1FO0H

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
b'MGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALLOGENEIC H-2KB MHC CLASS I MOLECULE)
publication title Crystal structure of a T cell receptor bound to an allogeneic MHC molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fo0H02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1fo0H01
2GJJA 3EOBB 1NCTA 1RZGB 1I3GL 3OG6B 4GG6F 4LIQE 1P2CA 5ACMA 4DOHE 1G0DA 1FVCA 4FG6D 1FRGH 4HT1L 3DRTA 5DT1L 5HHQA 1L0YA 1RUQL 1T7VA 3QNZB 3OJMB 4HLJA 4JFQA 1S7TB 4POZC 3O2WH 2OBGA 2EKSB 3SKOB 1A6TB 4I5BA 3IFNH 5HYJA 2YD8A 3P77B 5I74C 3VXOA 4M7KH 4S1RL 4JR9H 5J1AA 2MQ0A 2UWEE 1ZA6A 2JCCE 1BEYH 4O58H 1Z5LB 1UB6B 4MXQC 2Y6SD 4G9FD 4RGOH 1CFNB 5F9OH 4NUGH 1A64A 3GKWL 3S3SA 5KG9A 3TBVA 2LVCA 2GW5A 4FQJL 3N1GC 4R4BA 4F33B 4HUKB 2D31A 3O0RH 3RVTD 3QXDB 1TZIB 1V3JA 2PF6A 3T2NL 4LPVA 1EO7A 3JZ7A 3GMNB 4N0UA 1KTRL 2ZG3A 5A43C 4QF1B 2E9WA 4DKEL 1K8DA 1SY6H 4MQXC 4MNHB 4NQCA 4WHTA 5EWIH 3SE9L 1DEEB 4FNLH 1OGAE 1G9NL 3LIZH 3T1FB 1YY8B 1JYVA 4ODTH 1MHPH 1F5WA 1AQKH 3VW3H 5FHAH 1NFIA 2C1OB 4JDTH 4JVPA 1ZT1A 3JV0A 5H2BA 3SDDD 1JGEA 1FO0H 4UDUA 4L3ED 2AQ3A 5DMIH 4KK8D 2HKHH 3RPIA 3MA7B 3KPLB 3GSOB 4Y19B 1OB1B 5LCVH 5C0GA 4Q0XH 3VXUD 4FQXD 1FFQA 4OZFH 3UTQA 4U1KA 4BQBA 4JM4H 3DETC 5C0AD 1CDCA 4PLJD 4KJQC 4LFHG 1CE6A 4NN7C 4OT1L 5IM7A 4YO0B 4LQFL 5EC2A 1L4IA 4HV8B 1G7MB 1AR1D 1AXSA 3FB8B 1AJ7L 1NANI 3LKRA 5IW1B 6CGTA 1FFPA 1N3NB 4CVWA 3T4YA 1E4WH 2CLVA 1QBMH 5DUMH 4ZYKB 4MCZA 4JPKH 1MOEA 2C5DC 5IBTL 1C5BL 5ERWA 4G8FB 3DURB 4OM1L 1ZLSH 4UU9A 4ERSH 1VSCA 5GRUH 2X4OB 4LAJH 3VXRE 1MAJA 2IQ9H 3MV7A 4FZEH 5BVPH 3AU1A 1XEDA 4NSKB 4RFOL 5JXAH 5BZWB 3DI2B 3UX9B 4MX7B 1RZJH 2V5SA 4M6AA 5CEXB 4HIIB 2IEPA 4Y16A 4HIJA 3HAEH 4PRID 4LEOA 1U8NA 2AABL 1PY9A 5EFIB 4UUJA 5D96B 5GZND 2UZIH 3CDYA 4S11A 5HGBA 3LS5L 5L9DL 5EPMA 5CSZA 2J7LA 2W38A 4P57B 1MRCL 1V7ML 4GQPH 3N1QC 2G9HA 2BC4A 2AJSH 1OTTD 1DLFH 4MD5A 3TPUA 4WJ5A 5CAYB 4LLVB 1G7PA 1TTUA 2H32H 2WIMA 5F9AC 3QEHB 1IQWH 1J9CT 4HBQA 4NQDE 1MCCA 3PABB 3EO1A 4AK1A 1Q0XH 1LP9B 4OB5H 1F4AA 2R8SH 1LDSA 5JA8B 1ZHLB 4PP2A 4DKAA 5L6YL 2VKXA 1LO2H 2MHAA 1HHJB 5GRWA 4LVNC 2UVFA 3OZ9L 3RWCA 3RWFA 1FZOB 2NNAB 1INQA 3TN0D 2OZ4H 3BN9C 4KQ3L 3O9WA 3UTSD 4JKPH 2Z8RA 3HR6A 5BVJA 4JFEE 1E6JL 1S7WB 4K94H 2DWDB 4KK5C 1U8LB 1OCWH 2LTQC 3TJEL 3VFSB 1H15B 3N9GL 2GY5A 2EEAA 1S7UA 1AGDA 2QSCH 3GNMH 3UC0L 4MQXD 3ZKXC 1D9KA 3RU8H 3HUJB 5AYUH 5TQ2L 2Z9TA 4WI2A 4AEEA 1PG7W 2F58H 5IVXF 1WVZA 5FYJL 4OFKA 1VENA 4TSBL 2CLRB 3I02B 2YXMA 3BYYA 3DIFB 3HMWH 4ZFFA 4ZOCA 2JJUA 1XCQA 3NZ8B 4JFYB 4X7TA 2Z8WC 4PPTA 4Z7VB 2P44B 1J0IA 1XGTA 1FN4A 2DB8A 3LPFA 5GIRB 5DYOB 4MQ7A 5EBGA 4HWZB 5EOCH 1ZTXL 4FQCL 1KJVA 2M1KA 5E4EC 1RZFL 5E8NA 1D5MA 1NAKL 3KWWB 4I3RL 4MAYA 4YHOL 1TJHL 3OV6A 1I3VA 5E1HB 2X4QA 5C08D 3GO1H 2XZCH 2FB4L 4ODXA 4WW1A 2CJUL 4GW4A 1LMKA 2PTUA 3O9WC 4L29B 1OP5K 2IALA 2IJ0C 5GRJL 2VABA 3G5ZA 3NGBC 2PXYC 3QO1B 3M8OL 3SY0B 3TNNA 4H88H 3DV6A 3RWEA 4KVCL 1FVCB 1HH9B 4JGJA 3OXRB 5HHQB 1WEJH 2EH8H 2WANA 3PGDB 1NBZB 1MLCA 4AG4L 4EXKA 5D70H 3TWCH 3IF1A 4L8BA 2APVA 1GHFL 3P11H 3DUHA 4OZGE 5FYKU 4IRZL 4DN3H 3C8HA 4K9EC 5C92A 5DD3H 1TQCB 4FFVD 4G6ML 2QQKL 3MA9H 1QRNA 5MI0B 3DROA 1FQ9C 4TSCL 1G9MC 2DKMA 4PV9A 1D5ZA 3QIBA 1KB5B 1YECL 4IOIA 3MRLB 2P4AB 3NIGE 3BRGC 2J88H 5C0RH 1BBJB 1INDH 4YHZH 4DUWA 5KS9A 1Y18A 4W68A 5IFHH 1NCDL 3ZYOA 5DRNA 1H8SA 4JB9H 2R56L 5F97E 2CLZB 3EFDH 3G6AB 3ZE0E 4HKZA 1F90L 3ZDYE 1XGYH 4YGVA 2H26A 4CRPA 4PP1D 3HI1A 4ALAL 4R8WL 2MCPL 1S9KC 4JO2L 1UA6H 4XPGH 2O61B 1AFVH 4O02L 1BVZA 2ENSA 4S1DD 5HHOA 3I3DA 1RK1B 4IDJL 4YFLF 1NFIB 5IF0A 3O8XB 1ZT1B 3MCLL 4D0BA 4JKWA 4UDUB 2JJSA 1U8PA 2XN9E 1AGCA 3I50H 1KV3A 5D5MB 5TE4H 3RGHA 4QTHB 2YRLA 4AIOA 5E2JA 2HVJB 3PWNA 3BH8B 3MX0A 1XGQA 3B8YA 1ULVA 2GTZA 3QIBC 3UYRL 3LV3A 2DMKA 1K8IA 1KTLA 4HZAA 4NWUH 1DN2A 1FC1A 3KLAB 5C7XL 1XCTB 1G7QA 3CVHL 3MODL 3OKNA 5DHYB 5IM7B 3T09A 2VLRD 1NBYB 3CMOL 1E4KC 3LKRB 4B7IA 4CMMB 3FAWA 1CXEA 3TVMB 4WUUA 2CLVB 3NABH 3K1KC 1X5ZA 4MCZB 4RMWA 5IJKA 1GAFL 3U9PL 1ZKAA 2XTJD 4M6OL 2AV7A 4R7NB 4UU9B 2BVPB 3SDAD 4RSVA 3QXTA 1MCKA 1HHHB 4OLZH 5J12C 1E6OL 1ZT4B 2C3HA 2KUTA 1JF1A 2P24A 35C8H 1U6AH 4MNQA 3QHZH 4Y16B 3QEQE 3O45A 5JW5A 4BSVB 2QR0A 5CS7A 2HT4C 4MAUL 4YHYB 2MKWA 2NY5C 2EE3A 2JJSC 1DSFL 2YS4A 4U6TA 3MLXH 4JREB 5HGBB 3FN9A 5J9PB 5EPMB 4RNRA 2OK0L 1NGYA 2MKLC 3GSQA 4NP4H 4NO5A 3U7WL 2NY4B 4P23A 5B8CB 1LQVA 3ARQA 3I6LE 4PJEF 4MD5B 1V3MA 4X6DA 5SWZA 1KEMH 1G7PB 3CLEH 5CILL 3B2UD 5IROA 3QB7C 4X8XA 2XWBB 3EO1B 1UM6H 1MY5A 2V6HA 2ORBH 3HUJE 1NEZG 1ORSB 2EDBA 1JMZA 2GFBA 4FN0A 4ZUTB 3ARGD 4QHLB 3RVUD 1I1YB 5IJKC 1BD2D 1PKOA 4ZFOB 3F7VA 43C9A 3TV3H 4Z7WF 4LSPL 1WIUA 5K9KA 4NPYA 2CD0A 4Z7VE 2ARJB 1ADQA 1INQB 1QVOB 2CDFB 3MBXH 1FGNL 2NYYC 1FYHB 1NCCH 1QRKA 4XP4H 2DYPD 4I0CC 4Y5XB 2FD6H 4JFZL 3WUWA 2AI0H 3H3KA 2J2ZA 2VSCA 3TBSB 4BKLB 2VDQL 4N0CD 5JR1H 4WEBH 5EBWB 5C2UB 4U0QB 3SDCA 1S7UB 1AGDB 3KYKH 2R1XA 4UOW1 5GSRB 3VXPA 4KXZI 4N5EA 1D9KB 3FQWA 5L2KA 5DVMA 1K4DA 3IXTB 4NRXA 4O51A 4P23C 