1FONA

Crystal structure of bovine procarboxypeptidase a-s6 subunit iii, a highly structured truncated zymogen e
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
SWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPTVDYEHCSQWDWWGITVKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWIDETIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine procarboxypeptidase A-S6 subunit III, a highly structured truncated zymogen E.
pubmed rcsb
molecule tags Serine protease
molecule keywords PROCARBOXYPEPTIDASE A-S6
total genus 55
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fonA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fonA01
3PTBA 3M3SA 1F5LA 1SI5H 3GISB 1DSUA 1GBLA 1ETSH 1O2HA 1O5GH 1HBTH 2AMQA 3QGNB 1AE8H 1PPCE 4NA7A 1ETTH 1OX1A 5I46H 3HGPA 8GCHF 1PPGE 3C27B 2FOMB 3MNSA 4CBOA 3P8NA 5C2ZA 3S9CA 1QL9A 3H7OA 4AORA 1J15A 1H9LB 1VCPA 2A4OA 2BXUH 1P11E 1P05A 2CXVA 2PGBB 3STJA 4A92A 2YNBA 4JZEH 1MAYA 1NU9A 2TIOA 5ABWA 1IQFA 1QIXB 1C2KA 2PV9B 1ARBA 1H8IH 1W8BH 3SJ8A 5GJ4B 1GDNA 3SI3H 1C4U2 2ESTE 2F9UA 4NIWA 1GBBA 1E0FD 2PFEA 1ABIH 2VJ1A 1Z1JA 1CQQA 1O2XA 3V3MA 2UUYA 2BX3A 1TALA 1NZQH 3MYWA 4Y11E 1BCUH 2EI8A 1EB2A 2Z9IA 1L1JA 1TB6H 1QBOA 3QGJA 1V2QT 1U6QA 2GDEH 3SV7A 4CREA 4FU7A 3T5FH 2G52A 3BTHE 2QXJA 2W7SA 1J16A 2BDHA 4TY6A 7GCHF 3P8OA 1GBKA 4IMQA 1D3TB 3VB4A 2OBOA 4X2YA 2Q6DA 1NTPA 1L0ZA 3TJNA 2F91A 2O8TA 3UWIA 1SGFG 4YLUA 1A0JA 2H5DA 2HPQH 2ZGHA 2ZHDA 1EATA 1W10U 3KHVA 5BPEA 2CV3A 3M36A 1C5ZB 2SGDE 2WPJS 3TK9A 4O97A 3PB1E 4A1XA 1MKXK 1AE5A 2R0LA 4KGAA 4LXBH 1SGTA 4YO9A 3M5LA 1Q2WA 6CHAB 1ELVA 4I31A 4KTUA 4LK4A 4CH2B 3E16B 3BF6H 1FV9A 4IGDA 1BTXA 3MWIU 1T8NA 1GCDA 1O30A 1C1RA 1CO7E 1UTMA 1VJAU 1NY22 4CHAB 1CT0E 1OYQA 1P04A 1K1NA 2O8LA 3F1SB 5DG6A 2Z9LA 1G2MA 1ZPZA 3SV9A 3O8RA 3LKWA 1UCYE 2QF0A 1YPMH 2DE8A 3UIRA 1XUKA 3FZDA 1P02A 2FLBH 4IMZA 1ELAA 1FONA 5JBAS 5DPAA 5GDSH 1YC0A 1TNLA 3A85A 3L6PA 5A8ZA 1AFEH 1O2VA 3AVZA 4BOHA 3ATLA 1MCVA 3MH7A 3P6ZB 1O3FA 3L33A 1ZR0A 2OC7A 3E3TA 1T8MA 5EPNA 1TOCB 1C1WH 2GP9B 2UWPA 1JWTA 3M3TA 1VITF 3U1IB 6LPRA 1C1OA 2QC2A 3IITA 3GDUA 4TPYA 1LHDH 1K1OA 2Y6TA 3RU4T 3SU5A 1O31A 3BEUA 4TWWA 2GCHG 2OCVB 1AO5A 3UFAA 2ZFQH 3PLPA 1TQ7B 2J34A 5DP8A 1C5LH 1T8LA 3BTFE 2PSXA 1D3DB 2QCYA 2TPIZ 4NSVA 3UOPA 3ZYEA 3EAJA 3RLWH 4OS4A 1O2YA 3T29A 1F0RA 3SU1A 4NWKA 1EP6A 1ESAA 2FYRA 2GMTB 3MFJA 4DIIH 4D76A 5A2MH 1NFWA 2AMDA 3T62A 2PR3A 2VVVA 1A0HB 3RMNH 2RA0A 5EODA 2Q6GA 4HGCA 1QA7A 2K1QA 3GCTG 4Z6AH 2FM2A 3RMMH 5EXNA 1KXCA 1TONA 2OBQA 2J92A 2CHAC 5EXLA 1OKXA 2BB4A 5JBTA 3SV6A 5A09A 1RXPA 3U69H 2ZPSA 1CVWH 1HV7A 3LGIA 2Z9JA 1K9OE 4BAHB 2ZHWH 1EX3A 5A0AE 1TX7A 4AYVB 1IQJA 1TYNA 2R9PA 3SZNA 1BA8B 4I7YH 1BB0B 3Q3XA 4B1TA 1EB1H 8GCHG 2FOHA 1UTKA 1CBWC 1EAUA 3U8RH 1ZSLA 2ZDVH 4JK5A 5FBEA 1GI7B 1MCTA 2H1UA 4RSPA 1L1GA 1O37A 5F8XA 1Z8RA 4CR9A 1O3BA 3TK5A 3O8BA 1ELTA 4LZ4B 1ZTLA 2BOKA 4WMEA 4GSOA 1B0EA 2WYJA 2BHGA 2BD3A 1FLEE 3BTGE 1BJVA 1GVKB 3V0XA 1O5BB 2PGQB 3ODFA 1NROH 1GHBG 4F4OC 2SGEE 1H9IE 1H9HE 1MTUA 1UTPA 4OS2A 1LQDB 2O8UA 3Q3YA 4OGYA 2XBWA 3TJUA 3LGWA 2ZDAH 2FTLE 2CGAA 3M5MA 1QA0A 8KME2 1FN8A 1SQTA 1LVMA 4CBNA 2A5KA 4OS6A 1AHTH 1AIXH 1YYY1 1F92A 4X2VA 4DW2U 1TMTH 5LGOA 2BDAA 1MQ6A 3S9AA 1DWDH 2J94A 1RIWC 1AWFH 4H6TA 2R3YA 4ABAA 1O0DH 2GMTC 3RXVA 1CE5A 3RM2H 3A8DA 2IN2A 4WF8A 1ESBA 5GCHF 2QY0B 1A2CH 1CA0B 1O2SA 2B7DH 1AVWA 2BD8A 2OUAA 2BXTH 2UUFB 5FAHA 4B71A 2ZU4A 3F9GA 3RC5A 2ZTZA 3AW0A 3LDXH 3SUFA 3E0PB 1NT1A 1OWEA 1NRSH 4X1SU 2FS9A 3A7WA 3DT0H 3PMHB 1MKWH 3MI4A 3A8CA 3A82A 4XE4A 1MTSA 5FPYA 5JBCS 4I8LA 3MU0A 2OQ5A 3S9BA 1D3PB 4XBCA 1BRUP 2ZEBA 3SBKA 3VB5A 3S69A 1N8OC 2PHBA 1KXEA 2ZCLP 3PWBA 3RXPA 1F5RA 3MO6A 1Y5AT 1B0FA 2YNAA 1O2RA 3M7TA 3AAUA 1SBWA 2STBE 1DVAH 3Q76A 4FUBA 1BBRE 4XFQA 2ZFSA 1QQ4A 1C9PA 1JRTA 4WY3A 1EPTB 1FUJA 3SJOA 1UVUH 2HNTE 4NA8A 3BTWE 1KYNA 3BTQE 1THPB 1RJXB 4VGCC 4ZXYH 4D9QA 1SVPA 1EUFA 3FP6E 1UVSH 2F9PA 1DXWA 1TNKA 4JCNA 1Z8IB 4JZFH 2PUXB 3M7QA 1ABJH 4DG4A 2SNVA 3L3TA 2A0QB 5HYOA 1BTHH 1MQ5A 4Y7AA 4DGJA 1VCQA 1NO9H 2FESH 4YT6H 3NK8A 3FANA 5EOKA 3RXGA 1UK3A 3KN2A 4FUIA 1FNIA 1WV7H 1B5GH 2HOBA 2ALVA 3QTOH 1JIRA 2FO9A 1OP2A 2HVXA 2ZHEH 5L6NH 2AMPA 1W11U 1BTZA 3KCGH 4B76A 3KQDA 1HJAB 1QB1A 4Y8XA 4FUCA 1P2MA 3MMGA 1VGCB 5CHAB 4A7IB 1IQNA 4GCHF 2H6MA 3Q00A 2C93B 1TABE 1E36B 4NG9H 4ZKRU 2IOTA 3Q3KA 5C1UA 2JETB 5L30H 1BITA 4Y76A 1AFQB 2AERH 1MAXA 9LPRA 4YOJA 4WH6A 1LVYA 5T6DA 2BD7A 5C1YA 3TH2H 2ZFTA 4ABJA 1O3OA 1L4ZA 1QR3E 1TNHA 2ZHQH 3P8FA 1NRQH 2BDBA 3W94A 1HYLA 2ZG0H 2FDAA 1ZHPA 3STIA 2FOGA 3V12A 1BTYA 1DWCH 3CS0A 2QGRA 2ZU1A 1KLTA 1SLWB 2C8YB 4BXWA 3KL6A 1NM6A 2WV4A 1CU1A 1HAVA 4FUFA 1LPZB 1N1LA 3D65E 3OTJE 3SJ9A 1V2KT 3VXFH 5FHTA 2CHAB 1Y5BT 3FP8E 2ULLA 1K28D 1UTQA 3KQBA 4NGAH 1W7GH 3BG4C 3VGCC 3V7TA 1KXBA 1RD3B 3H7TA 1NFYA 4GUXA 2G55A 1CBWB 2ZGJA 2GT8A 4FUHA 3T26A 1EASA 2BY9X 4KP0A 2Y7ZA 1Y3XA 2ZCHP 2QYIA 1UK2A 1CHGA 1AU8A 4AFQA 1PYTD 2PKSC 4XDEA 1TPPA 2ZU5A 3EGKH 4UDWH 3QX5H 4Q7ZA 1UVPA 3RXDA 1G3DA 1P9SA 1O2NA 1TFXA 1O3PB 5DP7A 2ZU3A 2SGPE 1K2I1 4UD9H 2ANMH 5EW1H 1IOEA 2BD2A 1D4PB 1XKAC 4I8HA 2DE9A 