1FONA

Crystal structure of bovine procarboxypeptidase a-s6 subunit iii, a highly structured truncated zymogen e
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
SWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPTVDYEHCSQWDWWGITVKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWIDETIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine procarboxypeptidase A-S6 subunit III, a highly structured truncated zymogen E.
pubmed rcsb
molecule tags Serine protease
molecule keywords PROCARBOXYPEPTIDASE A-S6
total genus 55
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fonA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fonA01
2OC7A 1O3LA 1BT7A 3RXTA 4AG1A 1F7ZA 3FP8E 1YCPH 2OC1A 7ESTE 1HJAB 1P2OA 4TYDA 3RM2H 3KQBA 1GJ9B 2GCHF 1GDQA 2P95A 5BRRE 2C8XB 3RC6A 4AX9H 1MTNB 2AIPA 1P3CA 7GCHF 6CHAC 1H9LB 1ZHRA 1KXAA 2B5TB 4ZMAH 1F5KU 2GZ8A 4ISNA 2ZPRA 3E90B 1ZYOA 2ZZUH 4FUCA 2D26C 4RKOB 3AAUA 1ESTA 4ZUHA 4AYYB 4BAHB 2ZU1A 2O9QA 2BVRH 2VGCC 2W7UA 1C5YB 2Q6DA 3CS7A 1C5OH 1SGIB 1XUIA 2C90B 1D3TB 2BDBA 3BEUA 2AH4X 1UTJA 4MDSA 3FAOA 2PFEA 5IYTA 1EOJA 3MU5A 3BTDE 3M7UA 5CHAB 1C1WH 1NRQH 1MQ5A 4O3TA 1BJUA 4MNXA 2ZI2H 2ANYA 4OGYA 1DLEA 4DIIH 1PPFE 4KELA 1O2HA 1EX3A 1FN8A 1GVLA 3D49H 3A87A 1W0ZU 1Y5AT 1T32A 1VR1H 3LGUA 4HZHA 4YZUA 1AFQB 1FIWA 5A2MH 4I8KA 4B2CA 1VJ9U 3SV6A 2ZIQH 4K1EA 3QUMP 3ZV9A 4MTBA 3ZZ6A 1O3IA 2QIQA 5T6FA 1BRCE 1P2KA 3SO3A 1C1VH 1SLVB 2AEIH 2XWAA 1ZJDA 4YESB 2NU1E 3RDZA 1IQEA 1NS3A 3UY9A 5JYIA 4GLYA 3P92A 5L2ZH 3P8OA 1WV7H 5JBBS 3UIRA 1IHSH 2BY6X 1OWEA 2BDIA 5E0JA 1TMTH 2A4RA 3TJOA 4NG9H 1XXFA 1O36A 3KNXA 2ANKH 4JZEH 1ZLRA 5E2OA 1BZXE 4DG4A 2OXSA 3W95A 3P70B 3MWIU 4YOJA 4UFGH 4Y7AA 4B73A 1P06A 3SHCH 1HDTH 1YPEH 3K65B 2FOAA 4KKDA 2OP9A 1VJAU 4YT6H 4JCNA 1A0JA 3ATWA 3T62A 2SNVA 2OLGA 3ESTA 4FUIA 4ZAEA 2ZHWH 3RMLH 3U1JB 1BUIA 5LPFA 1IQGA 1W3CA 4WY3A 5E2PA 1C5LH 1Z8IB 3RUOA 1NO9H 3MH7A 5HGGA 1OOKB 3A7ZA 3QZRA 3NWUA 1J14A 3JZ2B 2SGPE 1XVMA 1C1MA 1C5VA 3VB3A 2VWMA 2FYRA 2G52A 2BZAA 5DP3A 1BTWA 2YNBA 3GISB 2ZG0H 4Y8YA 3OY5U 1JWTA 2ZTYA 1GHYH 5C1YA 1GGDC 5F8TA 4Q7ZA 1O0DH 1SLWB 1GBLA 1SLUB 4WVPE 3KQCA 4IN2A 2FOCA 2Z9KA 1HAZB 2BD4A 4X2YA 3RXEA 3ZZ7A 1GI0A 2ZCKP 3V0XA 2UUJB 4OS1A 1JXPA 2H5DA 3LGTA 4UDWH 1TPPA 4DIHH 5E0HA 2V3OH 5H4IB 1SI5H 3VFEA 1HAOH 3GY5A 5ETXA 3RXBA 2F3CE 2R2WU 3RXFA 2IN2A 4K5ZA 1GI2A 8ESTE 1O5DH 1O32A 1SHYA 2VIWA 2J4IA 2F9PA 1SGRE 7GCHG 1W11U 2BDHA 3ELAH 4NGAH 3H5CB 3KL6A 4X1PU 1QR3E 5AFYH 1C2JA 3QK1A 3HKIB 3A85A 1P11E 4Y11E 1J16A 1PPGE 2ZTZA 3ZZCA 2P59A 4NA7A 5DGJA 2KAIA 3RXVA 2B7DH 4R8TB 1KDQA 1UHBA 2VNTA 1FUJA 4J2YB 2IOTA 1CA8B 1EPTA 3B9FH 2P93A 5FHTA 1F5LA 1SGDE 1NN6A 1QFKH 1AWHB 1ZPBA 2F9OA 3KIDU 2EA3A 4X2WA 4BAOB 3FP6E 3HK3B 6GCHF 2FX6A 5JBCS 1KYNA 2QN5T 1P2QA 4TPIZ 1DVAH 4O9VA 2FODA 1NT1A 3SORA 1GBAA 2GZ9A 4AFUA 2HPPH 1GDNA 1W10U 2VINA 1C5UA 1O3EA 1GBDA 1HAXB 2W26A 4XSKU 2LNCA 3ATLA 1W12U 4AGJA 4VGCB 2J95A 2JH6D 1QA0A 2NU0E 1KXBA 1TPAE 2AMQA 3RMMH 3MFJA 1ZSJA 2Y80A 1ZMNA 1V2RT 1SMFE 3A83A 2ZQ2A 4FUFA 3O8DA 2CGAA 3Q00A 1IQJA 3MO9A 1EPTB 3DHKH 1ANEA 1O2GH 1N8OC 1S0QA 5A0BA 1V2OT 4IMZA 3NCLA 5DJ7A 1TGNA 2ZGBH 1GDUA 4MNYA 1GL0E 1BDAA 5TCAA 1OP2A 2PKSC 2GMTC 1J15A 1C5NH 2DE8A 3OSYA 1J9CH 1P01A 2BQ7B 1TQ7B 4Q7XA 1YCPM 2F9NA 3RXSA 3BTEE 1QGFA 1O5GH 1TGSZ 1H8IH 1P3EA 4UFDH 3BIUH 3NK8A 3QLPH 2Y6TA 3E1XB 1T31A 1HAYB 1O2TA 4Q2KA 3TJNA 4CRDA 2VIDA 4JMYA 5DKMA 1D9IA 3MH5A 4ABGA 3RXGA 1LKAA 3T5FH 1ZMLA 1DOJA 4BANB 2G00A 4GAWA 4MNWA 4X8TH 1PQ7A 1WTHD 3KQDA 5EXNA 1O5EH 1VZQH 2PGQB 1TA6A 3QGJA 4K8YA 4BAKB 1YPLH 1N6XA 1GI6A 3GCTF 3SU4A 2FLBH 3VEQB 3CS0A 3ZZBA 3BTFE 3E3TA 4OS5A 2NU3E 2ANMH 2P3TB 4YT7H 3ATKA 1O3MA 2P3FH 3BTHE 4X6NA 1WAYB 1UTNA 1AZ8A 3M5NA 4JK6A 1V2PT 1F2SE 3L6PA 1EP5A 1C1PA 1LVYA 3P17H 3U1IB 5DP9A 1TB6H 1XUFA 4PROA 3ENSB 2CHAC 2G4TA 5C1UA 3M36A 3RXOA 1P9UA 2ZHFH 4X8SH 3A80A 1BBRH 3LGWA 1EXFA 1D3PB 2Z7FE 1ZTKA 4JZDH 3GDUA 3SUFA 1MUEB 3VB6A 4D9RA 1P10A 1H1BA 3RC5A 2CMYA 1UVSH 1AMHA 1VCWA 2UUKB 2AGGX 1F0RA 1OWHA 1GGDB 3SGQE 2A7JA 1BRAA 1O2IA 4NZLA 1GI1A 2FI4E 3OU0A 3RXJA 4B1TA 1WQVH 4D8NA 3GYMA 4CRGA 2BY8X 1EZUC 1AUJA 1O3KA 1RD3B 1Y5BT 2J38A 3ZZ3A 1C2FA 4OS6A 5AFZH 1O2QA 2HVXA 2KAIB 3R0FA 1C2MA 1Z7KA 1G2MA 2O8MA 1SL3A 1EB2A 1UVUH 3O8CA 1GBMA 1NM6A 3PTNA 4H42U 5EOKA 1GHBG 2AFQB 3GYLB 2BDYA 1VITG 1FY5A 4XE4A 4FUGA 3JZ1B 1GI9B 1V2MT 4MPUA 4GUXA 1O2LA 2AYWA 3SU0A 2OCVB 3VGCC 2P8OB 1F0UA 1SGEE 5TJXA 1ZOMA 2FDAA 5A8YA 1K1JA 2THFB 2GGVB 1YPJH 3A7YA 4D7GA 1SFIA 3TNTA 3HGNA 4FU9A 2R3UA 1AZZA 1TFXA 5C3NA 3NZIA 5HYOA 5GWZA 4O3UA 2RA3A 4KP0A 2HALA 5EG4A 3M3VA 3I78A 1RIWC 3M7TA 1C9PA 5J4QA 1MH0A 1O3CA 3LH3A 1TYNA 3LC3A 5DG6A 2ZDKA 4ABDA 1NRPH 4AOQA 2TGDA 1Q31A 3URCA 2P94A 9LPRA 1HB0B 4CRFA 3E0PB 1S6FA 3U8OH 3ZZ9A 3ZZ5A 2UWPA 1GJ4H 1KXEA 3LT3A 1AFQC 1ZTJA 3MH4A 3O8BA 2VJ1A 2J94A 1MCTA 1LDTT 1TLDA 1U6QA 6ESTA 1TGTA 4IC5A 5LGOA 4FVBA 3RU4D 2C3SA 1HYLA 1JOUB 4AYVB 1DUEA 1HFDA 4CR5A 1O3FA 4CHAC 1EAWA 4DW2U 3T29A 5DO4H 4CREA 2XCNA 1Y59T 3UREA 1C2IA 1Q2WA 1ESBA 1VITF 1C2LA 2ZP0H 2FP7B 1GHBF 1YPMH 2FOFA 2FPZA 3MO3A 1MZDA 1JIMA 1FNIA 1GL1A 