1FONA

Crystal structure of bovine procarboxypeptidase a-s6 subunit iii, a highly structured truncated zymogen e
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
b'SWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPTVDYEHCSQWDWWGITVKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWIDETIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCARBOXYPEPTIDASE A-S6
publication title Crystal structure of bovine procarboxypeptidase A-S6 subunit III, a highly structured truncated zymogen E.
pubmed rcsb
molecule tags Serine protease
total genus 55
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fonA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fonA01
1HV7A 1GI3A 1FUJA 4H42U 1HUTH 1O3AA 4FUFA 5GIBA 4Y11E 4DT7B 4WMEA 1THRH 2B7DH 2FI3E 1QFKH 2XBXA 2G55A 1KDQB 1KTTB 2PKSB 3STJA 1YPHE 1W2KH 2RA3A 3PMBB 1SHYA 5FCKA 1T4VH 1OYTH 4TPYA 5C3NA 4I8LA 2CMYA 3H5CB 1NRPH 3ODFA 1TX8A 1AQ7A 1FONA 5AVDA 3RM0H 1XUHA 4BNRA 3ATMA 4Z0KA 5HMAA 3UIRA 1HJ9A 4ZROA 1D3PB 3VGCC 3R0FA 1T7CA 3PYHA 3NXPA 1J15A 1F0RA 2GDEH 2PV9B 1S0QA 3ESTA 1THSH 1TNKA 2BVSH 2M5TA 1BRUP 2XYAA 1C1MA 1G37A 1P04A 3BTEE 3GY8A 4JZEH 1GBEA 1AVGH 4YOJA 1UCYH 5E2PA 2XBWA 4ZKNU 2OQ5A 3LGYA 1LHCH 2GD4B 2YNBA 1LKBA 3MH7A 2ODYB 1QJ7B 7ESTE 2NU1E 4FUJA 4UDWH 2I6QA 1SGPE 2G5VA 1G32B 1T32A 1GHXH 1WQVH 4ABDA 3V3MA 2FYRA 1BUIA 2XBVA 1MTUA 1BOQA 1XVMA 2EI8A 2Z6BD 2H2ZA 4F4OC 5JPMH 4CRAA 4NIXA 2BDHA 1NFWA 3MNSA 4B75A 3Q00A 5JB9S 2GV6A 2QF3A 1EXFA 4YZUA 5FXLA 1AUTC 2FTLE 2V0BA 8GCHF 1MKXH 1CSOE 1YPEH 3GY3A 1LCYA 1CVWH 5DGJA 2FOEA 1AHTH 1O3PB 1PFXC 1JOUB 3HGNA 1P05A 3GCOA 1O3DA 4HGCA 1SLVB 2A4RA 2G8TA 2XBYA 4ZHLU 4X8VH 3UOPA 3RXMA 2Z9IA 3F68H 3ZZ4A 3L3TA 5E8EH 4FUIA 4YOIA 5DJ7A 1C1RA 1SGEE 3JZ2B 1H8IH 2FZZA 1GJ6A 1T8LA 2R0KA 2ZGXH 3PO1B 3SNEA 1XM1A 2UUJB 1O3NA 3EA7A 4WH8A 3SHAH 4JZDH 1EJMA 3MU8A 1HIAA 2QGRA 3KQDA 4M7GA 2C4FH 1GDUA 3O8RA 1MCTA 1FPHH 2NU4E 2IPHA 3BEIB 1Z1IA 1QCPA 3PLKA 1OOKB 3ZZCA 1YLDA 1DXPA 1PYTD 1TNGA 1UCYK 3LKWA 5IDKA 3AAUA 1GMDF 1HAXB 2ANMH 2BD4A 2H6MA 1CHOF 4O3TA 4X1RU 5FPYA 4K5ZA 1C1VH 2C8WB 5EQSA 1VCPA 2ZPRA 4MNVA 4YLQH 1SR5C 1ZSJA 2GMTC 1FQ3A 1NT1A 2FODA 2VWLA 1NM6A 3UNQA 1T8OA 1TPOA 2KAIB 2WPJS 1UCYE 1P03A 3NUMA 1JRTA 2TGDA 2BD5A 1Z8GA 3P8FA 1PQ7A 2ZPQA 4GAWA 1W12U 2XCFA 3UNSA 2QN5T 1MKXK 4HI3A 1PPGE 1QL9A 1Z8RA 3BN9A 4F49A 2UWPA 3M3VA 2LPRA 1HAHH 1ZJKA 3GOVB 3B23B 2P3TB 1A4WH 2HGTH 1QB1A 2UUKB 1GGDC 8GCHG 1AFEH 1P06A 1D3QB 5E0HA 1SC8U 1KXBA 2H5CA 1ELTA 3BV9B 2PUXB 1BTZA 2XRCA 1ZPCA 2ZGBH 3D62A 3BTKE 4ABBA 1DT2A 3Q3KA 4TYDA 4BAMB 7KMEH 1T8MA 3OYPA 1O3CA 1EAUA 2OXSA 4AORA 5BRRE 5GDSH 2YOLA 1EB1H 1L2EA 3RXDA 2JKHA 2WPIS 1C2FA 2XWBI 1Q3XA 3A8DA 1S6HA 4FUEA 1UMAH 1W13U 1GG6B 1WYKA 3GCHC 4AOQA 1EZUC 3KF2A 3TH4H 1GMHG 3BTDE 1S84A 1O5FH 3M35A 1QRZA 1ZSKA 2SGFE 3LJOA 1O3FA 1P2KA 1C2KA 1CGIE 3RU4T 1Z7KA 2P3UB 2XC5A 2BQ7B 1Y5UT 1O2GH 4FU9A 3ZZ3A 4BAKB 7LPRA 1O3KA 1SLXB 2RG3A 2BY5X 1AE8H 1CA0B 1KSNA 1C5XB 1SGYE 3QDZB 1ZPZA 1TX7A 2A7JA 1RTKA 3M5NA 3LC3A 3QGNB 5HM2A 1W7XH 1O3GA 3M7QA 2BYAX 4Y8ZA 4ABJA 3TK6A 1O2MA 3NK8A 1T31A 5C5OA 1XUGA 1YGCH 1K1IA 3EQ0H 3Q76A 1G3BA 4XDEA 5GWZA 2HVXA 2PLXA 3OTJE 3F9HA 1DVAH 2Z9KA 8ESTE 5FPTA 3TVJB 1JMOH 1MZDA 2OC1A 1DICA 1W0YH 3U1IB 1L1NA 2ZQ2A 4GCHG 3EA9A 3I78A 1SFQB 3E16B 2BD2A 3SQEE 1G30B 4LZ1H 2FOBA 1GL0E 3URCA 1ELDE 3HGPA 1C1OA 1DY9A 2ANYA 4K69A 4ZKSU 3BTTE 4Z6AH 2A2QH 1BRBE 4NA9H 3LGIA 1QNJA 3LH3A 4U01A 1HAGE 1RRKA 3RC5A 2VGCB 1A5GH 3RU4E 1HFDA 1ABJH 1N6YA 1O5DH 1MAYA 3MH4A 4WMDA 2XXLA 3DA9B 2FS9A 1NU9A 2G4UA 3Q3XA 1NN6A 3MOCA 1C1WH 2PW8H 3F9GA 2BLQA 2FLRH 1S83A 4NA8A 1HBTH 4X6MA 1UK4A 1UTQA 2QAAA 5GCHF 1K1LA 1K21H 3ZZ7A 1GHBG 3RMMH 1UTKA 2CJIA 3BTWE 3DHKH 5I25A 2WPKS 4BAQB 3SJ8A 3KGPA 1BMNH 1GBJA 3CENA 3K9XB 2FOHA 1C5TA 2F9NA 4XBCA 1DWCH 4ABHA 3U9AH 1BDAA 1TBZH 1XXDA 2P95A 1AB9C 4OS4A 3LU9B 1GJCB 3MWIU 4NG9H 4BAOB 4D7GA 3FZZA 5FCRA 4AYVB 4CREA 4SGBE 2ZU2A 4JZFH 4RSPA 5L30H 2OQUA 2STBE 3DD2H 1FIWA 4K60A 1BJUA 3PO1C 1AKSA 1VCWA 1GI6A 4AYYB 1OWHA 1OX1A 2BD9A 3ATIA 4WY3A 2EI6A 1SOZA 1AMHA 4CRBA 2TIOA 2PSXA 1IHTH 2J2UA 5SGAE 1GBHA 2A7HA 2QXIA 4NZLA 1KXAA 2ZECA 4IS5A 2G4TA 1OP0A 1BMMH 5E0JA 1YM0A 2OLGA 1CGHA 1O2QA 3P6ZB 3AVZA 6LPRA 1LKAA 5JBTA 3DT0H 1LQEA 5FHTA 1LHDH 1LHEH 1W14U 4THNH 2A4GA 3A8BA 2VIDA 4AN7A 3GY4A 2VVCA 3EE0B 4UFFH 3RC6A 1P3CA 3VB7A 1O2UA 1NESE 1V2MT 4BXWA 1F0TA 3BTGE 2GCTB 3SU6A 3CS7A 1LDTT 3GCTF 1A5IA 2AH4X 3M5MA 4BTIB 4K3JA 3M61U 1SMFE 1EAWA 4KTCA 1CBWC 1FI8A 1TMUH 1GI7B 1VCQA 2CF9H 2PTCE 3PLBA 2ALVA 2DE9A 3K2UA 1SGRE 1ESAA 2V3OH 1Y3UA 1EJAA 1MCVA 2F83A 1ANBA 2G51A 1AZ8A 4X0WU 1AFQC 3SGBE 4B2BA 2P94A 5JBCS 4VGCB 3SHCH 3U8OH 5ABWA 4UFGH 2HOBA 3LC5A 2VH6A 3E91A 4Y0ZE 5E2OA 3SW2B 4MQAA 1GI5A 1JIRA 2XW9A 1G9IE 3KIDU 4D8NA 2A0QB 3UWJH 2IOTA 1FLEE 4ABGA 2ANWA 3BIVH 3U1JB 1ZTKA 3HATH 2VIWA 1C5UA 5GJ4B 1V2RT 1O2SA 3TH3H 3RXHA 1IAUA 4MTBA 4R8TB 3L33A 1O5BB 3GCNA 3MU0A 5FX6A 1E34B 1A0JA 2BLWA 1O2TA 1HPGA 2HWLB 3D23A 2O8LA 2TGPZ 3W94A 2BOKA 4MPWA 4A1TA 1O2PA 3SU5A 2BB4A 3MMGA 1Y3YA 1H9LB 2BY8X 1FIZA 5LPEA 1V2PT 4FUGA 3MHWU 3M3SA 4ZUHA 4KTUA 5C67A 8LPRA 