3GDSA 4NWLA 4DVAU 1O2LA 2A4QA 3TNTA 9ESTA 4ABHA 1BBRH 3P17H 1XUJA 3UWJH 1H4WA 4DY7B 4A1TA 1WAYB 5FXLA 1L1NA 2C8XB 4BNRA 3SV2H 4TWYA 1ELFA 4IC6A 1BZXE 1VJ9U 1AI8H 1SG8B 4WVPE 5HM9A 1J8AA 1AZZA 4BAKB 3EDXB 3RMOH 3SUEA 4AFUA 1AVGH 1KDQA 1O2OA 1O3CA 1EJMA 5T3HA 3TNSA 1SGPE 2VWOA 1LTOA 2VIPA 3RMLH 4X1QU 4B2BA 1TGCA 1ZMLA 1C5TA 4THNH 1O3IA 1C1UH 3UQOA 1SLUB 1KIGH 1HIAB 2VVCA 4JYVH 1IQIA 1O2IA 4CRFA 1SGNE 4O03A 1TGSZ 1GL1A 1AWHB 3LIWA 1EAWA 3A7YA 2EEKA 2J9NA 1LCYA 1C2LA 4AX9H 2WINI 1ZGVA 4OS1A 3LC5A 4KTCA 4BTTB 3MNBA 1C2EA 1C1QA 1QJ7B 4JYTA 4GVUA 5K7RA 1EQ9A 3TGJE 1HAHH 1OWKA 2WUCA 4JZIA 4I8KA 1GPZA 1UK4A 4GPGA 1HAVB 3UNRA 1BMAA 1EOLA 1GDQA 3LU9B 1O2TA 1O2QA 4K5ZA 1TLDA 5DP9A 1C4V2 1YCPH 4ABGA 1AD8H 4AG1A 3BSQA 1O36A 5F8ZA 1P01A 3BIUH 1WBGB 2BZ6H 3F6UH 4Q7XA 1CGIE 1IAUA 5LH8A 1TBQH 4I8GA 4CHAC 1SGCA 5FPSA 4YM9A 1GI9B 1GBCA 1O3NA 2CMYA 1Q31A 3RXMA 2FX4A 1O2UA 3VPKA 2WPMS 2VH0A 4MLFB 1BJUA 1EOJA 1V2JT 1JIMA 2VWLA 3IG6B 2TBSA 3D23A 2FS8A 2FP7B 3GOVB 1GBHA 3P95A 1WQSA 2WPIS 3ZV8A 2H5CA 1KTTB 2UWOA 4JZ1A 1YPHE 2ZGXH 4U2WA 1HCGA 4TYDA 3PMAB 2V0BA 5LPEA 2BY5X 5AHGH 3FZZA 3B9FH 2ZWLH 1YP9A 1GGDB 2A7JA 2GCTC 4WXIA 1XVMA 1TMUH 1D6RA 1SC8U 5JB8S 4Y79A 4K1EA 4SGBE 3SJKA 1LKBA 3O8DA 2OC0A 1GMCF 2OP9A 3FVFB 2G8TA 2HNTF 1T8OA 3GY2A 1XVOA 3T25A 1C2HA 1TRYA 4AGKA 1D3QB 2BYAX 4KKDA 3UY9A 4A6LA 1UTLM 1UTNA 2FPZA 1AQ7A 2OXSA 2Z3EA 5EQQA 1ELBA 2WUBA 1MTWA 3LC3A 4NSYA 4YOGA 2BVRH 1T32A 2Z3CA 4ABBA 1C2FA 6GCHG 1S6FA 1UJ1A 1SGIB 1DLEA 1S5SA 3PYHA 3BTME 1BIOA 3SORA 3EA8A 5E0GA 5L2YH 1IHSH 4MNYA 1YKTA 1O2JA 1O5FH 1PPHE 2P59A 1HPGA 1SHYA 1OSSA 2C3SA 1TGNA 1P03A 3UTUH 3RXAA 4JYUH 4X6MA 5GXPA 1GI0A 1GI8B 2PW8H 5EQSA 3DFJA 3PMBB 5J4QA 2BQ6B 2D8WA 5ESTE 1E38B 2A5AA 5F03A 1AB9B 3VB3A 1SSXA 1GBFA 1XX9A 6ESTA 2FTMA 3GY3A 5HXFA 3OYPA 2QXHA 2FOAA 3I77A 1TNIA 2ZPRA 3A86A 3DD2H 3BG8A 3BG4B 3VGCB 3MU5A 4E7RG 2R2WU 4CRBA 4X1PU 4ABEA 2G4UA 2AH4X 4BAQB 1LQEA 3PMJA 1LHEH 1SB1H 3GY7A 3HK3B 3SNEA 1ANCA 1N6XA 3HATH 1Z8JB 1P2NA 3CENA 2D26C 3E1XB 1W12U 3IWMA 3ODDA 3HKJB 1EJAA 2BVXH 1TE0A 1O5AB 2EC9H 1LPKB 2R2MB 2ZKSA 1MD8A 3TJVA 2GVFA 5C5OA 1RTKA 3A8BA 4E06H 3A7ZA 3SO3A 1YF4A 1LPGB 3WY8A 3SGBE 1NN6A 1Y8TA 1ZTJA 4MNWA 3QUMP 3O8CA 1Z6JH 1UCYH 2NU4E 3A88A 2JETC 2XC0A 1SGDE 1TBRH 1PPFE 2FMJA 4XOJA 4O9VA 4B73A 3ZVEA 2G5NA 4XBDA 1QBVH 1ZJKA 1GHXH 3I29A 1UO6A 1ELDE 1IQKA 4HTCH 2XC4A 1H8DH 1C5OH 2A2XH 2FI4E 2A31A 3QWCH 2ODYB 2ZF0H 4ZH8A 1GI6A 1HGTH 1K1IA 2QF3A 3LGUA 2WPHS 1HFDA 3AAVA 1DWEH 1GMHG 4GLYA 3RXLA 1AZ8A 1OPHB 4NCYA 1Y5UT 3SHAH 3CP7A 1TPOA 4MG3A 1HDTH 4LOYH 1S83A 5JYIA 1O3DA 2TRMA 2BD4A 2J4IA 3PV4A 3VXEH 4Q80A 1F0SA 1TPSA 2BDYA 4M7GA 1XUFA 1TGBA 1PPEE 1C2JA 1W0ZU 5JPMH 5C67A 4BANB 1SGQE 2P3UB 1P57B 4CH8B 1WUNH 3A7XA 2WPLS 4OGXA 1C5YB 3MHWU 1G3BA 3SU0A 1HJAC 4ABDA 3CS7A 1W14U 2FZZA 3ZVAA 4AOQA 1T7CA 2LNCA 3ENSB 1GJ5H 1PQ7A 1OWDA 2O8MA 1BTUA 4WMDA 1FY3A 3LGYA 1NFUA 1C1SA 1TWXB 2TGDA 4WJG2 5C20A 2BLVA 1O2PA 4B74A 3LJJA 1ZHMA 2CF9H 3OU0A 1IQHA 1KXDA 1WTHD 4X6NA 1GJDB 3SI4H 4TY7A 1DY8A 1DWBH 3M5NA 1N8OB 3G01A 4MPVA 1HAIH 2B5TB 1UTOA 5HM2A 2AIPA 1GJ6A 1SLXB 1ZSKA 1JBUH 1LHGH 2KAIA 2A7CA 3E8LA 3F9EA 1IQGA 1BTWA 3D49H 3FAOA 3KEEA 1E34B 4ISHH 1C2GA 2G51A 3BEIB 4TPIZ 2NU3E 1QRWA 2XCNA 3DUXH 1GHAG 2C8WB 1D6WA 4MPUA 1DUEA 3S0NA 3UOUA 3NPSA 2VGCC 3KIDU 1Z1IA 1DFPA 2VGCB 2VIDA 2BY7X 4DOQA 4YTAA 2H9TH 1G30B 4X1NU 1QURH 2P8OC 2ZDMA 1HXEH 7KMEH 3U8OH 1PQAA 3PLKA 4ZROA 3RUOA 4ABFA 3QO6A 4RN6A 5GWZA 5DJ7A 5FCRA 1C1MA 1WYKA 2ZECA 1AMHA 3SUGA 4IW4E 3LOXA 1F0TA 1QRXA 4ZKOU 2HWLB 1MZAA 5B6OA 2NU1E 1K1PA 1GI1A 5EG4A 1G37A 2AYWA 1OYTH 3DFLA 4AFSA 2A4GA 1Q3XA 1QB6A 2SFAA 1ETRH 4X2WA 1YGCH 1XXDA 1O3GA 1SL3A 3ZZ5A 2P94A 3E6PH 1GWAA 1ZPCA 3BN9A 1HXFH 3RXHA 1LHFH 4FUJA 1PJPA 4X8VH 4ISOA 1UMAH 4AFZA 3ATMA 1HAPH 4CR5A 1TIOA 1G3CA 1ANEA 1CA8B 3ZZCA 1AFQC 1FQ3A 4NIVA 1C2MA 1NU7B 1F7ZA 3RXJA 3EA7A 2W7UA 4B2AA 5A0CA 2B9LA 2AEIH 4JMYA 3ZZAA 2RCEA 2ZDNA 1NPMA 1ELEE 1HAXB 1S6HA 2VIWA 3SU3A 1FI8A 6CHAC 1O35A 4YESB 2GGVB 4WXVA 1S0RA 3HGNA 3R3GB 4A1VA 2V3HH 1FIZA 1QJ1B 3SQEE 1HJ9A 2ZQ2A 5DO4H 2KAIB 1GVZA 1ELCA 3UR9A 2A45B 3SJIA 1YCPM 1P0SH 1AKSA 4UONA 5E0JA 3LT3A 2M5TA 1PFXC 4U30A 3GCOA 1P3CA 3RXIA 5ETXA 1MH0A 1BT7A 2I6SA 1OXGA 6GCHF 2W5EA 3KQEA 1ZZZA 1LVBA 1TAWA 3GYMA 5EGMA 4DCDA 7ESTE 1SQAA 1WQVH 3JZ2B 3VFEA 1YPHC 1TNGA 4D9RA 1N6YA 4BTIB 1HAOH 2AGGX 2ANKH 2FOFA 3MTYA 3TITA 3GDVA 3URCA 2FYQA 3TH3H 2QA9E 3HK6B 1ELGA 1EPTC 1GJ8B 1Z8GA 1CHOG 2BMGB 1GMDG 2BLWA 1PQ8A 3MU4A 5A8XA 4R8TB 4K69A 4AN7A 2GV6A 3A89A 1GI3A 1QY6A 2CJIA 2G81E 3B23B 3NXPA 1GDUA 4FVDA 1K22H 1SGYE 1EZQA 4UFFH 3GCTF 1DPOA 1O5DH 2GZ9A 1ZJDA 1SOZA 2J95A 2VVUA 1NS3A 1S81A 1C1PA 3ESTA 1GBAA 3ZV9A 1KTSB 1O34A 3NCLA 3KF2A 2ANYA 1SGFA 2SNWA 4K60A 2EI7A 4Y10E 5AFZH 3TGKE 1MKXH 3ATWA 4WH8A 3RLYH 1A61H 2Z6BD 1YPEH 4ZHAA 4CRDA 1J14A 1GMHF 2BLOA 3ZVGA 1SOTA 2QIQA 1WCZA 3T2NA 2GCHF 1HUTH 1HAGE 2HALA 3BIVH 5AF9H 2AGEX 1V2ST 2NWNA 5TCCA 3SU2A 1INCA 1A3BH 1P06A 3GY6A 1YPGH 4YT7H 4RKOB 1MD7A 2FI3E 2H2ZA 5I25A 3ATIA 1C5UA 3OY5U 2Q1JA 3M61U 5GCHG 1O2MA 1W0YH 3RXSA 3MO3A 1A1RA 3TIUA 5AFYH 4I32A 1HIAA 