1FORL

Structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
210
structure length
210
Chain Sequence
b'QIVLTQSPAIMSAFPGEKVTITCSATSSVNYMHWFQQKPGTSPKLWIYSSSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSSYPITFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of an Fab fragment that neutralizes human rhinovirus 14 and analysis of the Fab-virus complex.
pubmed doi rcsb
molecule keywords IGG2A-KAPPA 17-IA FAB (LIGHT CHAIN)
source organism Mus musculus
molecule tags Immunoglobulin
total genus 45
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1994-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1forL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1forL01
4XHJD 3RA7H 4J3OC 3EOTL 3AU1A 4G8IA 3CPLB 4Y19E 3MCLH 4L8BB 4JM4H 5DD3L 1D9KB 3D2UD 1UJ3A 2BVPA 3FRPG 1QRKA 3EDJA 4J23A 3KPRD 1OAQH 2HWZL 3DMMB 5IROC 1MWAB 5HY9B 3PWUB 4P23A 3OAZH 3D1MC 3HNVL 5JUEH 3DARA 1S5HA 4LASH 2XQYG 2X89D 3OB8A 3ZKQD 2BNRD 2EDFA 4M61B 4QKXB 1D6EB 5D2NB 1TPXC 1Z3GH 2XI9A 4NKMA 5C2UB 1ZAGA 1XZ0B 4FQIH 1F02I 5F9WB 3K4AA 5J11B 4XC3L 4M6MH 5EZLB 3ZKMC 2BZDA 3VCLB 2BNUB 3QNZA 4EI5A 1NDGA 4ELMB 2R2EA 2OSLA 3PWPD 3ORJA 4ZFZA 4XP9H 3TIDB 3RNKA 4K94H 3VXQA 4LSQH 1EAPA 4R8WH 4ELMF 1XFPA 4XXDA 4LFHD 4NBXB 4BZYA 1P2CB 1SBSH 4M93B 2EIZB 4MJ5B 3C8DA 4WEBH 5EFIB 4PJCA 1OP3H 4ODWB 1RURL 5A2KH 3ZTNH 1T22B 1MRCL 1A9EA 3W82A 1DEEB 5HD8C 1GGTA 5IVOA 4HJJL 1RUPL 4KRMB 2ARWA 4P4RB 1R3KB 4LLMA 1MFAL 2V6HA 4PR5B 2QKIA 1C7TA 3H7BA 4V2CB 4ZTOH 5ANMB 1TJIH 1YN6A 2AQ2A 2AKRB 3NA9H 5JDSA 2KQNA 5IMKA 4F33B 3KG5A 2GUOA 5DRXA 5GS0C 2P45B 2WUBH 3BJLA 3GMLA 1NUDA 3EOBA 3REWA 5EO0B 3CVHA 3KYNB 1KBGL 5FDYA 3I9GL 4M7KH 1CDJA 1VDGA 2PETA 1CD1A 5LKNA 3BRFA 3UAJD 2C1PB 4L4VB 3GSNL 4DGIL 3HRZB 3LKRB 1T2XA 3PWNA 4OF8A 2AJVH 3MRHA 4GMTH 3VFMB 1JNLH 2ADFH 1QFOA 4Q6YA 4GKZB 2R1WB 3JBG7 2VUOA 3AAZB 2JCCE 1WFOA 2F8OA 4XAWH 3V8CA 2XV6B 2H3NB 5DJCB 2G2RB 5DYOA 1OTSD 4PRBA 4PJ8A 4PRAA 4KXZI 2AJUH 4B53A 5HDOA 3D69B 2ERJB 2W38A 3ARRA 4KKAD 3ZT6A 2QLVB 3PDDA 3FMGH 4NCC2 4Z7VE 2IC2A 2X4PB 3U7WH 5EOQH 1XR8A 4P23D 1SEBA 2WK2A 3IJSB 1I8MA 2VC2H 4NFDA 4UUJB 3G5XB 4LPUA 2E8YA 2J6EA 3VMNA 4EBQL 2OR8A 1R5IA 3GGWA 1AI1L 2O5XH 3ULUC 3ZL4L 3P4NA 5MENA 4MSWA 2QQKH 5DS8B 1TZHB 5GS0L 3MV7E 2H32H 3CH8A 2AJSH 3C2AL 1S7XA 2DS4A 2RIKA 4EI5D 4L4TA 4JVWA 5T3XE 4RMSA 4V1DB 4JFEB 1DQJA 5DQJA 4YHMH 1Z5LA 5CHNB 5FYJE 2HA1A 3C60C 4N9GB 1I9JL 2X41A 3V95A 5D1ZB 1NCWL 1U8QB 5MEPA 2ADIA 5KVGL 1N5AA 4PJXB 3VXME 5J56B 2HT2C 4P2OC 3WFEH 1VFAB 1K5NA 2VITB 4KI5D 4X7SL 2CMRL 4YHIA 3ARDC 3FB8A 4G43B 4PJXF 1EZVY 4NC1E 3M45A 4P59L 5DTFB 1YEEH 1GHFL 2R69H 4HZLB 5I8KL 3QUKA 3U4EA 4LOUD 1QA9B 1NBVH 2H26A 5D7IE 5DQ9A 3VFWB 3L3IA 4IIQB 3PP4L 4XMLL 4MJIB 5IBLC 4O9HL 5EZOH 1E6JH 4PLNC 2UVEA 4YZFE 1ROWA 1JWUA 1IBGH 1U42A 4HT1L 4DOHB 3TA3A 4DGYH 3ULUL 1QP1A 3LS4H 3IDMB 1QBMH 3MRIA 4JZNA 1T21B 3IFOB 4Z95L 4MQXD 1A7PH 3KYOA 2HJKB 1OQXA 3VFGH 3HKFA 4AENB 1JPSL 4LEXL 4ZFOA 5CP3A 2V7NB 5CIPB 3SKMA 1CI5A 4I2XA 2B7DT 1YZZA 4YIQB 1T2JA 3SJVE 2ID5A 1ZVSA 5ADOL 3SDAB 1HEZA 5ITBL 1RJZB 1S5IL 1WZ1H 3OHXB 3LKSB 4QRPB 1MSPA 1TQCC 4EDWH 2R4RL 1ZLVH 4JQVC 5K9OB 2VDOH 4K71B 4PJ8D 4EUPA 4LSTL 1F58L 2Z4QB 2I9TB 1B2WH 3BUYA 2YPLE 3L6FA 3MLTA 3HI5H 3IVKB 3MXWL 3BPCA 3ES6B 1CE1L 3QULA 3T3ME 3QCUH 2PXYB 3UTTB 3S36H 1NEUA 1KXTB 2VXUL 2C1OB 4IJ3C 7FABH 5MEOA 4DVRH 1ES0A 1PQZB 4D3CH 5CILH 3RPIA 2GT9B 1TMCB 3DX7B 5MEND 5ACLA 3G5YB 5DHYA 4KQ3H 1ZHNB 3OJMB 4OM1H 3TEUA 4WY7H 3O2DA 2W60B 5JNYA 4RSVA 5B3JE 2WBJA 2Z91A 5JQ6L 2VUYA 2IADA 1OP5K 3UC0L 2Z35A 1OT2A 1JPFA 2NY2B 4L4TD 1NQBA 4LSRL 5DMGD 1AJ7H 2E9IA 1JHLL 4JFOA 5C2BL 4NQDB 5HYJA 3DV6B 2BNQE 5D1XA 1I9RL 4P5TC 3VXTA 3KPMA 4KK9C 1NGWB 1QTYT 1DL7L 3UTSE 5C0EA 4DKAA 1BFOA 1I1AC 2Z8RA 4U1SA 1BQUA 1UEYA 3U7YL 3IU3B 4N8CL 2C4FT 4KDWA 1NGPH 1AXIB 5DMJB 1BF2A 1CLYL 4IRZH 1LNUA 4OZGA 3GSUA 5FGCB 