4YQXH 4P2OC 4TULL 1R3IH 3V0WH 1FHGA 1N8ZA 3L5WB 1R3HB 5GRVL 1M4KA 5CUSL 1S9WB 2R0WH 2F54A 5IROC 3NCEB 5FCUH 3ULUH 1SEQH 1IM9A 4LRNH 3BT2L 3SDXE 4KVNL 3UBXB 12E8H 5T3XH 4PRNB 4ZD3H 1WISA 4OGYH 4KTYA 4TRPL 4MQ7B 1MCJA 2CDGA 2YA0A 3MACH 4ODBD 4Y4FD 3V8OA 5T33L 4NRZB 1D5MB 3CCHA 5C09A 4MAYB 2Z93A 4LLYA 2DAVA 1RUKH 2VJXA 3OJ2C 4WW1B 1F4XH 3W2DH 2JIXD 4I3SL 3B9KC 3KPSA 2X5PA 4Q9QL 3PUCA 1KFAH 1RFDH 2VABB 3G5ZB 4I0KA 1UADC 3SN6N 3T0XA 3DBXA 1YDPA 4QXGH 3ARUA 3RWEB 1GPOL 4ZPVA 3Q0HA 2WIIA 1NDGB 2CH8A 3MJ7B 1A6VL 4EUPB 4NBZB 4LPCA 4YZFE 2BNRB 1Q0YL 3QDME 4L8BB 3GMPB 1U8MA 4R4FL 3DX9A 3NA4A 2D3VA 1JFQH 4G9DA 2BNQA 4KKAD 1G6VK 4XPFL 3QWOB 3DROB 4HUXA 3UJIH 3LKOA 5IESH 1FE8L 1QBLL 1IAKB 3QUZA 5DJCB 4UV7L 4KHXL 2X44D 5DJXB 1FFRA 1MAMH 4XRCA 2W60B 3VMOA 2VLJA 4FFZL 3UTTA 1OLZA 4RFNC 4Y2DA 2OLDA 1K3IA 4I9WD 2V9RA 1FL6A 4ZFGL 4HZLA 2EYRB 2BJMH 5D5ME 4P4RB 3D69A 1Z6JT 4MSWA 4RMVA 4NO2A 4XPBL 1TQBC 4P2QA 3JV6A 4TSAH 5EIVA 3N0PB 3OAZK 3CDGA 1NGWA 1XR9A 2VAAA 4I18A 4NM4H 1LWRA 4YHIA 5FV1L 5CD3A 4YH6A 4LVOB 1GGTA 2H8PA 4IJ3B 4TUOB 2WUBL 3BKYH 4TVPH 4OF6A 5E8EB 4JG0L 4O4YH 5D9SA 1RSFA 2EDRA 3HFMH 1DL7H 3OGCA 3ULSA 1LE9A 5FA4B 2BVOA 3IDNA 5DUPL 3LKPB 4P9ML 1M6OB 5D72L 1PZ5B 3PWNB 2OTWB 2N7BA 1FFOB 3O2DH 3HNTL 3ROOA 3KLDA 1G7IA 5GJSL 5IBLC 4P4KB 5DURB 4KROD 2R29L 2P47B 3ESVF 5CWSA 3EYQD 4YJZL 1U3HB 3DMMC 4EQ3A 5F7DB 4PRAA 4WUUB 4XMLH 1ETZA 3NIDE 2IG2L 2FIKA 4XP9L 3V0AC 4HJ0C 1XGPA 3OJVC 5J1SC 1IAIH 1FLTX 2AEWA 1CD0A 4MNGA 4FFWD 3WDJA 2NY1B 3B9KD 4NQSA 4PD4K 3FT2B 4Z8FL 3AS1A 1TDQA 4MDJA 3G08B 1JF1B 5EU7E 4XI5D 3MBEB 2X9WA 4M03A 3GHBH 2ICWA 1T83A 2RFXA 2NQCA 4YPGA 1B2WH 1A7PL 5DA4A 1FLRH 2P49B 1UXWB 2UWEA 3CSGA 4M93C 5A2KH 4MJIE 4IDLA 4RNRB 5DLML 2JCCA 2N7AA 3WL9A 3QFJA 3LEVH 3WSQH 1RIHH 4HG4J 1INEL 4X6DB 3BPOC 4XVJH 1NC4A 3QIWD 3PL6D 3QAZC 1G9ML 4UI2A 5E56A 2EO9A 1QBAA 2V5YA 4ZODA 4NCC1 4DW2H 1T03L 1AXTL 4X98A 4CVUA 4PRDA 4QRPB 5ELIA 1YEIL 3IJHA 1CFSB 1QYGH 1AO7A 1JWSA 3F12A 3S35H 4Y5VB 2Y36L 4FXLA 43C9B 4UB0H 3VXNB 3WMSA 3TGXA 3BGMA 5K9KB 3DVGB 4YHMH 4N0FB 1OGAA 3GMMA 5EOTA 4YWGH 2P5WD 1TTFA 1E27A 1FC2D 1YPZA 5HDBF 4KI5C 5CBEA 4P48A 3IRZA 3TBTA 1S9YA 1T83C 3TBYA 2C7UA 3WLWC 3ZKNC 1UXSB 5CBAA 4Z7QF 1U3JA 4NNXB 2H3NA 3LDBB 4YHNB 2E27L 2P8LB 3HE6B 1EUTA 4LCCB 4LVEA 4G43B 4QXUH 4K23L 1U91B 1V8HA 1N64H 3H42L 5LGKA 4Y4HB 4U1SB 3F7RA 5GGQL 1AE6H 1DQML 4PJ7F 3DX8B 2OYPA 5JMOC 1I1AB 1P7KB 1NKRA 5DJ6B 4DAGL 3T0EB 4P2YA 4XNMA 3MRRB 4GRMA 2KBGA 5CP3H 5SX4H 1JGUH 2GJZB 4PYGA 3MJ9L 2Y5EA 2X9YA 2HG5A 3S5LB 2EIEA 4M1GH 4QEGA 4MB5A 4JFXA 4P3CL 4HEPG 5I75B 3CSBA 1Z3GL 2G5BB 1IILE 1DBAH 5LJYH 3O11A 1LEIA 1K5NB 2R15A 1U3ZA 1ZS8A 2CPCA 3RWGB 3DBXB 4G80B 1BVLB 2WBJB 5CINL 5JW4M 4LSSL 2WIIB 3E6FB 5DZLA 3P9LB 3C6SB 4XC1L 2LQRA 4Z5RA 1MF2L 5MEPA 3B2VH 4K3HA 4U3XA 5F9JA 2ADJB 4WTZA 3O81A 2NY5L 3QDAA 4G9DB 4PUBH 2AV1B 1H8OA 2A83B 1YEHL 3NFPB 3C08L 3JWDH 3TCXA 4E41B 5EO0A 1A7NL 5EBMA 5LWYH 1T1XB 5GS0C 3MXVL 1EHLL 3HN3A 3VFGH 4D9RE 5IJVB 1HKLH 5I0DA 3U0PA 1QSEA 4Y2DB 4KHTH 3WIFA 3UMTA 4Q7DA 1RUAH 4LCIL 2RIKA 5JORA 4U2ZA 4WIQA 1GYAA 3D69B 1RJYA 4G6AD 4OUOA 4Y4KB 5HGGS 7CGTA 5JHDD 4XMPL 4WI8A 1A3QA 2PYEE 4X5XB 2CUIA 2D9CA 1N5YL 4X99A 1BQSA 2R4SL 5BJTA 3KYMB 1PSKH 4I18B 1RURL 4YHIB 3RL1B 5J6GB 4QRQA 2HFTA 1ZA3B 1CZ8L 1XF1A 1YEGL 2GSIA 5F1NA 4R0LC 5TF1H 3DUSA 4ZG1A 4TPRL 3S4SG 4EVNA 4WNQA 1BREA 5EUKA 5I18L 4FFYL 4U6HB 1E4XH 1D3CA 3V4UH 5IK3B 1R0AH 3OTTA 2B5IC 5D7JA 1F45A 1ZWIA 3IDNB 4E0RB 3MUY1 5AYQA 1A8JH 1PLGL 2YPVL 3ZLQC 5I2IA 1J5OL 5CJ5A 1HYSD 1JNJA 5IW6B 5JW3L 4KK9D 4DZBA 4PJCB 5FGBC 2YZ1A 2YSSB 1EJOH 5LGJB 2X4SB 3CU7A 4XCFL 5DTFA 5BS0A 4TTDC 5HYIA 3R8QA 1ONQA 2J4WL 3IYLW 1OGTA 5DI8B 1K2DB 2AKRB 3QQ3B 2HTKC 5GHWH 4S0SD 1XGPB 4LBEA 4XMKL 1T3FA 3BHBA 1I8KB 2WWMC 2X4UB 3L3DA 3WFCH 3PHQB 3MRQB 3BEWA 4MNGB 2F15A 3O3DA 2H6PB 1UZ8A 4EIZC 3X3GH 1QFUL 2EZ0C 4OZGA 4MDJB 4Q58C 4U1LA 4GLRI 3FJTA 3O3EB 4MWFA 4WW2F 2Q76A 4RBPK 2BHZA 1MSPA 2ICWB 2RFXB 4YPGB 2IMNA 3BKCH 1BAFL 4YHKL 1LK2B 4N8CL 4HDIB 2ED7A 1P4BL 5DJ8B 3P9MA 1CK0L 1F3JB 1DBJL 3GI8L 4OCMC 4LKXA 4OZFA 4PD4J 1I7UA 3VWJD 4TOYH 4NWTL 1PAMA 5DA0B 1P5VA 4XPTL 1J1OL 1D5BA 4GG6B 1MHEB 2ZSVA 3G5VB 1FZJB 1CGWA 2XZAL 2VXQL 3PWPB 3QFDB 3BKML 2QJDA 4LARL 3FB6B 5IMMA 1AO7B 2BRQA 2NY2C 5IQ7L 2H1PL 3TYFB 3OAZH 5FO9B 2ZSWA 1BBDL 4MJ6B 3WLBA 1J05A 5E08L 4ODWA 5GJTH 1A14L 3T0EE 1F00I 1M71A 3HPLB 2V9TA 5D7SL 4DK3A 1CLOH 3R8BB 1J0HA 4DN4H 2DQCL 3ILPA 5E03A 2PO6A 3CFBB 2DQDH 1T2JA 3TBWB 1U8IB 1SBBA 3H9SA 2O5YH 5DD6B 1JWMA 1L7TH 4IRJD 3ARDA 1F13A 3WKML 5K93A 1YJDC 4NQDD 2NPLX 1JGVL 4DVBB 4J8RB 2H32A 2Q3AA 3OKDA 5JLZA 1RIVH 2HLAB 2BXZA 2H9GA 3HG1E 3OGOE 4KPHL 5E1AA 1HCVA 1BJMA 3L3OB 4P2RD 5E6YA 2LVEA 2ERJC 1LDPL 5IGXH 3HLAA 1KIQA 4GUPB 2YUZA 1U42A 3BH9B 4E41E 2ESVE 1WFUA 3S37H 1WZLA 4JFED 4EI5D 4Q6IB 4OI7A 3K4AA 2CIIB 5A3ID 4PS4H 1NMCB 4K3DH 3V5HB 2CRZA 1HZHL 3B6SA 1RZJC 3MOQA 4JJHA 3CUPA 4OFYD 1X4XA 3W9DA 1DVFC 3CPLA 1D6VL 1B6DA 4LPTA 1WTLA 5T3ZE 1MAKA 1YN7A 3I9GL 4HCRL 1A6ZB 1YMMA 3DSFL 3BD5A 3N1MC 3FONB 1QSFE 2PO6C 4MXWL 