3K65B 1RIWC 1SB1H 2O8UA 1T8NA 2BQWB 1XUJA 2J34A 3C1KA 5A8ZA 1H4WA 2Z94A 2A32A 1IQHA 1LVOA 5T6FA 1MZAA 1NZQH 4JZIA 4B74A 3RXPA 5A0AE 4UEHH 2JH0D 2P16A 3S9BA 1WU1A 4FUBA 2FOMB 1AVXA 5DP3A 1MUEB 1WAYB 4OS6A 2UWOA 4TPIZ 4X6NA 3TJNA 1ANEA 4CR9A 1UTPA 5F6MA 2BLVA 4KELA 1CQQA 1GJ7B 3PMAB 1M9UA 1EB2A 5L2YH 1C5VA 1LQDB 2TBSA 5DP9A 4MNXA 4NCYA 1NS3A 1O2WA 1W8BH 1K1OA 1LHGH 3UFAA 4TY6A 1UVTH 1YF4A 1N1LA 2C90B 2GT7A 5IYTA 2WPLS 3PV4A 3IWMA 2HNTE 1IQLA 1UTJA 4NSYA 2G00A 4X8TH 1AY6H 3FP8E 4ZXXH 2ZQ1A 3BG4B 3SJKA 1KXFA 3UQVA 2RA0A 5E0GA 1Z71A 3LT3A 4IC6A 1GBIA 3ZZ8A 1UTLM 1J8AA 1DE7H 1FAKH 3TPIZ 3UR9A 2TGAA 4YTAA 1YPHC 3ZZDA 3M7TA 3KQBA 2VIOA 4DIHH 2PKAB 4CRCA 4Y71A 8KME2 1F7ZA 4MPVA 5PTPA 1EP5A 1C2IA 2V3HH 2GP9B 2WINI 5DO4H 1G36A 1UTOA 1V2QT 2A31A 1B0FA 1BRAA 2AFQB 1GJ5H 4ZAEA 1C5RA 3E8LA 1PQ5A 1AI8H 3KEEA 3MNXA 1EOJA 1XX9A 2F9UA 2ZCLP 5AFZH 1Z6EA 1E37B 3KL6A 3UWIA 1K28D 5HYOA 4E7NA 3E0PB 2SGDE 3GYLB 1BTHH 4NA7A 3S7HB 1QA0A 2HNTF 1LTOA 1TGNA 2FX4A 3SV2H 4ABIA 1SPJA 1C1UH 1W11U 4GSOA 1ANCA 1QL7A 1YPGH 1AGJA 1ZHMA 4LK4A 1DITH 5F03A 2GGVB 3EAJA 1DANH 1GHAF 1N8OB 3TITA 3VPKA 3HKIB 4UFDH 3MH6A 4IC5A 1Y8TA 3I77A 2VJ1A 1Y59T 1O37A 1AWHB 3ZVGA 1O2XA 1QQUA 2C8ZB 1FDPA 4DCDA 4X6PA 2B8OH 2QA9E 3SV6A 2F9BH 5EXNA 2ASUB 4WF8A 3F6UH 1Q31A 4WJG2 4FVBA 1O3EA 2ALPA 1WQSA 3SU4A 3B9FH 3LGWA 1GHWH 1VGCB 1FJSA 1QBNA 4Y8YA 4YM9A 5C1UA 2FOFA 2BZAA 2VVUA 2WPHS 3NWUA 4ZKRU 1HGTH 2GCTC 4GPGA 1CT2E 4GHTA 3SU1A 4Y7AA 1NROH 1EPTB 1P02A 3Q77A 1DSTA 2P59A 1QB9A 1F2SE 2BHGA 2J4IA 1LVMA 1UVPA 1ZGIA 2J9NA 2AGGX 1TABE 1NRRH 2TGTA 4X2XA 4SGAE 3LH1A 4HZHA 4R0IA 2C8YB 3S0NA 2BDGA 5TJXA 4H4FA 4NSVA 3U8TH 3MO3A 1NO9H 1MTVA 1EAIA 2OCVB 3GY5A 1QBVH 3FZDA 1C1QA 1RD3B 4Q7YA 3BEUA 1FN6A 2WV5A 1TGCA 4MNWA 5HM9A 1XKAC 1KIGH 1BZXE 1B0EA 1GMHF 1C4V2 5FAHA 2P8OB 5DP4A 1QQ4A 1BITA 1C5SA 3H7OA 1EATA 4A92A 3SJ9A 1EP6A 1SG8B 2CN0H 1WTGH 5AFYH 1QA7A 3VB3A 1V2UT 1RGQA 2A4QA 2QXHA 3A8CA 5C1XA 3QTVH 4I7YH 1P10A 1O3OA 2ZU1A 2WYGA 2FEQH 2Q6DA 4A1XA 1C5NH 1GHAG 2BLOA 2JH5D 4NIYA 2GDDA 1O36A 3SJOA 3RXOA 5LPFA 1C2HA 4Y6DA 1S6FA 4MPXA 1INCA 3BIUH 2SGAA 1BMLA 1C5QA 3A86A 3UNRA 1ZMNA 1GJ8B 1TRYA 1MQ6A 3S9CA 4I8HA 1GCTB 2FMJA 4HFPB 1DLEA 1OS8A 4GCHF 1D4PB 2BY6X 3V7TA 3SUDA 3E90B 4JCNA 1L0ZA 4B76A 1ESBA 1V2ST 3K6YA 5ESBA 2BXTH 3LPRA 1C5WB 1F0SA 5A0CA 1S0RA 1QBOA 2GZ7A 1C2EA 1EZQA 1CHGA 2JETC 1H1BA 3UREA 3STIA 1GBBA 1SQAA 3U69H 1GI2A 3UR6A 1IQIA 2Y7XA 3W95A 2RCEA 1HJAB 3A7XA 1XUKA 4GVUA 1GI9B 1GVZA 1A3EH 1OWJA 1MH0A 4UD9H 1ZRKA 1PPEE 1A7SA 1XXFA 4GUXA 4NFFA 2DE8A 2Z9JA 3UPEA 3RXRA 1YPJH 2ZDMA 3SJIA 1IHSH 2ZGJA 1HAIH 3ODDA 3UTUH 1MU6B 3MO9A 3FANA 1GHBF 1WUNH 1RTFB 3CS0A 1YLCA 3P70B 1O2IA 2DUCA 4DOQA 1A0LA 4AG2A 5L2ZH 2HALA 2Y7ZA 1DY8A 2A2XH 1SQOA 5G4BA 2PUQH 2ZC9H 3SI3H 1BT7A 1P2QA 3N7OA 2HPQH 1G3DA 1J14A 1SVPA 1BRCE 1B5GH 2CHAB 1ZTJA 3RLYH 1UK3A 1GJAB 1GBKA 2VWNA 2GCHG 3AASA 1O35A 1GI8B 1SGTA 1SOTA 1VITH 2PSYA 1BTXA 3GICB 4GLYA 1BIOA 2BDCA 2ZFFH 5EW2H 1E38B 1O2ZA 4ISLA 1UTNA 3T5FH 3T25A 1EJNA 3LGUA 3A7ZA 3F9FA 1TQ7B 1C4U2 1SGCA 2Y5FA 4Y79A 2PKSC 1Z6JH 6GCHF 1O33A 1GJDB 2R2MB 4DW2U 3GISB 4B2AA 1ANDA 3VB6A 3BG8A 3V0XA 1S82A 3RMNH 2VINA 2OD3B 1ELGA 2J38A 2BTCE 1BTPA 1C5YB 3M5OA 1UO6A 3RXUA 1TNLA 2ZFPH 1GMCG 3MNCA 1ZMLA 1O34A 5TCCA 3EYDA 1O31A 2BXUH 3S69A 3FP7E 1IQKA 2VNTA 2FOCA 1G2MA 1KXCA 1BTYA 5C1YA 4H6TA 3ZZ6A 3ZVFA 1LHFH 1B7XB 1FY5A 1QHRB 2BDYA 3T2NA 3RP2A 1MTSA 1AWFH 4K1TA 2P3FH 2O8MA 1PJPA 1AO5A 1J16A 4JYVH 2ESTE 3RXIA 1A61H 3RXAA 1KXEA 3LDXH 3MU1A 4IBLH 4Y10E 2ZFSA 4Y0YE 1GBAA 4BTUB 2FOGA 1E36B 5HGGA 2XWAA 2PGQB 5K7RA 2NWNA 5TCAA 1BCUH 4X2VA 5LPRA 3M7UA 4D7FA 2W5EA 4DGJA 1C1SA 3QLPH 1ZTLA 1RTLA 3RXCA 3MFJA 2BVRH 1DS2E 4YLUA 3UUZA 1ARBA 1MAXA 4ISOA 4AB9A 2QXGA 1Y5BT 1CT4E 3FAOA 1V2OT 5ETXA 1QB6A 3QUMP 1O3IA 3ZZ5A 2FTMA 1MQ5A 3SUFA 1MBQA 1P2IA 1V3XA 1U6QA 1C1NA 3A87A 4TY7A 4IN2A 3QN7A 1C2GA 4LZ4B 2ZU3A 2ZHFH 4U32A 9LPRA 2JH6D 1PQAA 1IQFA 5JDUB 1ZHPA 1KDQA 2VB0A 4RN6A 4JYTA 1DWDH 2WUCA 1WOFA 1AVWA 2EA3A 2VU8E 1GPZA 3Q3YA 4GHQA 3RXKA 1OP2A 1NY22 1PYTC 1D3DB 1OKXA 1WV7H 1C1TA 2J95A 3A85A 5CE1A 3RXEA 1NFUA 1SFIA 1EKBB 6GCHG 1NPMA 2PWXA 1O2RA 2B9LA 4RKJB 5T6DA 3TK5A 3SV9A 1HIAB 3TNTA 2BZ6H 4AFSA 4AFZA 1GCDA 3A83A 1P9SA 3AW1A 5H4IB 4DURA 1NTPA 3S9AA 3VGCB 1NRQH 2J94A 3PTBA 5DP7A 3LOXA 3SOSA 3TLOA 3M37A 3L6PA 1L4ZA 3SZNA 2ZA5A 1K9OE 1EAXA 1LVYA 1ORFA 4I8JA 1YBWA 1D3TB 2XCNA 3U98H 3KCGH 3ZVCA 4OS5A 1H9HE 1W7GH 3SQHE 1EUFA 1OP8A 1FNIA 2FI5E 2SGPE 4DY7B 1DOJA 4NWKA 2WPMS 4NFEA 1VITF 3IG6B 4XOJA 4ABEA 1H9IE 1O3LA 2BDBA 2BX3A 3V13A 4DJZB 1TMBH 1OWKA 2Y81A 3ZZ9A 3BTME 1MD7A 1GBCA 1HXEH 4FU8A 1RXPA 1ELBA 4X6OA 4ZXYH 1EPTA 1XVOA 3DFJA 1D9IA 2AS9A 2Z3EA 3BTQE 3ITIA 4CRGA 3TGJE 1GBFA 1FZZA 2AMDA 2QYIA 3BTFE 1TB6H 1GVKB 1PPBH 2QF0A 1ZR0A 1CU1A 1BBRH 2B0FA 2VIVA 3RUOA 4ABFA 5FBIA 1ETSH 1MBMA 3ZVAA 1C2JA 2W26A 1EOLA 3GDSA 1DM4B 1JRSA 1HJAC 1Z8JB 3A84A 1HYLA 2CGAA 2ZF0H 1YP9A 1F5RA 2H9HA 5DKMA 3QX5H 5EW1H 2ZHDA 1TLDA 3KHVA 1PPHE 1GJBB 1P2OA 3HK6B 5EXMA 4BAHB 2ZHQH 1Q2WA 1GG6C 2HRVA 3F1SB 1DWBH 1MU8B 2BD7A 4IN1A 4KTSA 2ODPA 1ZSLA 3MI4A 2ZNKH 4OGXA 1TYNA 