1FONA

Crystal structure of bovine procarboxypeptidase a-s6 subunit iii, a highly structured truncated zymogen e
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
SWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPTVDYEHCSQWDWWGITVKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWIDETIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCARBOXYPEPTIDASE A-S6
publication title Crystal structure of bovine procarboxypeptidase A-S6 subunit III, a highly structured truncated zymogen E.
pubmed rcsb
molecule tags Serine protease
total genus 55
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fonA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fonA01
1HCGA 3RLWH 3I29A 2HALA 3RXPA 4X2WA 3EA8A 4D9QA 1NRQH 2G51A 4F4OC 1GDUA 1YCPM 2AMPA 2YNBA 1J16A 3MOCA 3OTJE 1Y3VA 1DITH 1E0FD 2QXGA 3GISB 1Z8GA 1BRCE 1TRYA 3V13A 1BDAA 1C5QA 1CHGA 3RXKA 2ZGCA 1ESAA 3AVZA 2BOKA 2ZFTA 5F03A 1GJ5H 1EKBB 3UPEA 1SGYE 4PROA 4ABBA 2Y5HA 1L4DA 1W8BH 3QK1A 1YLCA 2QGRA 1N8OC 1D3DB 2K1QA 1VCPA 1N6XA 3O8CA 1UCYE 1ANDA 2VVCA 1DWEH 3BIUH 2GP9B 2J95A 1TMUH 2CJIA 3GY7A 4IMQA 4YZUA 3C1KA 2R0LA 1GI5A 4BNRA 3SGBE 1G3DA 1O3AA 1XUKA 3BTDE 2Y6TA 1W12U 1EUFA 4DGJA 2HNTF 1K2I1 2VJ1A 5EPNA 1CA8B 1GDNA 3SGAE 1CA0C 4JZFH 1Y3YA 3RXGA 1DT2A 2Z3EA 3Q76A 1CHOF 5HYOA 1AWHB 3ATKA 1EB1H 2GMTB 1SG8B 2BLQA 3ZV9A 4GLYA 1IQFA 4X8TH 2PLXA 4QT8C 4WJG2 4XDEA 4GAWA 4JZDH 2BXUH 6GCHF 1IQNA 1DY9A 1JXPA 3FP7E 1NFYA 2FTLE 1BHXF 5JPMH 4X6NA 2XXLA 1C1MA 2O8UA 2XBWA 1EXFA 2BTCE 3HKJB 4JZEH 1CT2E 1FY8E 2ZHDA 1GHBF 1ZTJA 1SI5H 5FPSA 1VITF 3BF6H 5L30H 3V12A 1G2MA 1O3PB 1C4V2 1V2MT 1ZHRA 1O2MA 3SI4H 2ZNKH 1YPJH 3SU4A 3KQEA 1YPHC 4IBLH 5DGJA 2ZDAH 3RXOA 1S83A 1C5PA 2PKAB 4FU8A 1O2KA 4BXWA 1C5VA 1FIZA 1C5XB 2STAE 4D7GA 3GY6A 1EP6A 4IMZA 4Y8XA 4X1PU 1GI1A 4DJZB 3KN2A 2P59A 1FJSA 3BV9B 4Q7XA 4WVPE 1FLEE 4WF8A 4GSOA 3A85A 3S9CA 3RC4A 3ZZAA 4XSKU 9ESTA 4KKDA 2QYIA 1MH0A 3GICB 4ZHAA 1EX3A 2F83A 3PLBA 1WYKA 1GJCB 1ZPBA 4K60A 3V7TA 1SGFG 1QB9A 4Y8YA 3SU5A 3CS0A 5DO4H 3BTWE 3GY8A 3LH3A 4MDSA 1KLTA 1TIOA 3OSYA 3ZYDA 1Z6JH 4Q2KA 4K5ZA 1V2QT 4WY3A 2B0FA 1G2LA 1FAKH 3RXMA 1G37A 1GHXH 2A4RA 2ZO3H 2Z9GA 1IQHA 5EXMA 1K28D 1HLTH 1XUIA 3BTFE 3QZRA 3A89A 1CGHA 3LDXH 1IQLA 4CHAC 2BLOA 1WQSA 4MPXA 1C5NH 1W7GH 2Z94A 4I31A 1NRNH 5A2MH 1D6RA 2Z9KA 4GUXA 4MPWA 2CHAB 2XCFA 5A09A 3K6YA 4ABIA 1KXEA 1SGFA 3SBKA 1A4WH 1O2VA 3Q3XA 5CHAB 2C93B 3PLPA 4DCDA 2AS9A 2PR3A 3A84A 1K1IA 2TGDA 4B73A 1G36A 2Z3CA 1LDTT 1Z7KA 1AIXH 2UUJB 3A8CA 3URCA 1K1MA 5LPFA 1ZYOA 4CBOA 4B76A 1AFQC 3RXFA 2AGGX 3ZVEA 2FOHA 3DFLA 3FVFB 1AMHA 1O3EA 4YM9A 1AE5A 4AORA 5AFZH 1JWTA 3H5CB 1WBGB 4BOHA 4DY7B 1AFEH 1DWCH 4INHA 1G30B 2UWPA 1BT7A 3RMLH 5I46H 4AGKA 2A7JA 1D9IA 1AI8H 2OC8A 1QB1A 5DJ7A 4YLQH 1ELFA 2ZPSA 3SJ8A 2ZZUH 1O2PA 4HTCH 3AAVA 4CH2B 2BLWA 1MKWH 4ISNA 2ZI2H 1OWJA 2PHBA 1NU9A 3P95A 1BUIA 3SNAA 3HATH 1PPFE 1O5GH 1FV9A 2FOBA 1HBTH 4R0IA 2W7SA 1Z1IA 3M5NA 1AVWA 1DUEA 1UTQA 5EW2H 1C5MD 3LJJA 2G5VA 4AN7A 3MO3A 3W94A 1QJ6B 1XUJA 1RTFB 1YM0A 3ZVCA 1U6QA 1E34B 5EQSA 4NA8A 1C2JA 2B9LA 1TB6H 2C8XB 1T4VH 4TYDA 1IQGA 1S82A 1TBRH 3ZZCA 4TPYA 2GCTB 1DWBH 4DOQA 2A1DB 2WPIS 3HK3B 3DD2H 1C1OA 5IYTA 4BXSA 1ELGA 1C2LA 2G8TA 8GCHG 3QN7A 1W13U 5JB8S 1A46H 3GCHB 1V2JT 1H8DH 1EAWA 2HVXA 1JIRA 1O2XA 4O97A 5H4IB 4ZAEA 3LGIA 5ESBA 1O2OA 5GPIB 1GJ7B 1P9SA 4FUCA 1O5CB 1VGCB 5ESTE 5EXLA 4TY6A 1QQUA 2A4QA 4NFFA 2FS8A 1WTGH 1RJXB 1E36B 2P8OC 2YOLA 2VWMA 1QB6A 1MTNC 3FP6E 4AZ2B 1T4UH 2BQ6B 2C8ZB 2PGQB 3U1JB 2GVFA 4XFQA 2XW9A 2H5DA 2W5EA 3M7QA 1TBQH 3BEFB 2GTBA 1BMMH 2FO9A 5HGGA 2DUCA 3RDZA 3DA9B 1GG6C 1PYTC 1HAVA 3MU0A 1LVBA 3NKKA 1NS3A 2JETB 1O5BB 2ZGXH 4YT7H 1TNJA 4Y10E 1O39A 2VH0A 2F9BH 1FNIA 2AGEX 4K1SA 4FUEA 4IC5A 1W0YH 5GCHG 1KXAA 4Y7AA 3MO6A 2ZQ1A 1Z1JA 3ZYEA 1UVTH 2ZFQH 1EJAA 1D3PB 1AE8H 4FUFA 2V6NA 2BZAA 1HJAC 1XXFA 1FXYA 2BDHA 1EAIA 2D26C 1GL1A 1HAHH 3SHCH 1SLXB 2VINA 1C1UH 1ORFA 2SGAA 2AH4X 4K8BA 2ZU3A 1SGDE 2G4UA 2B5TB 1TLDA 1QBVH 1S6HA 2FX6A 1S0QA 1UHBA 3O8RA 4DW2U 2FIRH 3QTOH 3VFEA 4TWWA 1N1LA 1O3BA 2R3YA 3PTBA 4CREA 4KELA 2ALVA 4WH8A 5J4SA 4GCHG 3S7KB 3TJNA 8GCHF 2XYAA 1V2OT 3UREA 1P2IA 1AZZA 3BTHE 1DOJA 3SQEE 3SJOA 3SGQE 2ILNA 2PW8H 3FZZA 1OSSA 1ZLRA 3RXVA 1D4PB 3PB1E 2VB0A 1C5YB 1O3MA 3RXJA 3MFJA 1P9UA 3VB7A 3F1SB 3MI4A 2Z3DA 1NFUA 2VIDA 1O5DH 3JZ2B 4U32A 4FXGH 4JK6A 3GYLB 3LGWA 3MHWU 4VGCB 1EZXC 1NM6A 1DUAA 1ELEE 2PTNA 1BCUH 2ZF0H 5SGAE 3PWCA 3ATIA 1C2GA 3P8NA 4NSVA 2RA0A 4A6LA 4NIVA 2Y5GA 2XTTB 1TGBA 3RXRA 1QGFA 2WPJS 1C2HA 2BOHB 1SBWA 4THNH 4GHQA 1OX1A 5DKMA 3LJOA 5HXFA 4BAOB 5E8EH 3UNQA 1J15A 5T6GA 2ZGJA 3VGCC 1TGSZ 1AN1E 3HGNA 3T28A 5J4QA 3ZZ7A 3F68H 4AX9H 3SW2B 1MAXA 5GCHF 1F0SA 1F7ZA 2J2UA 3E0NB 1YPKH 2OQ5A 5JBCS 1P10A 1ZMLA 1GI4A 1SLVB 3SU6A 4IN1A 1MKXK 1OWHA 4E06H 9LPRA 1B7XB 1O0DH 1KTTB 1MZDA 1C2IA 1RRKA 1O2TA 3A8AA 2G55A 3SU2A 2GDEH 2GT8A 3NK8A 1TPSA 4UEHH 1T8LA 3M5OA 1DANH 2TIOA 1GBMA 1LO6A 1GBDA 2BB4A 2A45B 1BTUA 2G00A 3NWUA 4ABAA 3GY2A 3W95A 1A5HA 3URDA 1SLUB 1YCPK 1QHRB 4ABGA 2XNIA 3I78A 2BMGB 2F9NA 1JMOH 3K6ZA 4CRFA 3U69H 1Q2WA 1XM1A 3TGIE 1YYY1 3F6UH 2F9VA 2ZDVH 