2GJ6A 4WWKB 4N0YH 4A6YB 1BQHB 5IFAL 5K9KA 3FFCA 3RWJB 1A9BA 4JHZA 4YHPB 4NQVB 1HKLL 2ZWLT 3TO4B 2WM0A 4HC1A 4P3DB 4PB9L 3ULVE 4KH2A 4ODSH 5SV3A 5IMOA 4LIQL 3RWGA 5JXEA 1MCOL 2R56H 4J4PC 4YUEL 1CT8B 2MCG1 3TA3D 3OPZH 2DL2A 3BH8A 3VE0A 2DBLL 1IC7L 3MRNA 5F9OL 1DBAL 4PGJA 1VFBB 2V7HB 3BW9A 2V17H 3EO0B 4YHKL 1D5IH 4IEFB 5GISL 4X8XA 4DZBA 4LVHC 5KANI 1I7RB 4PJFA 3STBA 4XP5L 1Q0XH 1LD9B 2EC8A 4HKJB 3HI6H 3IKCA 1H5BA 1UB5B 3DBXB 4MDIB 1F90H 4RX4A 3VDBA 3BD5A 3P3YA 3WNNA 4NCDA 4S11A 3UBXB 3W0WE 1GC1C 3MRDB 2W07A 4JFPA 2B2XH 5FUCC 2HT3C 1R3HB 1V3MA 4M5ZH 5CZVH 2DF3A 4G8GB 4XBGA 4XHQA 3B9KA 1QFWI 3VXNA 5F71A 1YEGH 5FO9B 2PYEA 1WCBB 4I8DA 3REVB 3MGOA 1YUHA 3QO1B 2AJZA 4YWGL 3OKKA 1HH6B 1FAKT 4XCFH 1H15A 4GMSH 1MCSA 3GSXA 5DRWB 4YGVA 3WO4C 1QSEA 4OD1H 1ZGLA 3IDYB 5D2LE 5TF0A 5HGHA 5DJAA 2ICEA 1BWMA 4OCRH 2NY3D 5FIEA 2CLVA 3RL1A 1N7ML 4N5ED 5E8DH 3NCJL 2DQTH 2GITA 1UB6A 1FHGA 2OCFD 4TUOA 3MROB 4O2EA 2IH3A 3PNWA 5I1JL 5I0DA 1WQVT 1TDQA 2DQHL 4NKDA 4LCIL 4PJAA 3O2VL 5CD5D 2VDLL 3MPCA 4JY6B 1S78C 2WW8A 1VGKA 5D1QA 3MJGX 3QWOB 3VMOA 1SYSB 5FEBA 1WFUA 3H0TA 3BXNB 5I8EB 3QEHB 3G6JE 5D1XD 2F74B 2CIKA 3SY0A 4M1GL 5KW9L 1JF1A 5BW7C 5CINH 4M1CD 1G0DA 3ESUF 4HIEB 2H6PA 5L7XL 2DLFL 3RHWF 5L9DH 1L7TL 5A43C 2E7LC 3RVVC 5TH2A 4HKXB 4K3HA 4YJZL 2X4OB 3GRWA 3NH7H 4K8RL 4RBPH 4KY1H 3GSRB 5GJSL 2EE3A 3VFRB 5C0NC 3TYGL 3H9SA 1J05A 2ICWA 3NCYS 5DLMH 1QFWM 5ESAB 1ZLUK 1AE6H 4IRSD 4ZOEA 2C3HA 4HW6A 1PSKH 4M4RA 3GJEA 1U9KA 4D8PA 1HQ4B 1HHIA 3MCKA 3FFCD 4WUUA 3MBEA 2A77H 1FFNB 3BZEA 3CLFH 3HC3L 1GVIA 2WP3T 4UNVA 4HUUB 1UWEH 1KFAL 4GBXB 4WO4B 5JXED 4TPRH 3W5MA 4KAQH 3BIKA 4WRLA 3DXAE 3L5WA 4GKSA 2QSTA 3JTSA 4Q6IC 5ACZB 2I26N 5I6XC 1VGEH 2W59A 3CH1B 1PLGL 3QFJB 3OL2A 4O00A 1LHZA 1MQKL 1F3JB 4DWHA 1S7VB 4PV9A 4I9WD 4RX4D 1NFIB 1J86A 5CJ8A 1YDPB 3U0WH 4JR9H 5DD5L 2VZOA 5D96C 2IMMA 3TO2B 4DGVL 3LKOA 3UZQA 4OD3H 4BA8A 3O3DA 1FYTE 2XA3A 1CU4H 3CXDL 1K6QL 2YKLL 3HZYB 4WW2A 2VDRH 3SO5A 4Y16B 3B9KD 1S9VA 2WBKA 1M7IA 2PYED 4QRTA 5T1MB 4H1LA 3VI4E 1FGNH 3HCVB 1H3XA 1WC7A 5ISZA 25C8L 1X6LA 5CBAB 5EU7E 3K7UA 5EPMA 1G7MB 2Y7QA 1BFVH 4LPCA 4JN1L 5C0CB 5KSBA 3QNXA 5B21A 2FIKB 2YSSB 3TBSB 5KN5B 1QSED 1W8NA 4LLVA 1DBML 1KJ2L 1CDUA 1UQSB 3U0TB 4WFHD 3FB5A 4S10A 4HS6B 5E8PA 3DWTA 2P44B 2XPGA 5CEYA 4JKPL 1U95B 4RGNB 3IT8D 4BM7A 4XP4H 1GZQA 4R4BB 3JVGA 3C5ZC 2OL3B 4LCCB 4QHLB 1YY9C 2VLRA 4ZUSA 5ERWB 1UH2A 3H7LA 3HG1A 4U6YA 3WFHB 1I85C 4TTDD 4M7JL 5F21B 2CK2A 5IB5B 2D2OA 3ZKSD 5ICYB 4M5YL 2R0KH 3BAEH 4KKNA 3PGDA 5DT1L 1UM4H 1I3UA 2IPTH 4MA7H 4U6XA 5E8EA 4ODTH 3L9RB 2N7AA 3LRHA 4P9HH 1RUQH 1RZKC 3F5WA 3SPVA 2BRRL 3CMGA 5HI5D 1NEZB 2EO9A 1KLFA 3CLEL 4NHUB 4B5EA 5J1AA 2GK2A 3H9SD 1KPRB 4LP5A 4NNPL 4OF5A 4QF1A 1P7QB 3SDDA 1HHKB 5GHWL 4X7TA 4O2CB 4A2MA 4PP1D 3GBNL 2DJ4A 1IM3B 5TPWL 4WUUD 3MBED 5CWSA 5I1LB 2CR6A 2XKNA 4YNYB 3T65A 3GB7A 2J5LC 1QSFE 4P49A 4UI2A 4LSSL 3ZT5A 4E41A 3EYOA 2AQ3A 5D7IF 2BOCA 2NX5E 1JYWA 2HJLB 3PL6B 3KLAB 3CZFA 5DJ6B 4ELKA 5C7XL 4KK5D 3DTXA 3V7MA 5HHMD 3R1GH 3RA7L 2IFGA 5CSZA 3E3QC 5AYQA 2EO1A 3G5VA 1IKFH 3UDWA 3QDHA 4L8SC 3MCLL 5T5NF 4JM4L 2A6KB 2AV7A 1FVEA 1JI1A 5TFSH 1INEH 4C58B 1TVDA 3CFEA 3ELAT 4F7MB 5IJVA 4F9PA 1OAQL 1I9EA 2WMPA 1JCKA 2D7NA 3ALWA 2EDBA 4NZTH 2VISA 3O11B 3V0VA 4QHNB 4X98B 5JUEL 1T1XA 4LASL 5KG9B 3U46A 1A6ZA 5ISZD 1DSFH 1IZKA 4LGSB 5L8KB 1Z3GL 3GMRA 4GT7A 5E8OA 2ZUQB 3F6IA 3TT3H 2YXMA 4FQIL 1RUMH 3MFFA 4NBZB 5C0IB 5CBEB 3NCYP 4M6ML 4M9PA 3ZHDA 4KTEH 1AKJA 4JFZH 5F6IB 3L3JA 2PCPA 5HVGB 1D5ZB 3FQRA 2HVKA 4Y7MA 1OARH 4I3RH 3BGMA 3NFSH 2YC1B 1MFEH 2FX9H 4HUVB 2VLRD 5E5UB 2EEAA 4XP9L 3HG1D 1M71A 4K94L 2YD6A 4LSQL 5B3NA 4HUWB 4R8WL 1YNTB 1DE4A 4F9LC 4LNRB 5DZLA 4YDLC 1SBSL 4WEBL 3SE4A 4HK0B 4G5ZH 4QXTA 2X4NB 1TZGL 3QUMA 4CU7A 1MHHB 5IEKA 2VSCA 4JFYA 3ZTNL 1OD7A 2KH2B 3DUUB 3V6ZB 4BSVA 2BNQB 4K2UH 1FNGB 3H9HA 3ARXA 1FJ1B 3UTSB 1OAZH 1IJ9A 