1C5XB 1S82A 1W7XH 1QFKH 1WTGH 2QXIA 3TU7H 1GMDF 4BAMB 2TGAA 2BD9A 3B8JA 3BTEE 3BTKE 1GBTA 1GGDC 2GCTB 1MUEB 4FVBA 2ZZUH 1HLTH 5CE1A 3RXTA 4ISIH 2FOEA 2IPHA 2ASUB 3SU4A 2Z3DA 3SGQE 3KGPA 2Y5GA 3EYDA 1EXFA 3UNQA 2GD4B 4UFEH 4O3TA 4AZ2B 1O3LA 3RXBA 3RC6A 1RFNA 2ZC9H 2AS9A 1GHAF 4INHA 2YOLA 1DT2A 1YM0A 2GZ8A 1TX6A 1UTJA 4UEHH 1ZLRA 1TA6A 1IQLA 1Z71A 1GJBB 1BDAA 1UVOA 5DKMA 4K2YA 1Y59T 3NWUA 2HLCA 2QXGA 1O39A 5DP6A 2XW9A 4Y71A 3H5CB 1GJAB 2VB0A 1GBDA 4X2XA 3DHKH 2ZGBH 3FFGA 1B7XB 1GHZA 1IQEA 3ITIA 1RGQA 1ZYOA 3LH3A 3W95A 1HRTH 1UHBA 1CHOF 1QTFA 4FUGA 3MNCA 1SHHB 1O3EA 1LMWB 1P9UA 1GJ7B 4X8TH 1GG6B 2OINA 1O5EH 4AYYB 1ACBE 2BDIA 5AVDA 1FMGA 1MKWK 3ZVFA 1EAXA 2ZDKA 2ZFPH 1MTNB 3NKKA 4YZUA 5TJXA 1DSTA 1GBIA 2VIVA 1MMJN 4HZHA 1A4WH 1ESTA 1JMOH 1O3HA 1C5WB 4GAWA 5EU8A 3QK1A 1UCYK 1JXPA 1ZMNA 3S7KB 1AUJA 5CMXH 3NUMA 1ZTKA 2ZCKP 3JZ1B 3BTTE 3E90B 3QLPH 3M3VA 1EKBB 1TBZH 1KXFA 2JH6D 4JK6A 2ZTXA 4IS5A 5EXMA 3U1JB 1S85A 1V2WT 1C5NH 3A81A 2CN0H 4YLQH 8ESTE 3RU4D 3SHCH 1O3AA 1V2UT 2D2DA 1YPKH 2ZNKH 1DANH 1P2QA 3SN8A 1HAZB 3V13A 1E35B 1KY9A 2ZO3H 1Y3WA 2ZI2H 5E8EH 1X7AC 3QN7A 3EE0B 1J9CH 1VITH 1GI5A 1WOFA 4U01A 1TPAE 3Q77A 1XXFA 1QRZA 3SGAE 1NFXA 4MNVA 5E2OA 5K0HA 3PWCA 3SNCA 3AASA 1THSH 4D7GA 4NFFA 1FZZA 1Y3VA 2FX6A 1SR5C 3KQCA 3MNXA 3RXEA 1DXPA 2EA3A 3T27A 3U8TH 5T6GA 2BOHB 1DLKB 2FEQH 1V2RT 3FP7E 3K6ZA 1BMLA 1LVOA 1GCTC 3BTDE 4XSKU 2XBVA 2P3FH 3F68H 1T4VH 4NZQA 1V2VT 1RTFB 3MU1A 2OTVA 5DP3A 2F83A 4H4FA 1PPZA 1IQMA 2Z7FE 2Z9KA 2FI5E 3GY5A 1VCWA 1BUIA 3TPIZ 1GMCG 5T6FA 1MU6B 3K9XB 2Y81A 1YBWA 1P3EA 5F8TA 2R0KA 1QB9A 1VGCC 1FJSA 3RM0H 2P3TB 4K1TA 5EW2H 3E91A 1KLIH 1ANBA 4QT8C 1AN1E 2ZA5A 1W2KH 3OY6U 1AVXA 3A8AA 1P09A 2AFQB 4ZXXH 1NRRH 1T31A 2VIOA 1DX5M 1SFQB 2XTTB 1L4DA 4E05H 2F9OA 2ZP0H 3PO1C 3K65B 1W13U 1RS0A 3NZIA 1JRSA 1XKBC 2OQUA 3GY4A 1V2TT 2BM2A 1PYTC 1DITH 4DURA 2ZFFH 2QN5T 4Y0YE 1TA2A 4Y0ZE 3SQHE 1DOJA 1SLVB 4IN2A 1NRPH 1O3JA 4X6PA 4GHQA 2V3OH 2Y80A 1GJ9B 2PWXA 1FY5A 2WV5A 4ZAEA 1MTNC 5A0BA 1C5MD 2HGTH 1A7SA 1H1BA 1ZSJA 3LH1A 3LPRA 1HAYB 4BAOB 4ZHMU 2Y82A 1NRNH 1P2OA 2FXRA 3SNBA 2A5IA 4GHTA 4GCHG 1P2KA 3QDZB 3LONA 3DA9B 1TNJA 3SV8A 2XBXA 5HGGA 2PKAA 4NIYA 4ZKSU 2HPPH 2ZGCA 1QBNA 2A1DB 1V2PT 3A7TA 3GICB 3TGIE 3OSYA 4CRGA 3RXCA 1FN6A 1D9IA 1JOUB 4BTUB 1XUGA 1S84A 5PTPA 1O38A 4K8BA 1MBMA 2DUCA 1VR1H 5GIBA 2P8OB 2W3IA 4CRAA 4MQAA 2VWNA 1GCTB 1OS8A 3RXFA 4A5TS 4ESTE 2VH6A 2ZIQH 1YLDA 2XWBI 2F9BH 1UVTH 2FOBA 3ZZ7A 1SGRE 3QZQA 3SOSA 2B8OH 2BDCA 1G2LA 1O5CB 2C4FH 1BMNH 1FAXA 2WPKS 1C1TA 4ZKNU 2XCFA 1A0LA 1GHYH 3SNAA 1F0UA 5C1XA 1YLCA 3K6YA 4Y8ZA 1M9UA 5DP5A 4ASHA 2FIRH 4K1SA 2WYGA 1KLJH 3QZRA 4X6OA 3M37A 4XBBA 2VINA 1AB9C 4AB9A 3UREA 1GI2A 5E0HA 5EPYA 1BHXB 1FPCH 1QGFA 3TK6A 2TGPZ 8LPRA 1HB0B 1TRNA 3PLBA 1C9TA 1K1JA 1O2GH 1YPLH 1C2DA 1GG6C 4X1RU 1PPBH 1Y3YA 1CA0C 4H42U 3E0NB 3RXUA 2BTCE 1GL0E 1ZOMA 1BTPA 2J2UA 3PROA 3ZZBA 5E2PA 2PKAB 2AGIX 4OS7A 4X8SH 2SGQE 1FIWA 1GBJA 2J38A 1EPTA 2BZAA 1BHXF 2XNIA 4ISNA 3RXKA 1V2MT 2OC8A 3ZZ3A 1CGHA 1XMNB 1BBRK 1V2LT 2O8WA 5JB9S 2F9VA 2ZDLA 2V6NA 1ZRKA 1GHVH 3GCHC 3UQVA 4IBLH 1DDJA 2ANWA 2FOCA 3U98H 5F6MA 1CT4E 4Z0KA 2XWAA 1F2SE 2XBYA 1BMMH 1V2OT 3A83A 2G5VA 1IHTH 2GZ7A 2PUQH 4KELA 7GCHG 2Q6FA 2LPRA 1ZPBA 1OWJA 1C1VH 3LJOA 2ZU2A 4K3JA 4MTBA 4MVNA 2FWWA 5FPTA 1O2KA 2RDLA 1KSNA 1C5QA 2THFB 3RP2A 5FX6A 2BY8X 1T4UH 2XXLA 4R0IA 2SGAA 3R0FA 2NU0E 1YPJH 2OC1A 5LPRA 4ABIA 5C5NA 1G9IE 1QQUA 2XYAA 4I33A 1VITG 2BDGA 3RC4A 2A4RA 4D7FA 2QV1A 1E37B 2GT7A 3BV9B 1V3XA 5LPFA 2AIQA 1QNJA 3HPTB 3KNXA 4IN1A 3UPEA 2ODQA 1C4Y2 4O3UA 2JH5D 1O3KA 2W26A 4I8JA 1GHWH 3TH4H 1A3EH 1AY6H 1EP5A 1V2NT 3ZVDA 4HFPB 5G4BA 2Z9GA 1GBMA 3SNDA 1G32B 4NA9H 1YCPK 3UNSA 1G36A 2P93A 4UFGH 3AW1A 5BRRE 1GVLA 1FAKH 1OP0A 1TQ0B 4FUDA 1NESE 1LKAA 2FLRH 1BRAA 1P2IA 1QL8A 4HI3A 3UUZA 2I6QA 3MO9A 5HMAA 2STAE 1TOMH 2A32A 2Z94A 1TX8A 5GPIB 3MOCA 5ESBA 3SU6A 1GHBF 1QL7A 1L2EA 5FBIA 1K1MA 1MZDA 1A5GH 2VWMA 1DE7H 5SGAE 1EJNA 2OLGA 3OX7U 3URDA 2BLQA 5H4IB 2GTBA 4OS5A 1TRMA 4E7NA 3VB7A 1DUAA 4FUEA 1A46H 1LHCH 3MH5A 4J2YB 2JKHA 5IYTA 1ANDA 1GJ4H 2ODPA 3EQ0H 3M5OA 1XUHA 2VNTA 2PKSB 2Y5FA 4ZMAH 3RXOA 1P10A 2IJOB 4JZDH 4YOIA 1SGEE 3RDZA 5IDKA 2PLXA 2UUJB 1KDQB 1ZGIA 1OWIA 3SUDA 5C3NA 2F9NA 1G3EA 4X8UH 1O33A 3F9FA 1V6DA 1OP8A 4F49A 2BX4A 4LZ1H 4X0WU 1OWHA 3ZVCA 2BQWB 2BQ7B 5JBBS 2GV7A 4NZLA 1CSOE 1SQOA 4ISLA 4AG2A 1GJCB 4Y7BA 2G4TA 2G00A 1WU1A 1QCPA 3HKIB 2BD5A 3A87A 1EAIA 1CT2E 2D1JA 3K2UA 3F9HA 1ID5H 1BOQA 1NC6A 5J4SA 3M7UA 4PROA 1ZMJA 1SPJA 1Z7KA 4FU8A 4B75A 4K8YA 4D8NA 1QJ6B 1C5VA 1W3CA 1AGJA 2PTNA 4RKJB 1FDPA 1HJ8A 1GI4A 1THRH 1K1LA 4Q2KA 2CF8H 3I78A 2RG3A 2P95A 3EA9A 1RRKA 1A5HA 2PSYA 5DP4A 3M35A 2A7HA 1FY4A 5FCKA 4MPXA 1PQ5A 1EZUC 4NIXA 3TJOA 2RA3A 1AUTC 2XRCA 5CHAC 1P2JA 1CGJE 3ATKA 1VZQH 4ZUHA 1BQYA 1C5RA 2W3KA 3PM3A 3PO1B 1C1NA 1DM4B 4DT7B 4DIHH 3UR6A 5TCAA 2ZHFH 4DJZB 2BVSH 1S0QA 5A8YA 3SW2B 3ZZ9A 1KXAA 1J17T 3BEFB 1UHBB 3PTNA 4Q7YA 1C5SA 1ARCA 2P16A 2V35A 2OD3B 4INLA 3ZYDA 1XM1A 2UUKB 1SMFE 4UFDH 1FPHH 3GCHB 1MTVA 3RXQA 4MDSA 3T28A 2Y5HA 2JH0D 2VIQA 1SFIA 1O2WA 1FY8E 4J1YA 1Z6EA 1O2ZA 