1THRH 2ZHQH 3BV9B 3NKKA 1EKBB 2Z9IA 1O2VA 3QGNB 2G5NA 1SC8U 4F49A 1CA0B 1QL9A 2PLXA 3D65E 1GVKB 4AFZA 3E91A 1LVBA 1V3XA 3RU4E 2XTTB 3I77A 2O8WA 3VGCB 4ISHH 3Q3YA 4K1TA 1K2I1 4B71A 3V12A 1KLIH 3PO1C 1O2NA 1QQ4A 1PQAA 3M5MA 1EASA 1BMMH 1GI3A 2GT8A 2WPIS 1EJNA 1BTPA 3B8JA 1C5QA 1E38B 2BMGB 2RA0A 3PMAB 1GHWH 3AAVA 4CRCA 3BIVH 1O31A 1UK2A 2A31A 1GBIA 2VWLA 3UWJH 1BTUA 1SQOA 2Y7XA 4MNVA 3S9AA 1VCPA 2ZTXA 1BBRK 3BF6H 1LQDB 1SHHB 4BTUB 2XC0A 3F9GA 2B9LA 4A1VA 1ESAA 3GY6A 2ZNKH 4NIYA 1ELEE 3BTTE 4K2YA 2GVFA 3RMNH 2SGEE 1JIRA 1MD8A 2BVXH 3SNCA 1J17T 1EJMA 1EUFA 4MPWA 1GJCB 1GBTA 3IITA 3BG4B 1C1OA 1AVGH 5K7RA 2CXVA 1WQSA 2CHAB 1IOEA 4O03A 2ZDMA 2CF9H 4IS5A 1C4V2 2H5CA 1O5FH 2F9BH 5ABWA 4K69A 5GJ4B 1QNJA 1P8VC 2A7HA 2XNIA 3F9FA 2BYAX 1ZTLA 1HV7A 1QB6A 3A86A 1AD8H 1ELBA 1ZPZA 4B2BA 1YF4A 2ZKSA 2PHBA 1RTFB 4IMQA 4MPVA 2VWNA 4BXSA 1S82A 1TNHA 5E8EH 3SJIA 1OPHB 5FBEA 4Z6AH 1ACBE 1SG8B 1LCYA 3C1KA 4X8VH 3ATMA 1A7SA 3SBKA 2ZA5A 1MQ6A 4XOJA 4TWWA 4XBDA 3SU3A 1PFXC 1YPKH 4ZHLU 4ZHMU 2PKAB 1N1LA 3RU4T 4CRBA 2LPRA 1CT4E 2HPQH 4MPXA 1ZMJA 1T4UH 3RLWH 1O2YA 2GTBA 3QDZB 3KCGH 4ZKNU 3SUDA 2BQ6B 3NXPA 2BD7A 4H6TA 2JH5D 1UVOA 1NC6A 1P2NA 3RC4A 1BHXF 1YC0A 1AO5A 1FAKH 3ZZDA 1MCVA 2PUXB 2QV1A 4U30A 3FANA 1OX1A 2ZEBA 2B8OH 1L1JA 4Z0KA 2WPHS 3Q3KA 2VIOA 2W7SA 2D2DA 2ZDLA 1L2EA 3RXAA 2TGTA 2BDGA 4NFFA 3K6YA 5LPEA 1MBQA 4X2XA 1MKXK 3PM3A 4TWYA 1TRYA 3RXQA 4SGBE 1NRSH 1ANBA 1E34B 4Y0ZE 1HJ9A 1DM4B 3D62A 1L0ZA 2G5VA 1BMLA 2QXHA 1LHDH 1O34A 2ZHDA 3TITA 5A8XA 5G4BA 2BB4A 2DUCA 3SJKA 4DOQA 3PTBA 4NIVA 3V7TA 4YLQH 3D23A 1FI8A 1LPGB 2Z3DA 2XRCA 2VU8E 1SGTA 2FOGA 1WCZA 1O2KA 2F83A 3EGKH 2XWBI 4UD9H 1AN1E 2ANWA 2A1DB 1G3DA 3TNSA 1PYTC 3F9HA 2Z94A 1EAUA 1QL7A 1GHXH 3SV2H 2VVUA 3R3GB 3BG4C 4NWKA 5EPNA 1BRUP 3M35A 2PKAA 5C2ZA 1G2LA 1C9TA 3A88A 4FUDA 3BTWE 3UUZA 1HNEE 1AVWA 2TIOA 1T7CA 1YPHC 2ZC9H 1C2KA 1C2EA 3SV9A 3LGVA 3S7HB 1G3CA 4SGAE 1F92A 3BG8A 1Y3XA 2G4UA 1Z8GA 3UPEA 1WYKA 3LGYA 2Z3EA 1K28D 1FY4A 1O2SA 3E0NB 2GDDA 2XCFA 1TQ0B 5EQRA 1PPEE 3BN9A 4FUBA 1GJBB 1OS8A 5I46H 2FTMA 1QRWA 2C93B 1K1PA 5GCHF 4Y79A 1HUTH 1FV9A 8LPRA 3NUMA 5DP7A 4X2VA 1IQNA 2A5AA 2J92A 3SHAH 4FU7A 1QBVH 1RJXB 3T2NA 1NESE 3TH2H 4NWLA 1UK3A 2STAE 2FMJA 1UTOA 4KTUA 5L2YH 1WU1A 1GMHG 5A8ZA 4NSVA 1G3EA 2PUQH 2BY9X 1AKSB 2M5TA 1PJPA 1XM1A 4U32A 5AVDA 1FLEE 1FONA 1SFQB 1OWKA 4GHTA 1A3BH 2ZCHP 4BNRA 2ODYB 3ODFA 4ZXXH 2ZDVH 4A7IB 1KSNA 3V3MA 1O2OA 4Y8XA 2ZU3A 3LJOA 1MKXH 2FOEA 1KXFA 1O2WA 2OQ5A 3B23B 1EB1H 2GV7A 3A8AA 2PKSB 2CJIA 3UR6A 1P05A 3TK6A 1LPZB 4ABHA 3TGKE 2EI7A 1MU6B 1BIOA 3GCNA 3UWIA 5A0AE 3H7TA 4B74A 1XUKA 1GBKA 3MOCA 5F8XA 1MMJN 4AN7A 2FLRH 1HXFH 1UO6A 3ZVGA 1TGBA 2ZU4A 5EW2H 1C2GA 4YTAA 2SGAA 1BBRE 2EI8A 4Y8ZA 1T8LA 3ITIA 1A1RA 1AIXH 1JMOH 2SGDE 3A82A 4B2AA 1C1UH 3SNDA 1QY6A 3T26A 3UNRA 5DP4A 1A2CH 1TOMH 1UTLM 1CHOF 1LO6A 1BOQA 1D3DB 4AB8A 3M37A 2OQUA 1D6WA 1TONA 1LHGH 4ISOA 1HBTH 2BD2A 2C8WB 3T25A 2FYQA 1OSSA 1ABIH 1HAVA 1OXGA 2H9TH 3F68H 3T27A 1GI8B 1UK4A 1DT2A 1C5PA 5F03A 4BAMB 1QCPA 4D76A 2FS8A 1FPHH 2ZGJA 1SGNE 1J8AA 1NRNH 5HXFA 1UTMA 2ESTE 2WYJA 2ZO3H 3PROA 3F6UH 1GMCG 2FX4A 1GWAA 1THPB 1HAGE 2ALVA 4AZ2B 6LPRA 1C5XB 3A81A 3UNQA 2QXGA 2Y5FA 3WY8A 3HPTB 4M7GA 1IQKA 3BTGE 4FUHA 3TLOA 1P9SA 3STJA 5SGAE 4AFSA 2WV5A 2P16A 1P2MA 1RGQA 1KLTA 1DXPA 1HAIH 2PGBB 1P2JA 3EA9A 1XKAC 2G8TA 3DFLA 3G01A 2J34A 3SQEE 3K2UA 3SU1A 3PO1B 5EXLA 1O33A 3TGIE 3EA8A 1O3JA 1CVWH 1V6DA 1DWEH 1GG6C 3ATIA 5L6NH 2Z3CA 4ABJA 1ZRBA 4ABEA 1FJSA 2FWWA 1H9HE 1JRSA 1O39A 3DA9B 3QX5H 4ZH8A 1GCDA 3BEIB 3SZNA 1H4WA 2ZU2A 2FOBA 1EZQA 1DY9A 1QB9A 3A7VA 3KHVA 3TK5A 3MU1A 4DURA 3ZVCA 1Q3XA 1UVTH 1A4WH 4HI3A 1QURH 1C5ZB 3NPSA 4NCYA 3P8FA 1MTVA 1Y3VA 3SU6A 3ZZ4A 2ZFRH 2BLVA 1O3GA 4GCHF 4AG2A 4I7YH 2A7CA 4BXWA 8GCHF 1SQAA 1V2LT 5JBTA 5C67A 2XBWA 5EPYA 1C1RA 1VITH 4A92A 4CHAB 1HJAC 5ESTE 1NRRH 1NU7B 4ABBA 4RKJB 4U2WA 1P57B 1C2HA 1FDPA 1GMCF 1AFEH 5TCCA 1KY9A 3SJ9A 1GBJA 2GT7A 1DLKB 3RM0H 1X7AC 3Q77A 5FPSA 1GHAF 4WMEA 1O2UA 2A5IA 1V2WT 1QBOA 4YO9A 2HWLB 3VB4A 2AIQA 1DX5M 2EI6A 1LKBA 3I29A 1ARCA 3RXRA 4BTIB 5AF9H 3AW0A 1DUAA 1W14U 3SI4H 4NSYA 3PV4A 1AUTC 1S6HA 1CA0C 2HLCA 3SNEA 2JETB 5A0CA 4O97A 1FN6A 2QA9E 1A46H 2FEQH 4I31A 3Q76A 1UCYK 1OKXA 1TBZH 3SW2B 4LOYH 2Z9JA 1MU8B 1Y3YA 2H6MA 1N8OB 4D7FA 3ZZ8A 5FBIA 3TVJB 4I8LA 4I8HA 4JK5A 3RXPA 4AORA 2J2UA 2G81E 2VVCA 4UEHH 1NFUA 1TMUH 1WTGH 3MYWA 1P04A 2BXTH 9ESTA 1ORFA 3MU0A 3S7KB 4THNH 4BTTB 1BTYA 4K1SA 8GCHG 1MAXA 2PTNA 2GKVE 1TRNA 4KTSA 1BB0B 2A4GA 4LXBH 1ELTA 1GJ7B 1UJ1A 3MU4A 1O2PA 3SOSA 1H8DH 1K22H 2YOLA 1LVMA 1L1NA 4NA9H 4AFQA 3SN8A 4E7NA 1O3DA 1SOZA 1K21H 3A8BA 4I32A 1V2JT 4YM9A 3VXEH 5CHAC 3GCTG 2CV3A 1EZXC 1DDJA 1RIWB 2QF0A 2VWOA 1KXDA 3FVFB 2VGCB 3HK6B 2HGTH 1O38A 4K8BA 4WJG2 4OGXA 4OS4A 5DP5A 2C8ZB 1TALA 1NROH 1SGFG 2A4QA 1Z8RA 4WXIA 4JYUH 2Y7ZA 2ULLA 2A0QB 1QJ7B 2P8OC 3PMJA 1S81A 2P3UB 2UWLA 5C20A 2OBQA 2O8UA 3FZDA 5I25A 2FESH 1GI4A 1OYQA 3M61U 3ODDA 1TNJA 4JYVH 1RXPA 2GDEH 1GJ8B 5FPYA 1CGHA 2Q1JA 2OC8A 2UUYA 1HAPH 1GI7B 2HRVA 1IQFA 1ETSH 2R0KA 1DWDH 1S85A 2GZ7A 1C2DA 1GJ5H 4NA8A 4INHA 3GY8A 1INCA 1HPGA 