCMA 2AJSH 5FYKH 3ZSSA 3VD9A 2VDLL 1MCKA 2NY7L 2PYFB 5D6DA 3R1GL 2XQYG 1CL7L 2B7DT 3LPFA 1DBKH 3TVMB 4MNQB 1NMAH 1UJ3A 3WLWC 1V7MH 3JWOH 4KROB 4YBQC 3P40A 1WAAE 1NEUA 2FD6L 3TPUE 5EPMB 4M7LT 1UM5H 1C5BL 4LSSH 2E7LA 5DJZB 4AIXA 3DHMA 2FECL 4I48B 1KTRL 4LVEA 1S5IH 2JJUA 3BHBB 1J1XL 3DVNA 3RDTB 3R4DA 1RULH 3UBXI 5C0FA 3ZYOA 5CS7A 1HILB 1L0XA 2OZ4H 4MA3A 1LNUB 4Y5VA 4HPOL 2K7QA 4V1DE 4CBPA 5I2IB 1MCLA 4BFEA 2DLGA 2DBLH 3QEQA 1FJ1B 2APFA 2BX5A 2W0PA 2ID5A 5AD0A 3LEYL 2NLJA 5DFTA 2V7NA 3WHXB 4CDHA 4H8WL 1TTUA 1TVHA 3LQAH 4YEEA 3C08L 3WYRA 4UT9H 2AJ3B 4K71C 4X6DB 4AM0B 3HRZA 3MRIA 3TH2T 3T65B 5GRXG 4QY8B 1E28A 3BIKB 4PRAB 4P4KA 5GGVL 4OCYL 3GSNL 3GSNB 1EO8H 3QH3B 4QNPE 3OAYK 1MEXL 3OR6B 4G43A 3GI9L 3WIFA 4XCNA 1JFMA 3SO3B 1J1PL 4NN6C 1QACA 3P4OA 5DK0B 4TSCH 2RGSA 1NEZB 3QXWA 4HUUA 1UZ6E 2J2ZA 4M1DL 5DC4B 1FRGH 1TCMA 1PY4A 4KJPD 1GPOH 5GRVK 1KLUB 1OCWH 3VFSA 3HZYA 4ODVH 5C6PB 3BDYL 3QEQD 4RSVA 5DLML 4UOJA 4XP5L 4YUEL 3QJHB 1A7OH 5L2KE 4PJHA 3BQUB 4XC3H 1KCSL 4B50A 1G7PB 4ONHA 1MRDL 1XAUA 3SE4C 4GG8A 1EEQA 4QRPB 4X83A 3D9AL 4L4VA 3QCVH 5ETUA 1XF5B 4OFDA 5CD3B 3LAFA 1DL7L 2XY1A 3Q3GA 2DJ4A 4X6BA 5EZJA 5GXBB 1FNGA 1UM6H 1OQOA 3ZTJG 4OUUB 4CAGA 4HJ0D 4YE4H 3GBNL 2BNQD 2HWZL 1NCNA 1YEHL 3TJHC 2YSSA 1RZKC 1AIFB 1UKQA 4R7NA 3MACL 1NUFA 3ARBA 2QHRH 4OZHB 1A7PH 4PGDA 2VDOH 2VQ1A 4O5LL 3WFBH 1CF8L 3OKMA 2DM3A 2F5BH 5IFHL 3OWEA 1GGIH 1F3DH 4PLNC 4YIQA 1T5XB 5CJOH 1U8NB 1OARL 1T4KA 1N7MH 5L9DH 4X4ZA 4PRIE 3U0PB 2GJZA 2MOVA 5EZIL 4G7VH 1ZANL 3RPIB 1MLBB 3FQWA 4OZIB 2UWEE 3DO3A 1MJUH 1P2CA 4NUJA 3BKJL 1ZWIB 4NKDB 3ES6A 5BV7C 3KYAA 3T4YA 1QRNA 1HN1A 3LKSB 3S37X 3PWPB 5MP6L 4Q2ZA 1FSKB 1TCRB 2NYYC 4OI7A 4OLZH 3VGAC 1ZLUK 3N1FC 4OGYL 4FXLA 1NBZA 4PJIE 2GSGB 4JB9L 3RVVD 4LNRA 1JGUL 4GG6F 3WJJC 3ZL4L 4D9LL 8FABB 4AIZB 1CGSL 2B1AH 1BOGB 5ENWB 5L6YH 3L3HA 4YZFE 1A6AA 1OAQL 3HKFA 4Z0XB 1E4KC 1UFUA 2LABA 4Y1AB 4KHTH 1BD2D 3H7BA 1INQA 2PF6A 2OTWA 4FQ1L 4HUWB 