4MS8A 5KSBF 5D2LF 1JBJA 1MFCH 2BDNH 4XP1H 4Z5RB 1I8IB 3VFWA 5F9JB 4RA0C 5IMOA 4UQ3B 2QADC 1A1MA 2B8OT 1ZANL 3A6OA 5DMGD 3P4MA 4W4NA 5KOVC 3UPRA 2RHEA 4CU8A 5E9DB 2XA3A 5D8JL 1W72L 5JQHC 2BOCB 1G9EA 5IR1B 4QCIB 4NKOA 1RJLA 4ZFZB 4JFPA 4K8RH 5DMKA 3ZHDA 5CZXC 4HKBA 1GJIA 5K33A 2C1PA 1T4KA 3JVGC 3CXDH 2BVEA 5DC9B 4XCEB 2E8YA 3KVQA 3TH3T 5EU4B 3MRHB 4PJ9B 4LOUD 4PJCE 5DD5H 4W6XB 1FZMA 4XNYL 1RUMH 5BCAA 4KUZL 1KCVH 3QCUL 1XAUA 3VGBA 3HR5B 3T0VA 4MS8C 3FOLB 3TZVB 2MJWA 3QI9B 5FF6A 1FJ1A 5EUKB 5HD8C 2PW2A 2OQJA 4YUEL 3MLRL 1FG2B 5IKCA 1NAMH 3QO0B 2CMRH 5D7JB 3MRDA 5DHVH 2B7DT 3ZKMC 4ETQB 2VDPL 1BJ8A 2ZUUA 3V4PL 4P0DA 4C55A 4DZBB 5DK2B 3UPCA 4MB4A 2BY3A 1X5HA 1ZT7B 2VQTA 4Y19D 5IQ9A 2ZOLA 5DJDB 3IVKA 4WV1B 4M5YH 4PTUA 3RIAF 3FO0L 4F15C 1XIWB 1OSZB 2CKNA 1KGCE 4LBEB 1C7TA 4OCXL 4F7TA 5C0ND 5IVXB 3BW9B 4G6JH 1G7LA 1R24A 3F7YB 5C6TH 2FX8H 4Z7UF 4GG6E 3O3DB 4GFTB 2VDNL 2IFFH 3PWPE 4X4YB 2G60L 4YDJB 1JRHL 3QPQC 4U1LB 3QNXA 3WHE0 4PY7A 2ZCKL 1N6UA 5H37H 1W0WA 2GEEA 2H2SD 4N8VG 1KN2H 4HPYL 5TFSH 1N5AA 3HE7A 4HS3A 1S7XB 1FO0B 4GRLA 5IHBA 1LEKB 4V3EB 4UT9L 2IAMC 3V0VB 3FFCB 3VRLF 1IZKA 3G6JF 5C86A 2NY0C 3F58L 3QHFH 5GS0L 4HWBH 1V3KA 3VDAA 4ONFL 1FNEA 3M17A 4S1SL 4HIXH 5EZLB 4PJBA 2EIDA 4KKCC 4P46B 4I1NB 1PG7X 5IEHB 3GMOA 4Y1AB 4QRTA 1FL5A 2VYRE 2EYSB 4XVSH 3K74B 3QJFB 3Q6GH 5ALBL 3BPNB 2ZSWB 5GGUB 3ES6B 1A3RL 5HHVH 1I7RA 3FQTB 1GRWA 1T21B 1XMWA 2P8PA 1FVEB 4PJ5A 5EUOF 3MLSH 1L7IH 3HAEB 3D2UB 2DQEH 5D1XA 4X4XB 1OTUC 1U93B 5HI4C 5DF0A 4GRLC 1A9BA 3PDDA 3H9SB 1VFBB 4NKMA 1JWMB 3M45A 5C0BE 1A0QH 2IQAB 4EQ2A 3U4BH 2Q86A 1FORL 1KLGA 2X4PA 5IIEA 3MGOA 2H32B 3E8UL 1JI1A 4HEME 1KB9K 5AWNL 3VXTB 2CIKA 1E4JA 4M1DH 5JLZB 4S0TD 1L6XA 4GXUM 2NX5A 4PJGF 4RGMB 1CFBA 5E1AB 5E2TH 1PG7L 2NY6B 5TDPA 4ONGH 1J11A 3UZEA 5FYLD 3G04B 3RL2B 4Z18A 1S8DB 3DV4B 2HJLA 3MRBA 4J4PD 1VACB 5EU5A 3TVMC 1QFOA 4FFEX 5E9DE 3IB4A 1T66C 2ICES 3TFKD 3B6SB 3QUXB 3SGDI 4OCYL 4WI3A 5IB5A 3SGJA 4K07A 4PREB 2BSSA 4P59H 5JDJA 3SKNB 3WDHA 3QUMH 5CFHA 2HWZH 1CCZA 4WGVB 1B6UA 3A67H 4EKXA 1WCQA 3UBXI 4RFEA 1HWGB 1K6QL 2A6KA 4OLVL 2P43B 3P3YA 4C54A 3RDTA 4Q9RL 1RZIA 3LB6D 5TE7H 3KYOA 4Z95H 1A1MB 1JYNA 4JDZA 1ZE3C 2VZSA 4G8IA 4J7RA 2F5BH 2QQLL 2J8OA 1MCFA 1BWMA 2BVTA 2XKUA 4OZ4B 1EMTL 1NC2B 2PYFB 3CK0H 2IANA 1A2YB 5DMKB 3NA9H 5JQ6H 3LMJH 5IMKB 2ZJSL 3P4OA 4QY8B 5EO9A 1A5FH 4KY1L 5KAQF 5E8OB 3C9NB 5C0CA 4UIKL 3CD4A 2AK4A 4TNWK 1KNOB 4PJEB 2G75B 1IGFL 4JG1H 1N6QL 5JIIA 5JNYB 3H2WA 3H6JA 4KTDL 3LY6A 1M05A 5C8JB 3HRZA 3RTQA 4ELMF 5FF6B 4I77H 4MVBC 1TJIH 1EZVX 2F9BT 1BECA 4NKDA 3OKOB 3LQZB 5CEZD 1OD7A 5DO2C 4NNYA 4W70A 4Z7WB 3MRDB 1YJDL 1AGEA 3MLTA 4PGBA 2ADGB 2K9UA 5KW9H 1CFVL 4G8EB 1RZ7L 3O8XD 4K3EH 4OUUA 4ODVH 3I75A 1OM3H 3TJHA 1JPFA 3ULVH 4G5ZL 3X3FH 4JN1L 5T1LA 2K7PA 1UM5H 3NACH 1MFAL 1QFWH 4POUB 5DR5L 5IQ9B 2DRUA 4JY4A 5JZ7C 3D0VB 3CFKB 3CMGA 4DTGH 3INUL 1MLBA 4PTUB 2XWJA 1QA9A 3CZFB 4YBHA 3IFOA 2HMIC 1IC4H 4XGZB 1NDMA 5C0DA 3BIAX 3RKDC 4ODHH 3WHXA 3FFCE 1R24B 5FOBA 3QEGH 1N59A 4LHUA 1Q9KA 4KTEH 2EH7H 5F1IA 1EEQA 5KN5A 2AXFA 5ID0A 4CNIB 2YUXA 3B83A 2IF7A 3RTQC 3VFTA 5C9JB 4JZJA 1OARH 3GMRA 4XWOD 4S1QH 1ZGLP 3C5ZC 3AY4A 2FZ3B 4Z78A 4AM0B 4OQTA 4LNRA 4PJXE 5CP7A 4Y16D 1UWXK 1CFQB 3L6FA 4KV5F 1MJ8H 3VXMA 5LXGH 5I9QC 1SHMA 2RBLA 2GUOB 3QXAB 3BD3A 3VI3F 1PYWB 2ZUTA 4XAWL 1CGUA 1UWGL 2GAZB 5C2BH 2NY4D 2YMXL 5D1QA 2R69H 2XG5A 4NHUA 4F7PA 2NZ9C 2Z0BA 4X5WA 1FNEB 3M17B 2PYEA 3LKNA 1QNZH 3AS3A 3GMOB 3QYCA 4QRTB 2PTVA 4O5LL 4MJ5A 5I1AA 3GJFK 3L3JB 5GS1B 2C3XA 4QT5A 2VL5B 4AEIL 4PRBA 2CKBB 3MRFB 4OSUL 4XNXH 3OPZL 3NPSC 4XHJC 1I7RB 2KKQA 3DVIA 2P8PB 4Q9BA 4OD1L 3O6FA 2FATL 2ZZUT 3D3VB 2R0LL 2AJXL 4NM8H 2YPKB 3O3AA 5HHNA 1LK3L 4LVOC 1YEKH 3D87B 3TIEA 4HUWA 3AY4C 1A9BB 3OX8A 5T1DL 4NQEB 3IT8D 1TETL 4MVBD 4H1LG 3FO1B 5F7EL 4UTBL 5ECJE 5JIPA 4OTXL 3WFDH 2J8UF 1D9KD 4JO3L 5DO2D 5IIEB 1GGCL 5HGHA 3RVVC 5D1QC 1MJUL 1NEUA 3D85A 3IDGA 1S3KL 5FO7B 4O2FA 1H5BB 3EJYC 2NX5B 5LVEA 4NJAL 1N4XH 1I3RA 4IS6A 5DD1H 3MRJB 3S34L 2V2TB 4YHPA 5SWSE 1C7SA 1I3GH 1FIGL 4NJ9H 1F02I 2E7LA 3MRBB 4PB0L 1GIGL 4HT1H 1F2XK 5DT1H 1KB9J 1TCRB 3SE4C 2AEQH 3IJYB 1RUQH 4NO3A 3ULVF 4MAYD 3O6FC 2BSSB 1JNLL 1TPXB 3X14B 3DYMA 3JWOC 4V1DB 2BVUA 4X4ME 3VXQB 2F53B 4NZUH 4S1RH 3E3QA 4D8PA 5J6HA 3QJHB 4J3SA 4HKXB 3MGTA 4GKSB 3ZYIA 3FZUC 3RDTB 1PBYA 3T3ME 3SDYL 1D6EA 1KJMA 4PJEE 1RZIB 5ICYB 1WBZA 4KJYA 4YBLB 1DN0B 2BNRD 3GKWH 1L8JA 1XF3B 4NZRL 2CDEA 1GGIL 4G8IB 1JHLL 1UJ3A 2EDWA 2O5XL 2R4RL 2EYTB 4FQJH 4PBXA 3ECBB 4L8CA 1WF5A 5TDNB 1A4JB 1R6VA 3DX7A 1JPGB 4YXKH 5SWQB 4UIMA 4WW2A 2E7LC 4ZPTA 4Z7WE 1P7HL 4HXBL 5K9OA 4NT6A 2AERT 2Y7QA 5JXEA 2RQ8A 2APBA 4OGXH 1G9NH 4JM2F 3QDJB 2X1QA 4KDVA 3TIDB 1J18A 5C0CB 4F8QA 1A22B 2A0LC 1BFVL 2DF3A 3U1SL 3VE0B 4FXKA 3PIQB 2GKIA 3QQ9D 4XHJD 4BFGA 2I9TB 3IFLL 3BN3B 3DVFA 3AREB 3MRMA 3KPNA 5HSFA 1JWUA 3MRKA 4GG8A 3DTXB 5J13B 4OT1H 2WSKA 1KPRA 4NNYB 4RMTA 3K0WA 3FT3A 1AJ7H 1UJ3C 3DRQA 4LCCC 4H26B 4R96A 4U1HA 1MCQA 4OZIF 3V6ZA 4CUCA 2P45B 1WFTA 4OUUB 2YRZA 4D2NA 3UBXG 5IBTH 1C5BH 2ESVA 4RGNC 4OM1H 