1GL1A 2Y80A 1W0ZU 1D6RA 3M3TA 3SGQE 9ESTA 3SUGA 1AU8A 1ARCA 4XBBA 4CHAB 1TWXB 1HJ8A 3E3TA 1UTMA 1O3MA 1ACBE 3CP7A 3SBKA 1CA0C 4TWYA 1MD8A 4ESTE 3RXLA 5EQQA 4AZ2B 1O0DH 3ENSB 2GMTB 2KAIA 1O2JA 3ELAH 1DPOA 2FO9A 1HNEE 1DFPA 1FPCH 1SGFG 4Y7BA 1EQ9A 1XMNB 2GVFA 1SI5H 1VITG 2BOHB 2GT8A 2BY7X 2K1QA 2VH0A 3GY6A 4ISNA 1OSSA 2ZFQH 4CBNA 1CGJE 4ZH8A 3RXTA 1RS0A 4E05H 2EEKA 2AYWA 1WTHD 1BBRK 1C5MD 2FS8A 2QIQA 1LPGB 2ZTZA 1HXFH 2ZCHP 1GBMA 4JYUH 1TMTH 5DP6A 1GGDB 1L1JA 2Z7FE 4NIVA 4A5TS 2AMPA 2HNTC 1O5AB 1HB0B 3A8AA 3SNBA 2F9OA 2A5IA 2AERH 3MH5A 2GZ8A 1N6XA 1QY6A 1P2MA 1IOEA 4XSKU 1BBRE 2F9PA 1EZSC 3LONA 4A6LA 1FY3A 2VGCC 4H6SB 2GTBA 1ELCA 3ZVEA 5J4QA 3RLWH 4KP0A 1NRSH 3SU0A 1DX5M 2OC7A 1SGNE 1OWDA 1G2LA 3VEQB 4BXSA 1K22H 2ZTYA 1SLUB 1RJXB 4JZ1A 3UY9A 2A5AA 3A82A 5T6GA 4QT8C 1ZLRA 1QURH 4KKDA 5A2MH 4U2WA 2ZFTA 5A8XA 3GCHB 4DVAU 1KXDA 3ZYEA 1DDJA 1P0SH 2ZEBA 2ILNA 2QY0B 2ZDAH 1TAWA 2D26C 5JB8S 2FIRH 2QV1A 3IITA 3PWCA 2H1UA 2QC2A 3SV7A 4NZQA 3P8GA 1P12E 5BPEA 1GI4A 1YCPM 3TGKE 2VIQA 3SU3A 4INHA 3P8OA 1IQNA 1FY8E 1KY9A 1NFXA 1LO6A 2W3KA 3QTOH 4FUHA 1C2LA 2NU3E 1Z8IB 2WUBA 1QL8A 4YESB 4CH8B 1UHBB 2Y5HA 3ATKA 2BD3A 4E06H 1FN8A 2A1DB 1ZZZA 2A5KA 1TNHA 3H7TA 3G01A 1DWEH 1MTNB 3SUEA 1YC0A 5A0BA 2Y5GA 3MNBA 1QGFA 4D9RA 3ATWA 1KLTA 2Q1JA 4YT7H 2UWLA 5EU8A 5EODA 1A5HA 3AW0A 1GHYH 4AB8A 2ZCKP 4D9QA 1AKSB 1C9TA 2QXJA 3SV8A 4D76A 2ZDNA 3A80A 3T29A 2CXVA 3MTYA 4JK6A 3S7KB 2VWOA 1ZHRA 1CE5A 3OU0A 4ISHH 3ZYDA 2W7SA 3P8NA 3B8JA 4UFEH 3A81A 4AFQA 2OC0A 3PTNA 1ID5H 4ZHMU 2GZ9A 5J4SA 3KQEA 3RXJA 1PPCE 2FOAA 2BM2A 1AD8H 5I46H 1L4DA 2D2DA 3RU4D 4CR5A 2Q6FA 3TIUA 2R3YA 1TPSA 3JZ1B 2F91A 2CV3A 1BMAA 4ASHA 3I29A 1BHXF 1TX6A 3MYWA 1O30A 1NRNH 4X1NU 4RKOB 1PPFE 3NZIA 1T4UH 1O38A 1YPLH 1BQYA 3MU5A 3E1XB 2ANKH 1W3CA 1KYNA 4B2CA 1J17T 3TH2H 1P57B 1O2OA 4FVDA 5LH8A 1AUJA 1K1NA 1IQJA 1WBGB 1TRNA 4BANB 7GCHF 1HAVB 4I8KA 3A7VA 4CBOA 1O2YA 1ETTH 1TPAE 2Z9GA 1YCPH 1FV9A 3NKKA 1Y3WA 1O2NA 4VGCC 2FXRA 2GKVE 2C8XB 1OWIA 1AB9B 3ATLA 2PGBB 3VB5A 1SGQE 5AF9H 2ZP0H 1V2WT 4YOGA 1LMWB 2R0LA 1BTUA 1O3BA 3VXFH 2A45B 3BF6H 2GX4A 4I32A 2AIQA 3EDXB 3D49H 4K8BA 4MG3A 5EXLA 1S81A 4X1QU 2P93A 1GWAA 1P8VC 1LPKB 2ZGHA 5EGMA 5FX5A 1P2NA 3EGKH 1O3HA 1DUEA 3MO6A 4IW4E 4FU7A 5FPSA 2GCHF 2ZU5A 2XNIA 3HPTB 4LOYH 1QJ1B 3TK9A 3QZQA 3BEFB 2QCYA 2NU0E 3RXSA 3F9EA 1C5ZB 1OWEA 2UUYA 1C5PA 1GDNA 1QJ6B 1A2CH 2H5DA 5K0HA 3A7WA 4UONA 2OTVA 2RDLA 3GDUA 2IN2A 2ZFRH 1K1PA 2O8WA 5EPYA 4CHAC 3A7TA 5DP5A 5EOKA 1KLIH 1WSSH 1HAYB 1ELEE 2BDAA 3RMLH 5GPIB 2ZGCA 2ZDVH 1HAPH 2OINA 3T62A 1ESTA 4O3UA 2HPPH 2R3UA 1GMCF 1O5EH 4KGAA 4TWWA 2B5TB 2J92A 4IGDA 2H9TH 3FVFB 1TONA 1OXGA 2GV7A 1CBWB 2ZG0H 1CT0E 4I8GA 3QWCH 1YCPK 1NFYA 5HXFA 1HRTH 1J9CH 3HKJB 3OY6U 1AFQB 5JYIA 7GCHG 1A1RA 5EPNA 1Z1JA 4J2YB 1FMGA 3PLPA 1H8DH 5F8TA 4DG4A 1THPB 4XBDA 1TRMA 1TOCB 2PHBA 2Z3DA 2PTNA 2A7CA 1A3BH 1A0HB 1FY4A 2STAE 1S5SA 3RXFA 4WVPE 3AAVA 5F8XA 1UJ1A 5EQRA 1Y3VA 2OBQA 3E6PH 5A09A 1BTWA 4MVNA 1ZYOA 2O8TA 5CMXH 1G3CA 5C20A 3OY5U 1UVUH 1TE0A 1ZJDA 3SI4H 3RDZA 3BG4C 3PMJA 2EI7A 1K2I1 1JBUH 3T26A 4ABAA 5DG6A 3TNSA 2BVXH 4JK5A 1HLTH 2Y6TA 5CHAB 1QRXA 2ULLA 2ZWLH 4CRDA 2BY9X 2BD8A 1FAXA 4A1VA 4WXIA 4WXVA 1AZZA 4YT6H 1L1GA 2AEIH 1ETRH 3RXQA 1GMDG 1HDTH 1MTWA 1CHOG 1Y3XA 2VWMA 4J1YA 1AE5A 4IMQA 3LIWA 4BOHA 1TNIA 6CHAB 4K1EA 1RIWB 1EASA 4WWYA 1V6DA 3RXBA 1P01A 1JWTA 4OS1A 1MTNC 1SL3A 1GJ9B 1O5CB 2ODQA 3WY8A 5C2ZA 3LJJA 4MLFB 4X8SH 1C2MA 3UOUA 3QK1A 4O03A 1TA6A 1N8OC 2FDAA 3P92A 2I6SA 3RC4A 3O8CA 2G5NA 1C2DA 2SFAA 3LGVA 3K6ZA 4HTCH 3QGJA 1ELFA 1P09A 3EA8A 3ZZAA 1RFNA 3TJVA 3UQOA 1HAZB 1O2KA 2PFEA 4Q2KA 2XC4A 2ZKSA 1QTFA 3ZZBA 3A88A 2FX6A 2ZDLA 1ELAA 5LGOA 1ELVA 3BTHE 1C5OH 1YKTA 2VVVA 2FLBH 3GDVA 4X1SU 2FM2A 2FPZA 1VGCC 2Q6GA 3M36A 3VFEA 2XC0A 1GJ4H 1C1PA 1TOMH 1EPTC 2Z3CA 2LNCA 4FXGH 1BHXB 1C4Y2 1Y5AT 1V2JT 3RMOH 2F9VA 2PKAA 4B71A 3FP6E 1IQMA 4NIWA 4O9VA 4FUDA 1VR1H 1SGDE 3KNXA 3OSYA 2W7UA 3SORA 2O9QA 1F5LA 1ZOMA 2ZO3H 4ISIH 2OUAA 1V2NT 4Y76A 1TPPA 3P17H 3E0NB 1BJVA 4OGYA 4U30A 4LXBH 3PROA 1UHBA 1TA2A 2AGEX 1CO7E 1GDQA 1QR3E 1EX3A 3MU4A 2P8OC 3TU7H 5EG4A 4WMFA 1GBTA 2FI4E 1YPMH 1TGBA 1XKBC 3ZVDA 1S85A 1HCGA 3KQCA 1DUAA 2BMGB 1FXYA 1TGSZ 2CF8H 4MPUA 1SGIB 4ZKOU 3FFGA 3D65E 1IQEA 4X1PU 1FY1A 1E35B 1JIMA 1ZMJA 4X2WA 4A7IB 1G3EA 1O32A 1GHVH 2XTTB 1XUFA 2AIPA 3O8BA 1PPZA 4ZHAA 1YPKH 3M5LA 2C93B 2ZPSA 3TGIE 3PM3A 3A89A 3ZV9A 4OS7A 1GVLA 2ZU4A 4Y8XA 1AIXH 1W10U 2H9EH 2A4OA 1GBDA 5T3HA 2OBOA 1GCTC 1SBWA 1SGFA 3O8DA 1ABIH 4CH2B 4AGJA 3RXGA 3URDA 2TRMA 1SSXA 1O5GH 4K8YA 1ZRBA 4B1TA 4E7RG 4INKA 2OC8A 2G81E 4Q7ZA 5DPAA 4CRFA 3NPSA 2AMQA 3SN8A 1WCZA 1CA8B 1TQ0B 4NGAH 1JXPA 4MDSA 2C3SA 3DUXH 5F8ZA 2BDIA 1X7AC 1HAVA 3BSQA 1IQGA 5L6NH 5GCHG 2BQ6B 1ZPBA 2ZHWH 1V2VT 1TBQH 1MMJN 5A8YA 1BB0B 3PWBA 3SU2A 2SNVA 3NCLA 5DP8A 2TPIZ 2FP7B 2ZIQH 2FYQA 4IMZA 1K1JA 2ZTXA 3KN2A 4MNYA 1A46H 1VJAU 1KTSB 2ZZUH 4YO9A 3V12A 4PROA 2SGEE 1GI1A 3PMHB 2G52A 4BTTB 4NWLA 1SHHB 4K2YA 4ZMAH 1TIOA 1O3JA 1EZXC 2Z9LA 3U8RH 1NU7B 1C5LH 1SQTA 3ZV8A 2CHAC 4WH6A 4K1SA 3PB1E 4UE7H 3TJOA 3VXEH 3QZRA 3T28A 2ZI2H 2IJOB 5AHGH 3VB4A 