5C0GA 1PGRB 5HHQB 1HILB 4UBDC 2AXHA 2PYFA 4ZTOL 1TJIL 1E28B 4G9FB 4Z8FH 3NA9L 1RFDH 3DUSA 3SDDD 1XGTA 4Y5VB 5I1DA 1YN7A 1PYWB 4NRYA 1W0WB 2WUBL 2C26A 2I07A 2I9LA 5C86A 2FJFA 1ED3B 1A1NA 5EN2A 4YO0B 4HDIB 4X6CE 1F6FB 3V5HA 4ORGB 5IB1B 4M7KL 4F2MA 3LDBB 4HLZG 4ODXA 3B6SB 3C6SA 3IRPX 4ZUWA 1WF5A 3BE1H 4GKNA 4Q9QH 2DKMA 2XTJC 4QYOA 2DQIH 1FL3A 1MI5D 1PG7X 3RTQC 1N3NB 4U1NB 2JKXA 5KZCD 1CR9H 2KQMA 4JAMA 4NO2A 5SWSD 2AJVL 5F8QC 3ZYZA 4GMTL 3BGFC 1JNLL 2ADFL 3PJSA 4Z7UA 1FSKB 1ULVA 5DRNA 3MJ7A 1S9XA 4UDUA 2CDFB 3NCBB 3MRBA 4XAWL 3QZWB 1BVLA 3WXVH 1N5YH 2D3VA 1KT2A 5C0CD 2X10A 3O6MH 1QHOA 1HDMA 3QIUB 2AJUL 3TBWB 5JHLH 1IAIH 3O6FA 1ZT1B 3FMGL 3GMNA 1YYMH 5HVHC 5EU5A 4LLAA 3U7WL 1N59B 1TTUA 5EOQL 3ABZA 3TPUB 1ZANH 2VC2L 3KLHD 2WIIB 5HYEA 4I0PC 3S5LG 3UJTH 3PIQB 1BOYA 4QT5A 2O5XL 4X7EC 1Q72H 1U0QA 2CJUH 2EEBA 2QQKL 4QXWA 4Y1AD 1IARB 2VXTH 3STLA 1AKJD 2HTLD 4DUXA 2MMXA 1CL7H 1TQBC 5EU6A 2AJSL 3FT2B 2EDLA 2BFVH 4YHML 4RZCB 4EN3A 1HINH 4CW1A 1NMCB 1RVFH 5EUKA 1NGQH 1EMTH 2JJWA 3WDIA 2APFA 3FB6A 2FR4A 5C9JA 2FO1A 4MGXA 1A7QH 4KGJA 2Z31C 1K85A 3BP5A 5GSVA 2I27N 3D3VA 3WFEL 2OMNA 3L7FA 4U6TA 5CGTA 2AEQH 4ZXBB 1A6TA 4PRDB 3QIWC 8CGTA 1OCWH 1NCNA 4LLQA 1OP5H 4PG9A 2HLAB 2YBRB 1YEEL 2R69L 3QEQE 4K7FB 1LK2A 1UADC 3B5HA 3ECBA 3P77B 1C5DA 1NBVL 2C3XA 3GM8A 3Q5OA 3WE6B 5JMRA 1NCCH 3TJEH 4AM0B 4I3GA 3CVHH 3CFDA 5INCB 3V6OE 4OUOA 1CXEA 5EZOL 3NGBC 1E6JL 1CLZH 3DRTB 1JHTA 4QHMB 1ZVHA 4U7SA 3G6DH 3CGTA 4Y5XB 1IBGL 4DGYL 1OTTD 4NHCH 2WSKA 3LS4L 1QBML 5I1HH 5IGXH 1CGUA 1T5XB 2OMBA 2VLLB 3QDMA 4UILH 4OFYA 1A7PL 1E27B 1XF4A 5L6YH 4C4KO 2NY0D 4HXBH 4OCMC 3VFGL 2QL1A 1FP5A 3L3KA 1NUGA 3FZUC 4HEPG 5E2WH 1KTKE 5JW3H 1X44A 1ONQB 2DI9A 4PJHA 3O0RH 4A2LA 3HE6A 1SJHB 4GG6A 3T4AB 3NCMA 2EDEA 1AGFB 3BZDA 4P4KA 3UTQB 4NC2B 4MAYC 4PGDA 3TLRA 3BRDA 1KIQB 1WZ1L 2ZUYA 3I6LE 4EDWL 4LCUA 1XMWA 4YXHH 2VDOL 3EKCA 1U8MA 3DUHA 5F96H 3ZLQC 4Q7DA 4F7PB 5I1IH 4TRPH 1CXFA 4CADB 4PRPE 3X13B 2FECI 1B2WL 3CK0H 5JHDB 3HI5L 1DQDH 4G6MH 3EYFA 2WQRA 3WHXA 5DUMH 4P5MB 2Y5EA 4KHXH 1I7ZA 3QCUL 3S36L 7FABL 4DVRL 4D3CL 5CILL 1H3UA 1X3DA 4ACPA 3MV8A 4YC2C 2XWJB 4KQ3L 4H0GA 4OM1L 3IXTA 2ZSVA 4WY7L 3KYAA 5EU4B 3UPAA 1OW0C 5EU6D 2VDPH 4OLYH 5F1IA 3WLBB 1BJ8A 1LP9E 4Y89A 1U92A 4L8DB 4GJTB 1AJ7L 1RJLA 4MMXC 1ZA3A 5IQ9A 4QCIB 4HFWA 3UBXI 3WKMH 1I7UB 3TJHD 1X5XA 4QWWD 2Y25A 3NBNA 2Q86B 4UOW0 5FM4A 5L2KE 2BVTA 1CDIA 3D3VD 5EC2B 5HGAA 3WLWC 4JPWH 2VIRB 1NGPL 3Q6GH 1E4KA 4FTVB 3C6LC 3DETC 3O8XA 2H1PH 4IRZL 4KU1A 3BESR 4Z76B 3WFDH 4EI6A 2F8XC 1CFSA 4U1KA 1J88A 2LAAA 3QUXB 1S9YA 5DI8B 2BOBB 3PHQA 5D7LE 4YBQD 3ETBF 3VFOB 4E5XA 2VLMD 4N0YL 1T2QH 2X4QB 4P2RE 5JW5A 1ZTXH 4WEUD 5C08A 5GRYA 1T1ZA 5FO8B 3VJ6B 5I75B 1KCLA 5DSCB 4F15B 1QLEH 4ODSL 1KCRL 1IAKA 1P5VA 2R56L 2W65A 2HG5A 5CP3H 5DK0A 4PRHA 1U8OA 3OPZL 2D7TH 2XG5A 3QDMD 4OFYD 5HI3D 1ZLUH 2V17L 3CDFA 1IAOB 1D5IL 1HSAB 3B3IA 3ARBC 1Q0XL 3HI6L 3O3AB 2E5EA 2N1KA 4HF5H 4Z7QE 4GRLB 1F90L 4R0LA 1OM3H 4M6AA 3SGKA 4P4KD 1G84A 2ZNWA 1FNHA 1ZEAH 3GIZH 1IT9H 3B9EA 2VO5A 2B2XL 5BRZE 1UG9A 4HJ0C 4M5ZL 5CZVL 1MUJB 5HHVH 2AEWA 1O7SA 1YEGL 4C56B 5JOPD 4AT6A 4Q2ZA 2AABH 3DPBA 1PY4A 1DN0B 4JFQA 3BKYH 5LGJA 4R2GC 4MHHI 4XCFL 4AQ1B 3DJ9A 4GMSL 4KUCF 4YBLB 3IDIA 3QUZC 4OD1L 1P4LA 1EFXA 3O2DH 3V79C 4OCRL 4PJEE 3QDJA 4S1SH 2VDQH 5E8DL 3WBDA 5HHOA 3N0PB 3MV8D 2DQTL 5C6TH 3WN5A 5JO5B 5CMAA 1CDBA 1KCUH 2OP4H 4L3CB 4OD2A 1S7QB 5IR1B 4HG4K 3T0EB 3VXUE 5B38A 3D87B 1HSBA 1MEXH 4RGMC 1KJMA 1T20A 4UMGA 3N1FC 2NTSP 5D5MA 3T2OA 3KDMA 3KPSA 3T1FB 1MELA 3ULUE 1A1OB 1X4YA 4P3WA 2EYRA 3R4DA 1SM3H 5CINL 4OZFA 1NAKH 3MODH 5L9DL 1QFPA 3MZGB 1M6OA 3DGCR 3NH7L 4IRJC 4KY1L 3T0XA 3O8XD 1KIUA 2ENSA 4KJPC 4HC1H 5DLML 1AE6L 4G6FD 5CS7A 3QUYA 3M17B 3EJZD 1PSKL 1KJVA 2YA2A 5A2LH 3EIFA 4YDVA 4JO1H 1GGUA 2IALB 3QNYB 2A77L 3DV4A 3FJTA 1URLA 1HHHA 5C08D 1MCHA 2AXFB 2GKIA 3CLFL 1Z9OA 4ZUVB 3H8NA 