4FXGH 2C90B 3ZZ4A 4H6SB 2ZFRH 3VEQB 1LDTT 2C8ZB 4CRCA 7LPRA 1LO6A 4IC5A 3N7OA 2F3CE 3LGVA 1O32A 3GYLB 2UWLA 1TMBH 2B0FA 4UE7H 4SGAE 1OOKB 1P12E 4WWYA 3MH6A 2VU8E 4U32A 2HRVA 3A84A 4AB8A 2FODA 3MU8A 3S7HB 3ZVBA 3LGTA 4Y8YA 1K21H 3MH4A 2ALPA 4ZHLU 1A5IA 1FY1A 1MU8B 1QHRB 3QTVH 1GBEA 4KTSA 3P8GA 1DICA 2PTCE 3VB6A 1TGTA 1EZXC 1BRCE 4INKA 3GCNA 3A80A 4B2CA 1XUIA 4BXSA 3RU4E 1ZRBA 4AGJA 1BRBE 2SGFE 4FU9A 3P92A 3GY8A 5DGJA 1RTLA 1O3MA 2ILNA 4VGCB 2H9EH 3TLOA 1C5PA 2H9HA 1WSSH 3ZZDA 3ZZ8A 3P70B 2Y7XA 5JDUB 4WMFA 5EQRA 2HNTC 2TGTA 1Y3UA 3TVJB 2EI6A 1C2IA 4NFEA 1EZSC 1MBQA 1ORFA 4MNXA 2QAAA 2GKVE 1ZHRA 2GX4A 2BY6X 1AKSB 4MPWA 1P8VC 2O9QA 5DK1A 1FXYA 1HNEE 2ZPQA 2GDDA 1DY9A 4Y6DA 3C1KA 1DS2E 3A7VA 2XC5A 5FX5A 1F5KU 1RIWB 3U9AH 2A2QH 2ZQ1A 3D62A 2ZTYA 3ZZ6A 3ELAH 5L2ZH 2NU2E 2R3UA 3RXRA
chains in the Genus database with same CATH superfamily
1H8ED 3PTBA 3M3SA 1F5LA 1SI5H 3GISB 1DSUA 1GBLA 1ETSH 1O2HA 1O5GH 1HBTH 2AMQA 2J97A 3SZEA 3QGNB 1AE8H 1PPCE 4NA7A 1ETTH 1OX1A 5I46H 3HGPA 4AC9A 8GCHF 1PPGE 3C27B 2FOMB 3FKSD 3MNSA 4CBOA 3P8NA 5C2ZA 3S9CA 1QL9A 3H7OA 4AORA 1J15A 1H9LB 1VCPA 2A4OA 2BXUH 1P11E 1P05A 2CXVA 2PGBB 3N7EA 3STJA 5C94A 4A92A 2YNBA 4JZEH 1MAYA 1NU9A 2TIOA 5ABWA 1IQFA 1QIXB 1C2KA 2PV9B 1ARBA 1H8IH 1W8BH 3SJ8A 5GJ4B 1GDNA 3SI3H 1C4U2 2ESTE 2F9UA 4NIWA 1GBBA 1E0FD 2PFEA 2WZQA 1ABIH 2VJ1A 2J5UA 1Z1JA 1CQQA 1O2XA 3V3MA 2UUYA 2BX3A 1TALA 1NZQH 3MYWA 4Y11E 1BCUH 2EI8A 1EB2A 2Z9IA 5HIYA 1L1JA 1TB6H 1QBOA 3QGJA 1V2QT 1U6QA 2GDEH 3SV7A 4CREA 4FU7A 3T5FH 2G52A 3BTHE 2QXJA 2W7SA 1J16A 2BDHA 4TY6A 7GCHF 3P8OA 1GBKA 4IMQA 1D3TB 3VB4A 2OBOA 4X2YA 2Q6DA 1NTPA 1L0ZA 3TJNA 2F91A 2O8TA 3UWIA 1SGFG 4YLUA 1A0JA 2H5DA 2HPQH 2ZGHA 2ZHDA 1EATA 1W10U 3KHVA 5BPEA 2CV3A 3M36A 1C5ZB 2SGDE 2WPJS 3TK9A 4O97A 3PB1E 4A1XA 2PP6A 1MKXK 1AE5A 2R0LA 4KGAA 4LXBH 1SGTA 4YO9A 3M5LA 1Q2WA 6CHAB 1ELVA 4I31A 4KTUA 4LK4A 4CH2B 3E16B 3BF6H 1FV9A 4IGDA 1BTXA 3MWIU 1T8NA 1GCDA 1O30A 1C1RA 1CO7E 1UTMA 1VJAU 1NY22 4CHAB 1CT0E 2QF5A 1OYQA 1P04A 1K1NA 2O8LA 3F1SB 5DG6A 2Z9LA 1G2MA 1ZPZA 5DSFA 3SV9A 3O8RA 3LKWA 1UCYE 2QF0A 1YPMH 2DE8A 3UIRA 1XUKA 3FZDA 1P02A 2FLBH 4IMZA 1ELAA 1FONA 5JBAS 5DPAA 5GDSH 1YC0A 1TNLA 3A85A 3L6PA 5A8ZA 1AFEH 1O2VA 3AVZA 4BOHA 3ATLA 1MCVA 3MH7A 1VKYA 3P6ZB 1O3FA 4TSFD 3L33A 1ZR0A 2OC7A 3E3TA 1T8MA 1E79D 2WV9A 5EPNA 1TOCB 1C1WH 2GP9B 2UWPA 1JWTA 3M3TA 1VITF 3U1IB 6LPRA 1C1OA 2QC2A 3IITA 3GDUA 4TPYA 1LHDH 1K1OA 5KGOA 2Y6TA 3RU4T 3SU5A 1O31A 3BEUA 4TWWA 2GCHG 2OCVB 1AO5A 3UFAA 2ZFQH 3PLPA 1TQ7B 3UAIC 2J34A 5DP8A 1C5LH 1T8LA 3BTFE 2PSXA 1D3DB 2QCYA 2TPIZ 4NSVA 3UOPA 3FN8A 3ZYEA 3EAJA 3RLWH 4OS4A 1O2YA 3T29A 1F0RA 3SU1A 4NWKA 1EP6A 1ESAA 2FYRA 2GMTB 3MFJA 4DIIH 4D76A 5A2MH 1NFWA 2AMDA 3T62A 2PR3A 2VVVA 1A0HB 3RMNH 2RA0A 5EODA 2Q6GA 4HGCA 1QA7A 2K1QA 3GCTG 4Z6AH 2FM2A 1E1RD 5EXNA 3RMMH 1KXCA 1TONA 2OBQA 2J92A 2CHAC 5EXLA 1OKXA 2BB4A 5JBTA 3SV6A 5C0TA 5A09A 1RXPA 3U69H 2ZPSA 1CVWH 1HV7A 3LGIA 2Z9JA 1K9OE 4BAHB 2ZHWH 1EX3A 5A0AE 1TX7A 4AYVB 1IQJA 1TYNA 2R9PA 3SZNA 1BA8B 1NBME 1BB0B 4I7YH 3Q3XA 4B1TA 1EB1H 8GCHG 2FOHA 1UTKA 4M9FA 1CBWC 2JIZD 1EAUA 3U8RH 1ZSLA 2ZDVH 4JK5A 5FBEA 1GI7B 1MCTA 2H1UA 4Q63A 4RSPA 1L1GA 1O37A 5F8XA 1Z8RA 4CR9A 1O3BA 3TK5A 3O8BA 1ELTA 4LZ4B 1ZTLA 2BOKA 4WMEA 4GSOA 1B0EA 2BHGA 2WYJA 2BD3A 1FLEE 3BTGE 1BJVA 1GVKB 3V0XA 1O5BB 2KZ4A 2PGQB 3ODFA 1NROH 1GHBG 4F4OC 2SGEE 1H9IE 1H9HE 1MTUA 1UTPA 4OS2A 1LQDB 2O8UA 3Q3YA 4OGYA 2XBWA 3TJUA 3LGWA 2ZDAH 2FTLE 2CGAA 3M5MA 1QA0A 8KME2 1FX0B 1FN8A 1SQTA 1LVMA 4CBNA 2A5KA 4OS6A 1AHTH 1AIXH 1YYY1 1F92A 4X2VA 4DW2U 1TMTH 5LGOA 2BDAA 1MQ6A 3S9AA 1DWDH 2J94A 1RIWC 1AWFH 4H6TA 2R3YA 4ABAA 1O0DH 2GMTC 3RXVA 2KFWA 1CE5A 3RM2H 2RFKC 3A8DA 2IN2A 4WF8A 1ESBA 5GCHF 2QY0B 1A2CH 1CA0B 1O2SA 2CK3D 2B7DH 1AVWA 2BD8A 2OUAA 2BXTH 2UUFB 2W6JD 5FAHA 4B71A 2JDID 2ZU4A 3F9GA 3RC5A 2ZTZA 3AW0A 3LDXH 3SUFA 3E0PB 1NT1A 1OWEA 1NRSH 4X1SU 2FS9A 3A7WA 3DT0H 3PMHB 4F55A 1MKWH 3MI4A 3A8CA 3A82A 4XE4A 1MTSA 5FPYA 5EJLA 5JBCS 4I8LA 3MU0A 2OQ5A 3S9BA 1D3PB 4XBCA 1BRUP 2ZEBA 3SBKA 3VB5A 3S69A 1N8OC 4ACBA 2PHBA 1KXEA 5CDFE 2ZCLP 3PWBA 3RXPA 2QE7D 4YXWD 1F5RA 3OTPA 3MO6A 1Y5AT 2LELA 1B0FA 2YNAA 1O2RA 3M7TA 3AAUA 1SBWA 2STBE 1DVAH 3Q76A 4FUBA 1BBRE 4XFQA 2ZFSA 1QQ4A 1C9PA 1JRTA 4WY3A 1EPTB 1FUJA 3SJOA 1UVUH 2HNTE 4I86A 4NA8A 3BTWE 5CHBA 1KYNA 3BTQE 1THPB 1RJXB 4VGCC 4ZXYH 4D9QA 1SVPA 1EUFA 3FP6E 1UVSH 2F9PA 1DXWA 1TNKA 4JCNA 1Z8IB 4JZFH 2PUXB 3M7QA 1ABJH 4DG4A 2SNVA 3L3TA 2A0QB 5HYOA 1BTHH 1MQ5A 4Y7AA 4DGJA 1VCQA 1NO9H 2FESH 4YT6H 3NK8A 3FANA 5EOKA 3RXGA 2KM0A 1UK3A 3KN2A 4FUIA 1FNIA 1WV7H 1B5GH 2HOBA 2ALVA 3QTOH 1JIRA 2FO9A 1OP2A 2HVXA 2ZHEH 5L6NH 2AMPA 1W11U 1BTZA 3KCGH 4B76A 3KQDA 1HJAB 1QB1A 4Y8XA 4FUCA 1P2MA 3MMGA 2VBCA 1VGCB 5CHAB 4A7IB 1IQNA 4GCHF 2H6MA 3Q00A 2C93B 1TABE 1E36B 4NG9H 4ZKRU 2IOTA 3Q3KA 5C1UA 2JETB 5L30H 1BITA 4Y76A 1AFQB 2AERH 1MAXA 9LPRA 4YOJA 4WH6A 1LVYA 5T6DA 2BD7A 5C1YA 3TH2H 2ZFTA 4ABJA 1O3OA 1L4ZA 1QR3E 1TNHA 2ZHQH 3P8FA 1NRQH 2BDBA 2RDEA 1HYLA 2ZG0H 3W94A 2FDAA 1ZHPA 2J98B 3STIA 2FOGA 5FL7D 3UB0A 3V12A 1BTYA 1DWCH 1E1QD 3CS0A 2QGRA 