2PR3A 1MKWH 1LPZB 2EC9H 2HLCA 1YYY1 1F92A 4Q7XA 5CHAC 5JBAS 4INLA 3T27A 4X2YA 1OYQA 1XUIA 2SNWA 3HK3B 5ESTE 3SNCA 2OP9A 5JBBS 3RM2H 1V2LT 4AX9H 1F0UA 3LGTA 2THFB 4OS2A 4XE4A 1D6WA 1LVBA 1QIXB 1O2LA 5DK1A 1O39A 3SNDA 1PQ8A 2D1JA 1P3EA 1AN1E 6CHAC 4DIIH 4XFQA 2AGIX 1V2TT 4FUCA 1P9UA 1BA8B 1UVOA 1UK2A 1SLWB 4Q80A 2W3IA 3GY2A 5B6OA 3GCTG 4JMYA 1F5KU 1GBLA 1GHZA 1O2VA 2JETB 2ZHEH 3QO6A 3ZVBA 2V35A 3SGAE 3OX7U 2VIPA 1TGTA 2NU2E 3GY7A 2D8WA 1P11E 4AFUA 4I31A 3C27B 4AGKA 1QRWA 5FBEA 1ZGVA 2BX4A 1V2KT 2YNAA 3A7YA 1HAOH 2Y82A 1TFXA 2FESH 1UVSH 1P2JA 2WV4A 2SGQE 2F3CE 3SO3A 4O97A 3DFLA 1TBRH 1DXWA 4AG1A 4B73A 3P95A 3R3GB 1E0FD 2R2WU 3GYMA 2UUFB 2WYJA 4X8UH 1TALA 3TJUA 5C5NA 4I33A 1MKWK 1K1MA 1DLKB 1GI0A 1VJ9U 1OPHB 3RXVA 2R9PA 5GXPA 1DSUA 1VZQH 3SNAA 1TNJA 1C9PA 6ESTA 2ZDKA 1O2HA 2V6NA 1KLJH 1NC6A 2FWWA
chains in the Genus database with same CATH superfamily
1HV7A 1GI3A 1FUJA 4H42U 1HUTH 1O3AA 4FUFA 5GIBA 4Y11E 4DT7B 4WMEA 1THRH 2B7DH 2FI3E 1QFKH 2XBXA 2G55A 1KDQB 3F2HA 1KTTB 2PKSB 3STJA 1YPHE 1W2KH 2RA3A 3PMBB 1SHYA 5FCKA 1T4VH 1OYTH 4TPYA 5C3NA 4I8LA 2CMYA 3H5CB 1NRPH 3ODFA 1TX8A 1AQ7A 1FONA 5AVDA 3RM0H 1XUHA 5HIZA 4BNRA 3ATMA 4Z0KA 5HMAA 3UIRA 1HJ9A 4ZROA 1D3PB 3VGCC 3R0FA 1T7CA 3PYHA 3NXPA 2KCAA 1J15A 1F0RA 2GDEH 2PV9B 3FN8A 1S0QA 3ESTA 1THSH 1TNKA 2BVSH 2M5TA 1BRUP 2XYAA 1C1MA 1G37A 1P04A 3BTEE 3GY8A 4JZEH 1GBEA 1AVGH 4Q4LA 4YOJA 1UCYH 5E2PA 2XBWA 4ZKNU 2OQ5A 3LGYA 1LHCH 2GD4B 2YNBA 1LKBA 3MH7A 2ODYB 1QJ7B 7ESTE 2NU1E 4FUJA 4UDWH 2I6QA 1SGPE 2G5VA 1G32B 3DSOA 1T32A 1GHXH 1WQVH 4ABDA 3V3MA 2FYRA 1BUIA 2XBVA 1MTUA 1BOQA 1XVMA 2EI8A 2Z6BD 2H2ZA 4F4OC 5JPMH 4CRAA 4NIXA 2BDHA 1NFWA 3MNSA 4B75A 3Q00A 4TSFD 5JB9S 2GV6A 2QF3A 1EXFA 4YZUA 5FXLA 1AUTC 2FTLE 2V0BA 8GCHF 1MKXH 1CSOE 1YPEH 3GY3A 1LCYA 1CVWH 3KYGA 5DGJA 2FOEA 1AHTH 1O3PB 1PFXC 1JOUB 3HGNA 1P05A 3GCOA 1O3DA 4HGCA 1SLVB 2A4RA 2G8TA 2XBYA 4ZHLU 1E1RD 4X8VH 3UOPA 3RXMA 2Z9IA 3F68H 3ZZ4A 3L3TA 5E8EH 4FUIA 5C17A 4YOIA 5DJ7A 1C1RA 1SGEE 3JZ2B 1H8IH 2FZZA 1GJ6A 1T8LA 2R0KA 2ZGXH 3PO1B 3SNEA 1XM1A 2UUJB 1O3NA 3EA7A 4WH8A 3SHAH 4JZDH 1EJMA 3MU8A 1HIAA 2QGRA 3KQDA 4M7GA 2C4FH 1GDUA 3O8RA 1MCTA 1FPHH 2NU4E 2IPHA 3BEIB 3OEED 1Z1IA 1QCPA 3PLKA 1OOKB 3ZZCA 1YLDA 1DXPA 1PYTD 1TNGA 1UCYK 3LKWA 5IDKA 2JJ2D 3AAUA 1GMDF 1HAXB 2ANMH 2BD4A 2H6MA 1CHOF 4O3TA 4X1RU 5FPYA 4K5ZA 1C1VH 2C8WB 5EQSA 1VCPA 2ZPRA 4MNVA 4YLQH 1SR5C 1ZSJA 2GMTC 2FODA 1FQ3A 1NT1A 2VWLA 1NM6A 3UNQA 1T8OA 1TPOA 2KAIB 2WPJS 1UCYE 1P03A 3NUMA 1JRTA 2TGDA 2BD5A 1Z8GA 3P8FA 1PQ7A 2ZPQA 3PV2A 4GAWA 1W12U 2XCFA 3UNSA 2QN5T 1MKXK 4HI3A 1PPGE 1QL9A 1Z8RA 3BN9A 4F49A 2UWPA 3M3VA 2LPRA 1HAHH 1ZJKA 3N7EA 3GOVB 3B23B 2P3TB 1A4WH 2HGTH 1QB1A 2UUKB 1GGDC 8GCHG 1AFEH 1P06A 1D3QB 5E0HA 3UB0A 1SC8U 1KXBA 2H5CA 2YMSC 1ELTA 3BV9B 2PUXB 4FETA 1BTZA 2XRCA 1ZPCA 2ZGBH 3D62A 3BTKE 4ABBA 1DT2A 3Q3KA 4TYDA 4BAMB 7KMEH 1T8MA 3OYPA 1O3CA 1EAUA 2OXSA 4AORA 5BRRE 5GDSH 2YOLA 1EB1H 1L2EA 3RXDA 2JKHA 2WPIS 1C2FA 2KCYA 2XWBI 1Q3XA 3A8DA 1S6HA 4FUEA 1UMAH 1W13U 1GG6B 1WYKA 3GCHC 4AOQA 1EZUC 3KF2A 3TH4H 1GMHG 3BTDE 1S84A 1O5FH 5DN6D 3M35A 1QRZA 1ZSKA 2SGFE 3LJOA 1O3FA 1P2KA 1C2KA 1CGIE 3RU4T 1Z7KA 2P3UB 2XC5A 2BQ7B 1Y5UT 1O2GH 4FU9A 3ZZ3A 4BAKB 7LPRA 1O3KA 1SLXB 2RG3A 2BY5X 1AE8H 1CA0B 1KSNA 1C5XB 1SGYE 3QDZB 1ZPZA 1TX7A 2A7JA 1RTKA 3M5NA 3LC3A 3QGNB 5HM2A 1W7XH 1O3GA 3M7QA 2BYAX 4Y8ZA 4ABJA 3TK6A 1O2MA 3NK8A 1T31A 5C5OA 1XUGA 1YGCH 1K1IA 1EFRD 3EQ0H 3Q76A 1G3BA 4XDEA 5GWZA 2HVXA 2PLXA 3OTJE 3F9HA 1DVAH 2Z9KA 8ESTE 5T1VA 5FPTA 3TVJB 1JMOH 1MZDA 2OC1A 1DICA 1W0YH 3U1IB 1L1NA 2ZQ2A 4GCHG 3EA9A 3I78A 1SFQB 3E16B 2BD2A 3SQEE 1G30B 4LZ1H 2FOBA 1GL0E 3URCA 1ELDE 3HGPA 1C1OA 1QZ8A 1DY9A 2ANYA 4K69A 4ZKSU 3BTTE 4Z6AH 2A2QH 1BRBE 4NA9H 3LGIA 1QNJA 3LH3A 4U01A 1HAGE 1RRKA 3RC5A 2VGCB 1A5GH 3RU4E 1HFDA 1ABJH 1N6YA 1O5DH 1MAYA 3MH4A 4WMDA 2XXLA 3DA9B 2FS9A 1NU9A 2G4UA 3Q3XA 2JIZD 1NN6A 3MOCA 1C1WH 2PW8H 3F9GA 2BLQA 2FLRH 4P02A 1S83A 4NA8A 1HBTH 4X6MA 1UK4A 1BMFD 1UTQA 4XRNA 2QAAA 5GCHF 1K1LA 1K21H 3ZZ7A 1GHBG 3RMMH 1UTKA 2CJIA 3BTWE 3DHKH 5I25A 2WPKS 4BAQB 3SJ8A 3KGPA 1BMNH 1GBJA 3CENA 3K9XB 2FOHA 1C5TA 2F9NA 4XBCA 1DWCH 4ABHA 3U9AH 1BDAA 1TBZH 1XXDA 2P95A 1AB9C 4OS4A 3LU9B 1GJCB 3MWIU 4NG9H 4BAOB 4D7GA 3FZZA 5FCRA 4AYVB 4CREA 4SGBE 2ZU2A 4JZFH 4RSPA 5L30H 2OQUA 2STBE 3DD2H 2RDEA 1FIWA 4K60A 1BJUA 3PO1C 1AKSA 1VCWA 1GI6A 4AYYB 1OWHA 1OX1A 2BD9A 3ATIA 4WY3A 2EI6A 1SOZA 1AMHA 2XNDD 4CRBA 2TIOA 2PSXA 1IHTH 2J2UA 5SGAE 1GBHA 2A7HA 2QXIA 4NZLA 1KXAA 4ACBA 1VKYA 2ZECA 3OAAD 4IS5A 2G4TA 1WDIA 1OP0A 1BMMH 5E0JA 1YM0A 2OLGA 1CGHA 1O2QA 3W1EA 3P6ZB 3AVZA 5C94A 1LKAA 6LPRA 3DT0H 5JBTA 1LQEA 5FHTA 1LHDH 1LHEH 1W14U 4THNH 2A4GA 3A8BA 2VIDA 4AN7A 3GY4A 2VVCA 3EE0B 4UFFH 3RC6A 1P3CA 3VB7A 1O2UA 1NESE 1V2MT 4BXWA 1F0TA 3BTGE 2GCTB 3SU6A 3CS7A 3F0PA 1LDTT 3GCTF 1A5IA 2AH4X 3M5MA 4BTIB 4K3JA 3M61U 1SMFE 1EAWA 2J98B 4KTCA 1CBWC 1FI8A 1TMUH 1GI7B 2WZQA 1VCQA 2CF9H 2PTCE 3PLBA 2ALVA 2DE9A 3K2UA 1SGRE 1ESAA 3PV5A 2V3OH 1Y3UA 1EJAA 1MCVA 2F83A 1ANBA 2G51A 1AZ8A 4X0WU 1AFQC 3SGBE 4B2BA 2P94A 5JBCS 4VGCB 3SHCH 3U8OH 5ABWA 4UFGH 