2FWOB 3C5SB 5JMRA 1I1AC 4JY4B 4PRPB 4XBEH 4F9LA 4RFOH 3IDJA 1MLBB 4QOKB 3L5IA 4UDTA 5BO1L 3A6BL 3HZKB 4P4KD 2SEBB 5DURD 4J1UA 2GJ6B 1NDMB 3T3PF 4F37F 1RU9L 5D7IE 2NR6D 3C60B 1U3HD 2B0SL 1IAOA 1N59B 3IRPX 3IDYB 4WUUD 3KYNB 3K2MC 1J0KA 2BY1A 3LS5H 2AXFB 5ID0B 3IJSA 2EIZB 5FK9B 2IPTL 4GQ9H 3IAPA 1MJ7L 4PJ7B 3KPQA 2XQYK 1MRCH 1V7MH 4U49A 3ZE1F 2ITDB 2JB6B 4EUPG 1GC1L 3FTGB 1QEWB 3OHXA 3STBA 4MQTB 1QHPA 2NY1D 3U46A 5DJZA 4KC3B 3GBML 3VDBA 4JGMA 1CGVA 2A74A 2OJEA 1BQHA 3HZMA 1KYOJ 1NCNA 3MBED 4MNQD 4XVTL 5CP7B 5DMJB 3MNVA 4RMRA 3GMQB 5GGVL 1BZ7A 3ARFC 4R3SB 4YC2B 4H0GA 1CVRA 3MNWB 3PWLB 3ARPA 5L6YH 5IFJB 2ATPA 1QLFA 3D3VE 3WIHH 4I48A 4F7MB 3G5YA 4MA8L 3OZ9H 3U7AA 3KPRB 1DQDL 1S7RA 2R23B 4F9LC 4F7PB 4NQEE 4LGPB 5I71B 1BM3L 3O4LB 4LRIC 5GS2D 5D2LA 4JO1L 1E6JH 3DSNA 4YHLL 4DEPB 3TJEH 5I73C 3FAXA 3N9GH 2I9LA 4GH7B 2ICWI 5EOQL 4QRPD 3FKUS 3GM0A 5D93C 5KVDL 3UC0H 1BVKA 5C6PB 3WD5L 3R06A 1UVQA 5TQ2H 3O6KH 5I8KL 3BWAA 1I85A 1AD0A 1CIDA 1ZVSA 1YYMH 3LD8B 4PY8J 1SQ2N 3C2AH 1TMCA 4WUKH 3ROLA 2YD3A 5MERA 3NCMA 3VGDA 3C09B 4WFHE 5T1KA 5ILTH 4PJAB 3L95B 3RWDA 5LAXA 1DQLL 1GZQB 3P30L 4N5ED 1KELL 1ZTXH 1WCBA 4V1DE 1RZFH 2PNDA 5AUMA 4ZO8A 1NAKH 1MI5E 3HE6D 4I3RH 4RAUA 3PQYB 5HYQB 3IDGB 4UINL 2F53E 3MR9A 5IVOA 1FYTE 1IGCL 2FB4H 2CJUH 4XWGL 1ITBB 4IS6B 1JV5A 5ITFB 4X6CF 2EECA 1VFUA 4Y4HD 5GRJH 1T5XB 4MLIA 1I1AD 4N1EA 4R97C 1WZ1H 4P5MA 1OAKL 4HUUA 3OKYA 4KVCH 3T0ED 4PGCA 4CVXA 4NOBA 2H45A 4AG4H 5IBUG 1GHFH 2XY2A 1I85C 2EDNA 2F74A 4IRZH 3O4OC 2NTFA 4YPJA 2FJFA 2ATKA 3F6LA 4LCWE 2QL1A 4X9HA 5EN2B 1BJ1J 3PNWB 5IHZA 4G6MH 5I30L 5A1AA 4TSCH 3NN8B 1MH5A 5J6HB 4JZOA 5F7YC 2X7LB 3H9YA 3QDJE 3IXAB 3MGTB 5GQBA 1SJEA 2OI9B 4U6YA 3BP6B 2WBJD 5FDWA 1T0MA 1D6EB 1ZXQA 32C2B 3EOAB 2LU4A 4KJYB 3QIUA 2NW3B 3BI9X 4ZNCD 1NCDH 3L3KB 4E41D 3BGFB 2R56H 5FM8A 3V6OA 4X5LA 3SE8L 3WN5A 5HVFB 5GGVY 3GJFH 4WW2B 4BZ1L 4OKVB 4KZDL 3MV9B 1T20B 4YFDB 4ALAH 2Z31B 2MWCA 1YY9D 2MCPH 4R8WH 4YLQT 5MHSE 1X5FA 1IGYA 2ED8A 4JO2H 3SO3C 3CSYB 4YE4L 5I6XB 1VA9A 4O02H 2R9HC 4Y2DD 3ZYJA 2A1WL 4MHHG 4YR6A 4NC1E 3VJ6B 3LN5A 4M8QA 3I6GB 4Y4KD 4KDTA 2AEPL 5DEFB 3U2SA 5JO5B 1HI6B 1AGFA 4WO4A 4Z7QE 4UV4L 5C0BA 4UBDD 1TVBA 1DBBL 3UYRH 4PJHF 2GJ6E 5F7NC 4R4ND 2VLKA 3R0NA 3T04D 5C7XH 1CL7I 3MODH 3MUJA 3HTLX 4Z7NF 3QUYA 3DHJA 3FRUB 4LSTL 1KPRB 3QIUC 1ED3B 1KUMA 3CMOH 2EDDA 1LHZA 4QNPE 4PJ7E 1TJGH 3I2CL 1T0NA 5CEYB 2FH8A 3GIVA 1GAFH 3U9PH 3MCKB 2V7HB 2FJGB 4LSVL 5F3HA 2YR3A 2BZDA 2DQUL 1MIEL 3U6RA 1SMAA 1WFOA 1E6OH 2XWTA 1S9VA 1FV1A 5SX5K 5CJOL 4NQTA 1WJ3A 4EN3B 4F57L 4FQIL 4XCYA 4CDGC 3MJ8B 4JCLA 4K2UL 2I26N 2DQJL 1EEZB 1IAOB 4MAUH 4KDTC 3WNKA 3KPRE 4TNVF 1DSFH 3IJSB 4JFOB 3C2SA 3O4LE 4LKCA 3U7WH 1NFDF 5KTEL 2HFEA 1NJ9A 5FM4A 5DD0H 5DGRA 4NQVA 2VH5L 1I9JL 1J1XL 5F6IC 3B9AA 5DJZB 1B0GB 3RIFF 3FQXA 4D0DB 3TLRA 5C0IA 3DLQR 2EDYA 5DHVA 3LPGA 3VFVA 3VRJA 4XCCL 1RQ5A 5H94A 3W39A 2WP3O 3CFDB 4PGEA 1G6RB 4G8GA 2X89D 1RI8A 5FYKD 4K8RC 3G5YB 4LSPH 1ZLUH 2YC1A 5IT2H 4QHUA 5EG6C 2GQHA 4Z76A 5E94A 3QPXL 5KSBB 1U41A 5D2LB 3VFUA 4PJAE 4JFZH 4P5TA 2VDQH 1IFHL 4PV8B 2I9LB 5E6ZA 3CLFL 1LILA 3PQYE 1JN6B 3QSKB 4OLXH 1AO7D 1XR8B 3ESUF 4WU7B 1FNHA 2OL3A 1QTYT 4PJ9C 2L0DA 3PJSA 1J12A 2NXZB 4TULH 2Z8VC 1R5WB 3EYVB 1AD0B 3RZCA 3S36X 5CUSH 3I84A 2EDTA 2X4TB 2HJKB 1B4JL 5C0JB 3ROLB 2W0FA 1U8HA 3BT2H 5MERB 3BO8B 3ZT6A 4OF8A 5SV4A 1OAYL 4KVNH 1YN6A 3RRQA 2Z91A 2WBKA 1VDGA 4FZ8L 4J3WA 2J6EL 5DDHA 2ARJQ 5T33H 1WCBB 4G9FE 5ITBL 4K71C 1A6AA 4D0CB 3LPWA 1J1PH 3MR9B 4PJFE 4HWBA 3O2VH 3SKJH 4YEEA 2NY7L 4ZNEA 4JFDB 1ORQA 4I3SH 1F4YL 4Q9QH 4DFHA 4LLWB 3MFGB 1RY7B 3BPLC 1HXMB 1CG9A 2VLLA 1DQJB 1T2XA 2KPNA 4RZCA 4APQA 2YWZA 3VFOB 1GPOH 5FKAB 4XTRD 2C3VB 1A6VH 5IB1A 4K55A 1OP9A 5K9QI 1Q0YH 5TPWL 4QHMA 3S36L 4R4FH 5DMYA 1DDHB 1OHQA 2F74B 2P5EA 1I4FB 3RZCC 5L2JA 2FX9L 3LS4L 2PTTB 3TCLB 4XPFH 3Q5TA 4WY7L 2P46B 3ARBB 4L3EE 4MD4A 1KT2B 3L3HA 1UZ6F 1FE8H 3ARTA 2YD9A 3MREB 4J3VA 4KMLB 4LSRL 2OX5A 3SOBL 4KHXH 3HI5L 1NCWH 2ITCB 4XAKE 4FFZH 5K59E 4YFLI 1NGXA 5HYSB 4NRYA 4OD3L 4TUKL 1DANU 4Z7UB 4Y5YB 1A21A 1FH5L 3QWRA 3C5JA 3G5XB 4XPBH 4YEFA 4I0PB 3K2UL 5HGDA 3SCMB 5DUBA 5BXFA 5E9DD 3THML 3NAAL 3WS3A 1JHTA 5JPNA 4APQC 1OTSC 2EDFA 4O9HH 1NGQH 4HXAL 5T3ZL 4OIAA 2WUBH 4P46C 4GKNB 3LSOA 5HBBA 4OZHB 2UYLA 2HVKA 5B38G 3LH2H 4POYA 1NANH 5MEOB 4XP6L 1CXKA 1CN4A 5E6IC 4YR6B 3VI4F 4WWKA 3IU3A 4PRIE 3GMLA 2J5LB 4KJWC 4PJ9D 3G6JB 4P9MH 5D72H 1EEYB 1EFXA 3V52L 4PB9L 4UQ2B 1YA5A 5I1KL 4FXGB 3HNTH 5EBLB 3BVNB 4WHYG 4HX1A 2VLKB 3TZVD 1NCBL 3CFCL 2Q8AH 3CFJA 3QI9D 4IIQA 3PWJB 5B3NA 3BE1L 2X2YA 1HSAA 5ICXA 1FL3A 2JJTC 4F2MB 2XI9A 1U8QB 1IQDA 2MOVA 3Q1SL 1MREH 2FJHA 5SWSA 2IG2H 2R2CA 2DS4A 4XP9H 3RGVC 5D7JD 1QG3A 5EUOB 1SJXA 4U0RB 4YDKL 4BH8A 4WFGD 5BZDA 4IMLA 2VXUL 3MRCA 4WHCA 4Z8FH 4AQOA 3ZZ1A 1A7OL 1DQQB 1JJUA 2B1AL 4WWKC 5I1CL 4Q97A 1IBGL 3FQUB 1GOFA 4U3CA 2FL5B 1XIWD 3SGKC 1A7PH 3T0AA 5CZVL 1SBSL 5INDA 4G7VH 1RPQA 5DLMH 5KSBE 5I16A 4PJGB 1CQYA 2HFEB 1NJ9B 2VL4A 3VRIA 1INEH 3VFPB 2W1NA 1G9MH 4IIQC 1T22B 4X7DC 1MCWW 4MGXA 1NAMB 2XPGA 3VRJB 1AXTH 