2ZU1A 1KLTA 1SLWB 2C8YB 4BXWA 3KL6A 1NM6A 2WV4A 1CU1A 1HAVA 4FUFA 1LPZB 1N1LA 3D65E 3OTJE 3SJ9A 1V2KT 3VXFH 5FHTA 2CHAB 1Y5BT 3FP8E 2ULLA 1K28D 1UTQA 3KQBA 4NGAH 1W7GH 3BG4C 3VGCC 3V7TA 1KXBA 1RD3B 3H7TA 1NFYA 4GUXA 2G55A 1CBWB 2ZGJA 5KECA 2GT8A 4FUHA 3T26A 1EASA 2BY9X 4KP0A 2Y7ZA 1Y3XA 2ZCHP 2QYIA 1UK2A 1CHGA 1AU8A 4AFQA 1PYTD 2PKSC 4XDEA 1TPPA 2ZU5A 3EGKH 4UDWH 3QX5H 4Q7ZA 1UVPA 3RXDA 1G3DA 1P9SA 1O2NA 1TFXA 1O3PB 5DP7A 2ZU3A 2SGPE 1K2I1 4UD9H 2ANMH 4XRNA 5EW1H 1IOEA 2BD2A 1D4PB 1XKAC 4I8HA 2DE9A 3GDSA 4NWLA 4DVAU 1O2LA 2A4QA 3TNTA 9ESTA 4ABHA 1BBRH 3P17H 1XUJA 3UWJH 1H4WA 4DY7B 4A1TA 1WAYB 5FXLA 1L1NA 2C8XB 4BNRA 3SV2H 4TWYA 1ELFA 4IC6A 1BZXE 5EIYA 1VJ9U 1AI8H 1SG8B 4WVPE 5HM9A 1J8AA 1AZZA 4BAKB 3EDXB 3RMOH 3SUEA 4AFUA 1AVGH 1KDQA 1O2OA 1O3CA 1EJMA 5T3HA 3TNSA 1SGPE 2VWOA 1LTOA 2VIPA 3RMLH 4X1QU 4B2BA 1TGCA 1ZMLA 1C5TA 4THNH 1O3IA 1C1UH 3UQOA 4P00A 1SLUB 1KIGH 1HIAB 2VVCA 4JYVH 1IQIA 1O2IA 4CRFA 1SGNE 1W0KD 4O03A 1TGSZ 1GL1A 1AWHB 3LIWA 1EAWA 2K8IA 3A7YA 2EEKA 2J9NA 1LCYA 1C2LA 4AX9H 2WINI 1ZGVA 4OS1A 3LC5A 4KTCA 4BTTB 3MNBA 1C2EA 1C1QA 1QJ7B 4JYTA 4GVUA 5K7RA 1EQ9A 3TGJE 1HAHH 1OWKA 2WUCA 4JZIA 4I8KA 1GPZA 5EJ1A 1UK4A 4GPGA 1HAVB 3UNRA 1BMAA 1EOLA 1GDQA 3LU9B 1O2TA 1O2QA 4K5ZA 1TLDA 1UW7A 5DP9A 1C4V2 1YCPH 4ABGA 2YMSB 1AD8H 4AG1A 3BSQA 1O36A 5F8ZA 1P01A 3BIUH 1WBGB 2BZ6H 3F6UH 4Q7XA 1CGIE 1IAUA 5LH8A 1TBQH 4I8GA 4CHAC 1SGCA 5FPSA 4YM9A 1GI9B 1GBCA 1O3NA 2CMYA 1Q31A 5HKKD 3RXMA 2FX4A 1O2UA 4DT4A 3VPKA 2WPMS 2VH0A 4MLFB 1BJUA 1EOJA 1V2JT 1JIMA 2VWLA 3IG6B 2TBSA 3D23A 2FS8A 2FP7B 3GOVB 1GBHA 3P95A 2F43B 1WQSA 2WPIS 3ZV8A 2H5CA 1KTTB 2UWOA 4JZ1A 1YPHE 2ZGXH 4U2WA 1HCGA 4TYDA 3PMAB 2V0BA 5LPEA 2BY5X 5AHGH 3FZZA 3F0OA 2XOKD 3B9FH 2ZWLH 1YP9A 1GGDB 2A7JA 2GCTC 2YMSC 3OE7D 4WXIA 1XVMA 1TMUH 1D6RA 1SC8U 5JB8S 4Y79A 4K1EA 4SGBE 3SJKA 1LKBA 3O8DA 2OC0A 1GMCF 2OP9A 3FVFB 2G8TA 2HNTF 1T8OA 3GY2A 1XVOA 3T25A 1C2HA 1TRYA 4AGKA 1D3QB 2BYAX 4KKDA 3UY9A 4A6LA 1UTLM 1UTNA 2FPZA 1AQ7A 2OXSA 2Z3EA 5EQQA 1ELBA 2WUBA 1MTWA 3LC3A 4NSYA 4YOGA 2BVRH 1T32A 2Z3CA 4ABBA 1C2FA 6GCHG 1S6FA 1UJ1A 1SGIB 1DLEA 1S5SA 3PYHA 3BTME 1BIOA 3SORA 3EA8A 5E0GA 5L2YH 1IHSH 4MNYA 1YKTA 1O2JA 1O5FH 1PPHE 2P59A 1HPGA 1SHYA 1OSSA 2C3SA 1TGNA 1P03A 3UTUH 3ZIAD 3RXAA 4JYUH 4X6MA 5GXPA 1GI0A 1GI8B 2PW8H 5EQSA 3DFJA 3WWBA 3PMBB 5J4QA 2BQ6B 2D8WA 5ESTE 1E38B 2A5AA 5F03A 1AB9B 3VB3A 1SSXA 1GBFA 1XX9A 6ESTA 2FTMA 5IK2D 3GY3A 5HXFA 3OYPA 2QXHA 2FOAA 3I77A 1TNIA 2ZPRA 3A86A 3DD2H 3BG8A 3BG4B 3VGCB 3MU5A 4E7RG 2R2WU 4CRBA 2WHXA 2IJD1 4X1PU 4ABEA 1WXRA 2G4UA 2AH4X 4BAQB 1LQEA 3PMJA 1LHEH 1SB1H 3GY7A 3HK3B 3SNEA 1ANCA 1N6XA 3HATH 1Z8JB 1P2NA 3CENA 2D26C 3E1XB 1W12U 3IWMA 2JJ1D 3ODDA 3HKJB 1EJAA 2BVXH 1TE0A 5KEDA 1O5AB 2EC9H 1LPKB 2R2MB 2ZKSA 1MD8A 3TJVA 2GVFA 5C5OA 1RTKA 3A8BA 4E06H 3A7ZA 3SO3A 1YF4A 1LPGB 4RT0A 3OEHD 3WY8A 3SGBE 1NN6A 1Y8TA 1ZTJA 4MNWA 3QUMP 3O8CA 1Z6JH 2LP6A 1UCYH 2NU4E 3A88A 2F4LA 2JETC 3KQ5A 2XC0A 4XD7D 1SGDE 1TBRH 1PPFE 2FMJA 4XOJA 4O9VA 4B73A 3ZVEA 2G5NA 4ZCNA 4XBDA 1QBVH 1ZJKA 1GHXH 3I29A 1UO6A 1ELDE 1IQKA 4HTCH 2XC4A 1H8DH 1C5OH 2A2XH 2FI4E 2A31A 3QWCH 2ODYB 2ZF0H 4ZH8A 1GI6A 1HGTH 1K1IA 2QF3A 3LGUA 2WPHS 1HFDA 3AAVA 1DWEH 1GMHG 4GLYA 3RXLA 1AZ8A 1OPHB 4NCYA 1Y5UT 3SHAH 2JJ2D 3CP7A 1TPOA 4MG3A 1HDTH 4LOYH 1S83A 5JYIA 1K0HA 1O3DA 2TRMA 2BD4A 2J4IA 3PV4A 3VXEH 4Q80A 1F0SA 1TPSA 2BDYA 4M7GA 1XUFA 4Q4LA 1TGBA 4P02A 1PPEE 1C2JA 1W0ZU 5JPMH 3PRDA 5C67A 4BANB 1SGQE 2P3UB 1P57B 4CH8B 1WUNH 3A7XA 2WPLS 4OGXA 1C5YB 3MHWU 1G3BA 3SU0A 1HJAC 4ABDA 3CS7A 1W14U 2FZZA 3ZVAA 4AOQA 1T7CA 2LNCA 3ENSB 1GJ5H 1PQ7A 1OWDA 2O8MA 1SKYE 1BTUA 4WMDA 1FY3A 3H09A 3LGYA 1NFUA 1C1SA 1TWXB 2TGDA 4WJG2 5C20A 2BLVA 1O2PA 4B74A 3LJJA 1ZHMA 2CF9H 3OU0A 5GNDA 1IQHA 1KXDA 1WTHD 4X6NA 4B6FA 1GJDB 3SI4H 4TY7A 1DY8A 1DWBH 3M5NA 1N8OB 3G01A 4MPVA 1HAIH 2B5TB 1UTOA 5HM2A 2AIPA 1GJ6A 1SLXB 1ZSKA 1JBUH 1LHGH 2KAIA 2A7CA 3E8LA 3F9EA 1IQGA 1BTWA 3D49H 3FAOA 3KEEA 4RI0A 1E34B 4ISHH 1C2GA 2G51A 3BEIB 4TPIZ 2NU3E 1QRWA 2XCNA 2KX4A 3DUXH 1GHAG 2C8WB 1D6WA 4MPUA 1DUEA 3S0NA 3UOUA 3NPSA 2VGCC 3KIDU 1Z1IA 1DFPA 2VGCB 2VIDA 2BY7X 4DOQA 3WWFA 4YTAA 2H9TH 1G30B 4X1NU 1QURH 2P8OC 2ZDMA 1HXEH 2WPDD 7KMEH 3U8OH 1PQAA 3PLKA 3GS9A 4ZROA 3N7DA 3RUOA 4ABFA 3QO6A 4RN6A 5GWZA 5DJ7A 5FCRA 1C1MA 1WYKA 2ZECA 1AMHA 3SUGA 4IW4E 3LOXA 1F0TA 1QRXA 4ZKOU 2HWLB 1MZAA 5C17A 5B6OA 2NU1E 1K1PA 1GI1A 5EG4A 1G37A 4TT3D 2AYWA 1OYTH 3DFLA 4AFSA 2A4GA 1Q3XA 1QB6A 2SFAA 1ETRH 4X2WA 1YGCH 1XXDA 3F2HA 1O3GA 1SL3A 3ZZ5A 2V3MA 2P94A 4F48B 3E6PH 1GWAA 1ZPCA 3BN9A 1HXFH 3RXHA 1LHFH 4FUJA 1QZ8A 1PJPA 1S6LA 4ISOA 4X8VH 1UMAH 4AFZA 3ATMA 1HAPH 4CR5A 1TIOA 1G3CA 1ANEA 1CA8B 3ZZCA 1AFQC 1FQ3A 4NIVA 1C2MA 1NU7B 1F7ZA 3RXJA 3EA7A 2W7UA 2HLDD 3NRLA 4B2AA 5A0CA 2B9LA 2AEIH 4JMYA 3ZZAA 2RCEA 2ZDNA 1NPMA 1ELEE 1HAXB 1S6HA 2VIWA 3SU3A 1FI8A 6CHAC 1O35A 4YESB 2XNDD 2GGVB 4WXVA 1S0RA 3HGNA 3R3GB 4A1VA 2V3HH 1FIZA 1QJ1B 3SQEE 1HJ9A 2ZQ2A 2QF4A 2KAIB 5DO4H 1GVZA 1ELCA 3UR9A 2A45B 3SJIA 1YCPM 3SYJA 1P0SH 1AKSA 4UONA 5E0JA 3LT3A 2M5TA 1PFXC 4U30A 3GCOA 1P3CA 3RXIA 5ETXA 1MH0A 1BT7A 2I6SA 