4HFPB 5C5OA 3MNSA 1Y3UA 4ABIA 1SBWA 5EXMA 3ZVEA 2ZGCA 3OY6U 2W5EA 1WOFA 3ZVAA 1D4PB 1VGCB 2STBE 1JBUH 2Y5GA 1CT2E 1D6RA 3DFJA 3M3SA 4RSPA 2BDCA 1PQ8A 2GMTB 2WYGA 1A5IA 4GSOA 3EYDA 2RG3A 3MO6A 4I33A 3LC5A 4AB9A 1RRKA 3RXCA 2ZFPH 1UTQA 1BMNH 1WSSH 2H9EH 2WUCA 4WH8A 1XX9A 1TX7A 1SB1H 4X0WU 1TNIA 2Y82A 3LPRA 1MD7A 2QAAA 1AE8H 1ELDE 3RXIA 2XC5A 4Y7BA 1ZSKA 2CF8H 1V2KT 1E0FD 1TPOA 2FZZA 4MLFB 2XBXA 3PLPA 1BHXB 2QY0B 1NFWA 1C5MD 3BSQA 3SQHE 1HIAB 2OC0A 1ABJH 1XXDA 4A5TS 3SI3H 5FX6A 4BOHA 2XW9A 5DP6A 1QJ6B 1O2MA 1IHTH 2VIPA 2V6NA 2PSYA 3CP7A 1GHZA 2VH6A 1GMHF 4XBBA 4FUEA 3A7XA 1S0RA 1V2UT 2Y81A 3MNXA 3GY4A 3S9CA 1DY8A 1MAYA 3M7QA 2TGAA 5C5NA 3PMHB 1S84A 1GJAB 1YKTA 2ZF0H 1TGCA 3RXMA 3TK9A 1AY6H 1BA8B 2ILNA 1H9IE 3PYHA 3HKJB 4MG3A 3LOXA 1C1TA 2XBVA 2I6SA 3LGIA 3P8GA 1DITH 1C5WB 3FFGA 4ZROA 5F8ZA 4H6SB 1BTHH 1VGCC 1P12E 2O8LA 4R0IA 2I6QA 1LVOA 2G51A 1G30B 1DANH 1PPZA 4QT8C 1LHEH 1XUHA 3UQOA 1TE0A 2UWOA 4ZXYH 1MTUA 2BM2A 2Q6GA 1C1NA 4VGCC 1EQ9A 4WF8A 4I8GA 2ZFQH 3SU5A 3IWMA 1BRBE 1ETTH 1CSOE 5BPEA 5CMXH 2HNTE 2WPJS 4DT7B 1GPZA 1ZSLA 2V35A 1K1LA 3U9AH 2TRMA 3UOUA 1BCUH 1Y3WA 1CU1A 1DSUA 5EQSA 3UOPA 1TRMA 3MNBA 3DT0H 3M5LA 2OUAA 2C8YB 3GY2A 1D3QB 4CRAA 4YOGA 3ZVFA 1CHGA 4CBNA 4LZ4B 2ZGXH 1SLXB 3OX7U 2HOBA 1KXCA 2WPMS 1KDQB 2ZU5A 5DPAA 1O5AB 5C1XA 1CGJE 1AGJA 1LPKB 2GCHG 2BLOA 2TPIZ 3SGAE 1MTNC 4IGDA 3TJUA 1G32B 2R2MB 5HM2A 2GD4B 1ARBA 4ZKSU 2H9HA 4DVAU 2A4OA 1DE7H 2GP9B 4A1TA 1C5SA 2PSXA 1O2ZA 1O3HA 1XUGA 3GCHB 1NU9A 1V2NT 4XFQA 4NFEA 4MVNA 1E36B 2PV9B 3E6PH 1TNLA 4X8UH 1YLDA 2NU2E 2V0BA 5JBAS 2VVVA 1GJ6A 5JB9S 1F5RA 3L3TA 1O30A 4JZIA 1GCTC 2AGEX 5EU8A 2GCTB 1FQ3A 1K1OA 1QIXB 1PQ5A 2AS9A 2BZ6H 2ZDNA 3VXFH 1A0LA 3ZZAA 5T6DA 1Y5UT 3A89A 1LHCH 3EQ0H 4UFEH 1SSXA 1W2KH 2A2QH 4FVDA 4Y71A 4CR9A 1V2ST 3RMOH 1YYY1 1AI8H 2G55A 3ZVDA 1ZRKA 1C4U2 1W13U 4LZ1H 1MBMA 4IC6A 1YLCA 3OTJE 1SVPA 1G37A 4GPGA 4X1NU 4FU8A 5L30H 1O3AA 1EJAA 1T4VH 1HJ8A 1N6YA 2FI3E 1KLJH 4FUJA 3QN7A 5GCHG 3F9EA 1PYTD 3RLYH 1TX8A 2Z6BD 4GCHG 4Y76A 1FY1A 4K3JA 5FPTA 3L33A 1EOLA 4XDEA 2WV4A 2QC2A 1QA7A 4DJZB 2D8WA 2R0LA 2W3IA 4U01A 2GX4A 1HXEH 1ELAA 1GCTB 3PLKA 5GDSH 2WINI 4H4FA 4ABAA 4Y10E 5EODA 2ZQ1A 5FCRA 3GDSA 1ANCA 2YNAA 1A3EH 1CT0E 1DSTA 1DWBH 3GICB 4WH6A 3TPIZ 2HNTC 1SGCA 5IDKA 4E06H 1BMAA 1O35A 1E35B 2Z9LA 3GCOA 1CO7E 1GMDF 1O2JA 1SGFA 4Y0YE 1FY3A 3U98H 3UTUH 1GBHA 1NTPA 2QF3A 2WPLS 3PWBA 4A6LA 3QZQA 1V2TT 1L4ZA 1G9IE 2BY7X 1Y8TA 1JRTA 1PPBH 1Z8JB 1ZHPA 2DE9A 3STIA 3SNBA 3K9XB 2EC9H 1EATA 2AGIX 1P02A 1RTLA 3PWCA 1EP6A 1S5SA 3BTKE 4YOIA 1P0SH 2QYIA 3VB5A 1CBWB 1TX6A 2NU4E 1QRXA 2WUBA 3SJOA 2PW8H 1IQIA 3RXUA 3P8NA 4NZQA 1XVOA 3U69H 3FZZA 1B5GH 1OWIA 3BTME 4X6OA 1O5CB 1K9OE 3LJJA 1QRZA 1RTKA 5HM9A 3QWCH 1TA2A 1QJ1B 2FIRH 1BTXA 4TY6A 2V3HH 1CHOG 1C5TA 2IPHA 1UHBB 1GG6B 1YCPK 1K1NA 4DY7B 1SQTA 4AGKA 4WWYA 1IQLA 1DXWA 1YP9A 4D9QA 1XKBC 1QBNA 1PPCE 3KQEA 3E16B 3QTVH 2BTCE 4Y6DA 4IN1A 1WBGB 1YPHE 2D1JA 1Z1JA 2VH0A 1GBBA 5T6GA 1P03A 4BAQB 1MKWK 2BQWB 2ZFFH 5B6OA 5J4SA 4CH8B 7KMEH 2W3KA 1E37B 3KEEA 3LH1A 1BQYA 1CQQA 1TBQH 1DFPA 4KTCA 3HGPA 5GIBA 1G3BA 1ZR0A 2ZECA 1T8OA 1W7GH 1HLTH 4UONA 4JZ1A 6CHAB 1YM0A 1YGCH 3MH6A 3T28A 1FZZA 3K6ZA 3ZV8A 5EW1H 1AKSA 2UUFB 4LK4A 2QGRA 1GHVH 1O2XA 5FAHA 2B0FA 1ANDA 3MI4A 1AU8A 4ABFA 4ZKRU 2A45B 4WXVA 1MZAA 1LTOA 1O37A 2ZFSA 6GCHG 4OS2A 1AE5A 3TIUA 8KME2 2H1UA 3OYPA 2AMDA 5A09A 1O3PB 1YPGH 5EGMA 1ELFA 3VB7A 4X1SU 4OS7A 1O3BA 1VCQA 2FXRA 3GOVB 2BX3A 2BLQA 3LU9B 1UCYE 1XUJA 3E8LA 1EZSC 1Z6EA 4JYTA 5FX5A 1OWJA 1OP8A 3URDA 4KGAA 2QCYA 3O8RA 2BDAA 2JKHA 5JPMH 1O3OA 3PMBB 4Q7YA 1SGYE 5AHGH 1TAWA 3AW1A 1L4DA 3KF2A 1TPSA 1TNKA 5FCKA 2Q6FA 3BEFB 1UMAH 3LDXH 1EAXA 4WMDA 4RN6A 7LPRA 3LKWA 2TGPZ 3SU2A 3VPKA 1HCGA 1FAXA 3M5OA 5T3HA 2BD9A 1EPTC 2ZDAH 1IQMA 2ZFTA 3RP2A 4ZHAA 2FM2A 3S0NA 2SGQE 1GVZA 2VIVA 1C1SA 1EAIA 1SOTA 2FI5E 1BTZA 2BXUH 3RXDA 1NY22 3PLBA 2TBSA 1DICA 3A84A 3A8DA 4ASHA 2A5KA 2F91A 1L1GA 4IW4E 2VB0A 4JZFH 1LQEA 2BD8A 2BVSH 2XYAA 3MNCA 1QTFA 5ESBA 4E7RG 1ZGVA 3IG6B 1A5GH 3EDXB 2FOMB 2ASUB 2GCTC 1GMDG 4XBCA 1SGQE 1ZZZA 1SPJA 3RXHA 1B7XB 1KTSB 1S83A 3MHWU 1PPHE 1UTPA 3SV8A 2EEKA 3CENA 2FO9A 1TNGA 3TH4H 1SR5C 1ZHMA 4I8JA 4IBLH 2RDLA 5LPRA 1M9UA 1TWXB 4B76A 2BOKA 3TH3H 2JH0D 3GCHC 4YLUA 3DD2H 3Q3XA 2F9VA 2HNTF 1DWCH 1C1QA 4WMFA 1TOCB 3S69A 3ZYDA 3AVZA 5CE1A 2R3YA 2ZHEH 1OWDA 4A1XA 3SNAA 3QO6A 2BX4A 1AB9B 2SFAA 1AB9C 1O2RA 2ODQA 3BTQE 1ZPCA 1QB1A 3TU7H 1ID5H 3EE0B 5LH8A 1NFYA 1W0YH 1AVXA 1ZGIA 4INKA 5GXPA 3SJ8A 4B75A 3ZVBA 4DCDA 2AERH 3C27B 1KIGH 3U8TH 1TABE 3FP7E 3ZYEA 4X6PA 3KN2A 2R9PA 2FTLE 2CN0H 1AHTH 4Q80A 2BY5X 1ELVA 2XXLA 4FXGH 1P09A 4CBOA 1B0FA 4INLA 3P95A 3W94A 1G36A 2K1QA 1F0SA 2ZPQA 4ISIH 3SV7A 1A61H 3A7TA 1W8BH 1WUNH 4X6MA 2XC4A 1XMNB 3PB1E 4NIXA 1FXYA 1UVPA 4TPYA 2VIQA 1FPCH 1Z1IA 2NWNA 5GPIB 4E05H 1HAVB 3H7OA 5F6MA 1BITA 5K0HA 1CBWC 2Y5HA 3LIWA 1QQUA 1YBWA 1GHAG 2A2XH 1F0TA 2FS9A 4J1YA 4TY7A 1NFXA 2C4FH 1DS2E 1HRTH 1HIAA 1DPOA 4CH2B 2ZWLH 3QTOH 2Z9GA 1FMGA 3UNSA 3GY7A 4F4OC 3GY3A 1ETRH 1QHRB 3A7WA 1TBRH 2SNWA 3MU8A 2ZGHA 2PR3A 1SGPE 2FOHA 4MQAA 1BJVA 3N7OA 4X1QU 3TGJE 