2JJWA 4F7CA 3NIFE 3U36B 1EX0A 3UEZA 1CWVA 1LD9B 1P6FA 4G8GB 2Y36H 1FCGA 4CW1B 1FZKA 1ND0A 5C08E 4Z77B 4AQ1B 4F7EA 2W92A 1J8HA 3GSNA 3FFCD 3VFUB 3PGCA 4U1NA 5C07A 4E42A 5D6CA 1U8OB 4GMTL 2YXFA 4P5TB 2PCPA 5GZOC 5JDSB 2EXYC 1SM3L 5ISZA 2Q6WB 5CKGA 1DQTA 4X6FA 3AAZA 4OFIA 3QCTL 3QULA 3AB0B 4ZAKA 3C6LA 4LGRB 4P46D 4Y1AD 4AIZB 4XB7A 4M3JA 2E27H 3PJSB 1MEXL 4ZS7L 2DWEA 4JFDE 4PDCE 4U33A 1S7QB 3DI3B 2WUCL 4JJ5B 4K23H 4M7JL 5I8EA 3L3GB 5E00A 4AY0A 2VE6B 3QBTB 4MQSB 4R26L 2LU3A 4HIEB 3VGHA 1T5WB 2W0FB 5GGQH 1U8HB 3WIIL 3M07A 3PDOA 1W0VA 3D2UD 1F6FB 1FNGA 4K3GA 3VXSA 4DAGH 1I9RL 3H9HA 5CIPH 1LNUA 4QXTA 2VB5A 2HN7A 1CR9L 4CBPA 3H9SD 3CC5A 3ISWA 1EAJA 3PP4H 3ARDD 1W8NA 3MJ9H 4PRHB 4P9HC 3M1BB 6FABH 4HGWA 5D7IA 1PQZB 5E8PA 5E99L 2CUHA 1VHPA 4H8WC 4ELMB 1CG9B 4G7YL 4OLWL 3KS0J 4OAWB 4PGDB 4PJ8B 1F8TL 4ORZC 3PP3K 2NY6D 4ZAKC 3C6LC 2BNUB 4LSSH 5CINH 3ARZA 5ETUA 4J12A 2JE8A 4Z7UE 5CLTA 1H3XA 4FQQA 3OG4B 1MF2H 4LSDA 4X8JB 4CVZB 4CKVX 2NY5H 4PJDE 1BGXH 4NC0B 3GFUA 4L4TB 3PV6A 3QUXD 3C08H 5IVZA 5KVFH 43CAB 3RA7L 1A7NH 1VFAA 3L1OL 5ESVB 2XOTA 3V5DB 2YK1H 1FVDA 5HY9A 4OZHE 5IB3A 1EHLH 1H0DB 2D7QA 5ADPL 3QWQB 3S96B 3QXUA 3RHWF 4EDXB 3FFDB 1P7QA 5BQ7B 3OJDB 2PN5A 3WJLA 3G6JE 3TF7A 5ANMB 3MNZA 4HKJB 4LCIH 5CD5D 1K4CB 2AS5M 2A38A 3GK8H 3G6DL 2YBRA 5JPMA 2EC9U 3U0TB 4W6WB 3T8XB 1NCAL 3GZKA 1N5YH 1CU4L 5DUBB 5BXFB 3MRGA 1MCRA 2R4SH 1LO5A 2C4FT 3WS3B 3NVQA 1RURH 1CL7L 1MRFL 4GKZB 1CZ8H 1YEGH 4YNYB 3K8MA 3W11D 1NC2D 3STLA 4TPRH 2GIYA 5GZOD 4BA8A 4GBXA 5I18H 3WFEH 4ZDHA 4G3YL 2AJVH 1JUFB 5EUOE 1R3JB 4CN1A 5FUCE 3QUMB 3IDIB 3LEXA 1KSRA 1JZ6A 1EFXB 1PLGH 1Q38A 2E7BA 1X44A 4A6YB 3QDGA 5J56B 1OW0A 3RKPA 5JW3H 4HFUL 1DE4A 1MI5A 2V7NA 3WNPA 5JTWA 3O41A 1BMGA 1FYTA 3VFNB 4XCFH 3VWKA 5I1HL 3TF7C 2H2PC 1ZGLB 3GIZH 4RISL 2J4WH 2WINA 5FHBH 3K4DA 5BRZB 2WMPA 4PJGE 1H3GA 2HJFA 4XMKH 4L4VA 5EZJB 3BPCA 1BD2E 4E5XB 1XF2B 1KEGL 5JUEH 1OD9A 4M1CD 2JB5L 1S7VB 5I1LA 2FHBA 2XFXB 4FTVB 1GZPA 5KS9F 1GGUA 1XGRA 3X13B 1IC7L 3HB3D 4RAVB 3SHSA 1MHCA 4LCWA 4YIQA 4YAQB 2J8UB 4ZSOA 4ZUUB 1KBGL 2VWEC 1T7XA 1X3DA 4YHKH 3OKKB 4OIBA 3DARA 4N8CH 2YPLB 2P7TB 4LNVA 1DBJH 4KQ4L 1OW0C 3GI8H 2PETA 1SY6L 2J8HA 4X6CA 4OGAC 4ZQKA 2FCBA 1N2RA 3LIZL 1V05A 4XPTH 1KC5H 1J1OH 4OCLC 3VGGA 3RX5A 5D1ZB 3VWKC 3NFNB 2NW2A 5HXMA 5D7LB 4HMEA 2XZAH 2VXQH 3MV8B 2GT9B 3BKMH 1FO0L 1FDLH 4LARH 1PKQA 3STZB 4MDIA 1JNNL 3V8CA 3VD9A 2F19L 5IQ7H 2FX7L 2WLZA 3FOMA 1BLNA 3AMLA 4JM4L 2BXYA 4U7KA 1MRDL 1PY4A 1V5JA 2BY2A 2AJZA 1WAAA 1BBDH 4Z0XA 1J8HB 1RUPL 5E08H 3JXAA 1A14H 5JW4R 3FN0L 2FYYA 4DKFL 4YDLB 3BXNA 1D5XA 2DMCA 5DRXA 5D7SH 5DZOA 3JV4B 2DM4A 5F96L 4X6FB 5DUML 1NLDH 4G6KL 4PGZA 4XVUC 4JPKL 2DQCH 1T1WB 4PRHE 4R6UA 3I6KA 1LO4L 5GRUL 4NZJA 2IQ9L 5CGMA 1M7IA 3Q3GB 3ERYA 5JXAL 4ELME 1IGJA 1JGVH 4UT7H 1AI1L 4HUVB 3H0TB 4IOSD 4UNVA 1YC7A 5HI3C 4XBGB 2Y72A 2R2HB 3D3VD 1T0PB 1EPFA 4M6ML 2UZIL 4J23A 5J13C 1UACL 5ESQB 3BOVA 1LNUB 1AHWA 4JM2B 3WJJA 4MD0B 3WXVL 3T77B 3L5HA 4YBQC 1IAII 1X7QA 3HPJA 1DLHA 4L4TE 2AJSL 2H2PD 3QZWB 5J11C 5DJ2B 3TT1L 2D2OA 1CE1L 2YWYA 1CXFA 1IQWL 1HZHH 5B21A 3WNMA 3SPVA 4NC1C 5DQ9A 1D6VH 1S5HB 2VIRA 2NX5D 1ZSDB 2VUOA 3I9GH 2R8SL 4HCRH 3CZJA 5HHPB 3WO4B 3DSFH 2DQGL 3UZVB 1BHGA 1X5XA 4MXWH 4QTIH 5ANME 3V5KB 1C5DA 2BSTB 5HVHC 4WFEE 4OZIB 4GRWH 4JKPL 1KJ3L 2E7CA 1Y0LB 3K80A 1I9EA 4WFHD 5I15L 2HT3D 3MYZA 2FR4A 4PJIA 1G7JA 3EHBC 1VFAB 1J87A 4QWWC 5D8JH 3PF2A 3GNML 4V1DD 1JFMA 1W72H 2EDEA 2DI9A 1RHFA 4DGYH 4KV5E 5BMFL 5AYUL 2F53D 1EV2E 5CSGA 3ZDXF 4JPWL 3VI3E 3U9UB 4R90L 1NL0L 5F70A 3B9DA 2JK5A 2ICCA 1FPTH 3W0WB 3RDTD 4AENB 4ZXBB 4K7PX 1CD1A 4LIQH 3UYOD 1L9NA 2YBRB 5L8JB 1NFDA 1S78D 4XNYH 4N8PA 1NLBL 4IRSB 4KUZH 2VQUA 3QCUH 5I1DA 2EDJA 2EO1A 3EIFA 4HH9A 1W2KT 3OR6B 1ZHBB 1JGDA 1QQDB 4O2EB 3QRGL 4JY6A 5HYEA 1AIFA 5IB4A 3RNQA 5BRZE 1CFTA 1G7HB 5LQBL 4JANB 2B4CC 3GO1L 2ZOKB 4HS6A 2VZOA 1BX2B 2XZCL 5IP4A 4ZDHB 1T6WA 4YUEH 4XVUD 3MLRH 1KLUA 1U92A 3A0OA 3DYOA 3BP7B 3KPTA 5FOJA 4XNUL 5KSAC 4LPYA 1BIIB 2DLIA 4JPVL 5ALCL 3QDJD 1ES0A 4NZTL 5C0CD 4GS7B 1IL1B 1AY1L 5DJYA 4QYOA 3UTZA 3V4PH 4JHBA 3ZMRA 2EH8L 4L9LB 2BHUA 4NYLA 5SX4I 3ARED 5H8DA 5KJRL 2J8UE 4PJFA 1SYVA 4K7PL 3BQUA 4RCAA 3H7BB 4EI6A 2YPLE 5DD3L 1F58H 3FO0H 5KSVA 2QQNH 3QQ4B 2HJFB 4GAYA 4L1DA 4ZUVB 4L4VB 3BPCB 1QR1B 5AEAA 1ZV5A 1EO8L 1CDJA 2MQ3A 3GJFA 3MMEB 4FG6C 3PP3H 4JFFB 3S88H 4U2YA 3W81A 1MCHA 1NBVL 1REIA 1IGTB 2VDNH 4H8WL 4KJPD 3MV8E 3JTSA 4U1MB 1JRHH 3FO9B 1T2QL 2W07A 5IFHL 2ZCKH 4PRPD 4XBPB 3E1F1 3LN4A 3VWJB 4HPYH 1DP0A 4QOKD 5IFAH 1J0YA 3JUZA 3MLZL 4ZSOB 2GJ6D 4RQQB 3VXUA 4FQXA 1X6NA 3C60D 3E6HB 3HS0A 3GSWA 2Y6SC 4UT9H 5C0AA 3BZEA 3RWHB 3HZYB 2DBLL 5JOFA 3CVHA 3TA3A 1KCLA 1MHHA 5F9WC 1SJHA 3F58H 3MJGX 4I3GA 1AGBA 4TVPD 1JK8A 5E2VL 4HUNB 5GS0H 2QKIA 3OR7A 5EU3B 1X5GA 1F3DH 2OI9C 1I7TA 4HUMB 1PKQB 5CJQH 4GRWF 3RVTC 3QEUB 1XF4A 3KPOB 5J7CC 1FIEA 3FOMB 2LU7A 2W65A 4DCQA 3O3UN 4OV5B 1EBAA 2A77L 4IMKA 1F3RB 1GOHA 2NY3B 1Z0MA 1TENA 4OFDA 4PG9A 2IPKA 4ONHA 2VDKH 2FYYB 3UP1A 5EZOL 4KAQL 1KTDB 3BEVB 3KPRD 1E4XI 5F1OB 3SDDC 2XIDA 