5B6LA 1OXGA 6GCHF 2W5EA 3KQEA 1ZZZA 1LVBA 1TAWA 3GYMA 5EGMA 4DCDA 3F3BA 1SQAA 1WQVH 3JZ2B 7ESTE 3VFEA 1YPHC 1TNGA 4D9RA 1N6YA 4BTIB 1HAOH 2AGGX 2ANKH 2FOFA 3MTYA 3TITA 3GDVA 3URCA 2FYQA 3TH3H 2QA9E 3HK6B 1ELGA 1EPTC 1GJ8B 1Z8GA 1CHOG 2BMGB 1GMDG 2BLWA 1PQ8A 3MU4A 5A8XA 4R8TB 4K69A 4AN7A 2GV6A 3A89A 1GI3A 1QY6A 2CJIA 2G81E 3B23B 3NXPA 1GDUA 4FVDA 1K22H 1SGYE 1EZQA 4UFFH 3GCTF 1DPOA 1O5DH 2GZ9A 1ZJDA 1SOZA 2J95A 2VVUA 1NS3A 1S81A 1C1PA 3ESTA 1GBAA 1NBMD 3ZV9A 1KTSB 1O34A 3NCLA 3KF2A 2ANYA 1SGFA 2SNWA 4K60A 2EI7A 4Y10E 5AFZH 3TGKE 3F2GA 1MKXH 3ATWA 4ASUD 4WH8A 3RLYH 1A61H 2Z6BD 1YPEH 4ZHAA 4CRDA 1J14A 1GMHF 1W0JD 2BLOA 3ZVGA 1SOTA 2QIQA 1WCZA 3T2NA 2GCHF 1HUTH 1HAGE 2HALA 3BIVH 5AF9H 2AGEX 1V2ST 2NWNA 5TCCA 3SU2A 1INCA 3PV5A 1A3BH 1P06A 3KYGA 3GY6A 1YPGH 4YT7H 4RKOB 1MD7A 2FI3E 2H2ZA 5I25A 3ATIA 1C5UA 1YY3A 3OY5U 2Q1JA 1H8HD 3M61U 5GCHG 1O2MA 1W0YH 3RXSA 3MO3A 1A1RA 3TIUA 5AFYH 4I32A 1HIAA 1C5XB 1S82A 1W7XH 1QFKH 2IPQX 1WTGH 2QXIA 3TU7H 1GMDF 4BAMB 2TGAA 2BD9A 3B8JA 3BTEE 3BTKE 1GBTA 3EE7A 1GGDC 2GCTB 1MUEB 4FVBA 2ZZUH 1HLTH 5CE1A 3RXTA 4ISIH 2FOEA 2IPHA 2ASUB 3SU4A 2Z3DA 3SGQE 3KGPA 2Y5GA 3EYDA 2HVYB 1EXFA 3UNQA 2GD4B 4UFEH 4O3TA 3FOAA 4AZ2B 1O3LA 3RXBA 3RC6A 1RFNA 2ZC9H 2AS9A 1GHAF 4INHA 2YOLA 1DT2A 1YM0A 2GZ8A 1TX6A 1UTJA 4UEHH 1ZLRA 1TA6A 2GJGA 1IQLA 1Z71A 1GJBB 1BDAA 1UVOA 5DKMA 2OK5A 4K2YA 1Y59T 3NWUA 2HLCA 2QXGA 1O39A 5DP6A 2XW9A 4Y71A 5T1VA 3H5CB 1GJAB 2VB0A 1GBDA 4X2XA 3DHKH 2ZGBH 3FFGA 1B7XB 1GHZA 1IQEA 3ITIA 1RGQA 1ZYOA 3LH3A 3W95A 1HRTH 1UHBA 1CHOF 1QTFA 4FUGA 3MNCA 1SHHB 1O3EA 1LMWB 1P9UA 1GJ7B 4X8TH 1GG6B 2OINA 1O5EH 4AYYB 1ACBE 2BDIA 5AVDA 1FMGA 1MKWK 3ZVFA 1EAXA 2ZDKA 2ZFPH 1MTNB 3NKKA 4YZUA 5TJXA 1DSTA 1GBIA 2VIVA 1MMJN 4HZHA 1A4WH 3CNRA 1ESTA 1JMOH 1O3HA 2J98A 1C5WB 4GAWA 5EU8A 3WW7A 3QK1A 1UCYK 1JXPA 1ZMNA 3S7KB 1AUJA 5CMXH 3NUMA 1ZTKA 2ZCKP 3JZ1B 3BTTE 3E90B 3QLPH 3M3VA 1EKBB 1TBZH 1KXFA 2JH6D 4JK6A 2ZTXA 4IS5A 5EXMA 3U1JB 1S85A 1V2WT 1C5NH 3A81A 2CN0H 4YLQH 8ESTE 3RU4D 3SHCH 1O3AA 1V2UT 2D2DA 1YPKH 2ZNKH 1DANH 1P2QA 3SN8A 1HAZB 3V13A 1E35B 1KY9A 2ZO3H 1Y3WA 2ZI2H 5E8EH 1X7AC 3QN7A 3EE0B 1J9CH 1VITH 1GI5A 1WOFA 4U01A 1TPAE 3Q77A 1XXFA 1QRZA 3SGAE 1NFXA 4MNVA 5E2OA 5K0HA 3PWCA 3SNCA 3AASA 1THSH 4D7GA 4NFFA 1FZZA 1Y3VA 2FX6A 1SR5C 3KQCA 3MNXA 3RXEA 1DXPA 2EA3A 3T27A 3U8TH 5T6GA 2BOHB 1DLKB 2FEQH 3DSPA 1V2RT 3FP7E 3K6ZA 1BMLA 1LVOA 2L74A 1YLNA 1GCTC 3BTDE 4XSKU 1BMFD 2XBVA 2P3FH 3F68H 1T4VH 4NZQA 5C0UA 1V2VT 1RTFB 3F0PA 3MU1A 2OTVA 5DP3A 2F83A 2KCYA 4H4FA 1PPZA 1IQMA 2Z7FE 2Z9KA 2FI5E 3GY5A 1VCWA 1BUIA 1EFRD 3TPIZ 1GMCG 5T6FA 1MU6B 3K9XB 2Y81A 1YBWA 1P3EA 5F8TA 2R0KA 1QB9A 1VGCC 1FJSA 3RM0H 2P3TB 4K1TA 5EW2H 3E91A 1KLIH 1ANBA 3N99A 4QT8C 1AN1E 2ZA5A 1W2KH 3OY6U 1AVXA 3A8AA 1P09A 2AFQB 4ZXXH 1NRRH 1T31A 2VIOA 1DX5M 1SFQB 2XTTB 1L4DA 4E05H 2F9OA 2ZP0H 3PO1C 3K65B 1W13U 1RS0A 1OHHD 3NZIA 1JRSA 1XKBC 2OQUA 3GY4A 1V2TT 2BM2A 1PYTC 1DITH 4DURA 2ZFFH 2QN5T 4Y0YE 1TA2A 4Y0ZE 3SQHE 1DOJA 1SLVB 4IN2A 1NRPH 1O3JA 4X6PA 4GHQA 2V3OH 2Y80A 5DN6D 1GJ9B 2PWXA 1FY5A 2WV5A 4ZAEA 1MTNC 5A0BA 1C5MD 2HGTH 1A7SA 1H1BA 1ZSJA 3LH1A 3LPRA 1HAYB 4BAOB 4ZHMU 2Y82A 1NRNH 1P2OA 2FXRA 3SNBA 2A5IA 4GHTA 4GCHG 1P2KA 3QDZB 3LONA 3DA9B 1TNJA 3SV8A 2XBXA 5HGGA 2PKAA 4NIYA 4ZKSU 2HPPH 2ZGCA 1QBNA 2A1DB 1V2PT 3A7TA 3GICB 3TGIE 3OSYA 4HG6A 4CRGA 3RXCA 4OM9A 1FN6A 1D9IA 1JOUB 4BTUB 2V7QD 1XUGA 1S84A 5PTPA 2K0QA 1O38A 1MABB 4K8BA 1MBMA 3PV2A 2DUCA 1VR1H 5GIBA 2P8OB 2W3IA 4CRAA 4MQAA 2VWNA 1GCTB 1OS8A 3RXFA 4A5TS 4ESTE 2VH6A 2ZIQH 1YLDA 2XWBI 3OFND 2F9BH 1UVTH 5HIZA 2FOBA 3ZZ7A 1SGRE 3QZQA 3SOSA 2B8OH 2BDCA 1G2LA 1O5CB 2C4FH 1BMNH 1FAXA 2WPKS 1C1TA 4ZKNU 2XCFA 1A0LA 1GHYH 1SQRA 3SNAA 2AHME 1F0UA 5C1XA 1YWUA 1YLCA 3K6YA 4Y8ZA 1M9UA 5DP5A 4ASHA 3OEED 2FIRH 4K1SA 2WYGA 1KLJH 3QZRA 4X6OA 3M37A 4XBBA 1COWD 2VINA 1AB9C 4AB9A 3UREA 1GI2A 5E0HA 5EPYA 1BHXB 1FPCH 1QGFA 3TK6A 2TGPZ 8LPRA 1HB0B 1TRNA 3PLBA 1C9TA 1K1JA 1O2GH 1YPLH 5EJZA 1C2DA 1GG6C 4X1RU 1PPBH 1Y3YA 1CA0C 4H42U 3E0NB 3RXUA 2BTCE 1GL0E 1ZOMA 1BTPA 2J2UA 3PROA 3ZZBA 5E2PA 2PKAB 2AGIX 4OS7A 4X8SH 2SGQE 1FIWA 1GBJA 2J38A 1EPTA 2BZAA 1BHXF 2XNIA 3OAAD 4ISNA 3RXKA 1V2MT 2OC8A 3ZZ3A 1CGHA 1XMNB 3VG8A 1BBRK 1V2LT 2O8WA 3PRBA 5JB9S 2F9VA 2ZDLA 2V6NA 1ZRKA 1GHVH 3GCHC 3UQVA 4IBLH 1DDJA 2ANWA 2FOCA 3U98H 5F6MA 1CT4E 4Z0KA 2XWAA 1F2SE 2XBYA 1BMMH 1V2OT 3A83A 2G5VA 1IHTH 2GZ7A 2PUQH 4KELA 7GCHG 2Q6FA 2LPRA 1ZPBA 1OWJA 1C1VH 3LJOA 2ZU2A 4K3JA 4MTBA 4MVNA 2FWWA 5FPTA 1O2KA 2RDLA 1KSNA 1C5QA 2THFB 3RP2A 4B6EA 5FX6A 2BY8X 1T4UH 2XXLA 2KR7A 4R0IA 2SGAA 3R0FA 2NU0E 1YPJH 2OC1A 5LPRA 4ABIA 5C5NA 1G9IE 1QQUA 2XYAA 4I33A 1VITG 2BDGA 3RC4A 2A4RA 4D7FA 2QV1A 1E37B 2GT7A 3BV9B 1V3XA 5LPFA 2AIQA 1QNJA 3HPTB 3KNXA 4IN1A 3UPEA 2ODQA 1C4Y2 4O3UA 2JH5D 1O3KA 2W26A 4I8JA 1GHWH 3TH4H 1A3EH 1AY6H 1EP5A 1V2NT 3ZVDA 4HFPB 5G4BA 2Z9GA 1GBMA 3SNDA 1G32B 4NA9H 1YCPK 3UNSA 1G36A 2P93A 3DSGA 4UFGH 3AW1A 5BRRE 1GVLA 1FAKH 1OP0A 1TQ0B 4FUDA 1NESE 1LKAA 2FLRH 4Z1MD 1BRAA 1P2IA 1QL8A 4HI3A 3UUZA 2I6QA 3MO9A 3U28C 5HMAA 2STAE 1TOMH 2A32A 2Z94A 1TX8A 5GPIB 3MOCA 5ESBA 