1SGIB 2HOBA 1GBKA 1AWFH 3LH1A 4GCHF 3B23B 3T62A 1ETSH 1S0RA 4R8TB 1J8AA 5DP6A 3OY5U 4WMEA 4RSPA 3ZZ8A 1DICA 1HDTH 2ZC9H 1UTKA 1THPB 4I33A 2D8WA 3VB6A 1DFPA 2QC2A 2A32A 2C8YB 5ETXA 1A0JA 3PTNA 3BTEE 3QX5H 4AFZA 1O2SA 4IS5A 2NU2E 3L33A 1GDQA 1VZQH 1ZHPA 3D65E 4B2AA 1K1NA 1GI3A 2FI3E 1IHTH 3AW0A 3ZZDA 1VITH 1P2MA 1TAWA 2A5KA 1ZMNA 4UFGH 1EQ9A 1JRTA 2CXVA 3S7HB 4AFQA 3DUXH 1EAXA 2BD7A 3U1IB 1B5GH 1AD8H 1EASA 1HAOH 3EE0B 4B2CA 4BAMB 3BTQE 2B7DH 3P70B 2AMQA 3KEEA 1TGTA 1RTKA 2BDAA 3MU1A 2HGTH 1OWDA 1TX8A 2FZZA 2PV9B 2GT7A 3A87A 3RXEA 5DK1A 4MNWA 3F9EA 4MLFB 1W3CA 5EQQA 4CR5A 1C5WB 1P2NA 2SGFE 1H9HE 5FCRA 3RU4D 1TALA 4K1EA 1DXWA 1LHGH 3RM2H 3O8DA 1MQ6A 3UQVA 4AFSA 1THSH 2BX3A 1BBRK 4ABEA 1YPGH 1PYTD 4Q80A 2W3IA 4CR9A 3OY6U 4K3JA 5E0GA 1KLIH 4WXIA 1AB9C 1OOKB 4JYVH 2BD3A 2IOTA 1NESE 1XUHA 5CHAC 3TU7H 1SQTA 1TOCB 2GV6A 3SJIA 1T8NA 5PTPA 1GHZA 3KNXA 2ESTE 2C4FH 4I8GA 1ZJKA 1O3HA 2XWBI 3QO6A 1W2KH 2Y7XA 2ZFRH 2BY7X 2FP7B 2FTMA 5DG6A 5L6NH 4K1TA 5FBIA 4NCYA 1S5SA 2VIQA 6CHAB 4LK4A 3A8BA 1C2EA 1P3CA 1TONA 3A7ZA 1FZZA 1C4U2 2VWOA 4CH8B 1KYNA 1YPEH 3UR9A 1F0UA 1GCTB 4X1NU 2A2QH 3AASA 4JCNA 1HAYB 2BHGA 3MMGA 2LPRA 4BAHB 4X8UH 2A7HA 2FOFA 1O31A 5L2ZH 1QTFA 2ZECA 2D1JA 1C2KA 1FUJA 1GBJA 1KXFA 1GJAB 2RDLA 3SV9A 4I7YH 1V2UT 2FXRA 5E0HA 1WSSH 2CMYA 4X2YA 1ELTA 4UDWH 1MTSA 5E2OA 1F0RA 1W0ZU 2R0KA 1CQQA 3SO3A 5E2PA 1IHSH 4X6OA 7LPRA 3FZDA 1AO5A 1V2VT 1P2KA 1GBHA 1HIAB 1RTLA 2PGBB 4ZXXH 4WXVA 5C5OA 1LVMA 2ZDNA 3UOUA 1NRRH 3V0XA 5C1UA 1B0EA 2QN5T 5A8YA 5K7RA 3P6ZB 1ETRH 1NFWA 4U30A 2ZU4A 1C1VH 3WY8A 4OS6A 5AF9H 3LONA 2SGDE 1CBWB 1HB0B 5JB9S 3TH4H 5AVDA 4AB9A 1KSNA 1V2KT 5GWZA 1HRTH 4A92A 1ZGIA 2O8LA 2Q6GA 2WUCA 2F9PA 1V2TT 2FLBH 4K2YA 4CRAA 2A0QB 4NA9H 4JYUH 3SUGA 1AY6H 2FYRA 4ZHMU 2NWNA 1YKTA 1ZJDA 4Z0KA 1GGDC 1RIWC 3IWMA 2G81E 2IPHA 3BTGE 1VCWA 4X0WU 3QGNB 2F91A 4MTBA 4WWYA 1C5TA 3M5MA 1LPZB 2BD4A 3PLKA 1SFQB 1IQEA 2VWNA 4BTTB 2XBYA 3TITA 1P8VC 2PWXA 1KIGH 1K1PA 1PQ8A 1AVGH 3TK6A 1SOTA 4I8LA 1UO6A 2FOMB 2R9PA 2XC4A 3QWCH 4IW4E 4JMYA 3LC3A 4MG3A 3MU4A 4A5TS 5JBTA 1FMGA 2V35A 1TABE 3A7WA 4LZ4B 1Z8JB 2BVXH 3TVJB 4J1YA 2DE8A 3RM0H 1GBCA 3HGPA 4B74A 3A7TA 1P2QA 4DVAU 1UTMA 3U8RH 4U2WA 3MH7A 1ETTH 1OWEA 2ANWA 2XC5A 5E0JA 3RXUA 1UCYK 1KXBA 5FBEA 1IQJA 1FI8A 1Y5UT 2ODQA 2O8TA 1O3KA 2P3UB 3ZVDA 1C5LH 1XX9A 2GZ8A 3K2UA 3TGKE 3ZV8A 2AIQA 4FUIA 1DSTA 3M36A 1S85A 2PTCE 3M5LA 2FPZA 2GV7A 2PKAA 1S84A 3ELAH 2RA3A 1QBOA 1SGRE 1P04A 1SGCA 2R2MB 1BMLA 5EU8A 3RXDA 1WOFA 1E37B 4UFDH 3BN9A 5BRRE 3F9FA 1MKXH 1DWDH 4BTIB 1Y59T 3ITIA 3VEQB 2GGVB 1GI2A 4YT6H 1O37A 3E16B 2FEQH 1J9CH 2Z6BD 3BEUA 1O3GA 3TJVA 2BDIA 1ELDE 5FHTA 2XWAA 1O3JA 3L3TA 2WPHS 3BIVH 4IGDA 1H1BA 4J2YB 1INCA 1BMAA 1N8OB 4FUJA 1GMCG 1YCPH 1O3LA 1M9UA 5A0CA 2SNWA 2THFB 4U01A 3STIA 4ZXYH 2PUQH 1UK2A 2BY5X 2QXJA 1WCZA 1EAUA 1EATA 1KXDA 1MBMA 1PJPA 1O3FA 1FY5A 3ZVGA 1KLJH 1F5LA 2VNTA 1BOQA 1LHEH 4Y7BA 4JZIA 2V3OH 4DIIH 4DT7B 3GY5A 1O2GH 2NU1E 1CA0B 3KHVA 4MNYA 1QIXB 1KY9A 3KL6A 1GHWH 2ZU2A 1EJNA 3V3MA 1TNLA 1BB0B 1TNHA 4ISHH 3T27A 2Q6DA 5DP4A 4FU9A 1TPPA 3GYMA 1O2YA 1ZSLA 3ZZ3A 3BG4C 1EZSC 2IJOB 1FONA 1BRBE 1O5FH 1QR3E 1P06A 2PFEA 3HK6B 5DP8A 2QY0B 1LHCH 2BD8A 4ZHLU 1P02A 3RMNH 2UUFB 1ANBA 2FM2A 4ISIH 1A0HB 1A1RA 2CF9H 1GI8B 1T7CA 2NU0E 1K21H 2HPQH 5DPAA 2ZCLP 1QURH 4NSYA 5TCAA 4RKOB 2VVUA 2BQ7B 4KTCA 2Z9IA 3A86A 3SJ9A 2AMDA 1A3BH 3E1XB 3GDUA 1QL9A 2QIQA 1O38A 3RU4T 1LKAA 1SHYA 4NIYA 1GVKB 1BBRH 2Z9LA 3LGVA 1XUGA 1FQ3A 3PO1C 3T25A 4FVDA 2A31A 3B8JA 4Y8ZA 1ARBA 2ZHFH 1WTHD 2G4TA 1CU1A 1C1PA 4ZH8A 2GZ7A 1NRPH 2H9TH 1GMCF 2I6SA 4Q7ZA 2FODA 4NZLA 2F3CE 3PM3A 3P92A 3UNRA 3SUEA 5CE1A 2FI5E 3RXIA 2ANYA 1CO7E 3F9GA 3ESTA 1O3IA 4K8YA 1NROH 4ZKRU 3BEIB 3GY3A 2KAIB 2Q6FA 2FESH 1C1RA 4UONA 1GJ8B 1O3DA 2STBE 4DIHH 4Y11E 1W7XH 4OS2A 1H9LB 2V3HH 2SGEE 1A5GH 2ULLA 1F0TA 3E3TA 4CHAB 2VIVA 5GXPA 1ESBA 2VGCB 1SLWB 4K69A 3TGJE 3DFJA 3A83A 1GI7B 4YOJA 4CRCA 3A81A 4JZ1A 1H8IH 1C2DA 2UUYA 4JK5A 1EB2A 1O34A 3P8OA 1G3EA 2PSXA 1SGEE 3HKIB 1BRUP 1W10U 2ZGBH 1O2JA 3M3TA 3ZZ4A 3KQCA 2BDCA 1Q31A 2W26A 1CT0E 1HV7A 2NU4E 4XBBA 1O2NA 1QRZA 1LPGB 1LKBA 3TLOA 3EGKH 1TE0A 1ARCA 5DP5A 1GHAG 1RFNA 1TRNA 4MPVA 5A8ZA 3SV6A 4ISLA 1OS8A 3ZZ9A 1AFQB 1V2PT 1TQ7B 1YP9A 1LTOA 3T2NA 3RXCA 1LVOA 3SI3H 3SU3A 7ESTE 1VJAU 2BD5A 1BTYA 2XBVA 4UE7H 1GWAA 2BD9A 1XXDA 3UY9A 2SGPE 4AB8A 1O5AB 1D6WA 2VIPA 3HPTB 3QDZB 3UIRA 3ZVBA 3E8LA 3JZ1B 1MTUA 3T26A 4ESTE 2ZWLH 1SPJA 5EW1H 1SOZA 5B6OA 5FXLA 3SZNA 1TNGA 1O35A 2KAIA 2TPIZ 3EQ0H 1GBFA 3BTTE 4JYTA 2QF3A 4ABJA 1DPOA 1C1NA 3ATWA 3M35A 1O2LA 4TWYA 1GMDG 3SV2H 1YPLH 4Y71A 1DM4B 1GJBB 6CHAC 1TYNA 1C4Y2 5FX5A 1NN6A 1MU6B 4OGXA 4AGJA 1C1QA 1P2OA 1NRSH 1UTNA 3RUOA 2TGTA 1GI6A 2VU8E 3RXSA 2W7UA 4BAQB 3PMJA 2WINI 1WU1A 3ZZBA 3ZVAA 1ZTLA 1NC6A 4DG4A 1MUEB 5ABWA 2GMTC 4LXBH 5DP9A 4H6SB 5FCKA 3QGJA 2NU3E 4X6MA 3MNCA 2BQWB 5A8XA 2ZHWH 1OWIA 1FAXA 4Z6AH 1HGTH 1DE7H 1YGCH 4FUHA 3RXTA 7GCHG 1RD3B 2H9HA 3BSQA 4SGAE 1V6DA 3OX7U 3SV8A 1GHVH 3VXEH 3UOPA 4XBDA 1BQYA 3CENA 5FPTA 3ODFA 3LGYA 1DY8A 5F6MA 1UCYH 1GJ6A 4RKJB 4MNVA 1CGJE 1F5RA 1UK3A 1SGTA 1GHAF 3EAJA 4X2VA 