5DK1A 4HTCH 1ELGA 1GBFA 2BLWA 2XBYA 3P6ZB 2JETC 4NIWA 3V13A 2H2ZA 1RS0A 2AMPA 5E0GA 3UFAA 1A0HB 3SGBE 1KTTB 1Z71A 2OTVA 1OYTH 3RXLA 2ALPA 2SGFE 1CE5A 2O8TA 3UR9A 1IAUA 2F9UA 2ODPA 1Z6JH 1W7XH 3GDVA 1GBEA 2RCEA 4ESTE 2BHGA 2OD3B 1TIOA 4GVUA 3F1SB 1O5BB 3RXKA 1A5HA 1C4Y2 5FXLA 1LMWB 4X1RU 1V2VT 3SUGA 3DUXH 5JB8S 2A32A 5HMAA 5DP8A 4UFFH 1FIZA 4GHQA 4UE7H 1UCYH 1UTKA 2WPKS 1B0EA 2J9NA 2BD3A 2QXJA 3EAJA 1MTSA 3KGPA 2PWXA 1RFNA 2QXIA 1CGIE 1GBCA 1GI5A 3SUEA 1MTWA 5JDUB 1T8MA 2ZCLP 1ELCA 1GJDB 3A8CA 5PTPA 3UQVA 1QL8A 3HATH 1K1IA 3LONA 1AQ7A 2GV6A 1HGTH 4DGJA 3TJVA 1NPMA 1THSH 1FY8E 1HAHH 3S9BA 2OBOA 2OINA 1T8NA 2ZPSA 3MTYA 4HGCA 2PTCE 4ISLA 1V2QT 2BD5A 3AASA 1LHFH 1C5RA 2BOHB 1MKWH 5EQQA 3MMGA 1P2IA 1O3NA 1OP0A 3M3TA 4ZKOU 3EA7A 1NZQH 3U8RH 1ZJKA 1TMBH 1IQHA 1AWFH 2IJOB 4K60A 1K1MA
chains in the Genus database with same CATH superfamily
2OC7A 1O3LA 1BT7A 3RXTA 4AG1A 1F7ZA 3FP8E 1YCPH 2OC1A 7ESTE 1HJAB 1P2OA 1SQRA 4TYDA 3RM2H 3KQBA 1GJ9B 2GCHF 1GDQA 2P95A 5BRRE 2C8XB 3RC6A 4AX9H 1MTNB 2AIPA 1P3CA 7GCHF 6CHAC 1H9LB 1ZHRA 1KXAA 2B5TB 4ZMAH 1F5KU 3U28C 2GZ8A 4ISNA 2J98B 2ZPRA 3E90B 1ZYOA 2ZZUH 4FUCA 2D26C 4RKOB 3AAUA 1ESTA 4ZUHA 4AYYB 4BAHB 2ZU1A 2O9QA 2BVRH 2EQNA 2VGCC 2W7UA 1C5YB 2Q6DA 3CS7A 1C5OH 1SGIB 1XUIA 2C90B 1D3TB 2BDBA 3BEUA 2AH4X 1UTJA 1NBME 4MDSA 3FAOA 2PFEA 5IYTA 1EOJA 3MU5A 3BTDE 3M7UA 5CHAB 1C1WH 1NRQH 1MQ5A 4O3TA 1BJUA 4MNXA 2ZI2H 2ANYA 4OGYA 1DLEA 4DIIH 1PPFE 4KELA 1O2HA 1EX3A 1FN8A 1GVLA 3D49H 3A87A 1W0ZU 1Y5AT 1T32A 1VR1H 3LGUA 4HZHA 2YMSB 4YZUA 1AFQB 1FIWA 5A2MH 4I8KA 4B2CA 1VJ9U 3SV6A 2ZIQH 4K1EA 3QUMP 3ZV9A 4MTBA 3ZZ6A 1O3IA 2QIQA 5T6FA 1BRCE 1P2KA 3SO3A 1C1VH 1SLVB 2AEIH 2XWAA 1ZJDA 4YESB 2NU1E 3RDZA 1IQEA 1NS3A 3UY9A 5JYIA 4GLYA 3P92A 5L2ZH 3P8OA 3F0OA 1WV7H 5JBBS 3UIRA 1IHSH 2BY6X 5EJZA 1OWEA 2BDIA 5E0JA 3DCLA 1TMTH 2A4RA 3TJOA 4NG9H 1XXFA 1O36A 5C0UA 3KNXA 2ANKH 4JZEH 1ZLRA 5E2OA 1BZXE 4DG4A 2OXSA 3W95A 3P70B 3MWIU 4YOJA 4UFGH 4Y7AA 4B73A 1P06A 3SHCH 1HDTH 1YPEH 3K65B 2FOAA 4KKDA 2OP9A 1VJAU 4YT6H 4JCNA 1A0JA 4ACAA 3ATWA 3T62A 2SNVA 2OLGA 3ESTA 4FUIA 4ZAEA 2ZHWH 3RMLH 3U1JB 1BUIA 5LPFA 1IQGA 1W3CA 4WY3A 5E2PA 1C5LH 1Z8IB 3RUOA 1NO9H 3MH7A 5HGGA 1OOKB 3A7ZA 3QZRA 3NWUA 1J14A 3JZ2B 2SGPE 1XVMA 1C1MA 1C5VA 3VB3A 2VWMA 2FYRA 2G52A 2BZAA 5DP3A 1BTWA 2YNBA 3GISB 2ZG0H 4Y8YA 3OY5U 1JWTA 2ZTYA 1GHYH 5C1YA 1GGDC 2KCYA 5F8TA 4Q7ZA 1O0DH 1SLWB 1GBLA 1SLUB 4WVPE 3KQCA 4IN2A 2FOCA 2Z9KA 3FOAA 1HAZB 2BD4A 4X2YA 3RXEA 3ZZ7A 1GI0A 2ZCKP 3V0XA 2UUJB 4OS1A 1JXPA 3VG8A 1KMHB 2H5DA 3LGTA 4UDWH 1TPPA 4DIHH 5E0HA 2V3OH 5H4IB 1SI5H 3VFEA 1HAOH 3GY5A 5ETXA 3RXBA 2F3CE 2R2WU 3RXFA 2IN2A 4K5ZA 1GI2A 8ESTE 1O5DH 1O32A 1SHYA 2VIWA 2J4IA 2F9PA 1SGRE 7GCHG 1W11U 2BDHA 3ELAH 4NGAH 3H5CB 3KL6A 4X1PU 1QR3E 5AFYH 1C2JA 3QK1A 3HKIB 2F43B 3A85A 1P11E 4Y11E 3WWFA 1J16A 1PPGE 2ZTZA 4B6EA 3ZZCA 2P59A 4NA7A 5DGJA 2KAIA 3RXVA 2B7DH 4R8TB 1KDQA 1UHBA 2VNTA 1FUJA 4J2YB 2IOTA 1CA8B 1EPTA 3B9FH 2P93A 2XNDD 5FHTA 1F5LA 1SGDE 1NN6A 1QFKH 1AWHB 1ZPBA 2F9OA 3KIDU 2EA3A 4X2WA 4BAOB 3FP6E 3HK3B 6GCHF 2FX6A 5JBCS 1KYNA 2QN5T 1P2QA 4TPIZ 1DVAH 4O9VA 2FODA 1NT1A 2L74A 3SORA 1GBAA 2GZ9A 4AFUA 2HPPH 1GDNA 1W10U 2VINA 1C5UA 1O3EA 1GBDA 1HAXB 2W26A 4XSKU 2LNCA 3ATLA 1W12U 4AGJA 4VGCB 5C17A 2J95A 2JH6D 1QA0A 2NU0E 1KXBA 1TPAE 2AMQA 3RMMH 3MFJA 1ZSJA 2Y80A 1ZMNA 1V2RT 1SMFE 2WSSD 3A83A 3PV5A 2ZQ2A 4FUFA 3O8DA 2CGAA 3Q00A 1IQJA 5DN6D 3WW7A 3MO9A 1EPTB 3DHKH 1ANEA 1O2GH 1N8OC 1S0QA 5A0BA 1V2OT 4IMZA 3NCLA 3SZEA 5DJ7A 4ZCNA 1TGNA 2ZGBH 1GDUA 4MNYA 1GL0E 1BDAA 5TCAA 1OP2A 2PKSC 1K0HA 2GMTC 1J15A 1C5NH 2DE8A 3OSYA 1J9CH 1P01A 3OFND 2BQ7B 1TQ7B 4Q7XA 1YCPM 2F9NA 3RXSA 3BTEE 1QGFA 1O5GH 1TGSZ 1H8IH 1P3EA 4UFDH 3BIUH 3NK8A 3QLPH 2Y6TA 3E1XB 1T31A 3UB0A 1HAYB 1O2TA 3WWBA 4Q2KA 3TJNA 4CRDA 2VIDA 4JMYA 5DKMA 1D9IA 3MH5A 4ABGA 3RXGA 4AC9A 1LKAA 3T5FH 1ZMLA 1DOJA 4BANB 2G00A 4GAWA 4MNWA 4X8TH 1PQ7A 1WTHD 3KQDA 5EXNA 1O5EH 1VZQH 2PGQB 1TA6A 3QGJA 4K8YA 4BAKB 1YPLH 2AHME 1N6XA 1GI6A 3GCTF 3SU4A 2FLBH 3VEQB 3CS0A 3ZZBA 3BTFE 3H09A 3E3TA 4OS5A 2NU3E 2ANMH 2P3TB 4YT7H 3ATKA 1O3MA 2P3FH 3BTHE 4X6NA 1WAYB 1UTNA 1AZ8A 3M5NA 4JK6A 1V2PT 1F2SE 5KEDA 3L6PA 1EP5A 1C1PA 1LVYA 3P17H 3U1IB 5DP9A 1TB6H 3F2GA 5GNDA 1XUFA 4PROA 2JJ2D 2CHAC 3ENSB 2G4TA 5C1UA 3M36A 3RXOA 1P9UA 2ZHFH 4X8SH 3A80A 1BBRH 3LGWA 1EXFA 1D3PB 2Z7FE 1ZTKA 4JZDH 3GDUA 3SUFA 1MUEB 3VB6A 4D9RA 1P10A 1H1BA 3RC5A 2CMYA 1UVSH 1AMHA 1VCWA 2UUKB 2AGGX 1F0RA 1OWHA 1GGDB 4TT3D 3SGQE 2A7JA 2F4LA 1BRAA 1O2IA 4NZLA 1GI1A 2FI4E 3OU0A 3RXJA 4B1TA 1WQVH 4D8NA 3GYMA 4CRGA 5EIYA 2BY8X 1EZUC 1AUJA 1O3KA 1RD3B 1Y5BT 2J38A 3ZZ3A 1C2FA 4OS6A 5AFZH 1O2QA 2HVXA 2KAIB 3R0FA 1C2MA 1Z7KA 2O8MA 1G2MA 1SL3A 1VKYA 1EB2A 1UVUH 3O8CA 1GBMA 1NM6A 3PTNA 4H42U 5EOKA 1GHBG 2AFQB 3GYLB 2BDYA 1VITG 1FY5A 4XE4A 4FUGA 3JZ1B 1GI9B 1V2MT 4MPUA 4GUXA 1O2LA 2AYWA 3SU0A 2OCVB 3VGCC 3ZIAD 2P8OB 1F0UA 1SGEE 5TJXA 1ZOMA 2FDAA 5A8YA 1K1JA 2THFB 2GGVB 1YPJH 3A7YA 4D7GA 1SFIA 3TNTA 3HGNA 4FU9A 2R3UA 1AZZA 1TFXA 5C3NA 2K0QA 3NZIA 2J98A 5HYOA 5GWZA 4O3UA 2RA3A 4KP0A 2HALA 5EG4A 3M3VA 3I78A 1RIWC 3M7TA 