2HOBA 3LC5A 2VH6A 3E91A 4Y0ZE 5E2OA 3SW2B 4MQAA 1GI5A 5DSFA 1JIRA 2XW9A 1G9IE 3KIDU 4D8NA 2A0QB 3UWJH 2IOTA 1FLEE 4ABGA 2ANWA 3BIVH 5FL7D 1OHHD 3U1JB 1ZTKA 3HATH 2VIWA 1C5UA 5GJ4B 1V2RT 1O2SA 3TH3H 3RXHA 1IAUA 4MTBA 4R8TB 3L33A 1O5BB 3GCNA 3MU0A 5FX6A 1E34B 1A0JA 2BLWA 1O2TA 1HPGA 2HWLB 3D23A 2O8LA 2TGPZ 3W94A 2BOKA 4MPWA 4A1TA 1O2PA 3SU5A 2BB4A 3MMGA 1Y3YA 1H9LB 2BY8X 3PRDA 1FIZA 5LPEA 3FOAA 1V2PT 4FUGA 3MHWU 3M3SA 4ZUHA 4KTUA 5C67A 8LPRA 3K65B 1RIWC 1SB1H 2O8UA 1T8NA 2BQWB 1XUJA 2J34A 3C1KA 5A8ZA 1H4WA 2Z94A 2A32A 1IQHA 1LVOA 5T6FA 1MZAA 1NZQH 4JZIA 4B74A 3RXPA 5A0AE 4UEHH 2JH0D 2P16A 3S9BA 1WU1A 4FUBA 4B6EA 2FOMB 5EJ1A 1AVXA 5DP3A 1MUEB 1WAYB 4OS6A 2UWOA 4TPIZ 3F0OA 4X6NA 3TJNA 1ANEA 4CR9A 2OK5A 1UTPA 5F6MA 2BLVA 4KELA 1CQQA 1GJ7B 4B6FA 3PMAB 1M9UA 1EB2A 5L2YH 1C5VA 1LQDB 2TBSA 5DP9A 4MNXA 4NCYA 1NS3A 1O2WA 1W8BH 1K1OA 1LHGH 3UFAA 4TY6A 1UVTH 1YF4A 1N1LA 2C90B 2GT7A 5IYTA 2WPLS 3PV4A 3IWMA 2HNTE 1IQLA 1UTJA 4NSYA 2G00A 4X8TH 1AY6H 2YMSD 3FP8E 4ZXXH 2ZQ1A 3BG4B 3SJKA 4XD7D 1KXFA 3UQVA 2RA0A 5E0GA 1Z71A 3LT3A 4IC6A 1GBIA 3ZZ8A 1UTLM 1J8AA 1DE7H 1FAKH 3TPIZ 3UR9A 2TGAA 4YTAA 1YPHC 3ZZDA 3M7TA 3KQBA 2VIOA 4DIHH 2PKAB 4CRCA 4Y71A 8KME2 1F7ZA 4MPVA 5PTPA 1EP5A 1MABB 1C2IA 2V3HH 2GP9B 2WINI 5DO4H 1G36A 5F53A 1UTOA 1V2QT 2A31A 1B0FA 1BRAA 2AFQB 1GJ5H 4ZAEA 1C5RA 2F4LA 3E8LA 1PQ5A 2KX4A 1AI8H 3KEEA 3MNXA 1EOJA 1FX0B 1XX9A 2F9UA 2ZCLP 4Z1MD 5AFZH 1Z6EA 1E37B 3KL6A 3UWIA 1K28D 5HYOA 4E7NA 3E0PB 2SGDE 3GYLB 1BTHH 4NA7A 3S7HB 1QA0A 2HNTF 1LTOA 1TGNA 2FX4A 3SV2H 4RI0A 4ABIA 1SPJA 1C1UH 1W11U 4GSOA 1ANCA 1QL7A 1YPGH 1AGJA 1ZHMA 4LK4A 1DITH 2KR7A 5F03A 2GGVB 3EAJA 1DANH 1GHAF 1N8OB 3TITA 3VPKA 3HKIB 4UFDH 3DSPA 3MH6A 4IC5A 1Y8TA 3I77A 2VJ1A 1Y59T 1O37A 1AWHB 3ZVGA 1O2XA 1QQUA 2C8ZB 1FDPA 3DSGA 4DCDA 4X6PA 2B8OH 2QA9E 3WWFA 3SV6A 2F9BH 5EXNA 2ASUB 4WF8A 3F6UH 1Q31A 4WJG2 4FVBA 1O3EA 2ALPA 1WQSA 3SU4A 3ZIAD 3B9FH 3LGWA 1GHWH 1VGCB 1FJSA 1QBNA 4Y8YA 4YM9A 5C1UA 2FOFA 2BZAA 2VVUA 2WPHS 3NWUA 2CK3D 1HGTH 2GCTC 4GPGA 1CT2E 4GHTA 4ZKRU 3SU1A 4Y7AA 1NROH 1EPTB 1P02A 3Q77A 1DSTA 1QB9A 2BHGA 1F2SE 2J4IA 2P59A 1LVMA 1UVPA 1ZGIA 2J9NA 2AGGX 1TABE 1NRRH 2TGTA 3FKSD 5KECA 4X2XA 4SGAE 3LH1A 4HZHA 4R0IA 2C8YB 3S0NA 2BDGA 5TJXA 4H4FA 4ACAA 4NSVA 3U8TH 3MO3A 1NO9H 1MTVA 1EAIA 2OCVB 3GY5A 1QBVH 3FZDA 1C1QA 1RD3B 4Q7YA 3BEUA 1FN6A 2WV5A 1TGCA 4HG6A 4MNWA 5HM9A 1XKAC 1KIGH 1BZXE 1B0EA 1GMHF 4YXWD 1C4V2 5FAHA 2P8OB 5DP4A 1QQ4A 1BITA 1C5SA 3H7OA 1EATA 1S6LA 2KCPA 4A92A 3SJ9A 2AHME 1EP6A 1SG8B 2CN0H 3U28C 1WTGH 5AFYH 1QA7A 3VB3A 1V2UT 1RGQA 2A4QA 2QXHA 3A8CA 5C1XA 3QTVH 2V3MA 2XOKD 4I7YH 1P10A 1O3OA 2ZU1A 2WYGA 2FEQH 2Q6DA 4A1XA 1C5NH 1GHAG 2BLOA 2JH5D 4NIYA 3OFND 2GDDA 1O36A 3SJOA 3RXOA 2WSSD 5LPFA 1C2HA 4Y6DA 1S6FA 4MPXA 1INCA 3BIUH 2SGAA 1BMLA 1C5QA 3A86A 3UNRA 1ZMNA 1GJ8B 1TRYA 1MQ6A 3S9CA 4I8HA 1GCTB 2FMJA 4HFPB 1DLEA 1OS8A 4GCHF 1D4PB 2BY6X 3V7TA 3SUDA 3E90B 4JCNA 1L0ZA 2J98A 4B76A 1ESBA 1V2ST 3K6YA 5ESBA 2BXTH 1NBMD 3LPRA 1C5WB 1F0SA 5A0CA 1S0RA 1QBOA 2GZ7A 1C2EA 1EZQA 1CHGA 2JETC 1H1BA 3UREA 3STIA 1GBBA 1SQAA 3U69H 2KM0A 1GI2A 3UR6A 4I86A 1IQIA 2Y7XA 3W95A 2RCEA 1HJAB 3A7XA 1XUKA 4GVUA 1GI9B 1GVZA 1A3EH 1OWJA 1MH0A 4UD9H 1ZRKA 1PPEE 1A7SA 1XXFA 4GUXA 4NFFA 2DE8A 5EIYA 2Z9JA 3UPEA 3RXRA 1YPJH 2ZDMA 3SJIA 1IHSH 2ZGJA 1HAIH 3ODDA 3UTUH 1MU6B 3MO9A 3FANA 1GHBF 1WUNH 1RTFB 3CS0A 1YLCA 3P70B 1O2IA 2DUCA 4DOQA 1A0LA 4AG2A 5L2ZH 2HALA 2Y7ZA 1DY8A 2A2XH 1SQOA 5G4BA 2PUQH 2ZC9H 3SI3H 1BT7A 1P2QA 3N7OA 2HPQH 1G3DA 1J14A 1SVPA 1BRCE 1B5GH 2CHAB 1ZTJA 3RLYH 1UK3A 1GJAB 1WXRA 1GBKA 2VWNA 2GCHG 3AASA 1O35A 1GI8B 1SGTA 1SOTA 1VITH 2PSYA 1BTXA 3GICB 5CDFE 4GLYA 1BIOA 2BDCA 2ZFFH 5EW2H 1E38B 1O2ZA 4ISLA 1UTNA 3T5FH 3T25A 5IK2D 1EJNA 3LGUA 3A7ZA 3F9FA 1TQ7B 1C4U2 1SGCA 2Y5FA 4Y79A 2K0QA 2PKSC 1Z6JH 6GCHF 1O33A 1GJDB 2R2MB 4DW2U 3GISB 4B2AA 4DT4A 1ANDA 3VB6A 3BG8A 3V0XA 1S82A 3RMNH 2VINA 2OD3B 1ELGA 2J38A 2BTCE 1BTPA 1C5YB 3M5OA 1UO6A 3RXUA 1TNLA 2ZFPH 1GMCG 3MNCA 1UW7A 1ZMLA 2LP6A 1O34A 5TCCA 3EYDA 1O31A 2BXUH 3S69A 3FP7E 1IQKA 2VNTA 2FOCA 1G2MA 1KXCA 1BTYA 5C1YA 4H6TA 3ZZ6A 3ZVFA 1LHFH 1B7XB 1FY5A 1QHRB 2BDYA 3KYFA 3T2NA 3RP2A 1MTSA 1AWFH 4K1TA 1PJPA 2O8MA 2P3FH 1AO5A 1J16A 4JYVH 2ESTE 3RXIA 1A61H 3RXAA 1KXEA 3LDXH 3MU1A 4IBLH 4Y10E 2ZFSA 4Y0YE 1GBAA 4BTUB 2FOGA 1E36B 5HGGA 2XWAA 2PGQB 5K7RA 2NWNA 5TCAA 1BCUH 4X2VA 5LPRA 3M7UA 4D7FA 2W5EA 4DGJA 1C1SA 3QLPH 1ZTLA 1RTLA 3RXCA 3MFJA 1COWD 2BVRH 1DS2E 4YLUA 3UUZA 1ARBA 1MAXA 4ISOA 4AB9A 2QXGA 1Y5BT 1CT4E 3FAOA 1V2OT 5ETXA 1QB6A 3QUMP 1O3IA 3ZZ5A 2FTMA 1MQ5A 3SUFA 1MBQA 1P2IA 1V3XA 1U6QA 1C1NA 3A87A 4TY7A 4IN2A 3QN7A 3PRBA 1C2GA 4LZ4B 2ZU3A 2ZHFH 4U32A 9LPRA 2JH6D 1PQAA 1IQFA 5JDUB 1ZHPA 1KDQA 2VB0A 4RN6A 4JYTA 1DWDH 2WUCA 1WOFA 1AVWA 2EA3A 2VU8E 1GPZA 3Q3YA 4GHQA 3RXKA 1OP2A 1NY22 1PYTC 1D3DB 1OKXA 1WV7H 1C1TA 2J95A 3A85A 5CE1A 3RXEA 1NFUA 1SFIA 1EKBB 6GCHG 1NPMA 2PWXA 1O2RA 2B9LA 4RKJB 5T6DA 3TK5A 3SV9A 1HIAB 3TNTA 2BZ6H 4AFSA 4AFZA 1GCDA 3A83A 1P9SA 3AW1A 5H4IB 4DURA 1NTPA 3S9AA 3VGCB 1NRQH 2J94A 3PTBA 5DP7A 3LOXA 3SOSA 3TLOA 3M37A 3L6PA 1L4ZA 3SZNA 1H8ED 