3SU6A 1GHBF 1QL7A 1L2EA 5FBIA 1K1MA 1MZDA 4FETA 1A5GH 2VWMA 1DE7H 5SGAE 1EJNA 2OLGA 3OX7U 3URDA 2BLQA 5H4IB 2W6ID 2GTBA 4OS5A 1TRMA 4E7NA 2KCPA 3VB7A 1DUAA 4FUEA 1A46H 1LHCH 3MH5A 4J2YB 2JKHA 5IYTA 1ANDA 1GJ4H 2ODPA 3EQ0H 3DSOA 1XUHA 3M5OA 2WSSD 2VNTA 2PKSB 2Y5FA 4ZMAH 2EY4C 3RXOA 1P10A 2IJOB 4JZDH 4YOIA 1SGEE 3RDZA 5IDKA 2PLXA 2UUJB 1KDQB 1ZGIA 1OWIA 3SUDA 5C3NA 2F9NA 1G3EA 4X8UH 1O33A 3F9FA 1V6DA 1OP8A 2EQNA 4F49A 2BX4A 4LZ1H 4X0WU 1OWHA 3ZVCA 2BQWB 2BQ7B 5JBBS 2GV7A 4NZLA 2KCOA 1CSOE 1SQOA 3FO8D 4ISLA 4AG2A 1GJCB 4Y7BA 2G4TA 3KYFA 2G00A 1WU1A 1QCPA 3HKIB 2BD5A 3A87A 1EAIA 1CT2E 2D1JA 3K2UA 3F9HA 2YMSD 1ID5H 1BOQA 1NC6A 5J4SA 3M7UA 4PROA 1ZMJA 1SPJA 1Z7KA 4FU8A 4B75A 4K8YA 1KMHB 4D8NA 1QJ6B 4RT1A 1C5VA 1W3CA 1AGJA 2PTNA 4RKJB 1FDPA 1HJ8A 3W1EA 1GI4A 1THRH 2KCAA 1K1LA 4Q2KA 2CF8H 3I78A 2RG3A 2P95A 3EA9A 1RRKA 1A5HA 2PSYA 5DP4A 3M35A 2A7HA 1FY4A 5FCKA 4MPXA 1PQ5A 1EZUC 4NIXA 3TJOA 2RA3A 1AUTC 2XRCA 5CHAC 1WDIA 1P2JA 1CGJE 3ATKA 1VZQH 4ZUHA 1BQYA 1C5RA 2W3KA 3PM3A 3PO1B 1C1NA 1DM4B 4DT7B 4DIHH 3UR6A 5TCAA 2ZHFH 4DJZB 2BVSH 1S0QA 5A8YA 3SW2B 3ZZ9A 1KXAA 1J17T 3BEFB 1UHBB 3PTNA 4Q7YA 1C5SA 3AK5A 1ARCA 2P16A 2V35A 2OD3B 4INLA 3ZYDA 1XM1A 2UUKB 1SMFE 4UFDH 1FPHH 3GCHB 1MTVA 3RXQA 4MDSA 3T28A 3F2FA 2Y5HA 2JH0D 2VIQA 1SFIA 1O2WA 1FY8E 4J1YA 1Z6EA 1O2ZA 4FXGH 2C90B 3ZZ4A 4H6SB 2ZFRH 3VEQB 1LDTT 2C8ZB 4CRCA 7LPRA 1LO6A 4IC5A 3N7OA 2F3CE 3LGVA 1O32A 5F53A 3GYLB 2UWLA 1TMBH 2B0FA 4UE7H 4SGAE 1OOKB 1P12E 4WWYA 3MH6A 2VU8E 4U32A 2HRVA 3A84A 4AB8A 2FODA 3MU8A 3S7HB 3ZVBA 3LGTA 4Y8YA 1K21H 3MH4A 2ALPA 4ZHLU 1A5IA 1FY1A 1MU8B 1QHRB 3QTVH 1GBEA 4KTSA 3P8GA 1DICA 3DCLA 2PTCE 3VB6A 1TGTA 3MQKC 1EZXC 1BRCE 4INKA 3GCNA 3A80A 4B2CA 1XUIA 4BXSA 3RU4E 4ACAA 1ZRBA 4AGJA 1BRBE 2SGFE 4FU9A 3P92A 3GY8A 5DGJA 1RTLA 1O3MA 2ILNA 4VGCB 2H9EH 3TLOA 1C5PA 2H9HA 1WSSH 3ZZDA 3ZZ8A 3P70B 2Y7XA 5JDUB 4WMFA 5EQRA 2HNTC 2TGTA 1Y3UA 3TVJB 2EI6A 1C2IA 4NFEA 1EZSC 1MBQA 1ORFA 4MNXA 2QAAA 4FOUC 2GKVE 1ZHRA 2GX4A 2BY6X 1AKSB 4MPWA 1P8VC 2O9QA 5DK1A 1FXYA 1HNEE 2L6OA 2M2AA 2ZPQA 2GDDA 1DY9A 4Y6DA 3C1KA 1DS2E 3A7VA 2XC5A 5FX5A 1F5KU 1RIWB 3U9AH 2A2QH 2ZQ1A 3D62A 2ZTYA 3ZZ6A 3ELAH 5L2ZH 2NU2E 2R3UA 3RXRA
chains in the Genus database with same CATH topology
3PTBA 3M3SA 1F5LA 1SI5H 3GISB 1DSUA 1GBLA 1ETSH 1O2HA 1O5GH 1HBTH 2AMQA 3QGNB 1AE8H 1PPCE 4NA7A 1ETTH 1OX1A 5I46H 3HGPA 8GCHF 1PPGE 3C27B 2FOMB 3MNSA 4CBOA 3P8NA 5C2ZA 3S9CA 1QL9A 3H7OA 4AORA 1J15A 1H9LB 1VCPA 2A4OA 2BXUH 1P11E 1P05A 2CXVA 2PGBB 3STJA 4A92A 2YNBA 4JZEH 1MAYA 1NU9A 2TIOA 5ABWA 1IQFA 1QIXB 1C2KA 2PV9B 1ARBA 1H8IH 1W8BH 3SJ8A 5GJ4B 1GDNA 3SI3H 1C4U2 2ESTE 2F9UA 4NIWA 1GBBA 1E0FD 2PFEA 1ABIH 2VJ1A 1Z1JA 1CQQA 1O2XA 3V3MA 2UUYA 2BX3A 1TALA 1NZQH 3MYWA 4Y11E 1BCUH 2EI8A 1EB2A 2Z9IA 1L1JA 1TB6H 1QBOA 3QGJA 1V2QT 1U6QA 2GDEH 3SV7A 4CREA 4FU7A 3T5FH 2G52A 3BTHE 2QXJA 2W7SA 1J16A 2BDHA 4TY6A 7GCHF 3P8OA 1GBKA 4IMQA 1D3TB 3VB4A 2OBOA 4X2YA 2Q6DA 1NTPA 1L0ZA 3TJNA 2F91A 2O8TA 3UWIA 1SGFG 4YLUA 1A0JA 2H5DA 2HPQH 2ZGHA 2ZHDA 1EATA 1W10U 3KHVA 5BPEA 2CV3A 3M36A 1C5ZB 2SGDE 2WPJS 3TK9A 4O97A 3PB1E 4A1XA 1MKXK 1AE5A 2R0LA 4KGAA 4LXBH 1SGTA 4YO9A 3M5LA 1Q2WA 6CHAB 1ELVA 4I31A 4KTUA 4LK4A 4CH2B 3E16B 3BF6H 1FV9A 4IGDA 1BTXA 3MWIU 1T8NA 1GCDA 1O30A 1C1RA 1CO7E 1UTMA 1VJAU 1NY22 4CHAB 1CT0E 1OYQA 1P04A 1K1NA 2O8LA 3F1SB 5DG6A 2Z9LA 1G2MA 1ZPZA 3SV9A 3O8RA 3LKWA 1UCYE 2QF0A 1YPMH 2DE8A 3UIRA 1XUKA 3FZDA 1P02A 2FLBH 4IMZA 1ELAA 1FONA 5JBAS 5DPAA 5GDSH 1YC0A 1TNLA 3A85A 3L6PA 5A8ZA 1AFEH 1O2VA 3AVZA 4BOHA 3ATLA 1MCVA 3MH7A 3P6ZB 1O3FA 3L33A 1ZR0A 2OC7A 3E3TA 1T8MA 5EPNA 1TOCB 1C1WH 2GP9B 2UWPA 1JWTA 3M3TA 1VITF 3U1IB 6LPRA 1C1OA 2QC2A 3IITA 3GDUA 4TPYA 1LHDH 1K1OA 2Y6TA 3RU4T 3SU5A 1O31A 3BEUA 4TWWA 2GCHG 2OCVB 1AO5A 3UFAA 2ZFQH 3PLPA 1TQ7B 2J34A 5DP8A 1C5LH 1T8LA 3BTFE 2PSXA 1D3DB 2QCYA 2TPIZ 4NSVA 3UOPA 3ZYEA 3EAJA 3RLWH 4OS4A 1O2YA 3T29A 1F0RA 3SU1A 4NWKA 1EP6A 1ESAA 2FYRA 2GMTB 3MFJA 4DIIH 4D76A 5A2MH 1NFWA 2AMDA 3T62A 2PR3A 2VVVA 1A0HB 3RMNH 2RA0A 5EODA 2Q6GA 4HGCA 1QA7A 2K1QA 3GCTG 4Z6AH 2FM2A 3RMMH 5EXNA 1KXCA 1TONA 2OBQA 2J92A 2CHAC 5EXLA 1OKXA 2BB4A 5JBTA 3SV6A 5A09A 1RXPA 3U69H 2ZPSA 1CVWH 1HV7A 3LGIA 2Z9JA 1K9OE 4BAHB 2ZHWH 1EX3A 5A0AE 1TX7A 4AYVB 1IQJA 1TYNA 2R9PA 3SZNA 1BA8B 4I7YH 1BB0B 3Q3XA 4B1TA 1EB1H 8GCHG 2FOHA 1UTKA 1CBWC 1EAUA 3U8RH 1ZSLA 2ZDVH 4JK5A 5FBEA 1GI7B 1MCTA 2H1UA 4RSPA 1L1GA 1O37A 5F8XA 1Z8RA 4CR9A 1O3BA 3TK5A 3O8BA 1ELTA 4LZ4B 1ZTLA 2BOKA 4WMEA 4GSOA 1B0EA 2WYJA 2BHGA 2BD3A 1FLEE 3BTGE 1BJVA 1GVKB 3V0XA 1O5BB 2PGQB 3ODFA 1NROH 1GHBG 4F4OC 2SGEE 1H9IE 1H9HE 1MTUA 1UTPA 4OS2A 1LQDB 2O8UA 3Q3YA 4OGYA 2XBWA 3TJUA 3LGWA 2ZDAH 2FTLE 2CGAA 3M5MA 1QA0A 8KME2 1FN8A 1SQTA 1LVMA 4CBNA 2A5KA 4OS6A 1AHTH 1AIXH 1YYY1 1F92A 4X2VA 4DW2U 1TMTH 5LGOA 2BDAA 1MQ6A 3S9AA 1DWDH 2J94A 1RIWC 1AWFH 4H6TA 2R3YA 4ABAA 1O0DH 2GMTC 3RXVA 1CE5A 3RM2H 3A8DA 2IN2A 4WF8A 1ESBA 5GCHF 2QY0B 1A2CH 1CA0B 1O2SA 2B7DH 1AVWA 2BD8A 2OUAA 2BXTH 2UUFB 5FAHA 4B71A 2ZU4A 3F9GA 3RC5A 2ZTZA 3AW0A 3LDXH 3SUFA 3E0PB 1NT1A 1OWEA 1NRSH 4X1SU 2FS9A 3A7WA 3DT0H 3PMHB 1MKWH 