1C9PA 5J4QA 1MH0A 1O3CA 3LH3A 1TYNA 3LC3A 5DG6A 2ZDKA 4ABDA 1NRPH 4AOQA 2TGDA 1Q31A 3URCA 2P94A 9LPRA 1HB0B 4CRFA 3E0PB 1S6FA 3U8OH 3ZZ9A 3ZZ5A 2UWPA 1GJ4H 1KXEA 3LT3A 1AFQC 1ZTJA 3MH4A 3O8BA 2VJ1A 2J94A 1MCTA 1LDTT 2WPDD 1TLDA 1U6QA 6ESTA 1TGTA 4IC5A 5LGOA 4FVBA 3RU4D 2C3SA 1HYLA 1JOUB 4AYVB 1DUEA 1HFDA 4CR5A 1O3FA 4CHAC 1EAWA 4DW2U 3T29A 5DO4H 3FKSD 3PV2A 4CREA 2XCNA 1Y59T 3UREA 1C2IA 1Q2WA 1ESBA 1VITF 1C2LA 2ZP0H 2FP7B 1GHBF 1YPMH 2FOFA 2FPZA 4P00A 3MO3A 1MZDA 1JIMA 1FNIA 1GL1A 1THRH 2ZHQH 3BV9B 3NKKA 1EKBB 2Z9IA 5IK2D 1O2VA 3QGNB 2G5NA 1SC8U 4F49A 1CA0B 1QL9A 2PLXA 3D65E 1GVKB 4AFZA 3E91A 1LVBA 2K8IA 1V3XA 3RU4E 2XTTB 3I77A 2O8WA 3VGCB 4ISHH 3Q3YA 4K1TA 1K2I1 4B71A 3V12A 1KLIH 3PO1C 1O2NA 1QQ4A 1PQAA 3M5MA 1EASA 1BMMH 1GI3A 2GT8A 2WPIS 1EJNA 1BTPA 3B8JA 1C5QA 1E38B 1NBMD 2BMGB 2RA0A 3PMAB 1GHWH 3AAVA 4CRCA 3BIVH 1O31A 1UK2A 2A31A 1GBIA 2VWLA 3UWJH 1BTUA 1SQOA 2Y7XA 4MNVA 3S9AA 1VCPA 2ZTXA 1BBRK 3BF6H 1LQDB 1SHHB 4BTUB 2XC0A 3F9GA 5EJ1A 2B9LA 4A1VA 1ESAA 3GY6A 2ZNKH 4NIYA 1ELEE 3BTTE 4K2YA 2GVFA 3RMNH 2SGEE 1JIRA 1MD8A 2BVXH 3SNCA 1J17T 1EJMA 1EUFA 4MPWA 1GJCB 1GBTA 3IITA 3BG4B 1C1OA 1AVGH 5K7RA 2CXVA 1WQSA 2CHAB 1IOEA 4O03A 2ZDMA 2CF9H 4IS5A 1C4V2 2H5CA 1O5FH 2F9BH 5ABWA 4K69A 5GJ4B 1QNJA 1P8VC 2A7HA 2XNIA 3F9FA 2BYAX 1ZTLA 1HV7A 1QB6A 3A86A 1AD8H 1ELBA 1ZPZA 4B2BA 1YF4A 2ZKSA 2PHBA 1RTFB 4IMQA 4MPVA 2VWNA 4BXSA 1S82A 1TNHA 5E8EH 3SJIA 1OPHB 5FBEA 4Z6AH 1ACBE 1SG8B 1LCYA 3C1KA 4X8VH 3ATMA 1A7SA 3SBKA 2ZA5A 1MQ6A 4XOJA 4TWWA 4XBDA 3SU3A 1PFXC 1YPKH 4ZHLU 4ZHMU 2PKAB 1N1LA 3RU4T 4CRBA 2LPRA 1CT4E 2HPQH 4MPXA 1E1QD 1ZMJA 1T4UH 3RLWH 1S6LA 1O2YA 2GTBA 3QDZB 3KCGH 4ZKNU 3SUDA 2BQ6B 3NXPA 2BD7A 4H6TA 2JH5D 1UVOA 1NC6A 1P2NA 3RC4A 1BHXF 1YC0A 1AO5A 1FAKH 3ZZDA 1MCVA 2PUXB 2QV1A 4U30A 3FANA 1OX1A 2ZEBA 2B8OH 1L1JA 4Z0KA 2WPHS 3Q3KA 1E1RD 2VIOA 5FL7D 2D2DA 2W7SA 5HIZA 2ZDLA 1L2EA 3RXAA 2TGTA 2BDGA 4NFFA 3K6YA 5LPEA 1MBQA 4X2XA 1MKXK 3PM3A 4TWYA 1TRYA 3RXQA 4SGBE 1NRSH 1ANBA 1E34B 4Y0ZE 1HJ9A 1DM4B 3D62A 1L0ZA 2G5VA 1BMLA 2QXHA 1LHDH 1O34A 2ZHDA 3TITA 5A8XA 5G4BA 2BB4A 2DUCA 3SJKA 2J97A 4DOQA 3PTBA 4NIVA 3V7TA 4YLQH 3D23A 1FI8A 1LPGB 2Z3DA 2XRCA 2VU8E 1SGTA 2FOGA 1WCZA 1O2KA 2F83A 3EGKH 2XWBI 4UD9H 1AN1E 2ANWA 2A1DB 1G3DA 3TNSA 1PYTC 3F9HA 2Z94A 1EAUA 1QL7A 1GHXH 3SV2H 2VVUA 3R3GB 3BG4C 4NWKA 5EPNA 1BRUP 3M35A 2PKAA 5C2ZA 1G2LA 1C9TA 3A88A 4FUDA 3BTWE 3UUZA 1HNEE 1AVWA 2TIOA 1T7CA 1YPHC 2ZC9H 1C2KA 1C2EA 3SV9A 3LGVA 3S7HB 1G3CA 4SGAE 1F92A 3BG8A 1Y3XA 2G4UA 1Z8GA 2QF5A 3UPEA 1WYKA 3LGYA 2Z3EA 1K28D 2W6JD 1FY4A 1O2SA 3E0NB 2GDDA 2XCFA 1TQ0B 5EQRA 1PPEE 3BN9A 4FUBA 1GJBB 1OS8A 5I46H 2FTMA 1QRWA 2C93B 1K1PA 5GCHF 4Y79A 1HUTH 1FV9A 8LPRA 3NUMA 5DP7A 4X2VA 1IQNA 2A5AA 2J92A 3SHAH 4FU7A 1QBVH 1RJXB 3T2NA 1NESE 3TH2H 4NWLA 1UK3A 2STAE 2FMJA 1UTOA 4KTUA 5L2YH 1WU1A 1GMHG 5A8ZA 4NSVA 1G3EA 2PUQH 2BY9X 3KYFA 1AKSB 2M5TA 1PJPA 1XM1A 4U32A 5AVDA 1EFRD 1FLEE 1FONA 1SFQB 1OWKA 4GHTA 1A3BH 2ZCHP 4BNRA 2ODYB 2KCAA 3ODFA 4ZXXH 2ZDVH 4A7IB 1KSNA 3V3MA 1O2OA 4Y8XA 2ZU3A 3CNRA 3LJOA 1MKXH 2FOEA 1KXFA 1H8ED 1O2WA 2OQ5A 3B23B 1EB1H 2GV7A 3A8AA 2PKSB 2CJIA 3UR6A 1P05A 3TK6A 1LPZB 4ABHA 3TGKE 2EI7A 1MU6B 1BIOA 3GCNA 3UWIA 5A0AE 3H7TA 4B74A 1XUKA 2KX4A 1GBKA 3MOCA 5F8XA 1MMJN 4AN7A 2FLRH 1HXFH 1UO6A 4FETA 3ZVGA 1TGBA 2ZU4A 5EW2H 1C2GA 4YTAA 2SGAA 1BBRE 2EI8A 4Y8ZA 1T8LA 3ITIA 1A1RA 1AIXH 1JMOH 2SGDE 3A82A 4B2AA 1C1UH 2CK3D 3MQKC 3SNDA 1QY6A 3T26A 3UNRA 5DP4A 1A2CH 1TOMH 1UTLM 1CHOF 1LO6A 1BOQA 1D3DB 4AB8A 3M37A 2OQUA 1D6WA 1TONA 1LHGH 4ISOA 1HBTH 2BD2A 2C8WB 3T25A 2FYQA 1OSSA 1ABIH 1HAVA 1OXGA 2H9TH 3F68H 3T27A 1GI8B 1UK4A 1DT2A 1C5PA 5F03A 4BAMB 1QCPA 4D76A 2FS8A 4YXWD 1FPHH 2ZGJA 1SGNE 1J8AA 1NRNH 5HXFA 1UTMA 2ESTE 2WYJA 2ZO3H 3PROA 3F6UH 1GMCG 2FX4A 1GWAA 1THPB 1HAGE 2IPQX 3FN8A 2ALVA 4AZ2B 6LPRA 1C5XB 3A81A 3UNQA 2QXGA 2Y5FA 3WY8A 3HPTB 4M7GA 1IQKA 3BTGE 4FUHA 3TLOA 1P9SA 3STJA 5SGAE 4AFSA 2WV5A 2P16A 1P2MA 1RGQA 1KLTA 1DXPA 1HAIH 2PGBB 1P2JA 3EA9A 1XKAC 2G8TA 3DFLA 3G01A 2J34A 3SQEE 3K2UA 3SU1A 3PO1B 5EXLA 1O33A 3TGIE 3EA8A 1O3JA 1CVWH 1V6DA 1DWEH 1GG6C 3ATIA 3OEHD 5L6NH 2Z3CA 4ABJA 1ZRBA 4ABEA 1FJSA 2FWWA 2KR7A 1H9HE 1JRSA 1O39A 1OHHD 3DA9B 3QX5H 1GCDA 3BEIB 2JIZD 1H4WA 2ZU2A 4ZH8A 3SZNA 2FOBA 4F48B 1EZQA 1DY9A 1QB9A 3A7VA 3KHVA 3TK5A 3MU1A 4DURA 3ZVCA 1Q3XA 1UVTH 1A4WH 4HI3A 1QURH 1C5ZB 3NPSA 4NCYA 3P8FA 1MTVA 1Y3VA 3SU6A 3W1EA 3ZZ4A 2ZFRH 2BLVA 1O3GA 4GCHF 4AG2A 4I7YH 2A7CA 4BXWA 8GCHF 1SQAA 1V2LT 5JBTA 5C67A 2XBWA 5EPYA 1C1RA 1VITH 4A92A 4CHAB 1HJAC 5ESTE 4M9FA 1NRRH 1NU7B 4ABBA 4RKJB 4U2WA 1P57B 1C2HA 1FDPA 1GMCF 1AFEH 5TCCA 1KY9A 3SJ9A 1GBJA 2GT7A 5DSFA 1DLKB 3RM0H 1X7AC 3Q77A 5FPSA 1GHAF 4WMEA 1O2UA 2A5IA 1V2WT 1QBOA 4YO9A 2HWLB 3VB4A 2AIQA 1DX5M 2EI6A 1LKBA 2LELA 3I29A 1ARCA 3RXRA 4I86A 4BTIB 5AF9H 3AW0A 1DUAA 1W14U 3SI4H 2J5UA 4NSYA 3PV4A 1AUTC 1S6HA 1CA0C 2HLCA 3SNEA 2JETB 5A0CA 4O97A 1FN6A 2QA9E 1A46H 2FEQH 4I31A 3Q76A 1COWD 1UCYK 1OKXA 3N7EA 1TBZH 3SW2B 4LOYH 2Z9JA 1MU8B 1Y3YA 2H6MA 1N8OB 4D7FA 3ZZ8A 5FBIA 3TVJB 4I8LA 3OEED 4I8HA 4JK5A 3RXPA 1MABB 4AORA 2J2UA 3OAAD 