2J38A 2P8OB 1TA2A 1C5SA 1MTNB 2AYWA 1P01A 1GL0E 2EEKA 1AHTH 3GCTG 3P17H 3A88A 3M61U 4XBCA 1HAGE 2ZDKA 1P3EA 2A2XH 1GBBA 4IC6A 4A7IB 2BLVA 1MCVA 1A61H 2TBSA 3S69A 2GCHG 3SV7A 5C2ZA 3RLYH 2ZHQH 3NXPA 3DT0H 2ODYB 1BHXB 5C67A 2ZKSA 1C9PA 2C90B 5FX6A 2HWLB 3B9FH 2FS9A 4I32A 4ZROA 3AW1A 3U8OH 4Y0ZE 5EGMA 1GMDF 5K0HA 1VJ9U 1QJ1B 4GHTA 3PMAB 3SNEA 2UWOA 3P8GA 2UUKB 1HJAB 1ZPCA 5TCCA 4CRGA 2SFAA 1OXGA 2QA9E 2FDAA 1G32B 4YTAA 8KME2 2WPLS 4KTUA 5JYIA 1XUFA 5G4BA 4CRDA 1Q3XA 3LPRA 1S81A 1ACBE 3ZVFA 2A4OA 4OS1A 1LMWB 1TPOA 1TRMA 1ZR0A 2OCVB 3TJOA 3PMBB 5EODA 1NY22 2SNVA 1H4WA 1JBUH 3OYPA 1J17T 2R3UA 2B8OH 2BDBA 1TGCA 1K1OA 1CE5A 1L1GA 1ZRBA 2RCEA 2F9OA 1TOMH 2PUXB 4BTUB 2CHAC 1HUTH 1D3TB 7GCHF 1HYLA 4X6PA 1NO9H 1SL3A 4NIXA 3BTKE 2ZA5A 5JBBS 4TPIZ 1TNIA 2BY9X 1SSXA 2ZU5A 1W14U 5F8ZA 1MTWA 1ZZZA 2A5AA 2GD4B 1XKAC 2Y7ZA 3LKWA 1ELVA 4O3TA 3A80A 3QUMP 1TA6A 4NGAH 1SB1H 4OS4A 1MBQA 4O03A 1SGPE 3ENSB 3SNCA 4AYYB 2GX4A 1UVPA 1JOUB 2BXTH 3Q3KA 4HZHA 1WUNH 2GKVE 3SNDA 3MO9A 1O36A 1OKXA 5FAHA 2HNTE 3UR6A 1B0FA 2ANMH 1EOJA 4X8VH 2BY6X 4NFEA 3H7OA 2FOCA 2EI6A 1T8OA 1C5OH 1DXPA 3RU4E 4B75A 3GCTF 2WPMS 1EZQA 2ZFPH 4ZKSU 1JRSA 1WV7H 1O2WA 2BY8X 2ZFSA 1XKBC 4OS5A 3G01A 4AYVB 1GBLA 2GCHF 1F2SE 2V0BA 5T3HA 3VGCB 2SGQE 1CVWH 2BD2A 1CT4E 3FAOA 1BJUA 1O2RA 2JH5D 1FN8A 1O3CA 1ELBA 4ZMAH 1AVXA 2ZP0H 1HAIH 3ATMA 2BVSH 3NPSA 1A2CH 1SC8U 1E38B 1EJMA 1NU7B 1TFXA 3EA7A 1GJDB 1UVUH 4NIWA 4A1VA 1GCDA 3Q00A 3OU0A 2VIOA 1VR1H 1HAXB 2J34A 4O3UA 1V2WT 2ZCHP 2IN2A 5A0BA 1TWXB 2GCTC 1Z8IB 1TPAE 3E6PH 4F49A 1EPTB 4CRBA 1ESTA 1DDJA 1BIOA 1W11U 1L1NA 3MH4A 3SUFA 2WYGA 2P3FH 1BJVA 3GCHC 4BANB 1GI0A 2WYJA 3LOXA 2CV3A 3SJKA 1ID5H 1G3BA 3MU5A 3PWBA 3TK9A 5DP7A 1O2HA 3PYHA 4ABHA 1BTPA 1QL8A 2ZHEH 1NTPA 3BG8A 1VGCC 3C27B 3MH5A 4HFPB 4HI3A 4X8SH 1NT1A 2VH6A 4ABFA 1A5IA 5GDSH 2TGPZ 1JIMA 4E7RG 2PSYA 2G5NA 1O3NA 4YO9A 5EOKA 1IQIA 4X1RU 5TJXA 1FY4A 3L6PA 1GBTA 2J9NA 1CSOE 1GJ4H 2PKSB 1AUTC 3M7TA 4KP0A 1MZAA 4YOIA 2JH0D 2F9UA 3U98H 4ZUHA 1UTLM 1S6FA 1Y3XA 1GI9B 3BTME 4FUDA 8ESTE 1HIAA 2JETC 1O32A 2EI7A 2G52A 1ELCA 1QQ4A 3TK5A 5C3NA 2OLGA 4INKA 3LC5A 2VIWA 4IN2A 3MU8A 3A7XA 3MYWA 2OBOA 2P16A 1GBIA 2BDYA 4OS7A 2I6QA 1LHDH 2OINA 2XBXA 3R0FA 3CP7A 2FI4E 1MD7A 1BTHH 1HNEE 1T31A 1PPBH 2OP9A 2ZTZA 2WPKS 3FP8E 1OP0A 4XOJA 1EPTA 2FWWA 1GVZA 1QA7A 3A82A 3KIDU 1C5ZB 4D8NA 2VGCC 1YBWA 2P94A 1OYQA 1THRH 3TJUA 1AKSB 4CBNA 1BZXE 1O3OA 1C5RA 2ZGHA 4FU7A 1GVLA 2ZTYA 4H42U 1HFDA 1PPGE 1QBNA 2ZIQH 1EOLA 1AB9B 4Y6DA 4I8KA 2C8WB 2JH6D 4UFFH 1GJ9B 1BTWA 2LNCA 1P57B 3M7UA 1HXFH 1OWKA 1H9IE 4E05H 1WQVH 3ZZ6A 1G3CA 1C2FA 1FPCH 1LQDB 4NZQA 1UVOA 1F92A 3TH3H 5T6DA 1L2EA 1V2LT 1MTVA 2HPPH 3FANA 3RXQA 2P3TB 4FVBA 1YF4A 4H4FA 5EXNA 3QZQA 3SUDA 1ANCA 4INLA 1AQ7A 4X1SU 1SR5C 2Z9JA 1PQ5A 1QJ7B 2H2ZA 2HLCA 5IDKA 3GDVA 4UD9H 2H6MA 4VGCC 2CN0H 3A7VA 4NA7A 2ASUB 2DE9A 1DVAH 2ALPA 2ANKH 1BTZA 3E91A 1QL7A 2H1UA 3QTVH 4YLUA 1T32A 2BVRH 1XVMA 1ABJH 1O30A 2ODPA 1EP5A 4KGAA 1QFKH 1DX5M 3A8DA 1WAYB 5F8TA 1TMTH 1UTPA 2EI8A 3D62A 3PMHB 1ANEA 1V2NT 5GIBA 1OP2A 3IITA 3U8TH 4BAKB 2VVVA 1BMNH 2OXSA 5EPYA 1K9OE 2Y82A 3VPKA 1HAVB 3DHKH 3M37A 1GPZA 1DSUA 1AKSA 3ODDA 5LGOA 2AFQB 5AHGH 3VXFH 4MNXA 1NFXA 8LPRA 1GBAA 1UK4A 1FIWA 3SQHE 3KCGH 1ZSJA 5EG4A 2FOAA 3GDSA 4B71A 2FLRH 3N7OA 5JBAS 1PPCE 5C20A 3I77A 4WMFA 4KTSA 5C1XA 1L4ZA 1HPGA 2BYAX 1ELAA 2ZFFH 4AG1A 4DURA 1ZMJA 3GY4A 1LCYA 1IQKA 3E90B 1GBEA 2AGIX 1KTSB 2W3KA 3M3VA 3GOVB 4H6TA 1G9IE 1IQMA 1ZGVA 2C3SA 2GZ9A 5HM9A 5C1YA 5LPRA 2CGAA 4ZKOU 1GGDB 1RIWB 1ABIH 2BX4A 1UHBB 2Y80A 1FPHH 3Q77A 2QXHA 3MWIU 2AIPA 1PPEE 1LPKB 2M5TA 1V3XA 3K65B 1P2JA 2TGAA 3U9AH 3T5FH 2WV5A 4MPUA 2ZDMA 4D7FA 2AERH 2OUAA 2QCYA 3KQDA 1BRAA 3UTUH 4X1QU 1F5KU 4HGCA 1Z71A 3LIWA 1PPZA 2HNTC 2FYQA 1IAUA 4LZ1H 4TY7A 1RS0A 1HAPH 1SHHB 2R2WU 2QAAA 2GDDA 1YC0A 3K9XB 1LQEA 3SORA 1Y3WA 2QV1A 1E35B 2ZG0H 4NWKA 1C1WH 2A7CA 1ZOMA 3ATLA 1C9TA 2ZTXA 1TNKA 1GMHG 5CMXH 4E7NA 1UMAH 1AZ8A 1PQAA 3LGUA 3P8FA 2Q1JA 2FOGA 3SU0A 3SOSA 2ZPQA 3VB5A 3RP2A 1O2IA 3VB3A 2XC0A 5LPEA 3F9HA 1QRXA 1UTJA 3CS7A 3EA9A 2FOEA 6ESTA 3S0NA 1BITA 3SNBA 3UWIA 3EYDA 2J4IA 1X7AC 3LU9B 7KMEH 1QA0A 4Q7YA 1EZUC 1K1LA 2WV4A 4A1XA 1HXEH 4D9RA 3RXLA 2XRCA 4MVNA 1FN6A 2XCNA 3FFGA 4M7GA 1C5UA 3LT3A 2VWLA 1V2ST 3MNSA 1A7SA 2HRVA 2OC1A 1KXCA 2Y5FA 1K1JA 1NZQH 1MAYA 1HAZB 2BDGA 3O8BA 3TIUA 1O5EH 4WH6A 1C2MA 4YOGA 1YPHE 1IOEA 2J94A 1XVOA 2ZPRA 3D49H 1UTOA 4ISOA 1AU8A 5HMAA 2FMJA 4GVUA 3MNBA 3E0PB 4YESB 2OC0A 1TBZH 3NZIA 1NPMA 1DLEA 1O2QA 1OYTH 1SGQE 1ZPZA 3UWJH 3AAUA 4LOYH 1Z8RA 5LH8A 4AG2A 4FUBA 1Y3UA 3RMOH 5C5NA 2OBQA 2ZDLA 1O2ZA 1P05A 3RXBA 3SHAH 4Y76A 1T8MA 3ZZ5A 3D23A 3MNXA 3QLPH 3H7TA 1P12E 4B2BA 1UVSH 1QCPA 1GCTC 4AOQA 3T29A 1Y5AT 4RN6A 3GCOA 1BBRE 1MMJN 1PFXC 5JDUB 3TH2H 1J14A 1SVPA 1RGQA 1Z6EA 4MQAA 2ZU1A 3TPIZ 4I8HA 4WMDA 2A5IA 4AFUA 2WUBA 3BG4B 1Y5BT 1GMHF 1UJ1A 1XMNB 2OD3B 3VB4A 1FDPA 2JKHA 5BPEA 1ZSKA 4XE4A 1TMBH 1ZTKA 1C1SA 4FUGA 1BA8B 2QXIA 2O9QA 3NCLA 2Z7FE 1PPHE 4SGBE 1OP8A 2D2DA 3TNTA 1RXPA 3RXAA 5EQRA 1KDQB 5T6FA 2CF8H 2UWLA 3RC5A 2FX4A 1A3EH 2OQUA 4A1TA 5A0AE 1P0SH 3KF2A 3S9AA 1P09A 4D76A 