4XPGH 1UWEL 5FECB 2D31B 4TPRL 2Q20A 4KAQL 4JFDA 4O51B 3S7GA 4XBPA 5JIKA 4ZQKB 2YZ1A 4JEGB 1FZJB 2FYYA 5F7LB 1VGEL 4KJQD 2X9XA 3RKDC 1R3JB 4X6CB 4MCYA 1FH5H 2VLKB 5CEZE 2AV1A 4ETQB 3AXLB 4P9HC 5HGDB 3U0WL 2CIIB 2P24A 4X6CF 3HMXA 1OGTA 1W8OA 4OD3L 1CU4L 3P4OB 4FZEH 2YUVA 2VDRL 3GK8H 2NXYB 3U83A 4KRPB 1ORQB 3NZHH 1AXSB 2HJFA 1Q38A 1XF2B 3C5JB 1FGNL 5EBGA 2DQFA 1CG9B 5EU3A 2Q6WA 2XXMB 5IBUG 1BFVL 1QACA 3CFCH 4FRWA 1YEDA 3BPLB 1S7SB 3CZJA 4QOKA 4FG6C 1EFXD 4X99B 4FFZH 2HLFD 1KOAA 3OKLB 3QDJD 1BIHA 4IOSD 5HHOD 4XHJC 4EVNB 5I2IB 4IS6B 4XP4L 5T5FH 3U30B 5GZOD 2DMCA 5ESVA 2X1WL 2NY6D 2IBZX 4CVWA 1F6AA 3RFZC 1T0PB 2NTFB 4JREC 5TDOB 1JWSA 5FYJU 3B8SA 3DMMA 3RWDA 2JJUA 2R0KL 3BAEL 2ESVE 3R06B 4TVPD 4ZAKB 4OI9A 5AD0A 3OAYK 3KPSD 2BP3A 1JZ6A 4RWHA 1UM4L 2IPTL 1LO5B 3FO1A 2D9QB 1UYWH 4MA7L 3X12A 4ODTL 5GGUB 4HAFA 3SBWA 3V9FA 4P9HL 5E8NB 5FB8B 1RUQL 2GK0B 3S9DB 1FLRH 3GI8H 4LQFH 1GJIA 4R6UA 4MA3B 2FBOJ 5I76A 4NQCE 5H94B 1FVCB 1H3PH 1I8LA 4H26A 1OB1A 5C09B 5HVWA 3QUYD 1RK0A 5F93C 5EZIH 4OF0A 2XZQH 1I9IH 5FV1L 3S88H 3S37H 4MD0B 2A73A 4OZ4B 3U0PB 1I1RA 1P2CA 2Q7NA 3VWJA 2A6DA 1LO0H 2UYLA 3GO1H 4JFDD 3AB0C 4JM2A 2W1NA 1WSST 5CD3A 1UJTA 3OG6B 1CGXA 5ESQA 4NQXB 5DJYB 5E03A 2YD9A 4GW1B 4LBEA 2J8UB 5F88B 4NPYB 5DFTA 2FB4H 3R1GL 4FXGA 1WZMA 2BVQB 3KNBA 4M6OH 3B2VH 2J8UF 2PW2A 4LFHG 3BQUA 3NPSB 1IKFL 3U82B 4WI9A 4H1LH 1CXLA 1NMAH 1NFDE 4JPIA 1K4CA 2Q8AH 5TFSL 1INEL 4N1EA 4I18C 2XZCH 4PYGA 1CIDA 4Q9RL 4NZTL 4PRIE 2GCYA 4OLXH 4P3CH 4NN5B 5T1KA 1YC7A 3BZ4A 4BH7B 3MNVB 3VD9A 2A9MH 1AO7A 2VQ1B 1T89A 1DSFL 2ADGB 3LEXB 4L4VA 1AIFA 5C8JB 2RQ8A 3TT3L 5HSFA 3IKKA 1RUML 5HYQB 4QOKD 3MA9H 1J12A 3KPPA 5FUCE 1VKXB 4KTEL 2E27H 4JFZL 3SEPA 5C0AA 3JUYA 5T3ZD 4MQTB 1OARL 4CVXB 4I3RL 5AYUH 3HZKA 4NN6C 1MJJA 1Z2KA 2P5EE 3MRKB 3NFSL 1FORH 1BZ9A 1U3JA 1MFEL 2FX9L 2H3NA 4NO0B 1U93A 3L3HA 3GMPB 4JRYE 5DA4A 4HX1A 5ETUA 1UJ3C 4QHKI 4LCWA 2MQCA 3C08H 3X11A 2GFBA 3UTPD 3BHBA 4KKAC 1I4FB 4JKLA 5E2TH 4EQ2A 4Z5RB 1FL6B 4GW5B 5HBBA 4P23C 1BD2E 3THMH 1S7TB 5TDPA 2OTUB 3QEGH 1NPUA 4MX7B 5H2BB 4KKLC 2XZAH 1A4KA 1F3DJ 4K2UL 1JGLH 5EC1B 1SVZA 3ROOB 1OAZL 1T3FA 4TSAH 5F72S 3WDHA 3FQTA 3BT2H 2DQUH 4CN1A 4Z8FL 3GSNB 3S35X 4WU5A 1RFDL 5EZJA 4EI5C 5AG9A 3ZKXC 4H5SA 4BH8B 5MEQA 4EKXA 1S9KC 1G7HA 4HV8B 5A40E 3QPQC 1U58B 4M7ZC 3KLSA 3T77B 3VWJD 1N0LA 2XFXA 2YRPA 1W2KT 2V2WA 4JM2D 4KI5C 3BE1L 3V5KB 4Q9QL 5FYKU 3A6BH 2DQIL 2WLZA 3WO3B 3DGGA 3AREB 3ILPB 4X7DC 4HWZA 4WU7A 5E94B 1CR9L 2BVOB 4U2ZA 3HUJE 2APBA 3FONA 1NGYA 2DB8A 3QT2A 3F62A 3KHOA 5KVFH 4LOUC 4BUGA 3WXVL 3NCCB 3BQUD 4NCC1 4PJ5E 5I74C 1N5YL 2WQ8A 2JK5B 1ZHLB 2R8SH 2H8PB 3IF1A 3O6ML 1UGNA 4WTWA 1IQDA 2MHAB 1IAIL 5GGQH 3CFJB 4JRXB 5DJ0A 4RMVA 1CDHA 1YYML 4FQJH 4PD4K 5ICXB 5BRZB 5T1KD 4D9RD 3VXRE 1ZANL 4JO2H 4HIJB 4ODVH 1L4IA 3TZVB 1AO7D 2D0GA 4LLDB 3UJTL 1D9KC 4MD4A 2UY7A 1Q72L 2CJUL 2CDGB 2BSED 4QY8B 5IIEB 2VXTL 3OGOE 4WGWB 3KWWA 3K4DA 2NY1D 1CL7L 1U8IB 1NMBH 5LGKA 1IL1A 3C87A 2BFVL 4QRUB 5K9OA 2P4AB 3MLUH 3NZ8B 3O3EB 5J1SC 1HINL 3QUMH 1MCWM 4PJ8C 5DEGA 1NL0H 1RVFL 1NGQL 1EMTL 2K7PA 4LCWD 1Q9WB 1LDPH 1OAYH 1A7QL 1PKQE 3IJHA 5D93B 3G08A 4HKBB 2ZCKH 2YHGA 5E6YA 2PXYA 5C09D 1J1PH 2AEQL 1R24A 2GTWA 1L6XA 5DGRA 1OCWL 5DK2A 1RIHH 5HHPA 1QR4A 4ZPVB 2DL9A 5D7JB 2O5ZH 3EYQD 5J13C 1VFOA 1FBIH 2QR0B 3WYRA 1EZVX 5J57B 3CSGA 4G42A 3ULUF 3G9VA 4PUBH 1NCCL 3TJEL 4BK4A 3ET9F 3QFDB 3CVHL 4W4OA 5DMGC 1U8NA 3SOBH 3NIDF 3O9WA 3ZDXE 3UPRA 4J3UA 1CLZL 4OZHA 3GSWA 4D0CA 3G6DL 1I3GH 4NHCL 3TYFA 4JFFB 5I1HL 3CSYB 5IGXL 4UILL 2AK4E 2VE6A 4P2OB 5L6YL 1XGQA 4HXBL 2P8LA 5E9DE 2DM3A 5E2WL 5JW3L 3ARDB 3O0RL 4BFIA 2XWBB 1OLLA 5F7MC 1HE7A 2BVEA 3HC4H 3IJYB 1Q9LA 4UQ2B 1D5MA 5A2JH 2BJMH 3U36B 1I7TA 4C57C 4JG0H 1NANI 2OI9B 3SDXA 1XT5A 1ZHKB 4ISVB 4YXHL 4I3SH 2YD4A 5EO9A 5F96L 2YR3A 4MA8H 5I1IL 4NQEA 4TRPL 2Y5TA 3OKMB 4EJ1C 3CK0L 2DWDB 4AIZB 1DQDL 3EDKA 4G6ML 