2G81E 2VVCA 4UEHH 1NFUA 1TMUH 1WTGH 3MYWA 2KZ4A 1P04A 2BXTH 2RFKC 9ESTA 1ORFA 3MU0A 3S7KB 4THNH 4BTTB 2YMSC 1BTYA 4K1SA 8GCHG 1MAXA 2PTNA 2GKVE 1TRNA 4KTSA 1BB0B 2A4GA 4LXBH 1ELTA 1GJ7B 1UJ1A 2HLDD 3MU4A 1O2PA 3SOSA 1H8DH 1K22H 2YOLA 1LVMA 1L1NA 4NA9H 4AFQA 2RDEA 3SN8A 4E7NA 1O3DA 1SOZA 1K21H 3A8BA 4I32A 1V2JT 4YM9A 3VXEH 5CHAC 3GCTG 2CV3A 1EZXC 1DDJA 1RIWB 2LP6A 2QF0A 2VWOA 1KXDA 2KCPA 3FVFB 2QE7D 2VGCB 3HK6B 2HGTH 3F0PA 1O38A 4K8BA 4WJG2 4OGXA 4OS4A 5DP5A 2C8ZB 1TALA 1NROH 1SGFG 2A4QA 1Z8RA 4WXIA 4JYUH 2Y7ZA 2ULLA 2A0QB 1QJ7B 2P8OC 3PMJA 5HKKD 1S81A 2P3UB 2UWLA 5C20A 2OBQA 2O8UA 3FZDA 5I25A 2FESH 1GI4A 1OYQA 3M61U 3ODDA 1TNJA 5T1VA 4JYVH 1RXPA 2GDEH 1GJ8B 5FPYA 1CGHA 2Q1JA 2OC8A 2UUYA 1HAPH 1GI7B 3N7DA 2HRVA 1IQFA 1ETSH 2R0KA 1DWDH 1S85A 2GZ7A 1C2DA 1GJ5H 4NA8A 4INHA 2V3MA 3GY8A 1INCA 1HPGA 4HFPB 5C5OA 3MNSA 1Y3UA 2VBCA 4ABIA 1SBWA 5EXMA 3ZVEA 2ZGCA 3OY6U 2W5EA 1WOFA 3ZVAA 4DT4A 1D4PB 1VGCB 2STBE 1JBUH 2Y5GA 5C0TA 1CT2E 1D6RA 3DFJA 3M3SA 4RSPA 2BDCA 1PQ8A 2GMTB 2WYGA 1A5IA 4GSOA 3EYDA 2RG3A 3MO6A 4I33A 3LC5A 2IJD1 4AB9A 1YY3A 1RRKA 3RXCA 2ZFPH 1UTQA 1BMNH 1WSSH 2H9EH 2WUCA 4WH8A 1XX9A 1TX7A 1SB1H 4X0WU 1TNIA 4TSFD 2Y82A 3LPRA 1MD7A 2QAAA 1AE8H 1ELDE 3RXIA 2XC5A 4Y7BA 1ZSKA 2CF8H 2M2AA 1V2KT 1E0FD 1TPOA 2FZZA 4MLFB 2XBXA 3PLPA 3FO8D 1BHXB 2QY0B 1NFWA 1C5MD 3BSQA 3SQHE 1HIAB 4Z1MD 2OC0A 5HIYA 1ABJH 1XXDA 4A5TS 3SI3H 5FX6A 4BOHA 2XW9A 5DP6A 1QJ6B 1O2MA 5C94A 1IHTH 2VIPA 2V6NA 2PSYA 3CP7A 1GHZA 2VH6A 1GMHF 4OM9A 1W0KD 4FUEA 3A7XA 4XBBA 5KECA 3KYGA 1S0RA 1V2UT 2Y81A 3MNXA 3GY4A 3S9CA 1DY8A 1MAYA 3M7QA 2TGAA 5C5NA 3DSGA 3PMHB 1S84A 1GJAB 1YKTA 3SYJA 2ZF0H 1TGCA 2EY4C 3RXMA 3TK9A 1AY6H 1BA8B 2ILNA 1H9IE 3PYHA 3HKJB 4MG3A 3LOXA 1C1TA 2XBVA 2I6SA 3LGIA 3P8GA 1DITH 1C5WB 3FFGA 4ZROA 5F8ZA 4H6SB 1BTHH 1VGCC 1P12E 2O8LA 4R0IA 2I6QA 1LVOA 2G51A 4Q4LA 1G30B 1DANH 1PPZA 4QT8C 1LHEH 1XUHA 3UQOA 1TE0A 2UWOA 4ZXYH 1MTUA 2BM2A 2Q6GA 4FOUC 1C1NA 4VGCC 1EQ9A 4WF8A 5CDFE 4I8GA 2ZFQH 3SU5A 3IWMA 1BRBE 1ETTH 1CSOE 2KFWA 5BPEA 5CMXH 2HNTE 2WPJS 4DT7B 1GPZA 1ZSLA 2V35A 1K1LA 3U9AH 2TRMA 3UOUA 1BCUH 1Y3WA 1CU1A 1DSUA 5EQSA 3UOPA 1TRMA 3MNBA 3DT0H 3M5LA 3F2HA 5KGOA 2OUAA 2C8YB 3GY2A 1D3QB 4CRAA 4YOGA 4B6FA 3ZVFA 1CHGA 4CBNA 4LZ4B 2ZGXH 1SLXB 3OX7U 2HOBA 1KXCA 2WPMS 1KDQB 2ZU5A 5DPAA 1O5AB 5C1XA 1CGJE 1AGJA 1LPKB 2GCHG 2BLOA 2TPIZ 3PRDA 3SGAE 1MTNC 4IGDA 3TJUA 1G32B 2R2MB 5HM2A 2GD4B 2JJ1D 1ARBA 4ZKSU 2H9HA 4DVAU 2A4OA 1DE7H 2GP9B 4A1TA 1C5SA 2PSXA 1O2ZA 1O3HA 1XUGA 3GCHB 1NU9A 1V2NT 4XFQA 4NFEA 4MVNA 1E36B 2PV9B 3E6PH 1TNLA 4X8UH 1YLDA 2NU2E 2V0BA 1WXRA 5JBAS 2VVVA 2YMSD 1GJ6A 5JB9S 1F5RA 3L3TA 1O30A 2JDID 1GCTC 2AGEX 4JZIA 5EU8A 2GCTB 1FQ3A 1K1OA 1QIXB 1PQ5A 2AS9A 2BZ6H 2ZDNA 3VXFH 1A0LA 3ZZAA 2KM0A 5T6DA 1Y5UT 2L6OA 3A89A 1LHCH 3EQ0H 4UFEH 1SSXA 1W2KH 2A2QH 4FVDA 4Y71A 4CR9A 1V2ST 3RMOH 1YYY1 4ASUD 1AI8H 2G55A 3ZVDA 1ZRKA 1C4U2 1W13U 4LZ1H 1MBMA 4IC6A 1YLCA 3OTJE 1SVPA 1G37A 4GPGA 4X1NU 4FU8A 5L30H 1O3AA 1EJAA 1T4VH 1HJ8A 1N6YA 2FI3E 1KLJH 4FUJA 3QN7A 5GCHG 3F9EA 1PYTD 3EE7A 3RLYH 1TX8A 2Z6BD 4GCHG 4Y76A 1FY1A 4K3JA 5FPTA 3L33A 1EOLA 4XDEA 4RT1A 2WV4A 2QC2A 1QA7A 4RT0A 4DJZB 2D8WA 2R0LA 2W3IA 4U01A 2GX4A 1HXEH 1ELAA 1GCTB 3PLKA 5GDSH 2WINI 4H4FA 4ABAA 4Y10E 5CHBA 5EODA 3UAIC 2ZQ1A 3KQ5A 5FCRA 1WDIA 3GDSA 1ANCA 2YNAA 1A3EH 1CT0E 1DSTA 1DWBH 3GICB 4WH6A 3TPIZ 2HNTC 1SGCA 5IDKA 4E06H 1BMAA 1YLNA 1O35A 1E35B 2Z9LA 3GCOA 1CO7E 1GMDF 1O2JA 1SGFA 1W0JD 1FY3A 4Y0YE 3U98H 3UTUH 1GBHA 1NTPA 2QF3A 2WPLS 3PWBA 4A6LA 3QZQA 1V2TT 1L4ZA 1G9IE 3OTPA 2BY7X 1Y8TA 1JRTA 1PPBH 1Z8JB 1ZHPA 2DE9A 3DSOA 3STIA 3SNBA 3K9XB 2EC9H 1EATA 2GJGA 2AGIX 1P02A 1RTLA 3PWCA 1EP6A 1S5SA 3BTKE 4YOIA 1P0SH 2PP6A 2QYIA 3VB5A 1CBWB 1TX6A 2NU4E 1QRXA 2WUBA 3SJOA 2PW8H 1IQIA 3RXUA 3P8NA 4NZQA 1XVOA 3U69H 3FZZA 1B5GH 1OWIA 3BTME 4X6OA 4F55A 1O5CB 1K9OE 3LJJA 1QRZA 1RTKA 5HM9A 3QWCH 1TA2A 1QJ1B 2FIRH 1BTXA 4TY6A 2V3HH 1CHOG 1C5TA 2IPHA 1UHBB 1GG6B 1YCPK 1K1NA 4DY7B 1SQTA 4AGKA 4WWYA 1IQLA 2QF4A 1DXWA 1YP9A 4D9QA 1XKBC 1QBNA 1PPCE 3KQEA 3E16B 3QTVH 2BTCE 4Y6DA 5EJLA 4IN1A 1WBGB 1YPHE 4Q63A 2D1JA 1Z1JA 2VH0A 1GBBA 5T6GA 1P03A 4BAQB 1MKWK 2BQWB 2ZFFH 5B6OA 5J4SA 4CH8B 7KMEH 2W3KA 1E37B 3KEEA 3LH1A 1BQYA 1CQQA 1TBQH 1DFPA 3PRBA 3HGPA 4KTCA 5GIBA 1G3BA 1ZR0A 2ZECA 1T8OA 1W7GH 1HLTH 4UONA 4JZ1A 6CHAB 1YM0A 1YGCH 3MH6A 3T28A 1FZZA 3K6ZA 1YWUA 3ZV8A 5EW1H 1AKSA 2UUFB 4LK4A 2QGRA 1GHVH 1O2XA 5FAHA 2B0FA 1ANDA 3MI4A 1AU8A 4ABFA 4ZKRU 2A45B 4WXVA 1MZAA 1LTOA 1O37A 2ZFSA 6GCHG 4XRNA 4OS2A 1AE5A 3TIUA 8KME2 2H1UA 3OYPA 2AMDA 5A09A 1O3PB 1YPGH 5EGMA 1ELFA 3VB7A 4X1SU 4OS7A 1O3BA 1VCQA 2FXRA 2KCOA 3GOVB 2BX3A 2BLQA 3LU9B 1UCYE 1SKYE 1XUJA 3E8LA 1EZSC 1Z6EA 4JYTA 5FX5A 1OWJA 1OP8A 3URDA 4KGAA 2QCYA 3O8RA 2BDAA 2JKHA 1BMFD 5JPMH 1O3OA 3PMBB 4Q7YA 1SGYE 5AHGH 1QZ8A 3F3BA 1TAWA 3AW1A 1L4DA 3KF2A 1TPSA 1TNKA 5FCKA 2Q6FA 3BEFB 1UMAH 3LDXH 1EAXA 4WMDA 4RN6A 7LPRA 3LKWA 2TGPZ 3SU2A 3VPKA 1HCGA 1FAXA 3M5OA 5T3HA 2BD9A 3N99A 1EPTC 2ZDAH 1IQMA 2ZFTA 2OK5A 3RP2A 1E79D 4ZHAA 2FM2A 4XD7D 3S0NA 2SGQE 1GVZA 2VIVA 1C1SA 1UW7A 1EAIA 1SOTA 2FI5E 1BTZA 