1HJ8A 1TGNA 2TRMA 1BTXA 3PROA 1CBWC 4X2XA 3Q3YA 3UNSA 1QY6A 1EPTC 3PV4A 1A0LA 2BZ6H 2QF0A 2BM2A 1MKWK 1DS2E 3PO1B 2H5CA 2A4GA 1C1TA 3RXHA 2Y81A 1MQ5A 2P93A 1HJ9A 4ABDA 1L0ZA 5L2YH 3LGTA 5I25A 3A7YA 1MU8B 1GHYH 2H9EH 4GPGA 6LPRA 3GCNA 3TNSA 1GG6B 3IG6B 4ZKNU 3KQBA 2O8MA 4OGYA 1FY1A 1OPHB 5DP3A 1AGJA 1AUJA 5FPYA 2YNAA 1LVYA 2ZCKP 5F8XA 4O9VA 2EC9H 1N6YA 1K22H 4NG9H 1VCQA 2EA3A 3KGPA 1SQOA 1PQ7A 1LHFH 1CHOG 1DLKB 2OTVA 4NWLA 2RG3A 2PKSC 4ASHA 1YLDA 4B1TA 3UUZA 1L1JA 3MH6A 3SU1A 3M3SA 5HM2A 3S9BA 1QNJA 1TX7A 3MTYA 1O33A 1P11E 1SQAA 1FY3A 1O2UA 6GCHG 2ZQ2A 4UFEH 4Y0YE 3R3GB 3EDXB 2AEIH 2OC7A 1KDQA 1TX6A 1QRWA 2P95A 1ZHMA 4Y79A 1MCTA 1TQ0B 3RMMH 3UFAA 1CGIE 3UQOA 1SMFE 3RC6A 4I8JA 5GJ4B 2J92A 2ZEBA 1MD8A 5AFYH 1GHBG 1Y8TA 1YPMH 1SGNE 1V2RT 1VITG 1ZRKA 2O8WA 3SN8A 3STJA 3NUMA 1SFIA 1D3QB 1P03A
chains in the Genus database with same CATH superfamily
1HCGA 3RLWH 3I29A 2HALA 3RXPA 4X2WA 3EA8A 4D9QA 1NRQH 2G51A 4F4OC 1OHHD 3DSOA 1GDUA 1YCPM 2AMPA 2YNBA 1J16A 3MOCA 3OTJE 1Y3VA 4M9FA 1DITH 1E0FD 2QXGA 3GISB 1Z8GA 1BRCE 1TRYA 3V13A 1BDAA 1C5QA 1CHGA 3RXKA 2ZGCA 1ESAA 3AVZA 2BOKA 2ZFTA 5F03A 1GJ5H 1EKBB 3UPEA 1SGYE 4PROA 4ABBA 2Y5HA 2LP6A 1L4DA 1W8BH 3QK1A 1YLCA 2QGRA 1N8OC 1D3DB 2K1QA 1VCPA 1N6XA 3KQ5A 3O8CA 1UCYE 1ANDA 2VVCA 3KYFA 1DWEH 3BIUH 2GP9B 1E1QD 2J95A 1TMUH 2CJIA 3GY7A 4IMQA 4YZUA 3C1KA 2R0LA 1GI5A 4BNRA 3SGBE 1G3DA 1O3AA 1XUKA 3BTDE 2Y6TA 1W12U 1EUFA 4DGJA 2HNTF 1K2I1 2VJ1A 5EPNA 1CA8B 1GDNA 2KM0A 1CA0C 4JZFH 3SGAE 1Y3YA 3RXGA 1DT2A 2Z3EA 3Q76A 1CHOF 5HYOA 1AWHB 3ATKA 1EB1H 3DSPA 2GMTB 1SG8B 2BLQA 3ZV9A 4GLYA 1IQFA 4X8TH 2PLXA 4QT8C 4WJG2 4XDEA 4GAWA 4JZDH 2BXUH 6GCHF 3F0OA 1IQNA 1DY9A 1JXPA 3FP7E 1NFYA 2FTLE 1BHXF 5JPMH 4X6NA 2XXLA 1C1MA 2O8UA 2XBWA 1EXFA 2BTCE 3HKJB 4JZEH 1CT2E 2HVYB 1FY8E 2ZHDA 1GHBF 1ZTJA 1SI5H 5FPSA 2M2AA 1VITF 3BF6H 5L30H 3V12A 1G2MA 1O3PB 1C4V2 1V2MT 1ZHRA 1O2MA 3SI4H 2ZNKH 2AHME 1YPJH 3SU4A 1E1RD 3KQEA 1YPHC 4IBLH 5DGJA 2ZDAH 3RXOA 1S83A 1C5PA 2PKAB 4FU8A 1O2KA 4BXWA 1C5VA 1FIZA 1C5XB 2STAE 4D7GA 3GY6A 1EP6A 4IMZA 4Y8XA 4X1PU 1GI1A 4DJZB 3KN2A 2P59A 1FJSA 3BV9B 4Q7XA 4WVPE 1FLEE 4WF8A 2W6JD 4GSOA 3W1EA 3A85A 3S9CA 3RC4A 3ZZAA 4Z1MD 4XSKU 9ESTA 4KKDA 2QYIA 1MH0A 3GICB 4ZHAA 1EX3A 2F83A 3PLBA 1WYKA 1GJCB 1ZPBA 4K60A 3V7TA 1SGFG 1QB9A 4Y8YA 3SU5A 3CS0A 5EIYA 5DO4H 3BTWE 3F0PA 3GY8A 3LH3A 4MDSA 1KLTA 1TIOA 3OSYA 3ZYDA 1Z6JH 4Q2KA 4K5ZA 1V2QT 4WY3A 2B0FA 1G2LA 1FAKH 3RXMA 1G37A 1GHXH 2A4RA 2ZO3H 2Z9GA 1IQHA 5EXMA 1K28D 1HLTH 1XUIA 3BTFE 3QZRA 3A89A 1CGHA 3LDXH 1IQLA 2KCYA 4CHAC 2BLOA 1WQSA 4MPXA 1C5NH 1W7GH 2Z94A 4I31A 1NRNH 5A2MH 1D6RA 2Z9KA 4GUXA 2YMSB 4MPWA 2CHAB 2XCFA 5A09A 3K6YA 4ABIA 1KXEA 1SGFA 3SBKA 1A4WH 1O2VA 3Q3XA 2JIZD 5CHAB 2C93B 3PLPA 4DCDA 2AS9A 2PR3A 3A84A 1K1IA 2TGDA 3OE7D 4B73A 1G36A 2Z3CA 1LDTT 1Z7KA 1AIXH 2UUJB 3A8CA 3URCA 1K1MA 5LPFA 1ZYOA 3ZIAD 4CBOA 4B76A 1AFQC 3FOAA 2AGGX 3RXFA 2FOHA 3ZVEA 2EQNA 3DFLA 3FVFB 1AMHA 1O3EA 4YM9A 1AE5A 4AORA 5AFZH 1JWTA 3H5CB 1WBGB 4BOHA 4DY7B 1AFEH 1DWCH 4INHA 1G30B 2UWPA 1BT7A 3RMLH 5I46H 4AGKA 2A7JA 1D9IA 2YMSD 1AI8H 2OC8A 1QB1A 5DJ7A 4YLQH 1ELFA 3F2GA 2JJ2D 2ZPSA 3SJ8A 2ZZUH 1O2PA 4HTCH 3AAVA 4CH2B 2BLWA 1MKWH 4ISNA 2ZI2H 1OWJA 2PHBA 1NU9A 3P95A 1BUIA 3SNAA 3HATH 1PPFE 1O5GH 1FV9A 2FOBA 1HBTH 4R0IA 2W7SA 1Z1IA 5C0TA 2KFWA 3M5NA 1AVWA 1DUEA 1UTQA 5EW2H 1C5MD 3LJJA 2G5VA 4AN7A 3MO3A 3W94A 1QJ6B 1XUJA 1RTFB 4AC9A 1W0JD 1YM0A 3ZVCA 1U6QA 1E34B 5EQSA 4NA8A 4B6EA 1C2JA 2B9LA 4YXWD 1TB6H 2C8XB 1S6LA 2PP6A 1T4VH 4TYDA 1IQGA 1S82A 1TBRH 3ZZCA 4TPYA 2GCTB 1DWBH 4DOQA 2A1DB 2WPIS 3HK3B 3DD2H 1C1OA 5IYTA 4BXSA 1ELGA 1C2LA 2G8TA 8GCHG 3QN7A 1W13U 3VG8A 4XRNA 5JB8S 1A46H 3GCHB 1V2JT 1H8DH 1EAWA 2HVXA 1JIRA 1O2XA 4O97A 5H4IB 4ZAEA 3LGIA 5ESBA 1O2OA 2K0QA 2QF4A 5GPIB 1GJ7B 1P9SA 4FUCA 5FL7D 1O5CB 1VGCB 5ESTE 5EXLA 4TY6A 1QQUA 2A4QA 4NFFA 2FS8A 1WTGH 1RJXB 1E36B 2P8OC 2YOLA 2VWMA 1QB6A 1MTNC 3FP6E 4AZ2B 1T4UH 2BQ6B 2C8ZB 2PGQB 3U1JB 2GVFA 3PV2A 4XFQA 2XW9A 2H5DA 2W5EA 3M7QA 1TBQH 3BEFB 4RT1A 2GTBA 1BMMH 2FO9A 5HGGA 2DUCA 3RDZA 3DA9B 1GG6C 1PYTC 1HAVA 3MU0A 1LVBA 3NKKA 1NS3A 2JETB 1O5BB 2ZGXH 4YT7H 1TNJA 4Y10E 1O39A 2VH0A 2F9BH 1FNIA 2AGEX 4K1SA 4FUEA 4IC5A 1W0YH 5GCHG 1KXAA 4Y7AA 3MO6A 2ZQ1A 1Z1JA 3ZYEA 1UVTH 2ZFQH 1EJAA 1D3PB 1AE8H 4FUFA 2V6NA 2BZAA 1HJAC 1XXFA 1FXYA 2BDHA 1EAIA 2D26C 1GL1A 1HAHH 3SHCH 1SLXB 2VINA 1C1UH 1ORFA 2SGAA 2AH4X 4K8BA 5KGOA 2ZU3A 1SGDE 2G4UA 2B5TB 1TLDA 1QBVH 1S6HA 2FX6A 1S0QA 1UHBA 2QE7D 3O8RA 4DW2U 2FIRH 3QTOH 3VFEA 4TWWA 1N1LA 1O3BA 2R3YA 3PTBA 4CREA 4KELA 2ALVA 4WH8A 5J4SA 4GCHG 3S7KB 3TJNA 1UW7A 8GCHF 2XYAA 1V2OT 3UREA 1P2IA 1AZZA 3BTHE 1DOJA 3SQEE 3FKSD 3SJOA 3SGQE 5CDFE 2ILNA 2PW8H 3FZZA 1OSSA 1ZLRA 3RXVA 1D4PB 3PB1E 2VB0A 1C5YB 1O3MA 3RXJA 3MFJA 1P9UA 3VB7A 3F1SB 3MI4A 2Z3DA 1NFUA 2VIDA 5EJLA 1O5DH 3JZ2B 4U32A 4FXGH 4JK6A 3GYLB 3LGWA 3MHWU 4VGCB 4RI0A 1EZXC 1NM6A 1DUAA 1ELEE 2PTNA 4ASUD 1BCUH 2ZF0H 5SGAE 3PWCA 3ATIA 1C2GA 2F43B 3P8NA 4NSVA 2RA0A 4A6LA 4NIVA 2Y5GA 2XTTB 1TGBA 5IK2D 3RXRA 1QGFA 2WPJS 1C2HA 2BOHB 1SBWA 4THNH 4GHQA 1OX1A 5DKMA 1SQRA 3LJOA 5HXFA 