3MI4A 3A8CA 3A82A 4XE4A 1MTSA 5FPYA 5JBCS 4I8LA 3MU0A 2OQ5A 3S9BA 1D3PB 4XBCA 1BRUP 2ZEBA 3SBKA 3VB5A 3S69A 1N8OC 2PHBA 1KXEA 2ZCLP 3PWBA 3RXPA 1F5RA 3MO6A 1Y5AT 1B0FA 2YNAA 1O2RA 3M7TA 3AAUA 1SBWA 2STBE 1DVAH 3Q76A 4FUBA 1BBRE 4XFQA 2ZFSA 1QQ4A 1C9PA 1JRTA 4WY3A 1EPTB 1FUJA 3SJOA 1UVUH 2HNTE 4NA8A 3BTWE 1KYNA 3BTQE 1THPB 1RJXB 4VGCC 4ZXYH 4D9QA 1SVPA 1EUFA 3FP6E 1UVSH 2F9PA 1DXWA 1TNKA 4JCNA 1Z8IB 4JZFH 2PUXB 3M7QA 1ABJH 4DG4A 2SNVA 3L3TA 2A0QB 5HYOA 1BTHH 1MQ5A 4Y7AA 4DGJA 1VCQA 1NO9H 2FESH 4YT6H 3NK8A 3FANA 5EOKA 3RXGA 1UK3A 3KN2A 4FUIA 1FNIA 1WV7H 1B5GH 2HOBA 2ALVA 3QTOH 1JIRA 2FO9A 1OP2A 2HVXA 2ZHEH 5L6NH 2AMPA 1W11U 1BTZA 3KCGH 4B76A 3KQDA 1HJAB 1QB1A 4Y8XA 4FUCA 1P2MA 3MMGA 1VGCB 5CHAB 4A7IB 1IQNA 4GCHF 2H6MA 3Q00A 2C93B 1TABE 1E36B 4NG9H 4ZKRU 2IOTA 3Q3KA 5C1UA 2JETB 5L30H 1BITA 4Y76A 1AFQB 2AERH 1MAXA 9LPRA 4YOJA 4WH6A 1LVYA 5T6DA 2BD7A 5C1YA 3TH2H 2ZFTA 4ABJA 1O3OA 1L4ZA 1QR3E 1TNHA 2ZHQH 3P8FA 1NRQH 2BDBA 3W94A 1HYLA 2ZG0H 2FDAA 1ZHPA 3STIA 2FOGA 3V12A 1BTYA 1DWCH 3CS0A 2QGRA 2ZU1A 1KLTA 1SLWB 2C8YB 4BXWA 3KL6A 1NM6A 2WV4A 1CU1A 1HAVA 4FUFA 1LPZB 1N1LA 3D65E 3OTJE 3SJ9A 1V2KT 3VXFH 5FHTA 2CHAB 1Y5BT 3FP8E 2ULLA 1K28D 1UTQA 3KQBA 4NGAH 1W7GH 3BG4C 3VGCC 3V7TA 1KXBA 1RD3B 3H7TA 1NFYA 4GUXA 2G55A 1CBWB 2ZGJA 2GT8A 4FUHA 3T26A 1EASA 2BY9X 4KP0A 2Y7ZA 1Y3XA 2ZCHP 2QYIA 1UK2A 1CHGA 1AU8A 4AFQA 1PYTD 2PKSC 4XDEA 1TPPA 2ZU5A 3EGKH 4UDWH 3QX5H 4Q7ZA 1UVPA 3RXDA 1G3DA 1P9SA 1O2NA 1TFXA 1O3PB 5DP7A 2ZU3A 2SGPE 1K2I1 4UD9H 2ANMH 5EW1H 1IOEA 2BD2A 1D4PB 1XKAC 4I8HA 2DE9A 3GDSA 4NWLA 4DVAU 1O2LA 2A4QA 3TNTA 9ESTA 4ABHA 1BBRH 3P17H 1XUJA 3UWJH 1H4WA 4DY7B 4A1TA 1WAYB 5FXLA 1L1NA 2C8XB 4BNRA 3SV2H 4TWYA 1ELFA 4IC6A 1BZXE 1VJ9U 1AI8H 1SG8B 4WVPE 5HM9A 1J8AA 1AZZA 4BAKB 3EDXB 3RMOH 3SUEA 4AFUA 1AVGH 1KDQA 1O2OA 1O3CA 1EJMA 5T3HA 3TNSA 1SGPE 2VWOA 1LTOA 2VIPA 3RMLH 4X1QU 4B2BA 1TGCA 1ZMLA 1C5TA 4THNH 1O3IA 1C1UH 3UQOA 1SLUB 1KIGH 1HIAB 2VVCA 4JYVH 1IQIA 1O2IA 4CRFA 1SGNE 4O03A 1TGSZ 1GL1A 1AWHB 3LIWA 1EAWA 3A7YA 2EEKA 2J9NA 1LCYA 1C2LA 4AX9H 2WINI 1ZGVA 4OS1A 3LC5A 4KTCA 4BTTB 3MNBA 1C2EA 1C1QA 1QJ7B 4JYTA 4GVUA 5K7RA 1EQ9A 3TGJE 1HAHH 1OWKA 2WUCA 4JZIA 4I8KA 1GPZA 1UK4A 4GPGA 1HAVB 3UNRA 1BMAA 1EOLA 1GDQA 3LU9B 1O2TA 1O2QA 4K5ZA 1TLDA 5DP9A 1C4V2 1YCPH 4ABGA 1AD8H 4AG1A 3BSQA 1O36A 5F8ZA 1P01A 3BIUH 1WBGB 2BZ6H 3F6UH 4Q7XA 1CGIE 1IAUA 5LH8A 1TBQH 4I8GA 4CHAC 1SGCA 5FPSA 4YM9A 1GI9B 1GBCA 1O3NA 2CMYA 1Q31A 3RXMA 2FX4A 1O2UA 3VPKA 2WPMS 2VH0A 4MLFB 1BJUA 1EOJA 1V2JT 1JIMA 2VWLA 3IG6B 2TBSA 3D23A 2FS8A 2FP7B 3GOVB 1GBHA 3P95A 1WQSA 2WPIS 3ZV8A 2H5CA 1KTTB 2UWOA 4JZ1A 1YPHE 2ZGXH 4U2WA 1HCGA 4TYDA 3PMAB 2V0BA 5LPEA 2BY5X 5AHGH 3FZZA 3B9FH 2ZWLH 1YP9A 1GGDB 2A7JA 2GCTC 4WXIA 1XVMA 1TMUH 1D6RA 1SC8U 5JB8S 4Y79A 4K1EA 4SGBE 3SJKA 1LKBA 3O8DA 2OC0A 1GMCF 2OP9A 3FVFB 2G8TA 2HNTF 1T8OA 3GY2A 1XVOA 3T25A 1C2HA 1TRYA 4AGKA 1D3QB 2BYAX 4KKDA 3UY9A 4A6LA 1UTLM 1UTNA 2FPZA 1AQ7A 2OXSA 2Z3EA 5EQQA 1ELBA 2WUBA 1MTWA 3LC3A 4NSYA 4YOGA 2BVRH 1T32A 2Z3CA 4ABBA 1C2FA 6GCHG 1S6FA 1UJ1A 1SGIB 1DLEA 1S5SA 3PYHA 3BTME 1BIOA 3SORA 3EA8A 5E0GA 5L2YH 1IHSH 4MNYA 1YKTA 1O2JA 1O5FH 1PPHE 2P59A 1HPGA 1SHYA 1OSSA 2C3SA 1TGNA 1P03A 3UTUH 3RXAA 4JYUH 4X6MA 5GXPA 1GI0A 1GI8B 2PW8H 5EQSA 3DFJA 3PMBB 5J4QA 2BQ6B 2D8WA 5ESTE 1E38B 2A5AA 5F03A 1AB9B 3VB3A 1SSXA 1GBFA 1XX9A 6ESTA 2FTMA 3GY3A 5HXFA 3OYPA 2QXHA 2FOAA 3I77A 1TNIA 2ZPRA 3A86A 3DD2H 3BG8A 3BG4B 3VGCB 3MU5A 4E7RG 2R2WU 4CRBA 4X1PU 4ABEA 2G4UA 2AH4X 4BAQB 1LQEA 3PMJA 1LHEH 1SB1H 3GY7A 3HK3B 3SNEA 1ANCA 1N6XA 3HATH 1Z8JB 1P2NA 3CENA 2D26C 3E1XB 1W12U 3IWMA 3ODDA 3HKJB 1EJAA 2BVXH 1TE0A 1O5AB 2EC9H 1LPKB 2R2MB 2ZKSA 1MD8A 3TJVA 2GVFA 5C5OA 1RTKA 3A8BA 4E06H 3A7ZA 3SO3A 1YF4A 1LPGB 3WY8A 3SGBE 1NN6A 1Y8TA 1ZTJA 4MNWA 3QUMP 3O8CA 1Z6JH 1UCYH 2NU4E 3A88A 2JETC 2XC0A 1SGDE 1TBRH 1PPFE 2FMJA 4XOJA 4O9VA 4B73A 3ZVEA 2G5NA 4XBDA 1QBVH 1ZJKA 1GHXH 3I29A 1UO6A 1ELDE 1IQKA 4HTCH 2XC4A 1H8DH 1C5OH 2A2XH 2FI4E 2A31A 3QWCH 2ODYB 2ZF0H 4ZH8A 1GI6A 1HGTH 1K1IA 2QF3A 3LGUA 2WPHS 1HFDA 3AAVA 1DWEH 1GMHG 4GLYA 3RXLA 1AZ8A 1OPHB 4NCYA 1Y5UT 3SHAH 3CP7A 1TPOA 4MG3A 1HDTH 4LOYH 1S83A 5JYIA 1O3DA 2TRMA 2BD4A 2J4IA 3PV4A 3VXEH 4Q80A 1F0SA 1TPSA 2BDYA 4M7GA 1XUFA 1TGBA 1PPEE 1C2JA 1W0ZU 5JPMH 5C67A 4BANB 1SGQE 2P3UB 1P57B 4CH8B 1WUNH 3A7XA 2WPLS 4OGXA 1C5YB 3MHWU 1G3BA 3SU0A 1HJAC 4ABDA 3CS7A 1W14U 2FZZA 3ZVAA 4AOQA 1T7CA 2LNCA 3ENSB 1GJ5H 1PQ7A 1OWDA 2O8MA 1BTUA 4WMDA 1FY3A 3LGYA 1NFUA 1C1SA 1TWXB 2TGDA 4WJG2 5C20A 2BLVA 1O2PA 4B74A 3LJJA 1ZHMA 2CF9H 3OU0A 1IQHA 1KXDA 1WTHD 4X6NA 1GJDB 3SI4H 4TY7A 1DY8A 1DWBH 3M5NA 1N8OB 3G01A 4MPVA 1HAIH 2B5TB 1UTOA 5HM2A 2AIPA 1GJ6A 1SLXB 1ZSKA 1JBUH 1LHGH 2KAIA 2A7CA 3E8LA 3F9EA 1IQGA 1BTWA 3D49H 3FAOA 3KEEA 1E34B 4ISHH 1C2GA 2G51A 3BEIB 4TPIZ 2NU3E 1QRWA 2XCNA 3DUXH 1GHAG 2C8WB 1D6WA 4MPUA 1DUEA 3S0NA 3UOUA 3NPSA 2VGCC 3KIDU 1Z1IA 1DFPA 2VGCB 2VIDA 2BY7X 4DOQA 4YTAA 2H9TH 1G30B 4X1NU 1QURH 2P8OC 2ZDMA 1HXEH 7KMEH 3U8OH 1PQAA 3PLKA 4ZROA 3RUOA 4ABFA 3QO6A 4RN6A 5GWZA 5DJ7A 5FCRA 1C1MA 1WYKA 2ZECA 1AMHA 3SUGA 4IW4E 3LOXA 1F0TA