2BXUH 3RXDA 1NY22 3PLBA 2TBSA 1DICA 3A84A 3A8DA 4ASHA 2A5KA 2F91A 1L1GA 4IW4E 2VB0A 4JZFH 1LQEA 2BD8A 2BVSH 2XYAA 3MNCA 1QTFA 5ESBA 4E7RG 1ZGVA 3IG6B 1A5GH 3EDXB 2FOMB 2ASUB 2GCTC 1GMDG 4HG6A 4XBCA 1SGQE 1ZZZA 1SPJA 3RXHA 1B7XB 1KTSB 1S83A 3MHWU 1PPHE 1UTPA 3SV8A 2EEKA 3CENA 2FO9A 1TNGA 3TH4H 1SR5C 1ZHMA 4I8JA 4IBLH 2RDLA 5LPRA 1M9UA 1TWXB 4B76A 2BOKA 3TH3H 2JH0D 3GCHC 4YLUA 3DD2H 3Q3XA 2F9VA 2HNTF 1DWCH 1C1QA 2WV9A 1TOCB 4WMFA 3S69A 3ZYDA 3AVZA 5CE1A 3NRLA 2WHXA 2R3YA 2ZHEH 1OWDA 4A1XA 3SNAA 3QO6A 2BX4A 1AB9B 2SFAA 1AB9C 1O2RA 2ODQA 3BTQE 1ZPCA 1QB1A 3TU7H 1ID5H 3EE0B 5LH8A 1NFYA 1W0YH 1AVXA 5B6LA 1ZGIA 4INKA 5GXPA 3SJ8A 4B75A 3ZVBA 4DCDA 2AERH 3C27B 1KIGH 3U8TH 1TABE 3FP7E 3ZYEA 5F53A 4X6PA 3KN2A 2R9PA 2FTLE 2CN0H 1AHTH 2WZQA 4Q80A 2BY5X 1ELVA 2XXLA 4FXGH 1P09A 4CBOA 1B0FA 4INLA 3P95A 3W94A 1G36A 2K1QA 1F0SA 2ZPQA 4ISIH 3SV7A 1A61H 3A7TA 1W8BH 1WUNH 4X6MA 2XC4A 1XMNB 3PB1E 4NIXA 1FXYA 1UVPA 4TPYA 1FPCH 2VIQA 1Z1IA 2NWNA 5GPIB 4E05H 1HAVB 3H7OA 5F6MA 1BITA 5K0HA 1CBWC 1H8HD 2Y5HA 3LIWA 1QQUA 1YBWA 1GHAG 2A2XH 1F0TA 2FS9A 4J1YA 4TY7A 1NFXA 2C4FH 1DS2E 1HRTH 1HIAA 1DPOA 4CH2B 2ZWLH 3QTOH 2Z9GA 1FMGA 3UNSA 3GY7A 4F4OC 1FX0B 3GY3A 3OE7D 1ETRH 1QHRB 3A7WA 1TBRH 2SNWA 3MU8A 2ZGHA 2PR3A 1SGPE 2FOHA 4MQAA 1BJVA 3N7OA 4X1QU 3TGJE 5DK1A 4HTCH 1ELGA 1GBFA 2BLWA 2XBYA 3P6ZB 2JETC 4NIWA 3V13A 2H2ZA 1RS0A 2AMPA 5E0GA 3UFAA 1A0HB 3SGBE 1KTTB 1Z71A 2OTVA 1OYTH 4RI0A 3RXLA 2ALPA 2SGFE 1CE5A 2O8TA 3UR9A 1IAUA 2F9UA 2ODPA 1Z6JH 1W7XH 2V7QD 2W6ID 1GBEA 3GDVA 2RCEA 4ESTE 2BHGA 2OD3B 1TIOA 4GVUA 3F1SB 1O5BB 3RXKA 1A5HA 1C4Y2 5FXLA 1LMWB 4X1RU 1V2VT 4ACBA 3SUGA 3DUXH 5JB8S 2A32A 5HMAA 5DP8A 4UFFH 1FIZA 4GHQA 4UE7H 1UCYH 1UTKA 2WPKS 1B0EA 2J9NA 2BD3A 2QXJA 3EAJA 1MTSA 3KGPA 2PWXA 1RFNA 2QXIA 2HVYB 1CGIE 1GBCA 1GI5A 3SUEA 1MTWA 5JDUB 1T8MA 2ZCLP 1ELCA 1GJDB 3A8CA 5PTPA 3UQVA 1QL8A 3HATH 1K1IA 3LONA 1AQ7A 2GV6A 1HGTH 4DGJA 3TJVA 3GS9A 1NPMA 1THSH 1FY8E 3AK5A 1HAHH 3S9BA 2OBOA 2OINA 1T8NA 2ZPSA 3MTYA 4HGCA 2PTCE 4ISLA 1V2QT 2BD5A 3F2FA 3AASA 1LHFH 1C5RA 2BOHB 1MKWH 5EQQA 2XOKD 3MMGA 4P02A 1P2IA 1O3NA 1OP0A 3DSPA 3M3TA 4ZKOU 3EA7A 1NZQH 3U8RH 1ZJKA 1TMBH 1IQHA 1AWFH 2IJOB 4K60A 1K1MA
chains in the Genus database with same CATH topology
2OC7A 1O3LA 1BT7A 3RXTA 4AG1A 1F7ZA 3FP8E 1YCPH 2OC1A 7ESTE 1HJAB 1P2OA 4TYDA 3RM2H 3KQBA 1GJ9B 2GCHF 1GDQA 2P95A 5BRRE 2C8XB 3RC6A 4AX9H 1MTNB 2AIPA 1P3CA 7GCHF 6CHAC 1H9LB 1ZHRA 1KXAA 2B5TB 4ZMAH 1F5KU 2GZ8A 4ISNA 2ZPRA 3E90B 1ZYOA 2ZZUH 4FUCA 2D26C 4RKOB 3AAUA 1ESTA 4ZUHA 4AYYB 4BAHB 2ZU1A 2O9QA 2BVRH 2VGCC 2W7UA 1C5YB 2Q6DA 3CS7A 1C5OH 1SGIB 1XUIA 2C90B 1D3TB 2BDBA 3BEUA 2AH4X 1UTJA 4MDSA 3FAOA 2PFEA 5IYTA 1EOJA 3MU5A 3BTDE 3M7UA 5CHAB 1C1WH 1NRQH 1MQ5A 4O3TA 1BJUA 4MNXA 2ZI2H 2ANYA 4OGYA 1DLEA 4DIIH 1PPFE 4KELA 1O2HA 1EX3A 1FN8A 1GVLA 3D49H 3A87A 1W0ZU 1Y5AT 1T32A 1VR1H 3LGUA 4HZHA 4YZUA 1AFQB 1FIWA 5A2MH 4I8KA 4B2CA 1VJ9U 3SV6A 2ZIQH 4K1EA 3QUMP 3ZV9A 4MTBA 3ZZ6A 1O3IA 2QIQA 5T6FA 1BRCE 1P2KA 3SO3A 1C1VH 1SLVB 2AEIH 2XWAA 1ZJDA 4YESB 2NU1E 3RDZA 1IQEA 1NS3A 3UY9A 5JYIA 4GLYA 3P92A 5L2ZH 3P8OA 1WV7H 5JBBS 3UIRA 1IHSH 2BY6X 1OWEA 2BDIA 5E0JA 1TMTH 2A4RA 3TJOA 4NG9H 1XXFA 1O36A 3KNXA 2ANKH 4JZEH 1ZLRA 5E2OA 1BZXE 4DG4A 2OXSA 3W95A 3P70B 3MWIU 4YOJA 4UFGH 4Y7AA 4B73A 1P06A 3SHCH 1HDTH 1YPEH 3K65B 2FOAA 4KKDA 2OP9A 1VJAU 4YT6H 4JCNA 1A0JA 3ATWA 3T62A 2SNVA 2OLGA 3ESTA 4FUIA 4ZAEA 2ZHWH 3RMLH 3U1JB 1BUIA 5LPFA 1IQGA 1W3CA 4WY3A 5E2PA 1C5LH 1Z8IB 3RUOA 1NO9H 3MH7A 5HGGA 1OOKB 3A7ZA 3QZRA 3NWUA 1J14A 3JZ2B 2SGPE 1XVMA 1C1MA 1C5VA 3VB3A 2VWMA 2FYRA 2G52A 2BZAA 5DP3A 1BTWA 2YNBA 3GISB 2ZG0H 4Y8YA 3OY5U 1JWTA 2ZTYA 1GHYH 5C1YA 1GGDC 5F8TA 4Q7ZA 1O0DH 1SLWB 1GBLA 1SLUB 4WVPE 3KQCA 4IN2A 2FOCA 2Z9KA 1HAZB 2BD4A 4X2YA 3RXEA 3ZZ7A 1GI0A 2ZCKP 3V0XA 2UUJB 4OS1A 1JXPA 2H5DA 3LGTA 4UDWH 1TPPA 4DIHH 5E0HA 2V3OH 5H4IB 1SI5H 3VFEA 1HAOH 3GY5A 5ETXA 3RXBA 2F3CE 2R2WU 3RXFA 2IN2A 4K5ZA 1GI2A 8ESTE 1O5DH 1O32A 1SHYA 2VIWA 2J4IA 2F9PA 1SGRE 7GCHG 1W11U 2BDHA 3ELAH 4NGAH 3H5CB 3KL6A 4X1PU 1QR3E 5AFYH 1C2JA 3QK1A 3HKIB 3A85A 1P11E 4Y11E 1J16A 1PPGE 2ZTZA 3ZZCA 2P59A 4NA7A 5DGJA 2KAIA 3RXVA 2B7DH 4R8TB 1KDQA 1UHBA 2VNTA 1FUJA 4J2YB 2IOTA 1CA8B 1EPTA 3B9FH 2P93A 5FHTA 1F5LA 1SGDE 1NN6A 1QFKH 1AWHB 1ZPBA 2F9OA 3KIDU 2EA3A 4X2WA 4BAOB 3FP6E 3HK3B 6GCHF 2FX6A 5JBCS 1KYNA 2QN5T 1P2QA 4TPIZ 1DVAH 4O9VA 2FODA 1NT1A 3SORA 1GBAA 2GZ9A 4AFUA 2HPPH 1GDNA 1W10U 2VINA 1C5UA 1O3EA 1GBDA 1HAXB 2W26A 4XSKU 2LNCA 3ATLA 1W12U 4AGJA 4VGCB 2J95A 2JH6D 1QA0A 2NU0E 1KXBA 1TPAE 2AMQA 3RMMH 3MFJA 1ZSJA 2Y80A 1ZMNA 1V2RT 1SMFE 3A83A 2ZQ2A 4FUFA 3O8DA 2CGAA 3Q00A 1IQJA 3MO9A 1EPTB 3DHKH 1ANEA 1O2GH 1N8OC 1S0QA 5A0BA 1V2OT 4IMZA 3NCLA 5DJ7A 1TGNA 2ZGBH 1GDUA 4MNYA 1GL0E 1BDAA 5TCAA 1OP2A 2PKSC 2GMTC 1J15A 1C5NH 2DE8A 3OSYA 1J9CH 1P01A 2BQ7B 1TQ7B 4Q7XA 1YCPM 2F9NA 3RXSA 3BTEE 1QGFA 1O5GH 1TGSZ 1H8IH 1P3EA 4UFDH 3BIUH 3NK8A 3QLPH 2Y6TA 3E1XB 1T31A 1HAYB 1O2TA 4Q2KA 3TJNA 4CRDA 2VIDA 4JMYA 5DKMA 1D9IA 3MH5A 4ABGA 3RXGA 1LKAA 3T5FH 1ZMLA 1DOJA 4BANB 2G00A 4GAWA 4MNWA 4X8TH 1PQ7A 1WTHD 3KQDA 5EXNA 