3O4LD 4IOFD 1Q8MA 1FFNB 4KK8C 3WE6B 2MPAL 3Q48A 3QHTC 4M61A 3HHRB 1VGEL 4FQXC 2A73A 3NFSL 1HHIB 1TITA 2CKBL 2NXYB 3KDMB 4PLJC 4OLZL 3IDMA 1AR1C 2WY3A 4KI5F 5BOZG 5AWNH 3MROA 2FEDD 4QRRB 2MQCA 3QP3A 4GW5A 3BZFB 4MXQA 2IH3A 3HCVA 4ZUSA 5FDYA 2VISA 8FABB 5L8LB 2FO4B 1CICB 2UWEF 4FQ2H 4MA3A 4M4RA 2JCCF 3SGEH 1HH6B 1IZJA 1RHHA 4IMKC 3KHQA 1U2CA 2ZNXA 3UTSA 3B4NA 1OQOA 2JELH 1P5UA 4OCYH 5JHDE 4WCYL 1UM6L 3PQYD 4AH2A 2ORBL 4PJHB 2RJMA 1I8MB 1IEBB 3T3PE 5GZNC 4JE4B 3B5GA 5B4MD 3SKMA 4M5ZH 4XPHH 1N26A 1WFNA 3W0WE 1PVHA 1YEJL 4XNZC 3DXAB 4U6VL 1C5DB 2R2BA 5EU6B 3MRIA 4WGWB 1OTTC 1K6QH 2P42B 4OLVH 1X5LA 2BK8A 4Q9RH 3ZE1E 1Q9WB 4KI1A 1NCCL 3VG9C 1YPZF 1QACA 3MXWL 1CQKA 1A4KB 3REVA 1G7JB 4Q9CA 5HPOA 4RMUA 1A47A 3MOBH 5ID1B 2QQLH 4C56A 4F58L 1LGVA 3EDJA 4LEXH 5F72S 1WC7B 3KPMA 1EMTH 3EFFA 3SJVB 3VFRA 1HSBA 1R3IL 4F9PC 1KENL 1MCWM 3IKCA 3TN0C 2UZXB 3TO2B 1HILA 1CD1B 2ZJSH 4GJTB 5MENB 1XT5A 2E9IA 4KY1H 4U1IA 2EEBA 3QXVA 4UIKH 3TO4B 4JPIB 2C9AA 1IGFH 3S98A 5B39B 1R5VA 1N6QH 4KH2A 4KTDH 4RIRA 4F3FB 2W0KA 2EDKA 2QQQA 3BIKA 1VADB 5IB4B 4NN5C 3RNQB 4NQXA 3O3BB 2Z8SA 2ADIA 3L3IA 3MV9D 4KKLD 2Y1VA 3D0LB 3QH3A 2Z31D 5F71A 1FAIH 2GK0A 5JXED 5TH2A 2R2EA 1UT9A 3RI5F 4I2XA 3ALXA 4L8DA 3FL7A 1U8KA 3RWJB 5DEGB 1YJDH 3MOAL 4K7FA 1CFVH 2WNGA 4XAKD 2DD8L 3RY6A 1RZ7H 4UMGA 2CXGA 4JRXA 4ELKB 3KNBB 4G5ZH 3DX6B 1JZ5A 5HHMB 1PZUB 1RMFL 1MFAH 4GLRH 5DR5H 1SEBA 3BQUB 3E0GA 4LLUA 1JFQL 1AP2A 4EI6B 3RP1A 4JDVB 3DVNB 5B22A 3INUH 1NGZA 2E7MA 3EGSB 3KXFB 4L9DA 1NEZA 2A6DB 1TZHA 4X0KA 4NDMA 5IMLA 2ARWA 2X9XA 3UJIL 1MVUA 4QRUA 1EUUA 3W82A 5M7QA 3DPBA 4PG2C 4ZTOL 3IETB 1UB5B 3GJFB 2GITB 3N85L 3VFMB 4DZ8A 1A1OA 5F89B 1MAML 1F4HA 5BV7C 3C87A 3OAYK 5I8OL 4ENED 2XKNB 3UJJL 4PJDA 1JPST 1RULL 4X7CC 1QO3B 1A6WL 3D25A 4FFVC 3MO1B 2BSRA 1EGJL 4EN3D 5EIIA 3MSPA 1LO0L 3RY6C 3HS0B 5T1MB 3HZVA 2I60L 3D39B 2CO7B 1Q9OB 1CGXA 5JOFB 4X80L 5CKAA 4XAWH 3TA3B 3ORJA 1BOYA 1UWGH 1IEAB 2VLRA 2VN4A 1Z0NA 2YMXH 1WQVT 1FNSL 1AGBB 4D9QE 4XH2B 3MCG1 5BOPA 4KRMB 1P53A 2ADFL 4PLOB 1EAPB 3GSVB 4ZUWA 1A1NA 2V2XA 2BMKA 4P2RE 4XXDA 4PP1C 5FA3A 1YNKL 3D48R 4O5LH 4N9OB 4G6FB 3O2DL 2XNAB 4AEIH 1C16A 3SDAA 4Y5YC 3VCLB 1T7WA 3OPZH 1YNTB 4M6NL 4S1DC 2PXYA 5AD0A 4HHAA 2OXHA 3R0MA 3U30C 3IGAB 4ZO6A 2AJXH 1LK3H 1R3LA 4WU5A 2B4CL 2RCSL 2IFGA 3T65B 3HC4L 5T1DH 1MUJB 1IAIL 4KKBD 3S35X 1TETH 2A73B 5INCB 1MPAL 1VESA 5F7EH 1F11B 4UTBH 3EOTL 4OTXH 4PJHE 3WFBH 1YEFL 5I74B 1GGCH 2HKFL 4OZGF 2DMBA 2NXZD 1OVZA 3CAFA 4Z7NE 1MJUH 2FHCA 1S3KH 2CQVA 4MCYB 3EYFA 4WDIA 2DQHL 4NJAH 4BSWB 3ARGA 1QKZL 1BFOA 5GGSA 1I8LA 1OF2B 1WV7T 2XTJC 1T04B 4MA3B 5I8CA 2Q8BL 1QFHA 3VH8B 4U6XA 4JQVA 4DGVL 1EXUA 1RIHL 5I17B 1FIGH 2LFGA 3SDAC 5I76B 4MMZC 1ZHKA 1GIGH 5IG7B 3NIGF 4JRYB 4XVJL 4X9GA 4YXHH 2DYPA 3JTCA 2OTUA 2WK2A 5F9DC 1JNLH 1P2CB 1CDHA 3DRTB 3SJVE 3ZE0F 2BVQA 4JFDD 2F8OA 3S35L 3WDIA 4ONOA 4JFQB 4BUGA 2VN7A 1KN4L 5KVEL 4RMQA 4YHML 3H9ZA 4I5BB 5HYJB 3SDYH 3B2UC 3VXOB 5TQ0H 5J1AB 1TTGA 2Y4SA 1ZA6B 4NZRH 1GGIH 2O5XH 2R4RH 5TDOA 3ARGC 1BF2A 4HBCL 3RVUC 1KOAA 4AIXA 4NN7B 1I8LC 4Y4FA 5CIPA 4JAMA 1X4YA 4C56B 3ARBD 1OP3H 5L8KB 1E4KA 3HC0A 4JQVC 5KG9B 3TBVB 2OS7A 3EFFB 3VFRB 4Y19E 4GKOA 3MJ9A 4HXBH 4CL7A 4R4BB 1N64L 3ZHKA 3B3IA 1HOCA 3OBAA 2D31B 3UPAA 3QUKA 4L8SA 3TM6A 5F7UA 4I13B 4N0CC 3S8WA 3CH1A 1XF5A 4GO6B 4N0UB 2DQTH 4NUJA 4W4OC 5HHME 1ODAA 1VKXA 2RAMA 4MJ4A 1BFVH 1J88A 1K8DB 2DM3A 3RWIA 4OF0A 4NQCB 4WEMB 4WHTB 1R5VB 2A6IA 5DJAA 1KCUL 4XNQA 1H3PL 3D9AL 4I0PD 3NCYP 5ACZA 5FEBA 3KXFE 3SCMD 4S2SA 2PUQT 4NQXB 2ADIB 3L3IB 3H3PL 3KJ4C 3F8UB 1EJ6A 2OP4L 5H2BB 1JGEB 3Q5OA 4PR5A 4YDVA 5TH2B 3IAGC 4M1GL 2EDOA 3RPIB 2CK2A 5C0GB 1DBAL 2Q7YA 3AGVA 3UTQB 4U1KB 3OXSA 1CE6B 2IGFH 1TNNA 4Y4FC 3ZKSD 5EC2B 4H1LH 4JRXB 2YD2A 1AXSB 5FUZL 3U48A 4WO4D 1G0YR 1FFPB 1QLRA 5D71H 5EIQA 3T4YB 3FCTA 2VLKD 5ERWB 5DQJA 3A6BH 5BO1H 3GUTA 5CMAA 4L8SC 1R5IA 3S3PA 3BGAA 4LVNB 1MQ8A 3LN9A 4U4BA 3ZDZE 2XTLA 1RU9H 5LWYL 3MV7B 4HPOL 3TYGH 4BZYA 3AU1B 1LP9E 1B0RA 5ESAA 4LDEB 4HG4K 3PHOA 2XQYG 1RV6X 1HKLL 2VDOL 3HNSH 2IPTH 2LTQB 4HIJB 1Q94A 1BFTA 2APTA 1U8NB 4LEOB 3BKJL 4D3CH 2FNBA 4PJ8C 4UUJB 1GC1H 4MA1C 5E5MA 4KKAC 3ZKXB 1MJJA 4X6BA 3D25B 5CJXA 3GBMH 2DJUA 5CSZB 2EC9T 1HNGA 1UCTA 2VERN 4HC1L 3P9WB 4P2OA 4BYHA 2G9HB 1N7ML 2BC4B 2X4NA 3TPUB 4WJ5B 4G59A 2UY7A 1UYWL 3MLWH 5GGVH 1UZ6E 4X9FA 5TF1L 1UGNA 2UZYB 3MGAA 4M7LT 2R1YA 3DHMA 4PBWD 4M9PA 4AJ0A 4MA8H 3OKMA 3W5NA 1DQDH 4J3OC 3HMXL 3EJZD 5HYSG 4ETYA 1A9EA 2B2XL 4PP2B 1BM3H 1OWRM 4JO1H 2ICEA 5E4EB 3SDXF 4D94A 2MHAB 3MFFA 3LQAL 3RWCB 1OSPL 5FYLE 5J57B 3RWFB 5FA3B 3W9EA 1F4WL 1EHXA 3QISA 5EOQH 3O9WB 3BZ4A 1G6RL 3B9KA 1NUNB 5BVJB 4D9LL 4G8GD 1EJOL 3RUGA 3GGWA 3NGBB 2PXYB 1R3KA 2BOBA 1CXIA 2DOCA 3VGEA 4X7EC 5CJXC 1G0XA 1HHGA 3GJEA 2OTPA 4P5TD 1WLHA 1CDGA 4HJJL 1YQVL 4ZFFB 3OAUL 1AD9A 1DUYA 1XCQB 3QIWA 3PL6A 1DQLH 1KLFA 4YZFF 5F7LB 5HTSA 3ZE2F 4X7TB 4KROC 1KELH 1JCKA 4CJ1A 3LOWA 3UYPA 2AXJA 1XGTB 1QFWI 3EYQC 5JHLL 1FN4B 3FB7A 4AT6A 4TYUA 2VQ1A 4JRWA 5DVOA 2KZ1B 1E28A 3REWA 1KJVB 5E8NB 1DUZA 3J7HA 4JQXC 3BKCL 1ZGLM 