4M5ZL 2XWJB 3C6SB 1DBMH 5HI5C 1HNFA 2HG5A 3OB8A 4I9WD 1JBJA 5DFVC 3VG9C 5D7IF 4HUXA 5GRUH 1AKJD 4MNHB 4L8SA 5J89A 4F8TA 2X1QA 4XRCA 4I0KA 3PV6B 4E41B 1SVCP 2IALB 1MAJA 4L8BB 3QDJE 4MXVE 4UUJA 1J8KA 3NFSH 3W2DL 4KTDH 2DMBA 1FP5A 5EBWB 3M45A 3EDJA 5EWIL 1JZ4A 2IAMD 1NDGA 4XMLL 3WNOA 1WAAA 4XNZB 1ACZA 3TPUA 1MFDL 3UTTD 1A7RH 2A6IA 4JHBA 2ZUSA 3RIFF 1U9KA 3B9DA 1LO3L 3QDAA 4BFGA 4Q6IB 4Z7QF 1XGRA 2IQ9H 4L1DA 3CH1A 1VFUA 3BP7A 4GQPH 2CR6A 1I8LA 5T3XD 2ED8A 5CIPA 1LEGA 4XX1G 3SQOL 4JY5H 4V1DA 5CKGA 1MHHB 1AXSA 4X6CE 5D2NC 3EFDH 3ZE2E 3TIEA 2WP3O 3DXAE 2X1XR 4N5EA 5I1AA 1XGPB 4F7TA 2DM2A 4PJDE 5HHME 4F7CA 2MPAL 2CLVA 4IRJB 1A7QH 3V5KB 4Y4KC 4LP4A 4ALAL 1KOAA 5DVMA 2DQCL 4DGIH 4JDTH 1IQWH 5TE7L 3TWCL 4XP4H 4ERSL 5EZLA 5ANMB 2ZG3A 1B3JA 4TVPD 3P73A 1IC5H 3RZCC 3KG5A 1YMMD 4RAUA 4A2MA 4NRXB 1UGNA 1RZ8A 2D0GA 4I0PC 4L29B 3ALXA 4ZFFB 3QFJE 1F4AA 5HHOE 5DI8A 1F11B 2AKRB 2HT2D 3ZHDA 4TYUA 1H8OA 4NZTL 3L3DB 5HHVL 1N6VA 4R90H 4RMWA 4U1GB 4UQ2A 1MRFL 5IG7B 1XIWB 2VLKB 2I25N 2J4WH 4P2OD 4G42B 5DD6A 4P4RA 1WT5A 5C8JB 1JNJA 3ARDB 2NY6D 3SQBA 4Y19B 4GAFB 4JM4L 3QUMH 1B4RA 5C07E 3IDXH 3VH8A 2P49B 3HA0A 3JUYA 5E9DD 5L2KA 4BK4A 1XF4A 3CIQA 2WWKO 3LIZH 2P5ED 3WFDH 3PE9A 2F58H 4X9FA 1GH7A 5T3ZE 1NCDL 3FB5B 1RV6X 2AK4B 4H0GA 3W11D 4GRLD 1FFOB 4JJHA 4P9MH 5D93C 3LMJH 5HGAA 4X99B 4YLQT 3ULVC 4D9QE 4X9HA 32C2A 1JHKL 3GMNA 3RL1A 5JMRA 2F54D 2Y36H 4MCZA 4OIAA 4GJTB 1BQLL 3ULVF 5C0JA 4OCXL 1IKFH 2YEZA 3GSXB 2EDWA 2JB6A 1WBZA 3LKRA 4PD4J 1RIHH 5DSCB 3E6HB 5E2UH 4K7PL 1UVQA 5D7LB 4HHAB 3STLB 1NL0H 4GAYB 3TF7C 3HE6B 4PS4H 1S9VB 2VLMD 4JGJA 1A7BA 2E27L 2VAAA 5F3BB 5KAQG 5F88B 2V5MA 5JPNA 1NMBH 1Z9MA 5H2BB 3RVXD 3VXMB 2CJUH 4RMTA 3QIUD 1BMGA 4PG9A 3T0VA 2VLJB 4HIJA 5E8NA 4OGXH 5FYJL 5HGBB 1CLYH 3IKKA 4NWTH 2KQNA 1XR9A 2RIKA 1U8HA 3SKMB 1Q0YH 4XXDA 1SEBB 4MHHG 1I3UA 5GPRA 4HV8A 4JG0H 3CDGB 2QKIB 1OAKH 3FQNA 2LVCA 1MPAL 1IC4H 3BE1H 1C08B 4G80B 2NXZB 4ODSL 4DGYH 5EIIB 4E0RB 