5DUML 3FB7A 2VLJB 1HXYB 4KHXL 3MRJA 5KS9A 4OT1H 32C2B 3SE3A 1T7ZA 1SBBA 3E3QE 4XCEB 1C1EH 1LD9A 4XVJH 5DJ2A 3SE9H 5H8DA 5TGBA 2VDKH 3DBXA 3ARPA 2ERJC 1MH5A 3LQAH 3U1SH 3M07A 4EXPX 1MLCA 3ME0A 3O45B 3MRDA 1NLBH 2VDPL 4OLYL 1K2DA 1T04A 1JZ7A 2UZYB 4N0RA 1RZGB 5ALBH 1C16A 1GZPB 3VH8B 3WS3A 2ITCA 3WUWG 5HJ3B 3AUVA 3OKNB 4F7TB 3WKML 1M05A 2FLBT 3C8KB 2EDXA 1XCTA 3MYJA 5IW1B 4Y19A 1YY8B 3EUUA 2QTEA 5I9QC 3FQXA 1MCKA 3MLXH 2ENYA 2ZSWA 4NYLB 4WWID 4O02H 4JPWL 4IJ3B 3Q6GL 5JA8B 2RFXA 2H1PL 4OKVB 4DN3H 5DD6B 1C5CH 1LGVA 2R1XA 3WFDL 1NLDH 5MHSD 3FCTB 2DWEB 1RUAH 4EUPG 3VRJA 1K8DB 1N8ZB 1T2QL 4OV5B 5CD5C 1ZTXL 3PGFH 1UCBH 3E6FB 3MMEA 5E2JA 4OTXH 1MHPH 3P9MB 4K7PY 3VFPB 2DQGH 1SYSA 3O9WD 1QLEL 3UTZA 4ORZC 1EVTC 4JZJB 2XQYK 4P5TB 4KWUA 4ZFOL 4BK5A 2EYTB 3LZFH 2D7TL 2CGRH 1I3VA 4M1CC 1I1AB 2ZPKH 1ND0A 4Y5YA 2HKHH 1ZSDA 1BAFH 5SWZD 3RZWA 3C9NB 4NQSA 3HNTH 1HNFA 3KS0H 4PJBE 5F1NA 3VFRA 1J8HE 5ESAA 4HF5L 2DQDH 2VRAA 1OM3L 5JOFB 4IRSC 1T0NA 3EO9H 4ENED 2BDNH 3X14B 1ZEAL 5D7SH 3GIZL 1A0QH 1IT9L 5C0BB 1ZOXA 4D9LL 2K7QA 3RQ3A 3G04A 1DQQA 3CXHK 3LQZA 4L8CB 1JN6B 1C8PA 3W9EB 1EUTA 1GPOH 3P0VH 1U6AH 2XTJE 2AABL 2UWEE 5JXEC 4NQED 3BKYL 1F4XH 3DSNA 3O4LE 3C5SB 2B4CH 3NN8A 4U1JB 1NFDB 5ACZA 1NC2A 3LKQB 4UNUA 4U3HA 3O2DL 2GSGB 1NFDF 4GAYB 3WEXB 3WNKA 4S1SL 2VDQL 4K71C 4X6DB 4RFEA 3QB7C 2DJSA 5C6TL 2A6JB 3D85A 2FWOB 1KACB 4PBVC 1KCUL 2OP4L 4HH9A 3KPQB 3WDJA 1Q94B 2W91A 4X6DF 4ESKA 1VEPA 1Y6MR 5I1GH 1KSRA 1MEXL 1QHPA 3CDGA 4LPYA 5IVXB 3HZYA 4OGZA 3FFDA 1ZVYA 3B9KC 2JCCA 1XGPA 7CGTA 3VXPA 3HCVA 5IVXF 4FABH 3P0YH 1EVUA 3IFPB 4QTHB 4Y19D 3TN0A 1G7MA 1SM3L 4JRYB 4U33A 1JWMB 2C3VB 4F7EB 1NAKL 3MODL 1B90A 3TBSA 4WW1B 3ZE2E 3RJQB 3ZO0A 2NY2C 1UQSA 4WGVB 4Z7VA 5EDXA 5FO7B 2RCSH 1G0YR 3VRLE 2RAMA 2ZOKB 3PGCA 4HC1L 2HFGH 1HHGA 3KYMA 2A6IB 2VN4A 1BJMA 1MCQA 5ERWA 4YEEA 2YEZA 3V5DB 3OAYH 4JO1L 3UYPA 1D5XB 3MV7A 4YLQT 1MFBH 4M43H 3MRPA 4ZUTB 3WIHA 3P73A 3FQWB 4HIHB 4XPGL 4RAVB 2RR3A 4OQ1A 4UV4H 4JQXC 3WXWH 5CP7A 2E9WA 3MRCB 2P5WB 1IEAA 4N8VB 2F54B 3KJ4C 1X5HA 3PWJB 3QJFB 5FA4B 3L9RA 3EFDH 4WWKC 2EXYC 3VFVB 4PJ9B 5DFVD 3RZCA 4RWYH 5EO1B 1XR9A 3P9LA 3VW3H 1HXMA 1BIIA 4FQXA 2XN9B 5HI5C 1H9VA 3VXMA 5SX5K 2QQLH 1FH5L 4R3SA 3I6GB 5FHAH 3JSSA 3ALPA 2GSIA 3MLWH 3W11D 3LPWA 1GRWA 1VSCA 3LPFA 4NUGH 4PP2B 3G5ZB 4GLRI 2Y9RT 1KJ2B 3DIFA 1IC4H 2IANB 3E6HA 4FZEL 1TXKA 3MBEC 3BWAB 1WIUA 3GK8L 3NZHL 5D7IA 3KPOB 1CLCA 3QXUA 4MJ2A 3VDAA 2VZ1A 2HFFB 4NJAH 2Y6SD 3IGAA 2H2SD 1R3LB 4HH8A 2HT4D 2FDBP 3T2PA 4HIIB 4QHUA 4YDIL 3SGEH 3CFCL 1NC2D 4KROD 2VMFA 1WLHA 3PABB 2VXSH 3PDGA 5J12B 3S98A 4F3FA 1P6FA 4FFZL 1A4JA 3EAKA 1FZKA 2NXZB 5E24E 2GJZB 5IEHB 2LABA 1UT9A 5DMKB 1NC4B 5T5FL 4PJIB 1KTLA 3DSFH 4LLWA 4TVPH 2VKXA 5LAXA 1REIA 4RMWA 4HG4J 4OLWH 5D96B 5I8CB 5DVLA 3B43A 3JTTB 4HHAA 3GJFB 3E2HC 3SJVA 4PJIF 4JKWA 2MOVA 3IFLH 4WW2C 4X8JB 4OZFH 5BJTA 1H3TA 1A64A 3KXFE 3K8KA 4O2FA 1UCTA 4S1RH 1G7LB 1NGZA 4QRRE 3P11H 1U91A 4JDZB 4PBXA 1QEWB 1QO3B 1UYWL 4QHKJ 4UQ3A 3TN0D 2C3WA 2R2HB 1JZ4A 1N6UA 3GMMB 4I4WA 4LEOB 5BS0B 4IMLA 4X4XB 2AP2A 5JPNB 5EG6C 1FLRL 3GI8L 4OAWB 5I66A 4LQFL 5C0IA 1B0GA 2YPLA 5BZWB 2VB5A 3GMOB 1JNNH 3DX8A 3K1DA 2AQ1A 4K3EH 3RUGB 1H3PL 3EBAA 3HLAB 5EH1A 4GXUN 4X5XA 3SCMB 2X4SB 3JVGC 1FNAA 1HQRA 5EZIL 2Z8WC 1MFDH 1WBXA 2XZQL 5HGBB 1UA6H 1I9IL 3FOMB 3RUGF 3L5JA 1CF8L 2WIMA 3S88L 3L3GB 1YNTA 3MV7D 3BUTA 3S37L 4BSJA 2AEIT 1CN4A 2FSEB 4XCNB 4HK0A 4OLUH 2X4NA 3AFLA 5T3XD 3GO1L 1KLUA 3QWQB 1JFQL 4MXVE 2X70A 1QG3A 5FYJD 2VAAA 4ONOA 4ZO9A 3RZCD 1MPAH 3MNZA 3UTSA 3L5HA 3NMEA 3HMXH 4RIRA 3VXMD 2FB4L 4GBXC 3WJLA 4LF3A 4R9HA 4M6OL 3B2VL 1A6VH 4F58L 1ZT4A 3L5IA 4C4KT 3MRRB 3SDDC 4Y5VA 1NMAL 1FCCA 1CGWA 3N1GC 5IT2H 2Q8AL 2DBJA 1T0MB 1N4XH 3LV3A 3OKEB 2XZCL 2G5BA 4DJMA 1PDKA 4OLXL 4ZODA 4P3CL 4ORGA 4XWGH 4WJ5A 1I3RB 3JV6B 2X6MA 1L0QA 3IYLW 4KPHH 2A9ML 4X6EB 1EJOH 5T3ZH 3MRGB 3MGTA 1AQDA 