1GH7A 2X4QB 1EXUB 3LKSA 2DLFL 4ODXB 4RX4D 4FFWC 4GW4B 4GMSH 1KIPA 1OAKH 2P5WA 3S97C 2IALB 4JN2A 1WBYA 4LPWA 2UVEA 4HFWA 1JNHA 4NFCA 2OTUB 4XI5C 3GB7A 3TNNB 1NKOA 5CLWA 4L3CA 4PRHD 3DV6B 3MYJA 4DKDC 1RZ8A 5BV7L 4Z7OF 1OT1A 4FQPA 4PJBF 4H0HB 2FDBP 1HCFX 1MLCB 3L7FA 3IF1B 4NFDA 2IBZX 5B3JF 5D2NA 3BUYA 4PJ8D 4OIIL 1I1FA 1XH3A 4LLDA 3CX2A 3S4SA 4Y8DC 3QIWC 3PL6C 4IEFB 1QRNB 1ACYH 4LLMA 5CEZE 4ORGA 1YMHA 1KACB 4PV9B 1LO3H 1L0QA 1UH2A 1D5ZB 3QIBB 2QSTA 1CLOL 5LBSL 1U58A 4DN4L 4IOIB 1SMOA 4YGAB 4EIGB 4L4TD 5CIPB 4JAMB 5AAWA 2YUVA 2O5YL 3P2TA 1TLKA 3MUGA 5KS9B 1L7TL 3SE8H 3HC0B 1Y18B 1EA9C 1IGMH 4O2CA 3DMMA 3RJQB 4BZ1H 2Z92A 5DRNB 4KZDH 2R0KL 3SBWC 3B3IB 4J3TA 1QFWM 4HKZB 4YE4H 4XPAH 3P0GB 3KPPA 3QUKB 4YGVB 3WEXA 3NZHL 2H26B 3TNMA 3HI1B 2A1WH 1JZ4A 3P0VH 4L5FH 3NIDF 3U0WL 1T1ZA 2OM5A 3EOYG 4HCRA 5J12B 3QWRD 4BZ2H 4OF3A 4WFED 1UQSA 3UAJD 4M8VA 2IH1A 5HHOB 3EYOA 5D2NC 3WUZA 4UV4H 4YDLC 1DBBH 4DUVA 5IF0B 2VC2L 4D0BB 3GSRA 1U8PB 1AGCB 5I19L 4OQTH 5DC4B 1RJZA 1XGQB 2GTZB 3LV3B 1K8IB 1KTLB 2RB8A 5ADOL 4RWHA 1RAMA 2PW1A 1G7QB 3X12A 3I2CH 1W72A 3OKNB 4FQ1H 4EEEA 1MFCL 1SVCP 2BDNL 4OCSL 1KJ2L 2VZ1A 3MRPA 1EFXD 5IHUL 5IB2A 3K4ZA 1QLRB 4G42A 5KAQG 1OP5H 2DQUH 3UJTL 1ZVYA 1MIEH 4N0RA 3TPUE 5GGRA 2XRAH 4YXLL 5GXBB 3T0WA 3ULUF 1R5IB 2AV7B 3GKZA 5CJOH 4F57H 1WIOA 4FQIH 1YC8A 4K2UH 2XQBL 1S7SA 4L3AA 5BRZD 3WS6A 4KRLB 4NBYB 4NHCL 4BH7A 4JQIH 2P24B 2FGWH 5FECA 4M7ZC 1MCLA 4MNQB 3DO3A 4C4KT 3JWOH 5F44A 1MCDA 5KTEH 3O45B 5JW5B 1OQXA 2VR9A 2QR0B 3OL2A 4LF3A 3CXDL 2GSGA 5FKPA 1I9JH 1J1XH 1P9MA 2E3VA 5CGYD 3WO4C 5F7HA 5F3BA 3DO7A 1VGKA 1J86A 4FTVD 1NGYB 3GSQB 1OPGL 4NO5B 4P23B 5DD5L 3RBGA 1KCVL 4M48H 2X4NB 1KIUA 5SWZB 3ZL4H 3N1FC 5I66A 5DK0A 2GCYA 3EUUA 5DEZA 5FB8A 3AXLA 5E2WH 2YPLD 2R1YB 1F97A 3VMPA 1Q9LA 4F8TA 1GVIA 2GFBB 4ZS6D 5GS2H 5C9KA 1HXYA 4Y88A 4G6AC 3QPXH 4H25A 2JKXA 3F7VB 1NAML 3Q6FA 2CMRL 3T2PA 3WCYA 5D1ZD 1RJCA 1UCBL 4TUJA 4NPYB 5D7LD 1IFHH 3GRWL 1UKTA 3CLFH 3MV8D 4LU5L 3WS6C 4ZXBC 2A9NL 1CBVL 5CHNA 2HT2D 3WUWB 4U1JA 1JYWA 3ULVD 1OAXL 3SDCB 1FNLA 1R3KB 3IS1X 3Q2CA 2R1XB 4M43L 1LEGA 1P9MC 4JO4L 3VXPB 1P4IH 5J1TC 3X11A 1TIUA 3FQWB 3MRNA 1J8HD 3VD4A 4F80A 5L2KB 1B4JH 1K4DB 4NRXB 4O51B 4P5KA 4RWYL 4M02A 2VOTA 1CT8A 1HYSC 1N8ZB 4Y0GA 4KK9C 5C6TL 2HFGH 3BX7C 1RD6A 2F54B 1KPVA 4FZ8H 4GAJH 4HULB 3E2HA 2J6EH 3BFOA 3FB5A 1IM9B 3BP4A 2D9QB 3PXJA 2CSPA 4XHQA 3PWUA 4C59B 4GS7C 5DSCA 3CFEA 2BNRE 5F7KC 1KN2L 4HGKC 5F6HI 2CDGB 4WRLA 1E28B 3VXRA 1HIML 2O5ZL 1F4YH 4RDQF 3CCHB 5C09B 2Z93B 4LLYB 1QRNE 2VZUA 1P84K 3EAKA 3F7QA 5KANI 1KIPB 3RBSA 3KPSB 1MFDL 1F6AA 4JN2B 4JM2D 2HTLD 1TQBB 1U3YA 3GI9L 2W9DH 5JOPD 1JNHB 3QHFL 3GB7B 5TPWH 5EO1A 1O5DT 4L3CB 1YDPB 4NNPH 2YD4A 5E2UL 5KS9E 3WNLA 4ZPVB 2FX9H 3ZT5A 1IM3A 4R0LA 3LS4H 4WY7H 1J8KA 4GOSA 1U8MB 4IRJA 4OLEA 3DX9B 1QR4A 3P73A 2BNQB 4NQDA 2J1KA 4LSRH 3B9VA 1I1FB 3S4SB 3VWJC 1LE5A 3SOBH 3E2HC 3N1PC 5FO8A 3KJ6H 4HUXB 3LKOB 1P1ZA 1RK0A 1HE7A 3U7YL 4HWEL 4OD3H 3QUZB 1MELA 4TUKH 5HHOE 2CXKA 5FGBA 5MEQA 2DKSA 5L7XL 4XRCB 2VLJB 1FH5H 3UTTB 1ZMYA 2X10A 4R7DA 2I5YL 5C0FA 1FL6B 3MUGB 3K2UH 4HZLB 2WWKT 3VU2A 3THMH 4YK4C 3DMMB 4JFEA 4EI5A 1BQLL 4XZUA 3U4BL 4MSWB 3ZTNL 3PWVA 4HXAH 5T3ZH 2V2WA 4NO2B 4X6EA 4TQEH 4P2QB 2A6JA 3JV6B 4OFYA 3MJ6A 3ZHLA 3EZ8A 4AL8L 3TNMB 3OWEA 2BCKA 5GGSY 2ICWJ 2QTEA 3CDGB 2Y5TA 4XP6H 1NGWB 1XR9B 2B1HL 1J0JA 2VAAB 2ZKHH 3W0WD 4OI8A 1KG0A 3P0YH 5E2TL 4ZXBD 5CD3B 3BJLA 2H8PB 2OMBA 4WUUE 1YEDA 3EOBA 1RZGA 3MV01 4IRJC 3V52H 4PB9H 5D9SB 4IRSD 3OGCB 3ULSB 1LE9B 2BVOB 1Z9LA 3CFCH 3UO1L 4N8VA 3QNZA 3BE1H 4GBXD 3VGAC 5EA0L 1MFBL 3ROOB 1OL0A 2J3SA 1G7IB 2EKSA 4MNQE 1A6TA 3SKOA 3BPOB 3ILQD 3Q1SH 4YDIH 3T08A 3P77A 1B88A 3QUML 1W72B 3QAZB 2HWZL 1AC0A 2AGJL 4UILH 2EICA 5CWSB 4A6YL 2KDGA 2X1PA 4AEHL 4EI5C 1Z5LA 1BFSA 1UB6A 4YDKH 4PRAB 5A3IC 1ETZB 2GY7B 4Y7MA 1RZKC 2FIKB 1FSKC 1CFNA 4X6DE 1CICC 4PIRF 5DWUH 5SWZE 2D7NA 2XYCA 3CDFA 4DOHB 2BY0A 3SO5A 1NPUA 2B1AH 5I1CH 2R1WA 1IBGH 4NQSB 4F33A 5DVLA 2MFNA 1UG9A 4QRPE 2VDML 4ZO9A 3QXDA 1TZIA 5I1JL 5CZVH 4U1GB 1SBSH 3CK0L 4L4VD 5DQDL 3OF6D 4DUXA 1WWWX 3GMNA 3NA9L 4QHKI 1NUGA 4WI4A 4JFFD 1IAMA 2LABA 1DEEA 5JIHA 2UWEB 3T1FA 1YY8A 1A5FL 2JCCB 5DMGC 3WL9B 2Q87A 3QFJB 4JG1L 7FABL 1NC4B 5I66B 4BK4A 3MA7A 3KPLA 3TT3L 2D7TH 3GSOA 3AXLB 1OB1A 4Y19A 5L2KE 4X98B 3ZDXE 4PRDB 4MZ2A 1TJIL 3IJHB 1JWSB 3F12B 4YO0A 1MWAL 4LOUC 1G7MA 3FB8A 4XXCC 3VA2C 3LRHA 4GMTH 5IW1A 3BGMB 1SM3H 1N3NA 1OGAB 3GMMB 5EOTB 3IDXH 4K3EL 4J3UA 4ZYKA 1E27B 3LEYL 2BFVH 1C8PA 1YPZB 4G8FA 3DURA 4LK4A 4U1JB 5F7MC 1DVFA 5AG8A 5CBEB 1QFWL 1MEXH 4ZS7H 5HI5D 2X4OA 3UXFA 2IADA 2XN9A 1S9YB 4NSKA 3TBTB 3CX5K 3TBYB 2WUCH 4M7JH 5BZWA 2C7UB 5CBAB 1F6LL 2NY3D 5CEXA 2H3NB 4HIIA 4R26H 4P5KB 4QO1A 1ZLWK 3IKKA 1ZAGA 4ODHL 3WIIH 1JPTL 3TESA 1MFEL 5EFIA 3NCJH 1RIUL 1N6VA 1I9RH 1KPVB 3RPKA 4D9QD 2ZCLL 2ENYA 4WHYH 4OJFL 4P57A 4EDWL 3T0DA 3TC9A 1QBBA 3PWUB 4H5SA 2BHYA 3OB0K 1IARB 2NXYD 1Y6NR 3MTRA 4XNMB 4GRMB 3RJDA 3QEHA 2YEZA 3VXRB 5E99H 5C0NC 4QRRD 4M00A 4KMTL 4G7YH 4ODSL 2EIBA 2HG5B 3LKQA 3JVGA 5I1IL 4X4ZA 1FG9C 