2ZA5A 1K9OE 1EAXA 1LVYA 1ORFA 4I8JA 1YBWA 1D3TB 2XCNA 3U98H 3KCGH 3ZVCA 4OS5A 1H9HE 1W7GH 3SQHE 1EUFA 1OP8A 1FNIA 2FI5E 2SGPE 4DY7B 1DOJA 4NWKA 2WPMS 4NFEA 1VITF 3IG6B 4XOJA 4ABEA 1H9IE 1O3LA 2BDBA 2BX3A 3V13A 4DJZB 1TMBH 1OWKA 2Y81A 3ZZ9A 3BTME 1MD7A 1GBCA 1HXEH 4FU8A 1RXPA 2EQNA 1ELBA 4X6OA 4ZXYH 1EPTA 1XVOA 3DFJA 1D9IA 2AS9A 2Z3EA 3BTQE 3ITIA 4CRGA 3TGJE 1GBFA 1FZZA 2AMDA 4OM9A 2QYIA 2J5UA 3BTFE 1TB6H 1GVKB 1PPBH 2QF0A 1ZR0A 1CU1A 3OE7D 1BBRH 2B0FA 2VIVA 1YY3A 3RUOA 3OEHD 4ABFA 5FBIA 1ETSH 1MBMA 3ZVAA 1C2JA 2W26A 1EOLA 3GDSA 1DM4B 1JRSA 1HJAC 1Z8JB 5HKKD 3A84A 3CNRA 1HYLA 2CGAA 2ZF0H 1YP9A 1F5RA 2H9HA 5DKMA 3QX5H 5EW1H 2ZHDA 1TLDA 3KHVA 1PPHE 1GJBB 1P2OA 3HK6B 5EXMA 4BAHB 2ZHQH 1Q2WA 1GG6C 2HRVA 3F1SB 1DWBH 1MU8B 2BD7A 4IN1A 4KTSA 2ODPA 1ZSLA 3MI4A 2ZNKH 4OGXA 2V7QD 1TYNA 1GL1A 2Y80A 4TT3D 1W0ZU 1D6RA 3M3TA 3SGQE 9ESTA 3SUGA 2QE7D 1AU8A 1ARCA 4XBBA 4CHAB 1TWXB 1HJ8A 3E3TA 1UTMA 1O3MA 1ACBE 3CP7A 3SBKA 1CA0C 4TWYA 1MD8A 4ESTE 3RXLA 5EQQA 4AZ2B 1O0DH 3ENSB 2GMTB 2KAIA 1O2JA 3ELAH 1DPOA 2FO9A 1HNEE 1DFPA 1FPCH 1SGFG 4Y7BA 1EQ9A 1XMNB 2GVFA 1SI5H 1VITG 2BOHB 2GT8A 2BY7X 2K1QA 2VH0A 3GY6A 4ISNA 1OSSA 2ZFQH 4CBNA 2WHXA 1CGJE 4ZH8A 3RXTA 1RS0A 3F2FA 4E05H 2EEKA 2AYWA 1WTHD 1BBRK 1C5MD 2FS8A 3NRLA 2QIQA 1LPGB 2ZTZA 1HXFH 2ZCHP 1GBMA 4JYUH 1TMTH 5DP6A 1GGDB 1L1JA 2Z7FE 4NIVA 4A5TS 2AMPA 1SKYE 2HNTC 1O5AB 2YMSB 1HB0B 3A8AA 3SNBA 2F9OA 2A5IA 2AERH 3MH5A 2GZ8A 1N6XA 1QY6A 1P2MA 1IOEA 4XSKU 1BBRE 2F9PA 1EZSC 3LONA 4A6LA 1FY3A 2VGCC 4H6SB 2GTBA 1ELCA 3ZVEA 5J4QA 3RLWH 4KP0A 1NRSH 3SU0A 1DX5M 2OC7A 1SGNE 1OWDA 1G2LA 3VEQB 4BXSA 1K22H 2ZTYA 1SLUB 1RJXB 4JZ1A 3UY9A 2A5AA 3A82A 5T6GA 4QT8C 1ZLRA 1QURH 4KKDA 5A2MH 4U2WA 2ZFTA 5A8XA 3GCHB 4DVAU 1KXDA 3EE7A 1DDJA 3ZYEA 1P0SH 2ZEBA 2ILNA 2QY0B 2RFKC 2ZDAH 1TAWA 2D26C 5JB8S 2FIRH 2QV1A 4ASUD 3IITA 3PWCA 2H1UA 2QC2A 3SV7A 3SZEA 4NZQA 3P8GA 1P12E 5BPEA 1GI4A 1YCPM 3TGKE 2VIQA 3SU3A 4INHA 3P8OA 1IQNA 1FY8E 1KY9A 1NFXA 1LO6A 2W3KA 3QTOH 4FUHA 5KEDA 1C2LA 2NU3E 1Z8IB 2WUBA 1QL8A 4YESB 4CH8B 1UHBB 2Y5HA 3ATKA 2BD3A 4E06H 1FN8A 2A1DB 1ZZZA 2A5KA 1TNHA 3H7TA 3G01A 1DWEH 1MTNB 3SUEA 1YC0A 5A0BA 2Y5GA 3MNBA 1QGFA 4D9RA 3ATWA 1KLTA 2Q1JA 4YT7H 5B6LA 2UWLA 5EU8A 5EODA 1A5HA 2WV9A 3AW0A 1GHYH 4AB8A 2ZCKP 4D9QA 1AKSB 1C9TA 2QXJA 3SV8A 4D76A 2ZDNA 3A80A 2J97A 3T29A 2CXVA 3MTYA 4JK6A 3S7KB 2VWOA 1ZHRA 1CE5A 3OU0A 4ISHH 3ZYDA 5GNDA 2W7SA 3P8NA 3B8JA 4UFEH 3A81A 3F3BA 4AFQA 2OC0A 3PTNA 1ID5H 2KZ4A 4ZHMU 2GZ9A 5J4SA 3H09A 3KQEA 3RXJA 1PPCE 2FOAA 2BM2A 1AD8H 5I46H 1SQRA 1L4DA 2LELA 2D2DA 3RU4D 4CR5A 2Q6FA 3DCLA 3TIUA 2R3YA 1TPSA 3JZ1B 2F91A 2CV3A 1BMAA 4ASHA 3I29A 1BHXF 1TX6A 3MYWA 1O30A 1NRNH 4X1NU 4RKOB 1PPFE 3NZIA 1T4UH 1O38A 1YPLH 1BQYA 3MU5A 3E1XB 2ANKH 1W3CA 1KYNA 4B2CA 1J17T 3TH2H 1P57B 1O2OA 4FVDA 5LH8A 2W6ID 1AUJA 1K1NA 1IQJA 1WBGB 1TRNA 4BANB 7GCHF 1HAVB 2IJD1 4I8KA 3A7VA 4CBOA 1O2YA 1ETTH 1TPAE 2Z9GA 1YCPH 1FV9A 3NKKA 1Y3WA 1O2NA 4VGCC 5C0UA 2QF5A 2FXRA 2GKVE 2C8XB 1OWIA 1AB9B 3F2GA 3ATLA 2PGBB 3VB5A 1SGQE 5AF9H 2ZP0H 1V2WT 2VBCA 4YOGA 1LMWB 2R0LA 1BTUA 1O3BA 3VXFH 2A45B 3BF6H 2GX4A 4I32A 2AIQA 3EDXB 3D49H 2M2AA 4K8BA 4MG3A 5EXLA 1S81A 4X1QU 1H8HD 2P93A 3N7DA 1GWAA 1P8VC 5C0TA 1LPKB 2ZGHA 5EGMA 5FX5A 1P2NA 3EGKH 2F43B 1O3HA 1DUEA 3MO6A 4IW4E 4FU7A 5FPSA 2GCHF 2ZU5A 2XNIA 3HPTB 4LOYH 1QJ1B 3KQ5A 3TK9A 3QZQA 3BEFB 2QCYA 2NU0E 3RXSA 3F9EA 1C5ZB 1OWEA 2UUYA 1C5PA 1GDNA 1QJ6B 1A2CH 2H5DA 5K0HA 3A7WA 4UONA 2OTVA 2RDLA 3GDUA 2IN2A 2ZFRH 1K1PA 2O8WA 5EPYA 4CHAC 3A7TA 5DP5A 5EOKA 1KLIH 1YWUA 1WSSH 1HAYB 1ELEE 2BDAA 3RMLH 5GPIB 2ZGCA 2ZDVH 1HAPH 2OINA 3T62A 1ESTA 4O3UA 2HPPH 2R3UA 1GMCF 1O5EH 4KGAA 4TWWA 2B5TB 2J92A 4IGDA 2H9TH 3FVFB 1TONA 1OXGA 2GV7A 1CBWB 2ZG0H 1CT0E 4I8GA 3QWCH 1YCPK 3WWBA 1NFYA 5HXFA 1HRTH 1W0KD 1J9CH 3HKJB 4P00A 3OY6U 1AFQB 2WPDD 5JYIA 7GCHG 1A1RA 5EPNA 1Z1JA 4J2YB 1FMGA 3PLPA 1H8DH 5F8TA 4DG4A 1THPB 4XBDA 1TRMA 1TOCB 2PHBA 2Z3DA 2PTNA 2A7CA 1A3BH 1E79D 1A0HB 1FY4A 2STAE 1S5SA 3RXFA 4WVPE 3AAVA 5F8XA 1UJ1A 5EQRA 1Y3VA 2OBQA 3E6PH 5A09A 1BTWA 4MVNA 1ZYOA 2O8TA 5CMXH 1G3CA 5C20A 3OY5U 1UVUH 1TE0A 1ZJDA 3SI4H 3RDZA 3BG4C 3PMJA 2EI7A 5KGOA 2JJ1D 1K2I1 4F55A 1JBUH 3T26A 4ABAA 2KCOA 5DG6A 3TNSA 2BVXH 4AC9A 4JK5A 1HLTH 2Y6TA 5CHAB 1QRXA 2ULLA 2ZWLH 4CRDA 2BY9X 2BD8A 1FAXA 5HIYA 4A1VA 4WXIA 4WXVA 1AZZA 4YT6H 3OTPA 2HLDD 1L1GA 4F48B 2AEIH 1E1QD 1ETRH 2K8IA 3RXQA 1GMDG 1HDTH 1MTWA 1CHOG 1Y3XA 2VWMA 4J1YA 1AE5A 4IMQA 3LIWA 4BOHA 1TNIA 6CHAB 4K1EA 1RIWB 1EASA 4WWYA 1V6DA 3RXBA 1P01A 1JWTA 4OS1A 3UAIC 1MTNC 1SL3A 2GJGA 2W6JD 1GJ9B 1O5CB 2ODQA 3WY8A 5C2ZA 3LJJA 4MLFB 4X8SH 1C2MA 3UOUA 3QK1A 4O03A 1TA6A 1N8OC 2FDAA 3P92A 2I6SA 3RC4A 3O8CA 2G5NA 1C2DA 2SFAA 3LGVA 3K6ZA 4HTCH 3QGJA 1ELFA 1P09A 3EA8A 3ZZAA 4ZCNA 1RFNA 3TJVA 3UQOA 1HAZB 1O2KA 2PFEA 4Q2KA 2XC4A 2ZKSA 1QTFA 3ZZBA 3A88A 2FX6A 2ZDLA 1ELAA 5LGOA 1ELVA 3BTHE 1C5OH 1YKTA 2VVVA 2FLBH 3GDVA 4X1SU 2FM2A 2FPZA 1VGCC 2Q6GA 3M36A 3VFEA 2XC0A 1GJ4H 1C1PA 1TOMH 1EPTC 2Z3CA 2LNCA 4FXGH 1BHXB 1C4Y2 1Y5AT 1V2JT 2L74A 3GS9A 2F9VA 2PKAA 3RMOH 4B71A 3FP6E 1IQMA 4NIWA 4O9VA 4FUDA 1VR1H 1SGDE 