4P2CG 3MA9L 1IEBB 4JZOB 2E27L 1X4XA 4X5WA 3TT1H 1LE5A 3G6AA 4JVPA 3I6KA 5AYUL 3DURB 3WIFA 1FORL 2PF6A 5JPMB 1G7IA 3QCVH 4U1LA 1B0RA 4L8SB 3UDWC 1T83A 3K46A 1CICA 4Z0XA 4R4FH 4NNXB 1IGTA 3SJVD 5IV2B 1M7DA 3W0WA 3CX2A 5E2TL 1MVUB 3IXAA 4Z78B 2DYPB 3THML 5A2FA 2FZ3B 4GW4A 3VFTB 3KLHC 1F5WA 1KGCE 3QEGL 4LCCC 1GYAA 5E4EC 4FFWC 4NDMB 8FABB 1AR2A 3QDGE 5J0BA 5SWQA 2XZAL 4NT6B 1JGLL 2YPLD 5C07E 3HHRB 3LEVH 4TUJA 4TSAL 4XGZB 4ZOCA 2HTLC 4PREB 4IDJH 1FIGH 5E08H 3BT2L 5D9SB 2DQUL 2F53A 5D2LA 1VACA 1JNHB 5ID0A 1T03H 4LDEB 4OCNC 4JANB 3PWLB 2IAMA 3CU7A 2D9CA 1FL5B 4J8RB 2P8PB 3GKZA 1BOGB 3PQYB 4YDLB 1UXSB 2FJHB 1A14H 1QRNB 1U3HA 5BOZG 2X7LA 4LKCB 4LU5H 3QXDB 4EXKA 5TF1H 4HKZA 3U9UA 3A6BL 3GM0A 4IOIA 5E99H 1NCAH 3G6JA 3MLZH 4H25B 3GUTB 3CUPB 1RZIA 2OBGA 4AEEA 4MNHB 4XVTH 2JLLA 3DLQR 4DCQA 3KHQA 1GGIH 4KDVA 5FM5O 5KVFL 1F4WH 1U36A 1JUFA 3MA7A 2VL5A 3BN3B 1YYLH 2R39A 5J8OA 5DHVA 2R8SL 1VEMA 4F7CA 3MRMB 3QXWA 5AWNH 4PJDB 2XWTB 3PL6C 4U4BA 3QDAA 5GGQL 1LE9B 2H32B 3QISA 4FQJL 4KJYA 1YPZE 2A1WH 1T5XA 4PJDF 4NKIH 4JO2L 4OUUA 4ODVL 3L3OB 3RNQB 5IFJA 1AGBB 3ULVD 3S6CA 4B50A 4JY4B 3EDDA 3GEWB 3RTQB 3TVMB 4MNQE 3O4LB 4UTAH 2Q7YB 1CFNB 3DXAA 3OR6A 2VZSA 3AROA 4Y2DA 5C0DB 1BVZA 5A16A 3S37X 5CGYD 5FYKD 4G80A 4YR6B 5JA9A 3WNPA 1NMBL 4G7VH 5C0JA 3LPGA 3HAEA 2DJUA 3JWDH 1FAIH 3MLUL 4P5KA 1CICD 3QUML 1X9QA 1NL0L 1TVBB 4GG8B 4NZJA 2I24N 3TBTB 1LDPL 4L3EB 1U8KB 2WLYA 3KGRA 3SDCA 1OAYL 2Q3ZA 5K93A 3W0WD 5HVHB 4L9LA 2OJEA 2APWA 4I48B 1FYTA 2ZCKL 1TCMA 1TTGA 1C08B 3N50A 2CLZA 5E2UH 1J1PL 4ZO8A 4OCSH 3SO3B 4CMMB 4Y0GA 1IGJB 5FGBA 3IDJA 1RIHL 3QG6B 1MHCB 4N1HB 3L95A 2O5ZL 4M4PA 2IPKA 5FUOH 5E4IA 1FBIL 1AGCA 3DO3A 1LVEA 1TQBB 3WNMA 4PUBL 2EDKA 2F53D 4BKLB 2CRMA 4X9BA 3LSOA 1ETZB 3SOBL 3LQAC 4CDHA 3TJHC 5HYSB 2IAMD 3ROLB 1KG0B 3QI9B 1I3GL 2IH1A 1QFHA 3GIVB 2XTLA 4WV1B 3CFBA 2Z31B 1R5WA 1FO0H 1U3HD 1ZK9A 5DJDB 2VIRA 1FZOB 4NO3A 3QIWB 3KPNA 3T04D 3MRQB 4OSUH 5EBMB 3CU1A 3MGAA 4U2YA 2HN7B 3GSOA 3QUXA 2O5YH 3HC4L 2BOBA 4PJGE 3QG7H 4KRLB 4YBQC 1DZBA 4J3VA 2BJML 1EEYA 4JG0L 5FCUH 4RAHA 4UINH 1K8IA 1CFTB 4I3SL 3EOAB 5F3BA 4MA8L 3D25A 1IGYA 5DJ8B 3ARFA 3TNNA 3L5XH 4PD4J 3EYVA 1G7PB 3WHE0 3P0GB 4LDOB 2ZG1A 5HI3C 4OT1L 2H9GA 1Y6KR 3U7AA 1IKNA 4XRCB 3RWCA 1C1EL 3IDNA 4XVJL 3RWHA 1QSFA 3QIUC 3PWVA 4MWFA 3SE9L 2Q8BH 2VDKL 4KRNA 3DXAD 2JJSA 4Y2DD 3LQAL 4OLZH 1KIPA 1NKRA 4WHCA 5IW6B 3U1SL 3ARSA 1BECA 1WWCA 2NX5A 1G7JA 4HQQH 1OVZA 3KPLB 4X9IA 1NLBL 5BXFA 3JUZA 1JK8B 3F7QA 3MUHL 1J0IA 2DLEA 5ALBL 3X3GH 2KL6A 1KTDB 2P43B 1U8HB 3QXAB 1DDHA 1WUNT 1LK3H 1T1YA 3TBVA 3VGEA 3SDCD 1NAMA 2ICCA 1LEGB 3RIAK 1FYTD 3NIGE 3MLXL 1ZMYA 4O02L 4JJ5A 3B2UD 4MS8D 1II4E 3LY6A 4KDTC 3W9DB 1SY6H 4QRRB 1FGVH 4OB5H 4DN3L 2B4CC 4DZ8A 4NOFA 1C5CL 3ZKND 1NLDL 2EDDA 2NW2B 2VWEC 1RUAL 2XY1A 3D39B 3QIBA 3UJIH 3WFBH 4XX1E 4YHNB 4YHZH 1XF1A 3PGFL 1UCBL 3N1QC 2JIXB 4OTXL 1MHPL 5GGSB 2EXWD 1CWVA 2DQGL 2P1YA 4ZXBC 4TULH 1NJ9B 4Y8DC 3HE7D 3AMLA 5K59E 2SEBA 5C0RH 3LZFL 3VDCA 4Y4KB 4QLRA 43C9B 1WBYA 2ED8A 2CGRL 4PGZA 1XIWD 2ZPKL 4Y4HA 2HKHL 3I50H 5IB2B 4HIXH 5F3HB 2KZ1B 1BAFL 4LCYA 1E4KC 1D6VH 3HNTL 3C6LB 4OFPA 5GIRB 4HBQA 1CTOA 1Q9OA 2DQDL 5DEZA 3EO9L 4NJ9H 4APQB 2BDNL 4TNWK 5D7SL 1A0QL 4MQ7A 4XC1H 1FN4A 2HFEB 3ARWA 4L3AA 2G9HA 3MV9B 5JLZA 2AJ3A 3O6KH 4Y88A 1GPOL 3P0VL 5EBWA 1U6AL 5FKAA 4FOMA 3T09A 4PBWD 4Y4FD 1WBZA 3ARFD 1F4XL 2B4CL 2GTZB 3CDYA 1NBYA 5SX5H 2B5IB 5IF0A 5IFHH 4KJQC 1MCNA 5EUOB 1PAMA 4GKOA 2DKUA 3ARBB 1QSFD 1A2YB 2H2PD 1OHQA 5EUOF 1OSZA 3MR9A 2ADJA 5E00A 3SGKC 2NX5D 5DJZA 1OGAE 2Q3AA 5I1GL 3ARYA 5KANG 3VU2A 2FJGB 2W0FB 1ORQA 4LL9A 4PTUA 3VWKB 3F7YA 5AG8A 4NKQB 4FABL 3P0YL 4U0QB 4R2GB 3V0AC 2PW1B 3MYZA 3QUZB 3T0BA 2R2BA 4ODUB 1J0KA 1GOGA 2QADD 2FNBA 4RNRA 1BLNA 1AC6A 2RCSL 5GZND 2YK1H 5D2NE 4EVNA 3RWFB 2ARJB 2HFGL 3QI9D 5GZOC 4LSVH 3QIBD 1X5AA 1JTPA 1R3IH 1XEDA 1T1WA 1RZ8A 5C07B 5J1TC 2A83A 