3PWNA 2UWEA 5DTFA 5C0BA 5C0EB 1IAMA 4OD2A 4FFVC 1AGBB 4H88L 1DLFH 3OHXB 3HMXL 2WW8A 3VFNA 2NZ9D 3GB7A 3FB6B 5KVEL 4ODTH 1Z9SA 3BP5A 3F8UB 3H9HA 4QTHB 4X5WB 4IOFD 1FN4A 2UV3A 3QCUH 5IIEA 2NCMA 5D1XA 3WLBB 5DT1L 3SGDH 1M71A 2YPLA 5SX5K 5EOQL 4OIIH 5ID1B 1NAMA 2I9TB 3LS5H 2GK0B 4TUOB 3REVA 3WHE0 3GRWA 3BWUC 1A1OB 3THMH 4PRBB 4DCQB 5GJTL 1HCFX 2KBGA 3ZE0F 4S0UC 5DJ0B 4ODUA 5IB3A 4CN4A 1CXKA 5C0BD 3MNVA 1DQLL 1Q9LB 3I3BA 2NY1D 5DJ6B 3ILQC 3QIBC 4OCWL 3FT2B 3EYSH 5I71C 1H15A 3GMQB 5FDYA 1MCWW 1C7SA 5ADOH 1ORQB 2CDGA 2C4FU 4XT1C 3KPPA 3CH8A 1TVBA 3FN3A 4P23B 5D1XD 5CEXA 1NFKA 3F58H 1T7VA 4U6VH 4HKBB 3G6JF 3K8LA 2BFVL 4Z7VB 1IQDB 1KJMA 1YYMH 1S7VA 3O6MH 3E6FA 2XG4A 4X6FB 4ZUUA 2CIIB 3U9PH 3D2UA 3B2VL 1BZ9B 2CO6B 4U3XA 4Y4FB 3DO7B 4LEXL 1TQCB 5GHWL 4OM0L 4R4ND 4RGND 2R69H 1YEIL 5IBLD 2Y5TB 1YY9D 3AUVA 5C9KA 3V4PH 3DXAA 3IFNH 4JG1L 3VGDA 1YPZB 1JUFA 4LQFH 3V52L 4ELKA 2E9JA 3OPZL 4KRMB 1J05A 1UT9A 2NX5B 5HHMA 5F93C 5I8OL 4M62L 1VHPA 4HGMA 1IL1A 1JTTA 3OJVC 1S9WB 2G9HB 2Y7QA 4NKOA 4AQOA 2IGFH 3I6KB 4RZCA 2FX7H 2BHYA 1S7TB 5HY9B 1FBIH 3QFJA 5HHOA 3QXUA 1FDLH 3C5SA 1O7VA 4OF7A 5D7JC 1MH5B 1PGRB 4N1HB 3F7RA 3L3GA 1RK1B 5CINL 2GY7B 3AS3A 1MI5E 1OAYL 5EUKB 4XXCA 3EYFB 1DUZA 3PHSA 3LZFH 1LO4H 5C07A 1H9VA 2BNRD 4XC1H 4XPGL 3VI4F 5JIPA 1KB5A 1JNHB 4LVHC 5C0IA 5IBUB 1IGCH 1J8HE 1MQKH 1VACA 3QRGL 4OAWA 5LQBH 1URLA 3ARPA 5KS9B 1KULA 2V9TA 5BS0A 4WI5A 2KQMA 4PJAA 1KCVH 4DVBB 5LXGL 2VXSH 2YD3A 1HHIA 4AY0A 3INUL 5D9SB 5FUOH 3WDJA 4G8GE 1BFVL 4NQCE 4F3FB 5T3XH 3TCLA 2X4PB 4GRWH 4XP9L 5D7SL 1NGPH 1E0OB 3UROR 4U1KB 3V6OE 5J1SC 3IJYB 3NIFE 1KNOA 3DYPA 4LCWA 4KVNL 4XVTL 1NCTA 4PJCF 4JO4H 5E6ID 5J12C 5I0DA 2A6KB 4KJQC 4KH2A 2P5WD 2PNDA 2GAZA 4XZUB 5DD0L 3GSOA 1BZ7A 3RIFK 1H0DA 3WUWB 2VAJA 3OJDB 2C3XA 3KYMB 3G5ZB 3MMEB 4JKPL 3F12A 3D39B 3LN9A 3O2DL 2EXYC 4FHBD 2CKBA 3NCFB 4TVPH 3F65A 3HZMB 1R5VB 1RD6A 4MQ7A 5BS0D 3BZEA 3VRIB 1I9RL 3SDXB 3MLUH 3BD3A 1N4XH 2F5AL