1K3ZA 1ZHLA 1CICD 4JFXB 3ET9F 3QEQA 1IGIL 5MP6H 5C2BL 2R69L 2APXA 4HMCA 3O11B 1LEIB 1FZOA 1ZS8B 2A9ML 2H2SC 2NNAA 4KDWA 2J12B 2DQIL 3NPZB 5HHXH 1QNZL 1IM3B 1M7DA 1S7WA 1EVTC 1P84J 2DWDA 4OF5A 3RA7H 1U8LA 5MEPB 4Z6AT 1BF8A 1Z9SA 2DTML 1H15A 5AG9A 2HRLA 2VDLH 3MLYL 4P2QE 3K8LA 1OAUL 5D96C 3NH7L 1LE5B 3HUJA 5BW7A 3K1DA 5ADPH 4JFHD 2L7JA 5EO0B 2K1MA 4HAFA 3DXAD 3EW3B 3QR2A 5EBMB 5EU6D 5M94B 1JZ3A 1RK0B 4HAGA 2CLRA 4LGSB 2QEJA 4IM8A 3BSZL 3EO0A 3I02A 2D0GA 3DIFA 3DWTA 4NM8L 3NZ8A 1YEKL 4BQCA 3U0PB 1QSEB 4Z7VA 3WIFB 5T5FL 5GIRA 1QP1A 5JORB 5DYOA 4KUCF 1FAKT 1RJYB 4HWZA 1CIUA 3NCFB 1MRFH 3TFKA 3MZGB 2V2WB 5AZ2H 1EK3A 3KWWA 1PX4A 1ZLVK 2EE9A 4X99B 3SJVD 2QV2A 3CVIL 5BJTB 1DR9A 1QOKA 4G3YH 1N4XL 4L29A 1VFMA 2VLME 4QRQB 2GSIB 5F1NB 5MEND 3DUSB 4IHOA 4EVNB 1YEDB 4WNQB 2L4OA 5FM5O 1CLYL 3QO1A 3SY0A 5KANG 4URTB 4NJ9L 3TO4D 1PD6A 1X4ZA 1HH9A 4HFUH 4AEFA 3OXRA 4FHBD 3SDXA 4RMSA 5BW7C 4MNGE 3PGDA 1ZWIB 2AEQL 1NBZA 2HLFD 2V5RA 4N8VB 4LASL 1A02N 5I2IB 2EEDA 4KI5E 5I1HH 4RISH 2IAMA 3S3JA 3AS2A 3A6CL 1IKNA 4NZUL 1WZMA 1B3JA 5DTFB 5BS0B 1ONQB 1OGTB 1KEGH 5FYKE 1KB5A 4J4PC 4OLYL 3QFJE 1GGBH 3TFKC 2JB5H 3MRLA 1WUNT 1T3FB 5C0EA 5HHMD 3BHBB 1EO5A 1BBJA 2NY2B 3LZFL 5J3HD 3L3DB 4X9IA 3AFLA 3BQUD 4Y8AA 1IC7H 3IFPA 3BEWB 2AJUL 1UZ8B 2R1WB 3KXFD 2OL3H 3QDMA 1KBGH 1FNFA 4OZGB 2CLZA 3G6AA 4HD9A 4YXKL 3HI6L 3K3QA 1AO7E 3F5WA 4UTAL 4MWFB 3RY4A 2Q76B 4KQ4H 1J7VR 4OGXL 3LB6C 2DDQH 2O61A 3NTCH 2AXHA 3P9MB 1RK1A 2BERA 1YPZE 5F1KC 1CGSH 4LKXB 4OZFB 5C70A 3BYTA 1I7UB 3O8XA 1KULA 1TQCC 4LAQL 1IKNC 4K3JH 5MI0C 1HNFA 4H1LA 1JNNH 5D5MA 4KK6D 1D5BB 4QTHA 3EZJB 2HVJA 1IC5L 3BAEL 2ZSVB 1H3VA 2F19H 3BH8A 2ZUSA 2FX7H 3PXHA 3ZO0A 3D39D 3KLAA 3QCVL 1MRDH 1XCTA 5IMMB 2JTDA 5DHYA 2IC2A 1B0WA 1RUPH 2ERJB 2QLVB 3TA3D 1NBYA 3FN0H 3NCBB 4DKFH 4WTWA 4CMMA 1BQUA 3TVMA 5E5RB 5F96H 4G6KH 3WLBB 1J05B 4ODWB 4LHQB 1JPSL 2FBJH 5B39G 1DVFB 4PLKD 2CUMA 4R7NA 1LO4H 5GGRY 1M71B 4G6FD 5DFVD 4EXPX 2IADB 2BVPA 4XBEL 4YX2H 2XN9B 4X83A 3ILPB 1HHHA 1AI1H 2PO6B 1ZT4A 2YD5A 3ARDB 1A7RL 2XZZA 4LPXA 4DGIH 4BSVA 1JTPA 3O8XC 4KGJA 5EOCJ 4M6MH 1IVLA 1UACH 2AJ3A 2QADB 5J9PA 5ICZA 3PE9A 3OKDB 3WXVH 4GQ9L 3VGFA 2H9GB 5B8CA 4Y89A 1VPOL 3CX5J 2VDRH 4H5SB 4POZD 4JGUA 5CJBA 3O6ML 1JHKL 2GI7A 3F65A 3TT1H 4EBQL 2VXSL 1CE1H 3ZTJG 3DOSA 1EIBA 2YEZB 2XWBA 3HLAB 1KIQB 15C8H 1CXHA 1ORSA 2YOCA 1RZKL 4MXQD 4ZUTA 3LKQB 5J89A 4QHLA 3LHPL 1G1YA 5LKNA 1I1YA 2DQGH 5F7FA 4ZFOA 3CUPB 3WIHL 3W9DB 3QEQB 3CPLB 3FRPG 4U7SA 4RBPH 1YN7B 1QSEE 3SEPA 1YYLL 2ARJA 2BX5A 1QVOA 1YMMB 1GC1C 2CDFA 4MJIA 4JRYD 1URLA 4XWOC 4Y5XA 1KJ3H 1M7DB 5I15H 3FMGH 3TBSA 4BKLA 5EBWA 4Y16C 3VFWB 4MVBA 4A2MA 5D6DA 1KXTB 5IMOB 5GSRA 4YHYC 4UZGA 4JREC 4JY5L 2DM2A 5BMFH 1AQDA 3TEUA 3IXTA 2NY4C 3O6KL 3P4MB 4JPWH 5B8CC 3UPRB 4JEGB 4R90H 1NL0H 4BSJA 4HK3J 1H3UA 3EO0B 1R3HA 3L5WA 2Q20A 5HYJD 1WGOA 1S9WA 1YYML 3C2AL 5FXCH 1EVUA 4NKIL 4WUKL 4NKOB 1RJLB 4JFPB 2XZQL 2Z4QA 3ARYA 3UBXA 4HKBB 5ILTL 1C1EH 1NLBH 1T4KB 2C1PB 4PRNA 1QUNA 3DETD 3HA0A 4OCWL 5EU7C 4KJQD 1DBMH 3JV5A 4F15B 1NSNL 4WFGE 4C56D 5JW4N 4NRZA 1FBIL 3QRGH 3KHOA 1FZMB 2VITA 3OMZA 5L88H 5LQBH 1L9MA 1VB9A 4N0YH 5DC0A 4OFPA 5BS0E 4Y5XC 4XNUH 4IHOB 2AK1L 4JPVH 5ALCH 1ZLWH 4NZTH 1FJ1B 2FHFA 5DS8A 5TJWK 2PW2B 2OQJB 4FMFA 1CF8H 1AY1H 5D6DC 1WZ1L 5IVXE 4ZOEA 4NQCD 5IKCB 5A2LH 1NDGA 1D9KC 1S5IL 3SDXB 3C5ZA 3MJ7A 4EUPA 4OF7A 2BNRA 5KJRH 3GMPA 4K7PH 3OB0H 1WWBX 2LE9A 2IAMB 1JP5A 3F7PC 3I3BA 4PJXF 3QWOA 2K7QA 3DGCR 2NY0B 1UKQA 2ZOLB 3IVKB 4P9HH 1EO8H 3RVXC 1IAKA 3O6LL 2ZCHL 1JL8A 5DJCA 2G2RA 3GSNH 3VH8G 4HF5L 5DJXA 4LSQL 5DRWA 4JRXD 2W60A 5JOEA 1NBVH 4H8WH 5C0EB 1FGVL 4MAYC 4F7TB 4UNTA 2C3GA 1G7LB 1KYOK 5EH1A 2EYRA 1T2QH 2HH0L 3IFPB 4P4RA 4W6YB 3MLZH 5IUSA 3QDMB 3SQOL 4HS8L 2XXCB 3QDHA 1W0YT 4LQ1A 3QNXB 3F5WB 4PY7B 25C8L 3MV7D 4Y1AE 1JGLL 1W0WB 1N5AB 3BN9D 3HE7B 2X4RA 4HS3B 2YKLH 4H20L 1JF6A 4TUOA 2DBLH 4GRLB 4OCRH 3FT4A 4KK5D 4XP5L 1NQBA 5E8EA 4BK5A 2JF1A 4FQHA 5E2VH 1WZKA 5FA4A 2DM7A 3VD7A 2CO6B 2M2DA 1P69B 3KR3L 3EYSL 3LKPA 4H1LB 3F62A 4BFEA 1M6OA 5FGRA 1PZ5A 4LVHB 5GGTL 3EYUH 5CJ8A 2OTWA 3H9SE 1FFOA 3U79A 1AKJA 1IEHA 2A77H 2W91A 4PJBB 4P4KA 2Y06L 1FL5B 1ZLVH 5E8DH 5A2IH 5EZOH 4KAQH 1U3HA 2IWGA 5F7DA 1N0XL 1TJGL 2AW2A 3QQ9C 3SE4A 4EJ1C 2MPAH 4PJ5B 5J06A 1VGEH 2X1OA 3RX7A 5E70A 3NFSH 2CKBH 5KSUA 5E7BA 3O9WD 3WKNA 5D1XB 4IJ3C 2WQ8A 4Z0BL 2OR8A 3FT2A 2FLBT 1NMBH 3G08A 1UWEL 3VG0L 2PXYD 4NKMB 5DVKA 3MBEA 1MCBA 1CDYA 3KYAA 1ACZA 4M7LL 1A3LL 2Q86B 1ZEAL 2X4PB 1KLGB 1UEYA 3MGOB 1UXWA 2FLRT 1A7QL 2AJ3B 4N68A 5ICZB 1YMME 1MCOL 2CIKB 2QHRL 3T3MF 5DD0L 5FYLL 3LRSA 5TDPB 4P4KC 1GSMA 3TH2T 4OGZA 4WCYH 2NR6C 3RVXD 3HC3L 2GTWA 2HJLB 1U3HC 4QRPA 5EU5B 1CFSA 1DJSA 5GSVA 2PR4L 4Y5VA 4Q74A 5IB5B 1YEJH 4P3DA 4U6VH 4PBVC 3VXNA 5IT2L 3DVGA 2IBBA 3QT2A 4N0FA 1CTNA 3WYRA 2NY1C 4MJIB 1V7NL 5I1GL 5HJ3A 2AJYL 3MXWH 1EHNA 1E0OB 3ARRA 4RFEB 3MBEC 3V9FA 2A6KB 4NGHL 3CJJA 1T7ZA 1UXSA 4MXVF 1HQRA 4OLXL 3VDCA 4NNXA 1EZVY 3IS0X 3KYOB 4F58H 2J6EA 4YHNA 4GAGL 2HFFA 5EDXA 1AQDB 4JDZB 2HRPL 2P8LA 3HE6A 4LCCA 3R1GL 4G43A 1KENH