4L5FH 3HMWH 1MFBL 2MFNA 4M43L 4NWTH 4RA3A 2UUDK 3TCLA 4ELME 2V5YA 4M3JA 4KKBC 4UV4L 3VFNB 3WXWL 4YHYB 5MERA 3BFOA 1X5JA 3FAXA 3QRGH 2AXGA 3EFDL 3K8LA 4Z0BH 4J1UA 4RWYL 1BZQK 4YPGB 4G9DA 4Y4HD 3VW3L 3MJ8A 5KSVB 3VFUA 4POYA 1UVQA 1EHLH 2QQLL 4IRJB 5B38G 3F7VB 4JN2B 4F15C 1FVCA 4OQTA 5FHAL 1JTTA 2I60H 2XIDA 3MLWL 1FG2B 3FQNB 3QXVA 4L29A 4U1IB 1D3CA 3DO7A 4NUGL 1YMMD 3AS3A 2J3SA 4P46B 3CXHJ 4X5LA 1QLFB 1IC4L 1JL8A 4X0KA 3QEQA 5F97E 5ANME 4OZFG 3BO8A 4M02A 4MXQD 2NLJA 2HVJB 4OLEA 1MCIA 5T1LB 4NJAL 3LN5B 4GRLC 3BVNA 1CCZA 4XP6H 3HPLA 4QXUH 2LV4A 3V6OA 3HI1B 2XZZA 4AZ8A 4UU9A 5E1AA 1N2RB 4M1DH 4HS3B 5ECJE 1MLBB 1RK1B 2VXSL 5DUBA 2FBJH 3DECA 4ONFH 4OM0H 1YPZB 1TZIB 4NUJA 4BJLA 1C12A 5IBUB 3OXRA 4U1GC 3DSFL 4TVPL 4MB5A 3UTOA 1EJ6A 1YPZF 4JDVB 1ZLVK 2GIYA 4OLWL 2BSRB 3U2SA 4YBLC 2XACC 1JRHH 4OKDA 4G6AD 6FABH 4G8FA 1X7QB 1AR1D 4HXAH 3IFLL 1QVOA 4KK6C 4S1RL 5FUZH 1WWAX 5TQ2H 5IWLA 1ZLSH 3P11L 4MCZA 1DLHB 5C6PB 4NRXA 4EOWH 3OB0K 3EO1B 1ZA6B 5KSAA 2NYYC 4PRPA 2EE2A 3I84A 2AVGA 3BP6B 4I5BB 2J12B 2YN5A 4Z77A 4X4ME 4Z7WE 1JNNL 3T0WA 4K3EL 3Q2CA 1SQ2N 5I17B 1T4KA 4MJ4A 3WNOA 1WITA 3IU4H 4Z18A 4KV5E 4XT1C 1MFDL 5T3XH 5CGMA 4WI7A 1UA6L 3EGSB 1FCGA 2P7TB 3D2UB 1JJUA 4CNIA 5FYJH 2CUIA 4WDIB 2MQ0A 4DFIA 3KPRB 5EIIA 4G8EA 3GKWH 4V1DE 4JFEE 4OLUL 1LP9A 2OTUA 3TBYB 4N90E 4DEPC 2BNRB 3L3DB 1EBPA 1NKOA 3DNKA 1I8KA 1MPAL 1VADA 4PJXE 5DK3A 3VXOA 2G5RA 2YUWA 3HMXL 2A74B 5L2KA 4AH2A 5D71H 1FVDA 5I1AB 4JGUA 4Q0XH 1AP2B 1G9MC 1A6VL 1I8LC 1RPQA 5AUMA 5D70H 3FN0H 4RQQB 5KTEH 3PWPB 4IM8A 5IT2L 1RD6A 3VA2C 1NCDH 4WTZG 5I16A 3QEQD 3Q1SH 4WFFD 4FMKA 1N4XL 2Z8VC 3HC0A 3K0WA 5D7LA 1AD0B 3CX5J 2LE9A 3RL2A 1P7KB 5F9JA 4P2RA 4XWGL 2DDQH 5B39B 4HMDA 2EKSB 1UKQA 4KPHL 4ODBD 4IOFD 5FOBA 1EJOL 3AB0B 1H3WM 4JM2C 1TIUA 4FN0A 4M8QA 4MD5A 5T3ZL 1XH3B 4DOHE 4XVUD 1AHWB 1BFTA 5CLWA 1YQ2A 1G7QA 2VOTA 3D0LB 4KRPC 1XGUB 5GRUH 1SJEA 3TT1L 2VTFA 5F7DB 1FFPA 2FRGP 4P57B 1TCRA 2MJWA 2PO6A 3QCVL 2JK5A 4PG2C 1QR1A 1Q0YH 2H8PA 1A7OH 3CC5A 3I3BA 4HZAA 4R4FL 3BPLC 2BVUA 5L2JA 1JGEA 4I18B 4ZMAT 1TJHH 2D03H 3S4SA 2HMID 3E0GA 4R96B 5BRZA 3I6LD 1XF5B 4HGKC 3U79A 5F7WC 2O93L 1EXUB 5KSAD 4PRPD 3ULSA 1QQDA 4QY8A 3LEVL 2XNAB 3UTTE 4FHBD 3FO9B 2MSPA 4PTTB 4QRQA 1BHGA 4IDJL 1FIGL 1RV6X 2NY1C 5C9KA 5E08L 2O61A 4OGAD 4ZDHA 4NN6B 4PJEA 3RVTC 4XH2A 2M8XA 3ARVA 3AU1B 1T03L 3NIGF 4AG4H 1FQ9C 3CVIH 1BBJA 1UJ3B 2BVPB 2DI7A 4OZIE 4UIMA 4IMKA 5JW4N 3VXUA 2IBZY 1JZ3A 4WFHE 4CN4A 1A14L 3JWDC 4P23B 1EHXA 4PLKD 3V4PH 4LU5L 4NQDE 4ZD3H 1WGOA 4AK1A 5C92A 1YJDH 2BC4A 4P46D 5TF1L 4XWOC 1PG7H 1UZ8A 5E99L 1WEJH 4URTB 1NCAL 4NKMB 3J8F7 3MLZL 4NWUH 5L2KD 4POZC 4XVTL 4J3XA 3B83A 1RIVH 3FAWA 1GGIL 1F3RB 2W9DH 3D0VA 1T5WB 1F4WL 3BPOB 3FOLA 1YYLL 5IBTH 5FGCE 4EI5B 1NDGB 3ZKXB 1HH9A 3OV6A 2R2EB 2OSLB 1CE6A 4ZFZB 5AWNL 3RNKB 3C60A 2YOCA 3ULVH 3VXQB 1EAPB 4YHOH 5D7LD 4M7ZB 2A1WL 4P2RD 4XXDB 2EYSA 3CSYA 3S3JA 2F5BH 4YAQA 4KI1A 1JIBA 4NKIL 1M1SA 1XGRA 5GGTA 4PJCB 3NPSC 1MIEH 5FYKH 1G6RA 1DLFH 5D4QA 1BVKB 1EA9C 1A9EB 4B41A 1ORSB 4K9EH 4UTAL 4PJCF 3IJYA 4KI5F 5ENWA 3K8MA 4LLMB 3BN9D 1T7XA 4NN5C 4LQ1A 1Z6JT 2QKIB 4FXLA 3H7BB 4WI4A 2EH8H 3B5TA 1YN6B 4G7VL 5JDSB 1NCUA 2PO6D 5IMKB 4ZYKA 3JWDL 1FAIL 2GUOB 2GQHA 5DRXB 4C83A 4X80H 4XNMA 5JQHC 1NSNH 4PY7A 4WVRA 5JW4R 3GMLB 4ZO6A 5C3TA 3EOBB 4G8GE 4LSPH 3REWB 3CVHB 2JB5H 1HXYA 2E8ZA 5KVDH 1P53A 1S7UB 5E2UL 4AJ0A 1CD1B 3G9AB 5DMYA 3DI2B 4KTDH 3OGCA 2FEDC 2V5SA 3RI5K 4BFBD 3PWNB 2X1PA 4U7MA 5FUOL 3MRHB 2YD7A 4NFCA 4PGCB 5F6HI 1DR9A 2C4XA 4ZFGH 4XP1H 2RJMA 3LH2H 5FM5M 3QQ3A 1H0DA 2CUMA 4JQVA 4LLUB 3OKNA 1TENA 1WTLA 3OKOA 5DYOB 4PRBB 4PJ8B 4PRAB 4XNUH 3JZ7A 5DEFA 4PY8J 4UOW1 2DICA 3VXUD 4F57H 2CXGA 4G7YH 5FYLE 5IG7A 1FO0L 1XR8B 1MHEB 4DKFH 1SEBB 1I8MB 2ESVA 5F89A 1F97A 3LIZH 4HMCA 2DLTA 4WI2A 4WI6A 1KTRL 1R5IB 3GGWB 5DFWH 4OSUL 5DD0H 1QPPA 4OF3A 5DHVH 5MENB 2O5YL 4MSWB 5J13B 