1O5EH 1VZQH 2PGQB 1TA6A 3QGJA 4K8YA 4BAKB 1YPLH 1N6XA 1GI6A 3GCTF 3SU4A 2FLBH 3VEQB 3CS0A 3ZZBA 3BTFE 3E3TA 4OS5A 2NU3E 2ANMH 2P3TB 4YT7H 3ATKA 1O3MA 2P3FH 3BTHE 4X6NA 1WAYB 1UTNA 1AZ8A 3M5NA 4JK6A 1V2PT 1F2SE 3L6PA 1EP5A 1C1PA 1LVYA 3P17H 3U1IB 5DP9A 1TB6H 1XUFA 4PROA 3ENSB 2CHAC 2G4TA 5C1UA 3M36A 3RXOA 1P9UA 2ZHFH 4X8SH 3A80A 1BBRH 3LGWA 1EXFA 1D3PB 2Z7FE 1ZTKA 4JZDH 3GDUA 3SUFA 1MUEB 3VB6A 4D9RA 1P10A 1H1BA 3RC5A 2CMYA 1UVSH 1AMHA 1VCWA 2UUKB 2AGGX 1F0RA 1OWHA 1GGDB 3SGQE 2A7JA 1BRAA 1O2IA 4NZLA 1GI1A 2FI4E 3OU0A 3RXJA 4B1TA 1WQVH 4D8NA 3GYMA 4CRGA 2BY8X 1EZUC 1AUJA 1O3KA 1RD3B 1Y5BT 2J38A 3ZZ3A 1C2FA 4OS6A 5AFZH 1O2QA 2HVXA 2KAIB 3R0FA 1C2MA 1Z7KA 1G2MA 2O8MA 1SL3A 1EB2A 1UVUH 3O8CA 1GBMA 1NM6A 3PTNA 4H42U 5EOKA 1GHBG 2AFQB 3GYLB 2BDYA 1VITG 1FY5A 4XE4A 4FUGA 3JZ1B 1GI9B 1V2MT 4MPUA 4GUXA 1O2LA 2AYWA 3SU0A 2OCVB 3VGCC 2P8OB 1F0UA 1SGEE 5TJXA 1ZOMA 2FDAA 5A8YA 1K1JA 2THFB 2GGVB 1YPJH 3A7YA 4D7GA 1SFIA 3TNTA 3HGNA 4FU9A 2R3UA 1AZZA 1TFXA 5C3NA 3NZIA 5HYOA 5GWZA 4O3UA 2RA3A 4KP0A 2HALA 5EG4A 3M3VA 3I78A 1RIWC 3M7TA 1C9PA 5J4QA 1MH0A 1O3CA 3LH3A 1TYNA 3LC3A 5DG6A 2ZDKA 4ABDA 1NRPH 4AOQA 2TGDA 1Q31A 3URCA 2P94A 9LPRA 1HB0B 4CRFA 3E0PB 1S6FA 3U8OH 3ZZ9A 3ZZ5A 2UWPA 1GJ4H 1KXEA 3LT3A 1AFQC 1ZTJA 3MH4A 3O8BA 2VJ1A 2J94A 1MCTA 1LDTT 1TLDA 1U6QA 6ESTA 1TGTA 4IC5A 5LGOA 4FVBA 3RU4D 2C3SA 1HYLA 1JOUB 4AYVB 1DUEA 1HFDA 4CR5A 1O3FA 4CHAC 1EAWA 4DW2U 3T29A 5DO4H 4CREA 2XCNA 1Y59T 3UREA 1C2IA 1Q2WA 1ESBA 1VITF 1C2LA 2ZP0H 2FP7B 1GHBF 1YPMH 2FOFA 2FPZA 3MO3A 1MZDA 1JIMA 1FNIA 1GL1A 1THRH 2ZHQH 3BV9B 3NKKA 1EKBB 2Z9IA 1O2VA 3QGNB 2G5NA 1SC8U 4F49A 1CA0B 1QL9A 2PLXA 3D65E 1GVKB 4AFZA 3E91A 1LVBA 1V3XA 3RU4E 2XTTB 3I77A 2O8WA 3VGCB 4ISHH 3Q3YA 4K1TA 1K2I1 4B71A 3V12A 1KLIH 3PO1C 1O2NA 1QQ4A 1PQAA 3M5MA 1EASA 1BMMH 1GI3A 2GT8A 2WPIS 1EJNA 1BTPA 3B8JA 1C5QA 1E38B 2BMGB 2RA0A 3PMAB 1GHWH 3AAVA 4CRCA 3BIVH 1O31A 1UK2A 2A31A 1GBIA 2VWLA 3UWJH 1BTUA 1SQOA 2Y7XA 4MNVA 3S9AA 1VCPA 2ZTXA 1BBRK 3BF6H 1LQDB 1SHHB 4BTUB 2XC0A 3F9GA 2B9LA 4A1VA 1ESAA 3GY6A 2ZNKH 4NIYA 1ELEE 3BTTE 4K2YA 2GVFA 3RMNH 2SGEE 1JIRA 1MD8A 2BVXH 3SNCA 1J17T 1EJMA 1EUFA 4MPWA 1GJCB 1GBTA 3IITA 3BG4B 1C1OA 1AVGH 5K7RA 2CXVA 1WQSA 2CHAB 1IOEA 4O03A 2ZDMA 2CF9H 4IS5A 1C4V2 2H5CA 1O5FH 2F9BH 5ABWA 4K69A 5GJ4B 1QNJA 1P8VC 2A7HA 2XNIA 3F9FA 2BYAX 1ZTLA 1HV7A 1QB6A 3A86A 1AD8H 1ELBA 1ZPZA 4B2BA 1YF4A 2ZKSA 2PHBA 1RTFB 4IMQA 4MPVA 2VWNA 4BXSA 1S82A 1TNHA 5E8EH 3SJIA 1OPHB 5FBEA 4Z6AH 1ACBE 1SG8B 1LCYA 3C1KA 4X8VH 3ATMA 1A7SA 3SBKA 2ZA5A 1MQ6A 4XOJA 4TWWA 4XBDA 3SU3A 1PFXC 1YPKH 4ZHLU 4ZHMU 2PKAB 1N1LA 3RU4T 4CRBA 2LPRA 1CT4E 2HPQH 4MPXA 1ZMJA 1T4UH 3RLWH 1O2YA 2GTBA 3QDZB 3KCGH 4ZKNU 3SUDA 2BQ6B 3NXPA 2BD7A 4H6TA 2JH5D 1UVOA 1NC6A 1P2NA 3RC4A 1BHXF 1YC0A 1AO5A 1FAKH 3ZZDA 1MCVA 2PUXB 2QV1A 4U30A 3FANA 1OX1A 2ZEBA 2B8OH 1L1JA 4Z0KA 2WPHS 3Q3KA 2VIOA 2W7SA 2D2DA 2ZDLA 1L2EA 3RXAA 2TGTA 2BDGA 4NFFA 3K6YA 5LPEA 1MBQA 4X2XA 1MKXK 3PM3A 4TWYA 1TRYA 3RXQA 4SGBE 1NRSH 1ANBA 1E34B 4Y0ZE 1HJ9A 1DM4B 3D62A 1L0ZA 2G5VA 1BMLA 2QXHA 1LHDH 1O34A 2ZHDA 3TITA 5A8XA 5G4BA 2BB4A 2DUCA 3SJKA 4DOQA 3PTBA 4NIVA 3V7TA 4YLQH 3D23A 1FI8A 1LPGB 2Z3DA 2XRCA 2VU8E 1SGTA 2FOGA 1WCZA 1O2KA 2F83A 3EGKH 2XWBI 4UD9H 1AN1E 2ANWA 2A1DB 1G3DA 3TNSA 1PYTC 3F9HA 2Z94A 1EAUA 1QL7A 1GHXH 3SV2H 2VVUA 3R3GB 3BG4C 4NWKA 5EPNA 1BRUP 3M35A 2PKAA 5C2ZA 1G2LA 1C9TA 3A88A 4FUDA 3BTWE 3UUZA 1HNEE 1AVWA 2TIOA 1T7CA 1YPHC 2ZC9H 1C2KA 1C2EA 3SV9A 3LGVA 3S7HB 1G3CA 4SGAE 1F92A 3BG8A 1Y3XA 2G4UA 1Z8GA 3UPEA 1WYKA 3LGYA 2Z3EA 1K28D 1FY4A 1O2SA 3E0NB 2GDDA 2XCFA 1TQ0B 5EQRA 1PPEE 3BN9A 4FUBA 1GJBB 1OS8A 5I46H 2FTMA 1QRWA 2C93B 1K1PA 5GCHF 4Y79A 1HUTH 1FV9A 8LPRA 3NUMA 5DP7A 4X2VA 1IQNA 2A5AA 2J92A 3SHAH 4FU7A 1QBVH 1RJXB 3T2NA 1NESE 3TH2H 4NWLA 1UK3A 2STAE 2FMJA 1UTOA 4KTUA 5L2YH 1WU1A 1GMHG 5A8ZA 4NSVA 1G3EA 2PUQH 2BY9X 1AKSB 2M5TA 1PJPA 1XM1A 4U32A 5AVDA 1FLEE 1FONA 1SFQB 1OWKA 4GHTA 1A3BH 2ZCHP 4BNRA 2ODYB 3ODFA 4ZXXH 2ZDVH 4A7IB 1KSNA 3V3MA 1O2OA 4Y8XA 2ZU3A 3LJOA 1MKXH 2FOEA 1KXFA 1O2WA 2OQ5A 3B23B 1EB1H 2GV7A 3A8AA 2PKSB 2CJIA 3UR6A 1P05A 3TK6A 1LPZB 4ABHA 3TGKE 2EI7A 1MU6B 1BIOA 3GCNA 3UWIA 5A0AE 3H7TA 4B74A 1XUKA 1GBKA 3MOCA 5F8XA 1MMJN 4AN7A 2FLRH 1HXFH 1UO6A 3ZVGA 1TGBA 2ZU4A 5EW2H 1C2GA 4YTAA 2SGAA 1BBRE 2EI8A 4Y8ZA 1T8LA 3ITIA 1A1RA 1AIXH 1JMOH 2SGDE 3A82A 4B2AA 1C1UH 3SNDA 1QY6A 3T26A 3UNRA 5DP4A 1A2CH 1TOMH 1UTLM 1CHOF 1LO6A 1BOQA 1D3DB 4AB8A 3M37A 2OQUA 1D6WA 1TONA 1LHGH 4ISOA 1HBTH 2BD2A 2C8WB 3T25A 2FYQA 1OSSA 1ABIH 1HAVA 1OXGA 2H9TH 3F68H 3T27A 1GI8B 1UK4A 1DT2A 1C5PA 5F03A 4BAMB 1QCPA 4D76A 2FS8A 1FPHH 2ZGJA 1SGNE 1J8AA 1NRNH 5HXFA 1UTMA 2ESTE 2WYJA 2ZO3H 3PROA 3F6UH 1GMCG 2FX4A 1GWAA 1THPB 1HAGE 2ALVA 4AZ2B 6LPRA 1C5XB 3A81A 3UNQA 2QXGA 2Y5FA 3WY8A 3HPTB 4M7GA 1IQKA 3BTGE 4FUHA 3TLOA 1P9SA 3STJA 5SGAE 4AFSA 2WV5A 2P16A 1P2MA 1RGQA 1KLTA 1DXPA 1HAIH 2PGBB 1P2JA 3EA9A 1XKAC 2G8TA 3DFLA 3G01A 2J34A 3SQEE 3K2UA 3SU1A 3PO1B 5EXLA 1O33A 3TGIE 3EA8A 1O3JA 1CVWH 1V6DA 1DWEH 1GG6C 3ATIA 5L6NH 2Z3CA 4ABJA 1ZRBA 4ABEA 1FJSA 2FWWA 1H9HE 1JRSA 1O39A 3DA9B 3QX5H