3KNXA 3OSYA 2W7UA 3SORA 2O9QA 1F5LA 1ZOMA 2ZO3H 4ISIH 2OUAA 1V2NT 4Y76A 1TPPA 3P17H 3SYJA 3E0NB 1BJVA 4OGYA 4U30A 4LXBH 3PROA 1UHBA 1TA2A 2AGEX 1CO7E 1GDQA 1QR3E 1EX3A 3MU4A 2P8OC 3TU7H 2QF4A 4M9FA 5EG4A 4WMFA 1GBTA 2FI4E 1YPMH 1TGBA 1XKBC 3ZVDA 1S85A 1HCGA 3KQCA 1DUAA 2BMGB 1FXYA 1TGSZ 2CF8H 4MPUA 1SGIB 4ZKOU 3FFGA 3D65E 1IQEA 4X1PU 1FY1A 1E35B 1JIMA 5CHBA 1ZMJA 4X2WA 4A7IB 1G3EA 1O32A 1GHVH 2XTTB 1XUFA 2AIPA 3O8BA 1PPZA 4ZHAA 1YPKH 3M5LA 2C93B 3FO8D 2ZPSA 3TGIE 3PM3A 3N99A 3A89A 3ZV9A 4OS7A 1GVLA 2EY4C 2ZU4A 4Y8XA 1AIXH 1W10U 2H9EH 2A4OA 1GBDA 5T3HA 2OBOA 1GCTC 5EJZA 3WW7A 1SBWA 1SGFA 3O8DA 1ABIH 4CH2B 4AGJA 3RXGA 3URDA 2TRMA 1SSXA 1O5GH 4K8YA 1ZRBA 4B1TA 4E7RG 4INKA 2OC8A 2G81E 4Q7ZA 5DPAA 4CRFA 3NPSA 2AMQA 3SN8A 1WCZA 1CA8B 1TQ0B 4RT0A 1NBME 4NGAH 1JXPA 4MDSA 2C3SA 3DUXH 5F8ZA 2BDIA 1X7AC 1HAVA 3BSQA 1IQGA 5L6NH 5GCHG 2BQ6B 1ZPBA 2ZHWH 1V2VT 1TBQH 2KFWA 1MMJN 5A8YA 1BB0B 3PWBA 3SU2A 2HVYB 2SNVA 3NCLA 5DP8A 2TPIZ 2FP7B 2ZIQH 2FYQA 4IMZA 1K1JA 2ZTXA 3KN2A 4MNYA 1A46H 1VJAU 1KTSB 1YLNA 2ZZUH 4YO9A 3V12A 3MQKC 2IPQX 4PROA 2SGEE 1GI1A 3PMHB 2G52A 4BTTB 4NWLA 1SHHB 4K2YA 4ZMAH 1TIOA 3VG8A 1O3JA 1EZXC 2Z9LA 3U8RH 1NU7B 1C5LH 1SQTA 3ZV8A 2CHAC 4WH6A 4K1SA 3PB1E 4UE7H 3TJOA 3VXEH 3QZRA 3T28A 2ZI2H 2IJOB 5AHGH 3VB4A 2PR3A 1KMHB 1MKWH 1LPZB 2EC9H 2HLCA 1YYY1 1F92A 4Q7XA 5CHAC 5JBAS 4INLA 3T27A 4X2YA 1OYQA 1XUIA 2SNWA 3HK3B 5ESTE 3SNCA 2OP9A 5JBBS 3RM2H 1V2LT 4AX9H 1F0UA 3LGTA 2THFB 4OS2A 4XE4A 1D6WA 1LVBA 1QIXB 1O2LA 5DK1A 1O39A 3SNDA 1PQ8A 2D1JA 1P3EA 1AN1E 6CHAC 4DIIH 4XFQA 2L6OA 2AGIX 1V2TT 1W0JD 4RT1A 4FUCA 1P9UA 1BA8B 1UVOA 1UK2A 1SLWB 4Q80A 2W3IA 3GY2A 5B6OA 3GCTG 4JMYA 1F5KU 1GBLA 1GHZA 1O2VA 2JETB 2ZHEH 3QO6A 3ZVBA 2V35A 3SGAE 3OX7U 2VIPA 1TGTA 2NU2E 3GY7A 2D8WA 1P11E 4AFUA 4I31A 3C27B 4AGKA 1QRWA 5FBEA 1ZGVA 2BX4A 1V2KT 2YNAA 3A7YA 1HAOH 2Y82A 1TFXA 2FESH 1UVSH 1P2JA 2WV4A 2SGQE 2F3CE 3SO3A 4Q63A 4O97A 3DFLA 1TBRH 1K0HA 1DXWA 4AG1A 4B73A 3P95A 3R3GB 1E0FD 2R2WU 3GYMA 2JDID 2UUFB 2WYJA 4X8UH 3AK5A 1TALA 3TJUA 5C5NA 4I33A 1MKWK 1K1MA 1DLKB 4FOUC 1GI0A 1VJ9U 1OPHB 3RXVA 2R9PA 5GXPA 1DSUA 1VZQH 2PP6A 1TNJA 3SNAA 1C9PA 6ESTA 2ZDKA 1O2HA 2V6NA 5EJLA 1KLJH 1NC6A 2FWWA
chains in the Genus database with same CATH topology
1HV7A 1GI3A 1FUJA 4H42U 1HUTH 1O3AA 4FUFA 5GIBA 4Y11E 4DT7B 4WMEA 1THRH 2B7DH 2FI3E 1QFKH 2XBXA 2G55A 1KDQB 1KTTB 2PKSB 3STJA 1YPHE 1W2KH 2RA3A 3PMBB 1SHYA 5FCKA 1T4VH 1OYTH 4TPYA 5C3NA 4I8LA 2CMYA 3H5CB 1NRPH 3ODFA 1TX8A 1AQ7A 1FONA 5AVDA 3RM0H 1XUHA 4BNRA 3ATMA 4Z0KA 5HMAA 3UIRA 1HJ9A 4ZROA 1D3PB 3VGCC 3R0FA 1T7CA 3PYHA 3NXPA 1J15A 1F0RA 2GDEH 2PV9B 1S0QA 3ESTA 1THSH 1TNKA 2BVSH 2M5TA 1BRUP 2XYAA 1C1MA 1G37A 1P04A 3BTEE 3GY8A 4JZEH 1GBEA 1AVGH 4YOJA 1UCYH 5E2PA 2XBWA 4ZKNU 2OQ5A 3LGYA 1LHCH 2GD4B 2YNBA 1LKBA 3MH7A 2ODYB 1QJ7B 7ESTE 2NU1E 4FUJA 4UDWH 2I6QA 1SGPE 2G5VA 1G32B 1T32A 1GHXH 1WQVH 4ABDA 3V3MA 2FYRA 1BUIA 2XBVA 1MTUA 1BOQA 1XVMA 2EI8A 2Z6BD 2H2ZA 4F4OC 5JPMH 4CRAA 4NIXA 2BDHA 1NFWA 3MNSA 4B75A 3Q00A 5JB9S 2GV6A 2QF3A 1EXFA 4YZUA 5FXLA 1AUTC 2FTLE 2V0BA 8GCHF 1MKXH 1CSOE 1YPEH 3GY3A 1LCYA 1CVWH 5DGJA 2FOEA 1AHTH 1O3PB 1PFXC 1JOUB 3HGNA 1P05A 3GCOA 1O3DA 4HGCA 1SLVB 2A4RA 2G8TA 2XBYA 4ZHLU 4X8VH 3UOPA 3RXMA 2Z9IA 3F68H 3ZZ4A 3L3TA 5E8EH 4FUIA 4YOIA 5DJ7A 1C1RA 1SGEE 3JZ2B 1H8IH 2FZZA 1GJ6A 1T8LA 2R0KA 2ZGXH 3PO1B 3SNEA 1XM1A 2UUJB 1O3NA 3EA7A 4WH8A 3SHAH 4JZDH 1EJMA 3MU8A 1HIAA 2QGRA 3KQDA 4M7GA 2C4FH 1GDUA 3O8RA 1MCTA 1FPHH 2NU4E 2IPHA 3BEIB 1Z1IA 1QCPA 3PLKA 1OOKB 3ZZCA 1YLDA 1DXPA 1PYTD 1TNGA 1UCYK 3LKWA 5IDKA 3AAUA 1GMDF 1HAXB 2ANMH 2BD4A 2H6MA 1CHOF 4O3TA 4X1RU 5FPYA 4K5ZA 1C1VH 2C8WB 5EQSA 1VCPA 2ZPRA 4MNVA 4YLQH 1SR5C 1ZSJA 2GMTC 1FQ3A 1NT1A 2FODA 2VWLA 1NM6A 3UNQA 1T8OA 1TPOA 2KAIB 2WPJS 1UCYE 1P03A 3NUMA 1JRTA 2TGDA 2BD5A 1Z8GA 3P8FA 1PQ7A 2ZPQA 4GAWA 1W12U 2XCFA 3UNSA 2QN5T 1MKXK 4HI3A 1PPGE 1QL9A 1Z8RA 3BN9A 4F49A 2UWPA 3M3VA 2LPRA 1HAHH 1ZJKA 3GOVB 3B23B 2P3TB 1A4WH 2HGTH 1QB1A 2UUKB 1GGDC 8GCHG 1AFEH 1P06A 1D3QB 5E0HA 1SC8U 1KXBA 2H5CA 1ELTA 3BV9B 2PUXB 1BTZA 2XRCA 1ZPCA 2ZGBH 3D62A 3BTKE 4ABBA 1DT2A 3Q3KA 4TYDA 4BAMB 7KMEH 1T8MA 3OYPA 1O3CA 1EAUA 2OXSA 4AORA 5BRRE 5GDSH 2YOLA 1EB1H 1L2EA 3RXDA 2JKHA 2WPIS 1C2FA 2XWBI 1Q3XA 3A8DA 1S6HA 4FUEA 1UMAH 1W13U 1GG6B 1WYKA 3GCHC 4AOQA 1EZUC 3KF2A 3TH4H 1GMHG 3BTDE 1S84A 1O5FH 3M35A 1QRZA 1ZSKA 2SGFE 3LJOA 1O3FA 1P2KA 1C2KA 1CGIE 3RU4T 1Z7KA 2P3UB 2XC5A 2BQ7B 1Y5UT 1O2GH 4FU9A 3ZZ3A 4BAKB 7LPRA 1O3KA 1SLXB 2RG3A 2BY5X 1AE8H 1CA0B 1KSNA 1C5XB 1SGYE 3QDZB 1ZPZA 1TX7A 2A7JA 1RTKA 3M5NA 3LC3A 3QGNB 5HM2A 1W7XH 1O3GA 3M7QA 2BYAX 4Y8ZA 4ABJA 3TK6A 1O2MA 3NK8A 1T31A 5C5OA 1XUGA 1YGCH 1K1IA 3EQ0H 3Q76A 1G3BA 4XDEA 5GWZA 2HVXA 2PLXA 3OTJE 3F9HA 1DVAH 2Z9KA 8ESTE 5FPTA 3TVJB 1JMOH 1MZDA 2OC1A 1DICA 1W0YH 3U1IB 1L1NA 2ZQ2A 4GCHG 3EA9A 3I78A 1SFQB 3E16B 2BD2A 3SQEE 1G30B 4LZ1H 2FOBA 1GL0E 3URCA 1ELDE 3HGPA 1C1OA 1DY9A 2ANYA 4K69A 4ZKSU 3BTTE 4Z6AH 2A2QH 1BRBE 4NA9H 3LGIA 1QNJA 3LH3A 4U01A 1HAGE 1RRKA 3RC5A 2VGCB 1A5GH 3RU4E 1HFDA 1ABJH 1N6YA 1O5DH 1MAYA 3MH4A 4WMDA 2XXLA 3DA9B 2FS9A 1NU9A 