4BAOB 5E8EH 3UNQA 1J15A 5T6GA 2ZGJA 3VGCC 1TGSZ 1AN1E 3HGNA 3T28A 5J4QA 3ZZ7A 3F68H 2KR7A 4AX9H 3SW2B 1MAXA 5GCHF 1F0SA 1F7ZA 2J2UA 1MABB 3E0NB 1YPKH 2OQ5A 5JBCS 1P10A 1ZMLA 1GI4A 1SLVB 3SU6A 4IN1A 1MKXK 1OWHA 4E06H 9LPRA 1B7XB 1O0DH 1KTTB 1MZDA 1C2IA 1RRKA 1O2TA 3A8AA 2G55A 3SU2A 2GDEH 2GT8A 3NK8A 1TPSA 4UEHH 1T8LA 3M5OA 1DANH 2TIOA 1GBMA 1LO6A 1GBDA 2BB4A 2A45B 3H09A 1BTUA 2G00A 4TSFD 3NWUA 4ABAA 3GY2A 3W95A 1A5HA 3URDA 1SLUB 1YCPK 1QHRB 4ABGA 2XNIA 3I78A 2BMGB 3UAIC 2F9NA 1JMOH 3K6ZA 4CRFA 3U69H 1Q2WA 1XM1A 3TGIE 1YYY1 3F6UH 2F9VA 2ZDVH 1SGIB 4XD7D 2HOBA 1GBKA 4F48B 1AWFH 3LH1A 4GCHF 3B23B 3T62A 1ETSH 1QZ8A 1S0RA 4R8TB 1J8AA 5DP6A 3OY5U 4WMEA 4RSPA 3ZZ8A 1DICA 3UB0A 1HDTH 2ZC9H 1UTKA 1THPB 4I33A 2D8WA 3VB6A 1DFPA 1H8HD 2QC2A 2A32A 2C8YB 5ETXA 1A0JA 3PTNA 3BTEE 3QX5H 4AFZA 2L6OA 1O2SA 4IS5A 2NU2E 3L33A 1GDQA 1VZQH 1ZHPA 3D65E 4B2AA 1K1NA 1GI3A 2FI3E 1IHTH 3AW0A 3ZZDA 5C94A 1VITH 1P2MA 1TAWA 2A5KA 1ZMNA 4UFGH 3PV5A 1EQ9A 1JRTA 2CXVA 3S7HB 4AFQA 3DUXH 1EAXA 2BD7A 3U1IB 1B5GH 1AD8H 1EASA 1HAOH 3EE0B 4B2CA 4BAMB 3BTQE 2B7DH 5DN6D 3P70B 2AMQA 3KEEA 3SZEA 1TGTA 2RDEA 1RTKA 2BDAA 3MU1A 2HGTH 1OWDA 4B6FA 1TX8A 2FZZA 2PV9B 2W6ID 2GT7A 3A87A 3RXEA 5DK1A 4MNWA 2J98A 3F9EA 4MLFB 1W3CA 5EQQA 4CR5A 1C5WB 1P2NA 2SGFE 1H9HE 5FCRA 3RU4D 1TALA 4K1EA 1DXWA 1LHGH 3RM2H 3O8DA 1MQ6A 3UQVA 4AFSA 1THSH 2BX3A 1BBRK 4ABEA 1YPGH 1PYTD 5KEDA 4Q80A 2W3IA 4CR9A 3OY6U 4K3JA 5E0GA 1KLIH 4WXIA 1AB9C 1OOKB 2K8IA 4JYVH 2BD3A 2IOTA 1NESE 1XUHA 5CHAC 3TU7H 1SQTA 1TOCB 2GV6A 3SJIA 1T8NA 5PTPA 1GHZA 3KNXA 2ESTE 2C4FH 4I8GA 1ZJKA 1O3HA 2XWBI 3QO6A 1W2KH 2Y7XA 2ZFRH 2BY7X 3N7EA 2FP7B 2FTMA 5DG6A 5L6NH 4K1TA 5FBIA 4NCYA 1S5SA 2VIQA 6CHAB 4LK4A 3A8BA 1C2EA 1P3CA 1TONA 3A7ZA 1FZZA 1C4U2 2VWOA 4CH8B 1KYNA 1YPEH 3UR9A 1F0UA 1GCTB 4X1NU 2A2QH 3AASA 4JCNA 1HAYB 2J97A 2BHGA 3MMGA 2LPRA 4BAHB 4X8UH 2A7HA 2FOFA 1O31A 5L2ZH 1QTFA 2ZECA 2D1JA 1C2KA 1FUJA 1GBJA 1KXFA 1GJAB 2KCPA 2RDLA 3PRBA 3SV9A 4I7YH 1V2UT 2FXRA 5E0HA 1WSSH 2CMYA 4X2YA 1ELTA 4UDWH 1MTSA 5E2OA 4F55A 1F0RA 1W0ZU 2R0KA 1CQQA 3SO3A 2WHXA 5E2PA 1IHSH 4X6OA 7LPRA 3FZDA 1AO5A 1V2VT 1P2KA 1GBHA 1HIAB 1RTLA 2PGBB 4ZXXH 4WXVA 5C5OA 1LVMA 2ZDNA 3UOUA 1H8ED 1NRRH 3V0XA 5C1UA 1B0EA 2QN5T 4RT0A 5A8YA 5K7RA 3P6ZB 1ETRH 5F53A 1NFWA 4U30A 2ZU4A 1C1VH 3WY8A 4OS6A 5AF9H 3LONA 2SGDE 1CBWB 1HB0B 2F4LA 5JB9S 3TH4H 5AVDA 3WWBA 4AB9A 1KSNA 1V2KT 5EJZA 5GWZA 1HRTH 4A92A 1ZGIA 2O8LA 2Q6GA 2WUCA 2F9PA 1V2TT 2FLBH 4K2YA 4Q4LA 4CRAA 2A0QB 4NA9H 4JYUH 3SUGA 1AY6H 2FYRA 4ZHMU 2NWNA 1YKTA 1ZJDA 4Z0KA 1GGDC 1RIWC 3IWMA 2G81E 2IPHA 3BTGE 4FOUC 1VCWA 4X0WU 3QGNB 2F91A 4MTBA 4WWYA 1C5TA 3M5MA 1LPZB 2IPQX 2BD4A 3PLKA 1SFQB 1IQEA 2VWNA 4BTTB 2XBYA 3TITA 1P8VC 2PWXA 1KIGH 1K1PA 1PQ8A 1AVGH 3TK6A 1SOTA 4I8LA 3F2FA 1UO6A 2FOMB 2R9PA 2XC4A 3QWCH 4IW4E 4JMYA 3LC3A 4MG3A 3MU4A 4A5TS 5JBTA 1FMGA 2V35A 1TABE 3A7WA 4LZ4B 1Z8JB 2BVXH 3TVJB 4J1YA 2DE8A 3RM0H 1GBCA 3HGPA 4B74A 3A7TA 1P2QA 4DVAU 1UTMA 3U8RH 4U2WA 2WV9A 3MH7A 1ETTH 1OWEA 2ANWA 2XC5A 5E0JA 3RXUA 1UCYK 1KXBA 5FBEA 1IQJA 1FI8A 1Y5UT 2ODQA 2O8TA 1O3KA 2P3UB 3ZVDA 1C5LH 1XX9A 2GZ8A 3K2UA 3TGKE 3ZV8A 2AIQA 4FUIA 1DSTA 3M36A 1S85A 2PTCE 3M5LA 2FPZA 2GV7A 2PKAA 1S84A 3ELAH 2RA3A 1QBOA 1SGRE 1P04A 1SGCA 2R2MB 1BMLA 5EU8A 3RXDA 1WOFA 1E37B 4UFDH 3BN9A 5BRRE 3F9FA 1MKXH 1DWDH 4BTIB 1Y59T 3ITIA 3VEQB 2GGVB 1GI2A 4YT6H 1O37A 3E16B 2FEQH 1J9CH 2Z6BD 1EFRD 3BEUA 1O3GA 3TJVA 2BDIA 1ELDE 5FHTA 2XWAA 1O3JA 3L3TA 2WPHS 3BIVH 4IGDA 1W0KD 1H1BA 4J2YB 1INCA 1BMAA 1N8OB 4FUJA 1GMCG 1YCPH 1O3LA 1M9UA 5A0CA 2SNWA 2THFB 4U01A 3STIA 4DT4A 4ZXYH 2PUQH 1UK2A 2BY5X 2QXJA 1WCZA 1EAUA 1EATA 5HIZA 1KXDA 1MBMA 1PJPA 1O3FA 1FY5A 3ZVGA 1KLJH 1F5LA 2VNTA 1BOQA 1LHEH 4Y7BA 4JZIA 2V3OH 4DIIH 4DT7B 3GY5A 1O2GH 2NU1E 1CA0B 3KHVA 4MNYA 1QIXB 1KY9A 3KL6A 1GHWH 2ZU2A 1EJNA 3V3MA 1TNLA 1BB0B 1TNHA 4ISHH 3T27A 2Q6DA 5DP4A 4FU9A 1TPPA 3GYMA 3OAAD 1O2YA 1ZSLA 3ZZ3A 3BG4C 1EZSC 2IJOB 1FONA 1BRBE 1O5FH 1QR3E 2V7QD 1P06A 3DSGA 2PFEA 3HK6B 5DP8A 2QY0B 1LHCH 2BD8A 4ZHLU 1P02A 3RMNH 2UUFB 1ANBA 2KX4A 2FM2A 4ISIH 1A0HB 1A1RA 1YY3A 2CF9H 1GI8B 1T7CA 2NU0E 1K21H 2HPQH 5DPAA 2ZCLP 1QURH 4NSYA 2JDID 5TCAA 4RKOB 2VVUA 2BQ7B 3OTPA 4KTCA 2Z9IA 3A86A 4FETA 1SKYE 3SJ9A 2AMDA 1A3BH 3E1XB 2L74A 3GDUA 1QL9A 2QIQA 1O38A 3RU4T 1LKAA 2HLDD 1SHYA 4NIYA 1KMHB 1GVKB 1BBRH 2Z9LA 1BMFD 4Q63A 3LGVA 1XUGA 1FQ3A 3PO1C 3T25A 4FVDA 4OM9A 2A31A 3B8JA 4Y8ZA 1ARBA 2ZHFH 1WTHD 2G4TA 1CU1A 1C1PA 4ZH8A 2GZ7A 1NRPH 2H9TH 1GMCF 2I6SA 4Q7ZA 2FODA 4NZLA 2F3CE 3PM3A 3P92A 3UNRA 3SUEA 5CE1A 2FI5E 3RXIA 2ANYA 1CO7E 3F9GA 3ESTA 1O3IA 4K8YA 1NROH 4ZKRU 3BEIB 3GY3A 2KAIB 2Q6FA 2FESH 1C1RA 4UONA 1GJ8B 1O3DA 2STBE 4DIHH 4Y11E 1W7XH 4OS2A 1H9LB 2V3HH 2SGEE 1A5GH 2ULLA 1F0TA 3E3TA 4CHAB 2VIVA 5GXPA 1ESBA 2VGCB 1SLWB 4K69A 3TGJE 3DFJA 3A83A 1GI7B 4YOJA 4CRCA 3A81A 4JZ1A 1H8IH 1C2DA 2UUYA 4JK5A 1EB2A 1O34A 3P8OA 1G3EA 2PSXA 1SGEE 3HKIB 1BRUP 1W10U 2ZGBH 1O2JA 3M3TA 3ZZ4A 3KQCA 2BDCA 1Q31A 2W26A 1CT0E 1HV7A 2NU4E 4XBBA 1O2NA 1QRZA 1LPGB 1LKBA 3TLOA 3EGKH 1TE0A 1ARCA 5DP5A 1GHAG 1RFNA 1TRNA 4MPVA 5A8ZA 3SV6A 4ISLA 1OS8A 3ZZ9A 1AFQB 1V2PT 1TQ7B 1YP9A 1LTOA 3T2NA 3RXCA 1LVOA 3SI3H 3SU3A 7ESTE 1VJAU 2BD5A 1BTYA 2XBVA 4UE7H 1GWAA 2BD9A 1XXDA 3UY9A 2SGPE 4AB8A 1O5AB 1D6WA 2VIPA 3HPTB 3WW7A 3QDZB 3AK5A 3UIRA 3ZVBA 2KCOA 3E8LA 1MTUA 3JZ1B 3T26A 4ESTE 2EY4C 2ZWLH 1SPJA 5EW1H 1SOZA 5B6OA 5FXLA 3SZNA 1TNGA 1O35A 2KAIA 2TPIZ 3EQ0H 1GBFA 3BTTE 4JYTA 2QF3A 4ABJA 1DPOA 5T1VA 1C1NA 3ATWA 3M35A 5EJ1A 1O2LA 4TWYA 1GMDG 3SV2H 1YPLH 4Y71A 1DM4B 1GJBB 6CHAC 1TYNA 1C4Y2 5FX5A 1NN6A 1MU6B 4OGXA 4AGJA 1C1QA 1P2OA 1NRSH 1UTNA 3RUOA 2TGTA 1GI6A 2VU8E 3RXSA 2W7UA 4BAQB 3PMJA 2WINI 1WU1A 3ZZBA 3ZVAA 1ZTLA 1NC6A 4DG4A 1MUEB 5ABWA 2GMTC 5GNDA 4LXBH 5DP9A 4H6SB 5FCKA 3QGJA 2NU3E 4X6MA 3MNCA 2BQWB 5A8XA 2ZHWH 1OWIA 1FAXA 4Z6AH 1HGTH 1DE7H 1YGCH 4FUHA 3RXTA 7GCHG 1RD3B 2H9HA 3BSQA 4SGAE 1V6DA 3OX7U 3SV8A 1GHVH 3VXEH 3UOPA 4XBDA 1BQYA 3CENA 5FPTA 3ODFA 3LGYA 4I86A 1DY8A 5F6MA 1UCYH 1GJ6A 4RKJB 1COWD 4MNVA 1CGJE 1F5RA 1UK3A 1SGTA 1GHAF 3EAJA 4X2VA 2J38A 2GJGA 2P8OB 1TA2A 1C5SA 1NBMD 1MTNB 2AYWA 1P01A 1GL0E 2EEKA 1AHTH 3GCTG 3P17H 3A88A 3M61U 4XBCA 1HAGE 2ZDKA 1P3EA 2A2XH 1GBBA 4IC6A 4A7IB 2BLVA 1MCVA 1A61H 2TBSA 3S69A 2GCHG 3SV7A 5C2ZA 3RLYH 2ZHQH 3NXPA 3DT0H 2ODYB 1BHXB 5C67A 2ZKSA 1C9PA 2C90B 5FX6A 2HWLB 3B9FH 2FS9A 4I32A 4ZROA 3AW1A 3U8OH 3PRDA 4Y0ZE 5EGMA 3N7DA 1GMDF 5K0HA 1VJ9U 1QJ1B 4GHTA 3PMAB 3SNEA 2UWOA 3P8GA 2UUKB 5C0UA 1HJAB 1ZPCA 5TCCA 4CRGA 2SFAA 4TT3D 1OXGA 2QA9E 2FDAA 1G32B 4YTAA 8KME2 2WPLS 4KTUA 5JYIA 1XUFA 5G4BA 4CRDA 1Q3XA 3LPRA 1S81A 1ACBE 3ZVFA 2A4OA 4OS1A 1LMWB 1TPOA 1TRMA 1ZR0A 2OCVB 3TJOA 3PMBB 5EODA 1NY22 2SNVA 1H4WA 1JBUH 3OYPA 1J17T 2R3UA 2B8OH 2BDBA 1TGCA 2WSSD 1K1OA 1CE5A 1L1GA 1ZRBA 2RCEA 2F9OA 2YMSC 1TOMH 2PUXB 4BTUB 2CHAC 1HUTH 4ACAA 1D3TB 7GCHF 1HYLA 4X6PA 1NO9H 1SL3A 4NIXA 3BTKE 4P02A 2ZA5A 5JBBS 4TPIZ 1TNIA 2BY9X 1SSXA 2ZU5A 1W14U 5F8ZA 1MTWA 1ZZZA 2A5AA 2GD4B 1XKAC 2Y7ZA 3LKWA 1ELVA 4O3TA 3A80A 3QUMP 1TA6A 2LELA 4NGAH 1SB1H 4OS4A 1MBQA 4O03A 1SGPE 3ENSB 3SNCA 4AYYB 2GX4A 1UVPA 1JOUB 2BXTH 3Q3KA 4HZHA 2OK5A 1WUNH 2GKVE 3SNDA 3MO9A 1O36A 3CNRA 1OKXA 5FAHA 2HNTE 3UR6A 1B0FA 2ANMH 1EOJA 4X8VH 2BY6X 4NFEA 3H7OA 2FOCA 2EI6A 1T8OA 1C5OH 1DXPA 3RU4E 4B75A 3GCTF 2WPMS 1EZQA 2ZFPH 4ZKSU 1JRSA 1WV7H 1O2WA 1YLNA 2BY8X 2ZFSA 1XKBC 4OS5A 3G01A 4AYVB 1GBLA 2GCHF 1F2SE 2V0BA 5T3HA 3VGCB 3OEED 2SGQE 1CVWH 2BD2A 1CT4E 3FAOA 1BJUA 1O2RA 2JH5D 1FN8A 2XNDD 1O3CA 1ELBA 4ZMAH 1AVXA 2ZP0H 1HAIH 3ATMA 2BVSH 3NPSA 1A2CH 1SC8U 1E38B 1EJMA 1NU7B 1TFXA 3EA7A 1GJDB 1UVUH 4NIWA 4A1VA 1GCDA 2IJD1 3Q00A 3OU0A 2VIOA 1VR1H 1HAXB 2J34A 4O3UA 1V2WT 2ZCHP 2IN2A 5A0BA 1TWXB 2GCTC 1Z8IB 1TPAE 3E6PH 4F49A 1EPTB 4CRBA 1ESTA 1DDJA 1BIOA 1W11U 1L1NA 2KCAA 3MH4A 3SUFA 2WYGA 2P3FH 1BJVA 3GCHC 4BANB 1GI0A 2WYJA 3LOXA 2CV3A 3SJKA 1ID5H 1G3BA 3MU5A 3PWBA 3TK9A 5DP7A 1O2HA 3PYHA 4ABHA 1BTPA 1QL8A 2ZHEH 1NTPA 3BG8A 1VGCC 3C27B 3MH5A 4HFPB 3GS9A 4HI3A 4X8SH 1NT1A 2VH6A 4ABFA 1A5IA 5GDSH 2TGPZ 1JIMA 4E7RG 2PSYA 2G5NA 3OEHD 1O3NA 3KYGA 4YO9A 5EOKA 1IQIA 4X1RU 5TJXA 1FY4A 3L6PA 1GBTA 2J9NA 1CSOE 1GJ4H 2PKSB 1AUTC 3M7TA 4KP0A 1MZAA 4YOIA 2JH0D 2F9UA 3U98H 4ZUHA 1UTLM 1S6FA 1Y3XA 1GI9B 2KZ4A 3BTME 4FUDA 8ESTE 1HIAA 2JETC 1O32A 2EI7A 2G52A 1ELCA 1QQ4A 3TK5A 5C3NA 2OLGA 4INKA 3LC5A 2VIWA 1K0HA 4IN2A 3MU8A 3A7XA 3MYWA 2OBOA 2P16A 1GBIA 2BDYA 4OS7A 2I6QA 1LHDH 2OINA 2XBXA 3R0FA 3CP7A 2FI4E 1MD7A 1BTHH 1HNEE 1T31A 1PPBH 2OP9A 2ZTZA 2WPKS 3FP8E 1OP0A 4XOJA 1EPTA 2FWWA 1GVZA 1QA7A 3A82A 3KIDU 1C5ZB 4D8NA 2VGCC 1YBWA 2P94A 1OYQA 1THRH 3TJUA 1AKSB 4CBNA 1BZXE 1O3OA 1C5RA 2ZGHA 3OFND 4FU7A 1GVLA 2ZTYA 4H42U 1HFDA 1PPGE 1QBNA 2ZIQH 1EOLA 1AB9B 4Y6DA 4I8KA 2C8WB 2JH6D 4UFFH 1GJ9B 1BTWA 4ACBA 2LNCA 1P57B 3M7UA 1HXFH 1OWKA 1H9IE 4E05H 1WQVH 3ZZ6A 1G3CA 1C2FA 1FPCH 1LQDB 4NZQA 1UVOA 1F92A 3TH3H 5T6DA 1L2EA 1V2LT 1MTVA 2HPPH 3FANA 3RXQA 2QF5A 2P3TB 4FVBA 1YF4A 3MQKC 4H4FA 5EXNA 3QZQA 3SUDA 1ANCA 4INLA 1AQ7A 4X1SU 1SR5C 2Z9JA 1PQ5A 2V3MA 1QJ7B 2H2ZA 2HLCA 5IDKA 3GDVA 4UD9H 2H6MA 4VGCC 2CN0H 3A7VA 4NA7A 2ASUB 2DE9A 1DVAH 2ALPA 2ANKH 3DCLA 1BTZA 3E91A 1QL7A 2H1UA 3QTVH 4YLUA 1T32A 2BVRH 1XVMA 1ABJH 1O30A 2ODPA 1EP5A 4KGAA 1QFKH 1DX5M 3A8DA 1WAYB 5F8TA 1TMTH 1UTPA 2EI8A 3D62A 3PMHB 1ANEA 1V2NT 5GIBA 1OP2A 3IITA 3U8TH 4BAKB 2VVVA 1BMNH 2OXSA 5EPYA 1K9OE 2Y82A 3VPKA 1HAVB 3DHKH 3M37A 1GPZA 1FX0B 1DSUA 1AKSA 2WPDD 3ODDA 5LGOA 2AFQB 5AHGH 3VXFH 4MNXA 1NFXA 8LPRA 1GBAA 1UK4A 1FIWA 1VKYA 3SQHE 3KCGH 1ZSJA 5EG4A 2FOAA 3GDSA 4B71A 2FLRH 3N7OA 5JBAS 1PPCE 5C20A 3I77A 4WMFA 4KTSA 5C1XA 2WZQA 1L4ZA 1HPGA 2BYAX 1ELAA 2ZFFH 4AG1A 4DURA 1ZMJA 3GY4A 1LCYA 1IQKA 3E90B 1GBEA 2AGIX 1KTSB 2W3KA 3M3VA 3GOVB 4H6TA 1G9IE 1IQMA 1ZGVA 2C3SA 2GZ9A 5HM9A 5C1YA 5DSFA 5LPRA 2CGAA 4ZKOU 5HIYA 1GGDB 1RIWB 1ABIH 2BX4A 1UHBB 2Y80A 1FPHH 3Q77A 2QXHA 3MWIU 2AIPA 1PPEE 1LPKB 2M5TA 1V3XA 1YWUA 3K65B 1P2JA 2TGAA 3U9AH 3NRLA 3T5FH 5B6LA 2WV5A 4MPUA 2ZDMA 4D7FA 2AERH 5KECA 2OUAA 2QCYA 3KQDA 1BRAA 3UTUH 4X1QU 1F5KU 4HGCA 1Z71A 3LIWA 3N99A 1PPZA 2HNTC 2FYQA 1IAUA 4LZ1H 4TY7A 1RS0A 1HAPH 1SHHB 5CHBA 2R2WU 2QAAA 2GDDA 1YC0A 3K9XB 3WWFA 1LQEA 3SORA 1Y3WA 2QV1A 5HKKD 1E35B 2ZG0H 4NWKA 1C1WH 