2G4UA 3Q3XA 1NN6A 3MOCA 1C1WH 2PW8H 3F9GA 2BLQA 2FLRH 1S83A 4NA8A 1HBTH 4X6MA 1UK4A 1UTQA 2QAAA 5GCHF 1K1LA 1K21H 3ZZ7A 1GHBG 3RMMH 1UTKA 2CJIA 3BTWE 3DHKH 5I25A 2WPKS 4BAQB 3SJ8A 3KGPA 1BMNH 1GBJA 3CENA 3K9XB 2FOHA 1C5TA 2F9NA 4XBCA 1DWCH 4ABHA 3U9AH 1BDAA 1TBZH 1XXDA 2P95A 1AB9C 4OS4A 3LU9B 1GJCB 3MWIU 4NG9H 4BAOB 4D7GA 3FZZA 5FCRA 4AYVB 4CREA 4SGBE 2ZU2A 4JZFH 4RSPA 5L30H 2OQUA 2STBE 3DD2H 1FIWA 4K60A 1BJUA 3PO1C 1AKSA 1VCWA 1GI6A 4AYYB 1OWHA 1OX1A 2BD9A 3ATIA 4WY3A 2EI6A 1SOZA 1AMHA 4CRBA 2TIOA 2PSXA 1IHTH 2J2UA 5SGAE 1GBHA 2A7HA 2QXIA 4NZLA 1KXAA 2ZECA 4IS5A 2G4TA 1OP0A 1BMMH 5E0JA 1YM0A 2OLGA 1CGHA 1O2QA 3P6ZB 3AVZA 6LPRA 1LKAA 5JBTA 3DT0H 1LQEA 5FHTA 1LHDH 1LHEH 1W14U 4THNH 2A4GA 3A8BA 2VIDA 4AN7A 3GY4A 2VVCA 3EE0B 4UFFH 3RC6A 1P3CA 3VB7A 1O2UA 1NESE 1V2MT 4BXWA 1F0TA 3BTGE 2GCTB 3SU6A 3CS7A 1LDTT 3GCTF 1A5IA 2AH4X 3M5MA 4BTIB 4K3JA 3M61U 1SMFE 1EAWA 4KTCA 1CBWC 1FI8A 1TMUH 1GI7B 1VCQA 2CF9H 2PTCE 3PLBA 2ALVA 2DE9A 3K2UA 1SGRE 1ESAA 2V3OH 1Y3UA 1EJAA 1MCVA 2F83A 1ANBA 2G51A 1AZ8A 4X0WU 1AFQC 3SGBE 4B2BA 2P94A 5JBCS 4VGCB 3SHCH 3U8OH 5ABWA 4UFGH 2HOBA 3LC5A 2VH6A 3E91A 4Y0ZE 5E2OA 3SW2B 4MQAA 1GI5A 1JIRA 2XW9A 1G9IE 3KIDU 4D8NA 2A0QB 3UWJH 2IOTA 1FLEE 4ABGA 2ANWA 3BIVH 3U1JB 1ZTKA 3HATH 2VIWA 1C5UA 5GJ4B 1V2RT 1O2SA 3TH3H 3RXHA 1IAUA 4MTBA 4R8TB 3L33A 1O5BB 3GCNA 3MU0A 5FX6A 1E34B 1A0JA 2BLWA 1O2TA 1HPGA 2HWLB 3D23A 2O8LA 2TGPZ 3W94A 2BOKA 4MPWA 4A1TA 1O2PA 3SU5A 2BB4A 3MMGA 1Y3YA 1H9LB 2BY8X 1FIZA 5LPEA 1V2PT 4FUGA 3MHWU 3M3SA 4ZUHA 4KTUA 5C67A 8LPRA 3K65B 1RIWC 1SB1H 2O8UA 1T8NA 2BQWB 1XUJA 2J34A 3C1KA 5A8ZA 1H4WA 2Z94A 2A32A 1IQHA 1LVOA 5T6FA 1MZAA 1NZQH 4JZIA 4B74A 3RXPA 5A0AE 4UEHH 2JH0D 2P16A 3S9BA 1WU1A 4FUBA 2FOMB 1AVXA 5DP3A 1MUEB 1WAYB 4OS6A 2UWOA 4TPIZ 4X6NA 3TJNA 1ANEA 4CR9A 1UTPA 5F6MA 2BLVA 4KELA 1CQQA 1GJ7B 3PMAB 1M9UA 1EB2A 5L2YH 1C5VA 1LQDB 2TBSA 5DP9A 4MNXA 4NCYA 1NS3A 1O2WA 1W8BH 1K1OA 1LHGH 3UFAA 4TY6A 1UVTH 1YF4A 1N1LA 2C90B 2GT7A 5IYTA 2WPLS 3PV4A 3IWMA 2HNTE 1IQLA 1UTJA 4NSYA 2G00A 4X8TH 1AY6H 3FP8E 4ZXXH 2ZQ1A 3BG4B 3SJKA 1KXFA 3UQVA 2RA0A 5E0GA 1Z71A 3LT3A 4IC6A 1GBIA 3ZZ8A 1UTLM 1J8AA 1DE7H 1FAKH 3TPIZ 3UR9A 2TGAA 4YTAA 1YPHC 3ZZDA 3M7TA 3KQBA 2VIOA 4DIHH 2PKAB 4CRCA 4Y71A 8KME2 1F7ZA 4MPVA 5PTPA 1EP5A 1C2IA 2V3HH 2GP9B 2WINI 5DO4H 1G36A 1UTOA 1V2QT 2A31A 1B0FA 1BRAA 2AFQB 1GJ5H 4ZAEA 1C5RA 3E8LA 1PQ5A 1AI8H 3KEEA 3MNXA 1EOJA 1XX9A 2F9UA 2ZCLP 5AFZH 1Z6EA 1E37B 3KL6A 3UWIA 1K28D 5HYOA 4E7NA 3E0PB 2SGDE 3GYLB 1BTHH 4NA7A 3S7HB 1QA0A 2HNTF 1LTOA 1TGNA 2FX4A 3SV2H 4ABIA 1SPJA 1C1UH 1W11U 4GSOA 1ANCA 1QL7A 1YPGH 1AGJA 1ZHMA 4LK4A 1DITH 5F03A 2GGVB 3EAJA 1DANH 1GHAF 1N8OB 3TITA 3VPKA 3HKIB 4UFDH 3MH6A 4IC5A 1Y8TA 3I77A 2VJ1A 1Y59T 1O37A 1AWHB 3ZVGA 1O2XA 1QQUA 2C8ZB 1FDPA 4DCDA 4X6PA 2B8OH 2QA9E 3SV6A 2F9BH 5EXNA 2ASUB 4WF8A 3F6UH 1Q31A 4WJG2 4FVBA 1O3EA 2ALPA 1WQSA 3SU4A 3B9FH 3LGWA 1GHWH 1VGCB 1FJSA 1QBNA 4Y8YA 4YM9A 5C1UA 2FOFA 2BZAA 2VVUA 2WPHS 3NWUA 4ZKRU 1HGTH 2GCTC 4GPGA 1CT2E 4GHTA 3SU1A 4Y7AA 1NROH 1EPTB 1P02A 3Q77A 1DSTA 2P59A 1QB9A 1F2SE 2BHGA 2J4IA 1LVMA 1UVPA 1ZGIA 2J9NA 2AGGX 1TABE 1NRRH 2TGTA 4X2XA 4SGAE 3LH1A 4HZHA 4R0IA 2C8YB 3S0NA 2BDGA 5TJXA 4H4FA 4NSVA 3U8TH 3MO3A 1NO9H 1MTVA 1EAIA 2OCVB 3GY5A 1QBVH 3FZDA 1C1QA 1RD3B 4Q7YA 3BEUA 1FN6A 2WV5A 1TGCA 4MNWA 5HM9A 1XKAC 1KIGH 1BZXE 1B0EA 1GMHF 1C4V2 5FAHA 2P8OB 5DP4A 1QQ4A 1BITA 1C5SA 3H7OA 1EATA 4A92A 3SJ9A 1EP6A 1SG8B 2CN0H 1WTGH 5AFYH 1QA7A 3VB3A 1V2UT 1RGQA 2A4QA 2QXHA 3A8CA 5C1XA 3QTVH 4I7YH 1P10A 1O3OA 2ZU1A 2WYGA 2FEQH 2Q6DA 4A1XA 1C5NH 1GHAG 2BLOA 2JH5D 4NIYA 2GDDA 1O36A 3SJOA 3RXOA 5LPFA 1C2HA 4Y6DA 1S6FA 4MPXA 1INCA 3BIUH 2SGAA 1BMLA 1C5QA 3A86A 3UNRA 1ZMNA 1GJ8B 1TRYA 1MQ6A 3S9CA 4I8HA 1GCTB 2FMJA 4HFPB 1DLEA 1OS8A 4GCHF 1D4PB 2BY6X 3V7TA 3SUDA 3E90B 4JCNA 1L0ZA 4B76A 1ESBA 1V2ST 3K6YA 5ESBA 2BXTH 3LPRA 1C5WB 1F0SA 5A0CA 1S0RA 1QBOA 2GZ7A 1C2EA 1EZQA 1CHGA 2JETC 1H1BA 3UREA 3STIA 1GBBA 1SQAA 3U69H 1GI2A 3UR6A 1IQIA 2Y7XA 3W95A 2RCEA 1HJAB 3A7XA 1XUKA 4GVUA 1GI9B 1GVZA 1A3EH 1OWJA 1MH0A 4UD9H 1ZRKA 1PPEE 1A7SA 1XXFA 4GUXA 4NFFA 2DE8A 2Z9JA 3UPEA 3RXRA 1YPJH 2ZDMA 3SJIA 1IHSH 2ZGJA 1HAIH 3ODDA 3UTUH 1MU6B 3MO9A 3FANA 1GHBF 1WUNH 1RTFB 3CS0A 1YLCA 3P70B 1O2IA 2DUCA 4DOQA 1A0LA 4AG2A 5L2ZH 2HALA 2Y7ZA 1DY8A 2A2XH 1SQOA 5G4BA 2PUQH 2ZC9H 3SI3H 1BT7A 1P2QA 3N7OA 2HPQH 1G3DA 1J14A 1SVPA 1BRCE 1B5GH 2CHAB 1ZTJA 3RLYH 1UK3A 1GJAB 1GBKA 2VWNA 2GCHG 3AASA 1O35A 1GI8B 1SGTA 1SOTA 1VITH 2PSYA 1BTXA 3GICB 4GLYA 1BIOA 2BDCA 2ZFFH 5EW2H 1E38B 1O2ZA 4ISLA 1UTNA 3T5FH 3T25A 1EJNA 3LGUA 3A7ZA 3F9FA 1TQ7B 1C4U2 1SGCA 2Y5FA 4Y79A 2PKSC 1Z6JH 6GCHF 1O33A 1GJDB 2R2MB 4DW2U 3GISB 4B2AA 1ANDA 3VB6A 3BG8A 3V0XA 1S82A 3RMNH 2VINA 2OD3B 1ELGA 2J38A 2BTCE 1BTPA 1C5YB 3M5OA 1UO6A 3RXUA 1TNLA 2ZFPH 1GMCG 3MNCA 1ZMLA 1O34A 5TCCA 3EYDA 1O31A 2BXUH 3S69A 3FP7E 1IQKA 2VNTA 2FOCA 1G2MA 1KXCA 1BTYA 5C1YA 4H6TA 3ZZ6A 3ZVFA 1LHFH 1B7XB 1FY5A 1QHRB 2BDYA 3T2NA 3RP2A 1MTSA 1AWFH 4K1TA 2P3FH 2O8MA 1PJPA 1AO5A 1J16A 4JYVH 2ESTE 3RXIA 1A61H 3RXAA 1KXEA 3LDXH 3MU1A 4IBLH 4Y10E 2ZFSA 4Y0YE 1GBAA 4BTUB