2A7CA 1ZOMA 3F3BA 3ATLA 1C9TA 2ZTXA 1TNKA 1GMHG 5CMXH 4E7NA 1UMAH 1AZ8A 1PQAA 3LGUA 3P8FA 2Q1JA 2FOGA 3SU0A 4HG6A 3SOSA 2ZPQA 3VB5A 3RP2A 1O2IA 3VB3A 2XC0A 5LPEA 3F9HA 1QRXA 1UTJA 3CS7A 3EA9A 2FOEA 6ESTA 3S0NA 1BITA 3SNBA 3UWIA 3EYDA 2J4IA 1X7AC 3LU9B 7KMEH 1E79D 1QA0A 4Q7YA 1EZUC 1K1LA 2WV4A 4A1XA 1HXEH 2JJ1D 4D9RA 3RXLA 2XRCA 4MVNA 1WXRA 1FN6A 2XCNA 3FFGA 4M7GA 1C5UA 3LT3A 2VWLA 1V2ST 3MNSA 1A7SA 2HRVA 2OC1A 1KXCA 2Y5FA 1K1JA 1NZQH 1MAYA 1HAZB 2BDGA 3O8BA 3TIUA 1O5EH 4WH6A 1C2MA 4YOGA 1YPHE 1IOEA 2J94A 1XVOA 2ZPRA 3D49H 1UTOA 3F2HA 4ISOA 1AU8A 5HMAA 2FMJA 4GVUA 3MNBA 3E0PB 4YESB 2OC0A 1TBZH 3NZIA 1NPMA 1DLEA 1O2QA 2J5UA 1OYTH 1SGQE 1ZPZA 3UWJH 3AAUA 4LOYH 1Z8RA 5LH8A 4AG2A 4FUBA 1Y3UA 3RMOH 5C5NA 2OBQA 2ZDLA 1O2ZA 1P05A 3RXBA 3SHAH 4Y76A 3EE7A 1T8MA 3ZZ5A 3D23A 3MNXA 3QLPH 3H7TA 1P12E 4B2BA 1UVSH 1QCPA 1GCTC 4AOQA 3SYJA 3T29A 1Y5AT 4RN6A 3GCOA 1BBRE 1MMJN 1PFXC 5JDUB 3TH2H 1J14A 1SVPA 1RGQA 1Z6EA 4MQAA 3FO8D 2ZU1A 3TPIZ 4I8HA 4WMDA 2A5IA 4AFUA 2WUBA 3BG4B 1Y5BT 1GMHF 1UJ1A 1XMNB 2OD3B 3VB4A 1FDPA 2JKHA 2CK3D 5BPEA 1ZSKA 4XE4A 1TMBH 1ZTKA 5C17A 1C1SA 4FUGA 1BA8B 2QXIA 2O9QA 3NCLA 2Z7FE 1PPHE 4SGBE 1OP8A 2D2DA 3TNTA 1RXPA 3RXAA 5EQRA 1KDQB 5T6FA 2CF8H 2UWLA 2J98B 3RC5A 2FX4A 3U28C 1A3EH 2OQUA 4A1TA 5A0AE 1P0SH 3KF2A 3S9AA 1WDIA 1P09A 4D76A 1HJ8A 1TGNA 2TRMA 1BTXA 3PROA 1CBWC 4X2XA 3Q3YA 3UNSA 1QY6A 1EPTC 3PV4A 1A0LA 2BZ6H 2QF0A 2BM2A 1MKWK 1DS2E 3PO1B 2H5CA 2A4GA 1C1TA 3RXHA 2Y81A 1MQ5A 2P93A 1HJ9A 4ABDA 1L0ZA 5L2YH 3LGTA 5I25A 3A7YA 1MU8B 1GHYH 2H9EH 4GPGA 6LPRA 3GCNA 3TNSA 1GG6B 3IG6B 4ZKNU 3KQBA 2O8MA 4OGYA 1FY1A 4P00A 1OPHB 5DP3A 1AGJA 1AUJA 5FPYA 2YNAA 1LVYA 2XOKD 2ZCKP 5F8XA 4O9VA 2EC9H 1N6YA 1K22H 4NG9H 1VCQA 2EA3A 3KGPA 1SQOA 1PQ7A 1LHFH 1CHOG 1DLKB 2OTVA 4NWLA 2RG3A 2PKSC 4ASHA 1YLDA 4ZCNA 4B1TA 3UUZA 1L1JA 3MH6A 3SU1A 3M3SA 5HM2A 3S9BA 1QNJA 1TX7A 3MTYA 2RFKC 1O33A 1P11E 1SQAA 2VBCA 1FY3A 1O2UA 6GCHG 2ZQ2A 4UFEH 4Y0YE 3R3GB 1NBME 3EDXB 3FN8A 2AEIH 2OC7A 1KDQA 1TX6A 1QRWA 2P95A 1ZHMA 4Y79A 1MCTA 1TQ0B 3RMMH 3UFAA 1CGIE 3UQOA 1SMFE 3RC6A 4I8JA 5GJ4B 2J92A 2ZEBA 1MD8A 5AFYH 1GHBG 1Y8TA 1YPMH 1SGNE 1V2RT 1VITG 1ZRKA 2O8WA 3SN8A 3STJA 3NUMA 1SFIA 1D3QB 1P03A
chains in the Genus database with same CATH topology
1HCGA 3RLWH 3I29A 2HALA 3RXPA 4X2WA 3EA8A 4D9QA 1NRQH 2G51A 4F4OC 1GDUA 1YCPM 2AMPA 2YNBA 1J16A 3MOCA 3OTJE 1Y3VA 1DITH 1E0FD 2QXGA 3GISB 1Z8GA 1BRCE 1TRYA 3V13A 1BDAA 1C5QA 1CHGA 3RXKA 2ZGCA 1ESAA 3AVZA 2BOKA 2ZFTA 5F03A 1GJ5H 1EKBB 3UPEA 1SGYE 4PROA 4ABBA 2Y5HA 1L4DA 1W8BH 3QK1A 1YLCA 2QGRA 1N8OC 1D3DB 2K1QA 1VCPA 1N6XA 3O8CA 1UCYE 1ANDA 2VVCA 1DWEH 3BIUH 2GP9B 2J95A 1TMUH 2CJIA 3GY7A 4IMQA 4YZUA 3C1KA 2R0LA 1GI5A 4BNRA 3SGBE 1G3DA 1O3AA 1XUKA 3BTDE 2Y6TA 1W12U 1EUFA 4DGJA 2HNTF 1K2I1 2VJ1A 5EPNA 1CA8B 1GDNA 3SGAE 1CA0C 4JZFH 1Y3YA 3RXGA 1DT2A 2Z3EA 3Q76A 1CHOF 5HYOA 1AWHB 3ATKA 1EB1H 2GMTB 1SG8B 2BLQA 3ZV9A 4GLYA 1IQFA 4X8TH 2PLXA 4QT8C 4WJG2 4XDEA 4GAWA 4JZDH 2BXUH 6GCHF 1IQNA 1DY9A 1JXPA 3FP7E 1NFYA 2FTLE 1BHXF 5JPMH 4X6NA 2XXLA 1C1MA 2O8UA 2XBWA 1EXFA 2BTCE 3HKJB 4JZEH 1CT2E 1FY8E 2ZHDA 1GHBF 1ZTJA 1SI5H 5FPSA 1VITF 3BF6H 5L30H 3V12A 1G2MA 1O3PB 1C4V2 1V2MT 1ZHRA 1O2MA 3SI4H 2ZNKH 1YPJH 3SU4A 3KQEA 1YPHC 4IBLH 5DGJA 2ZDAH 3RXOA 1S83A 1C5PA 2PKAB 4FU8A 1O2KA 4BXWA 1C5VA 1FIZA 1C5XB 2STAE 4D7GA 3GY6A 1EP6A 4IMZA 4Y8XA 4X1PU 1GI1A 4DJZB 3KN2A 2P59A 1FJSA 3BV9B 4Q7XA 4WVPE 1FLEE 4WF8A 4GSOA 3A85A 3S9CA 3RC4A 3ZZAA 4XSKU 9ESTA 4KKDA 2QYIA 1MH0A 3GICB 4ZHAA 1EX3A 2F83A 3PLBA 1WYKA 1GJCB 1ZPBA 4K60A 3V7TA 1SGFG 1QB9A 4Y8YA 3SU5A 3CS0A 5DO4H 3BTWE 3GY8A 3LH3A 4MDSA 1KLTA 1TIOA 3OSYA 3ZYDA 1Z6JH 4Q2KA 4K5ZA 1V2QT 4WY3A 2B0FA 1G2LA 1FAKH 3RXMA 1G37A 1GHXH 2A4RA 2ZO3H 2Z9GA 1IQHA 5EXMA 1K28D 1HLTH 1XUIA 3BTFE 3QZRA 3A89A 1CGHA 3LDXH 1IQLA 4CHAC 2BLOA 1WQSA 4MPXA 1C5NH 1W7GH 2Z94A 4I31A 1NRNH 5A2MH 1D6RA 2Z9KA 4GUXA 4MPWA 2CHAB 2XCFA 5A09A 3K6YA 4ABIA 1KXEA 1SGFA 3SBKA 1A4WH 1O2VA 3Q3XA 5CHAB 2C93B 3PLPA 4DCDA 2AS9A 2PR3A 3A84A 1K1IA 2TGDA 4B73A 1G36A 2Z3CA 1LDTT 1Z7KA 1AIXH 2UUJB 3A8CA 3URCA 1K1MA 5LPFA 1ZYOA 4CBOA 4B76A 1AFQC 3RXFA 2AGGX 3ZVEA 2FOHA 3DFLA 3FVFB 1AMHA 1O3EA 4YM9A 1AE5A 4AORA 5AFZH 1JWTA 3H5CB 1WBGB 4BOHA 4DY7B 1AFEH 1DWCH 4INHA 1G30B 2UWPA 1BT7A 3RMLH 5I46H 4AGKA 2A7JA 1D9IA 1AI8H 2OC8A 1QB1A 5DJ7A 4YLQH 1ELFA 2ZPSA 3SJ8A 2ZZUH 1O2PA 4HTCH 3AAVA 4CH2B 2BLWA 1MKWH 4ISNA 2ZI2H 1OWJA 2PHBA 1NU9A 3P95A 1BUIA 3SNAA 3HATH 1PPFE 1O5GH 1FV9A 2FOBA 1HBTH 4R0IA 2W7SA 1Z1IA 3M5NA 1AVWA 1DUEA 1UTQA 5EW2H 1C5MD 3LJJA 2G5VA 4AN7A 3MO3A 3W94A 1QJ6B 1XUJA 1RTFB 1YM0A 3ZVCA 1U6QA 1E34B 5EQSA 4NA8A 1C2JA 2B9LA 1TB6H 2C8XB 1T4VH 4TYDA 1IQGA 1S82A 1TBRH 3ZZCA 4TPYA 2GCTB 1DWBH 4DOQA 2A1DB 2WPIS 3HK3B 3DD2H 1C1OA 5IYTA 4BXSA 1ELGA 1C2LA 2G8TA 8GCHG 3QN7A 1W13U 5JB8S 1A46H 3GCHB 1V2JT 1H8DH 1EAWA 2HVXA 1JIRA 1O2XA 4O97A 5H4IB 4ZAEA 3LGIA 5ESBA 1O2OA 5GPIB 1GJ7B 1P9SA 4FUCA 1O5CB 1VGCB 5ESTE 5EXLA 4TY6A 1QQUA 2A4QA 4NFFA 2FS8A 1WTGH 1RJXB 1E36B 2P8OC 2YOLA 2VWMA 1QB6A 1MTNC 3FP6E 4AZ2B 1T4UH 2BQ6B 2C8ZB 2PGQB 3U1JB 2GVFA 4XFQA 2XW9A 2H5DA 2W5EA 3M7QA 1TBQH 3BEFB 2GTBA 1BMMH 2FO9A 5HGGA 2DUCA 3RDZA 3DA9B 1GG6C 1PYTC 1HAVA 3MU0A 1LVBA 3NKKA 1NS3A 2JETB 1O5BB 2ZGXH 4YT7H 1TNJA 4Y10E 1O39A 2VH0A 2F9BH 1FNIA 2AGEX 4K1SA 4FUEA 4IC5A 1W0YH 5GCHG 1KXAA 4Y7AA 3MO6A 2ZQ1A 1Z1JA 3ZYEA 1UVTH 2ZFQH 1EJAA 1D3PB 1AE8H 4FUFA 2V6NA 2BZAA 1HJAC 1XXFA 1FXYA 2BDHA 1EAIA 2D26C 1GL1A 1HAHH 3SHCH 1SLXB 2VINA 1C1UH 1ORFA 2SGAA 2AH4X 4K8BA 2ZU3A 1SGDE 2G4UA 2B5TB 1TLDA 1QBVH 1S6HA 2FX6A 1S0QA 1UHBA 3O8RA 4DW2U 2FIRH 3QTOH 3VFEA 4TWWA 1N1LA 1O3BA 2R3YA 3PTBA 4CREA 4KELA 2ALVA 4WH8A 5J4SA 4GCHG 3S7KB 3TJNA 8GCHF 2XYAA 1V2OT 3UREA 1P2IA 1AZZA 3BTHE 1DOJA 3SQEE 3SJOA 3SGQE 2ILNA 2PW8H 3FZZA 1OSSA 1ZLRA 3RXVA 1D4PB 3PB1E 2VB0A 1C5YB 1O3MA 3RXJA 3MFJA 1P9UA 3VB7A 3F1SB 3MI4A 2Z3DA 1NFUA 2VIDA 1O5DH 3JZ2B 4U32A 4FXGH 4JK6A 3GYLB 3LGWA 3MHWU 4VGCB 1EZXC 1NM6A 1DUAA 1ELEE 2PTNA 1BCUH 2ZF0H 5SGAE 3PWCA 3ATIA 1C2GA 3P8NA 4NSVA 2RA0A 4A6LA 4NIVA 2Y5GA 2XTTB 1TGBA 3RXRA 1QGFA 2WPJS 1C2HA 2BOHB 1SBWA 4THNH 4GHQA 1OX1A 5DKMA 3LJOA 5HXFA 4BAOB 5E8EH 3UNQA 1J15A 5T6GA 2ZGJA 3VGCC 1TGSZ 1AN1E 3HGNA 3T28A 5J4QA 3ZZ7A 3F68H 4AX9H 3SW2B 1MAXA 5GCHF 1F0SA 1F7ZA 2J2UA 3E0NB 1YPKH 2OQ5A 5JBCS 1P10A 1ZMLA 1GI4A 1SLVB 3SU6A 4IN1A 1MKXK 1OWHA 4E06H 9LPRA 1B7XB 1O0DH 1KTTB 1MZDA 1C2IA 1RRKA 1O2TA 3A8AA 2G55A 3SU2A 2GDEH 2GT8A 3NK8A 1TPSA 4UEHH 1T8LA 3M5OA 1DANH 2TIOA 1GBMA 1LO6A 1GBDA 2BB4A 2A45B 1BTUA 2G00A 3NWUA 4ABAA 3GY2A 3W95A 1A5HA 3URDA 1SLUB 1YCPK 1QHRB 4ABGA 2XNIA 3I78A 2BMGB 2F9NA 1JMOH 3K6ZA 4CRFA 3U69H 1Q2WA 1XM1A 3TGIE 1YYY1 3F6UH 2F9VA 2ZDVH 1SGIB 2HOBA 1GBKA 1AWFH 3LH1A 4GCHF 3B23B 3T62A 1ETSH 1S0RA 4R8TB 1J8AA 5DP6A 3OY5U 4WMEA 4RSPA 3ZZ8A 1DICA 1HDTH 2ZC9H 1UTKA 1THPB 4I33A 2D8WA 3VB6A 1DFPA 2QC2A 2A32A 2C8YB 5ETXA 1A0JA 3PTNA 3BTEE 3QX5H 4AFZA 1O2SA 4IS5A 2NU2E 3L33A 1GDQA 1VZQH 1ZHPA 3D65E 4B2AA 1K1NA 1GI3A 2FI3E 1IHTH 3AW0A 3ZZDA 1VITH 1P2MA 1TAWA 2A5KA 1ZMNA 4UFGH 1EQ9A 1JRTA 2CXVA 3S7HB 4AFQA 3DUXH 1EAXA 2BD7A 3U1IB 1B5GH 1AD8H 1EASA 1HAOH 3EE0B 4B2CA 4BAMB 3BTQE 2B7DH 3P70B 2AMQA 3KEEA 1TGTA 1RTKA 2BDAA 3MU1A 2HGTH 1OWDA 1TX8A 2FZZA 2PV9B 2GT7A 3A87A 3RXEA 5DK1A 4MNWA 3F9EA 4MLFB 1W3CA 5EQQA 4CR5A 1C5WB 1P2NA 2SGFE 1H9HE 5FCRA 3RU4D 1TALA 4K1EA 1DXWA 1LHGH 3RM2H 3O8DA 1MQ6A 3UQVA 4AFSA 1THSH 2BX3A 1BBRK 4ABEA 1YPGH 1PYTD 4Q80A 2W3IA 4CR9A 3OY6U 4K3JA 5E0GA 1KLIH 4WXIA 1AB9C 1OOKB 4JYVH 2BD3A 2IOTA 1NESE 1XUHA 5CHAC 3TU7H 1SQTA 1TOCB 2GV6A 3SJIA 1T8NA 5PTPA 1GHZA 3KNXA 2ESTE 2C4FH 4I8GA 1ZJKA 1O3HA 2XWBI 3QO6A 1W2KH 2Y7XA 2ZFRH 2BY7X 2FP7B 2FTMA 5DG6A 5L6NH 4K1TA 5FBIA 4NCYA 1S5SA 2VIQA 6CHAB 4LK4A 3A8BA 1C2EA 1P3CA 1TONA 3A7ZA 1FZZA 1C4U2 2VWOA 4CH8B 1KYNA 1YPEH 3UR9A 1F0UA 1GCTB 4X1NU 2A2QH 3AASA 4JCNA 1HAYB 2BHGA 3MMGA 2LPRA 4BAHB 4X8UH 2A7HA 2FOFA 1O31A 5L2ZH 1QTFA 2ZECA 2D1JA 1C2KA 1FUJA 1GBJA 1KXFA 1GJAB 2RDLA 3SV9A 4I7YH 1V2UT 2FXRA 5E0HA 1WSSH 2CMYA 4X2YA 1ELTA 4UDWH 1MTSA 5E2OA 1F0RA 1W0ZU 2R0KA 1CQQA 3SO3A 5E2PA 1IHSH 4X6OA 7LPRA 3FZDA 1AO5A 1V2VT 1P2KA 1GBHA 1HIAB 1RTLA 2PGBB 4ZXXH 4WXVA 5C5OA 1LVMA 2ZDNA 3UOUA 1NRRH 3V0XA 5C1UA 1B0EA 2QN5T 5A8YA 5K7RA 3P6ZB 1ETRH 1NFWA 4U30A 2ZU4A 1C1VH 3WY8A 4OS6A 5AF9H 3LONA 2SGDE 1CBWB 1HB0B 5JB9S 3TH4H 5AVDA 4AB9A 1KSNA 1V2KT 5GWZA 1HRTH 4A92A 1ZGIA 2O8LA 2Q6GA 2WUCA 2F9PA 1V2TT 2FLBH 4K2YA 4CRAA 2A0QB 4NA9H 4JYUH 3SUGA 1AY6H 2FYRA 4ZHMU 2NWNA 1YKTA 1ZJDA 4Z0KA 1GGDC 1RIWC 3IWMA 2G81E 2IPHA 3BTGE 1VCWA 4X0WU 3QGNB 2F91A 4MTBA 4WWYA 1C5TA 3M5MA 1LPZB 2BD4A 3PLKA 1SFQB 1IQEA 2VWNA 4BTTB 2XBYA 3TITA 1P8VC 2PWXA 1KIGH 1K1PA 1PQ8A 1AVGH 3TK6A 1SOTA 4I8LA 1UO6A 2FOMB 2R9PA 2XC4A 3QWCH 4IW4E 4JMYA 3LC3A 4MG3A 3MU4A 4A5TS 5JBTA 1FMGA 2V35A 1TABE 3A7WA 4LZ4B 1Z8JB 2BVXH 3TVJB 4J1YA 2DE8A 3RM0H 1GBCA 3HGPA 4B74A 3A7TA 1P2QA 4DVAU 1UTMA 3U8RH 4U2WA 3MH7A 1ETTH 1OWEA 2ANWA 2XC5A 5E0JA 3RXUA 1UCYK 1KXBA 5FBEA 1IQJA 1FI8A 1Y5UT 2ODQA 2O8TA 1O3KA 2P3UB 3ZVDA 1C5LH 1XX9A 2GZ8A 3K2UA 3TGKE 3ZV8A 2AIQA 4FUIA 1DSTA 3M36A 1S85A 2PTCE 3M5LA 2FPZA 2GV7A 2PKAA 1S84A 3ELAH 2RA3A 1QBOA 1SGRE 1P04A 1SGCA 2R2MB 1BMLA 5EU8A 3RXDA 1WOFA 1E37B 4UFDH 3BN9A 5BRRE 3F9FA 1MKXH 1DWDH 4BTIB 1Y59T 3ITIA 3VEQB 2GGVB 1GI2A 4YT6H 1O37A 3E16B 2FEQH 1J9CH 2Z6BD 3BEUA 1O3GA 3TJVA 2BDIA 1ELDE 5FHTA 2XWAA 1O3JA 3L3TA 2WPHS 3BIVH 4IGDA 1H1BA 4J2YB 1INCA 1BMAA 1N8OB 4FUJA 1GMCG 1YCPH 1O3LA 1M9UA 5A0CA 2SNWA 2THFB 4U01A 3STIA 4ZXYH 2PUQH 1UK2A 2BY5X 2QXJA 1WCZA 1EAUA 1EATA 1KXDA 1MBMA 1PJPA 1O3FA 1FY5A 3ZVGA 1KLJH 1F5LA 2VNTA 1BOQA 1LHEH 4Y7BA 4JZIA 2V3OH 4DIIH 4DT7B 3GY5A 1O2GH 2NU1E 1CA0B 3KHVA 4MNYA 1QIXB 1KY9A 3KL6A 1GHWH 2ZU2A 1EJNA 3V3MA 1TNLA 1BB0B 1TNHA 4ISHH 3T27A 2Q6DA 5DP4A 4FU9A 1TPPA 3GYMA 1O2YA 1ZSLA 3ZZ3A 3BG4C 1EZSC 2IJOB 1FONA 1BRBE 1O5FH 1QR3E 1P06A 2PFEA 3HK6B 5DP8A 2QY0B 1LHCH 2BD8A 4ZHLU 1P02A 3RMNH 2UUFB 1ANBA 2FM2A 4ISIH 1A0HB 1A1RA 2CF9H 1GI8B 1T7CA 2NU0E 1K21H 2HPQH 5DPAA 2ZCLP 1QURH 4NSYA 5TCAA 4RKOB 2VVUA 2BQ7B 4KTCA 2Z9IA 3A86A 3SJ9A 2AMDA 1A3BH 3E1XB 3GDUA 1QL9A 2QIQA 1O38A 3RU4T 1LKAA 1SHYA 4NIYA 1GVKB 1BBRH 2Z9LA 3LGVA 1XUGA 1FQ3A 3PO1C 3T25A 4FVDA 2A31A 3B8JA 4Y8ZA 1ARBA 2ZHFH 1WTHD 2G4TA 1CU1A 1C1PA