1MCBA 4G3YH 3QG7L 2ATKA 3C8HA 4ZTPH 1L6ZA 5J6HA 1S7XB 5FCUL 3DX6A 1HOCA 4UINL 4L4TB 3RDTA 4NQCA 5DQJB 1Z5LB 3O9WC 3C60D 3AREC 2IJ0C 5HXMA 3L5XL 4NP4H 5FK9A 1Z0NA 3O4OC 3FO2A 3BDBA 5MEPB 2ADIB 1I1AA 5LJYH 1N5AB 2E7BA 5J89A 1JMXA 3FT4A 4ZUUA 1CVSC 1K5NB 1A21A 4D0BA 3OKYA 1TJGH 3GSVA 1G1YA 4YHIB 3FB8B 5FDWA 4LSUH 2Q8BL 3EFFA 3UZVB 5A1AA 4OLZL 2KKQA 4CRPA 4ENEC 3QFJE 1G9NH 4HQQL 4RDQF 4D0DA 3QUKB 3U4EB 4OCXH 4POUB 1B0WA 1JN6A 2C3GA 3K3QA 3TZVC 5DQ9B 5JORA 3W9EA 2YUZA 3BD4A 3L3IB 5T1DH 4LHUA 3X3GL 5IBLD 5CEZD 4LGRB 2JE8A 3IDGA 5J6GA 3ARGA 5ICZA 1MI5E 1LK3L 1AD9B 3RY6C 4UOJA 5SWSE 3TA3B 2BXYA 3MRIB 3H2WA 4JZNB 5FA3A 4X9HA 3KYOB 5EOCH 4PRIA 4HGWA 3SE3C 3ILQD 1J10A 2APXA 1SY6L 3RWIA 1FGVL 1S9WA 4OB5L 4ZFOB 5C0CE 3GHBH 4OJFH 3QWRA 2J1KA 3SKMB 1FLTX 4I2XB 4Q9BA 4YXLH 2YPVH 2A0LC 3UJIL 1ZVSB 3WFBL 1OF2A 3RVUD 5D93C 3BKMH 1HEZB 3Q3GA 3T0AA 4YHZL 2R4SH 4HLZH 3V6BR 1UH4A 4RGNE 4Q97A 4L9DA 5BMFH 4Z7WB 3TH3T 3BH9A 1H3GA 2UZIH 4LPWA 4C55A 2P5EA 5D7JC 2EDOA 1Y18A 4TSCH 4Z7WF 2Y1VA 4K7PX 5C0RL 2QHLA 5I9QB 3BUYB 3L6FB 3MLTB 4CKVX 4Y1AE 4B7IA 5IHZA 4KMLB 3BPCB 3I50L 4YEFA 1J5OH 3MREA 2ZUXA 4NO5B 4HIXL 3QULB 3NA4A 2ESVD 4KV5F 4OGXH 5GPRA 1P84K 1D6VL 2NY3B 1BD2A 1ES0B 2CKBA 3RPIB 2JELH 1RZFH 4FMFA 2A6IA 2UUDH 4NJ9L 5DHYB 1KPVA 2YD5A 3BEVB 4XC1L 5JNYB 1B88A 3LOWA 1I1FA 2WBJB 2Z91B 2IADB 2Z35B 1GOHA 1JPFB 1PBYA 2CXKA 3RDTD 3O6KL 4NQCD 4XXCC 2X05A 2NW3A 4JFOB 4KQ4H 5C3LD 3MRCA 4XCCH 1G1CA 5D1XB 3VXTB 3KPMB 3LEYH 5BW7A 5C0EB 1BFOB 1GGBH 1FYHB 3MNWB 3DVNA 4U1SB 4Y5YC 35C8H 5IFHL 1Q1JH 1EUUA 2E7LA 2OI9C 2FGWH 5F7YC 1MCLA 3WD5H 1MCPH 3W11C 4OZGB 4IRSB 1P1ZA 2BSSA 5LVEA 2GJ6B 4WIQA 3A67H 3WUWA 3HUJA 3JXAA 5K9KB 3FFCB 1NDMA 1NAMH 4OZGF 1IFHH 1A9BB 3WFCH 2YA0A 4LHUD 3OAUH 2BY0A 4WTXA 3ARGD 5IMOB 2QJDA 4PJ5A 2CH8A 2H2SC 4XTRC 2HT4C 1J0JA 4HUXA 1RAMA 3BH8B 3VE0B 4Q6IA 1WAAE 3MRNB 4KROC 4XZUA 1N6QH 3BW9B 4PRID 5IM7A 4DZBB 3VXRA 2YK1L 4MHHG 4PJFB 5EIQA 3MO1B 5KSUA 3QWRD 2HTKC 5K33A 3IKCB 1MY5A 1H5BB 1RJYB 3BYYA 4YQXH 4MJ6A 4PJFF 5I8CA 1R3IL 1KNOB 1RHHA 3SKOA 4JFPB 3D6GA 4L5FL 4RMQA 2HT3D 3HMWL 4NWTL 3OB0H 1Y0LA 4XBGB 3B9KB 3VXNB 4N68A 2PYEB 2P5ED 2DM7A 4TNVK 4JDZA 5GGRA 3QRGL 5DDHA 4OI7A 3MGOB 1YUHB 3TN0C 2AJZB 3OKKB 3F8UB 4Z0BL 1H15B 4Z7NE 4OZIB 5F1OB 4YGVB 1QSEB 2UVFA 1ZGLB 4KGLA 3ZYJA 5BZWA 1PKQA 1EHLL 5HGHB 5DJAB 2ICEB 1ZKAA 3MRLA 4DQOH 4FQQA 1BD2D 4GXVH 1MRFL 2CLVB 4LRNH 4XNQA 3RL1B 2I60L 4OZIF 4CMHC 4JZJC 2W0KA 5E5RB 4ZS6C 2X4SA 3C5ZA 4CVZA 3DX9A 1CBVH 2LAGB 1UB6B 4TUOB 4MDJA 4O2EB 2IH3B 3PNWB 3W2DH 4NKDB 3NIFF 1J87A 3FOMA 4PJAB 1I85A 1U8JA 1S78D 5JDJA 4G9FE 4OIAA 1VGKB 4YK4B 5D1QB 4EQ3A 5FOJA 4HULB 2ZCLH 4PJAF 3ZTJG 2CLRA 1VA9A 2HH0H 3H0TB 4XP6L 1JF6A 3QH3A 4QXUL 3KJ4B 2XXCB 2CIKB 4P2QA 5BO1H 4PRNB 1JF1B 4M1DL 3RZCC 2JB6A 4XCYA 2H6PB 4LPVA 2VSDA 2FBJL 2UZXB 4ONFL 4OM0L 3RVVD 1FV1A 2D4FA 5TH2B 2FH8A 5E1HB 2AK4A 4JFHE 2YD8A 5E9DA 5C0ND 1RUKH 5EOCJ 3UX9B 2QSVA 1J05B 3H9SB 2ICWB 2Q76A 4MNGA 4HJGB 3T8XA 1B4JH 2P8MA 3GI9H 3VFSA 3GJEB 4D8PB 1EGJA 1JRHL 1HHIB 3MCKB 6FABL 4WUUB 3MBEB 4HXAL 1YEKH 3BZEB 4M3KB 3AS2A 2ATPA 5FF6A 3OBAA 5FUZL 5TQ2L 1ZLSL 4PJ5D 3I02A 1DUYA 3J7HA 4NM8L 4R7DA 4EOWL 3BIKB 3FL7A 3O41A 3L5WB 4MQSB 3FN3A 3P9WB 4GKSB 3JTSB 4K8RC 5LQBH 3QO0A 3VXRD 2CRZA 1EK3A 1W0VA 5HHMB 5JOPE 1CGYA 3IU4L 1QYGH 5C70A 4WNQA 5T3XL 4P48A 3T1WA 3BD3A 1AGEA 1ITBB 3E2HB 3P4MA 1VPOH 3O3DB 5FYJL 5IV2A 5HHNB 2VR4A 4WW2B 4EDXA 3TH2T 3GKWL 2OM5A 1HI6A 1S9VB 1M7IB 1RMFH 4QRTB 4H1LB 4OFKA 3HR6A 1F13A 5T5NG 1WC7B 4WW2F 5ISZB 4OQTH 2VWEE 5GSRB 1OPGH 5EPMB 1MRDH 5JOEA 3DRQA 2WBJD 3N1MC 3QNXB 1EEUA 2NPLX 5KBNC 1FNSH 2BHZA 4NRZA 5D71L 3FB5B 4QXGH 2VABA 4LKXB 5E8PB 2XPGB 5HYJD 1NGXA 4Q0XL 3JWOH 4DK3A 1DBJH 5D70L 5IB4A 1GZQB 3WJJC 3FN0L 4BELD 5KTEL 2VLRB 4NNYA 4PJ9C 1WIOA 4ZUSB 3VI3F 3HG1B 1PEZA 1NCDL 2VZVA 3Q1SL 5D6DA 3IETB 4U6YB 5FKPA 5D6CA 2HWZH 3P30H 4I77H 4MYWB 1U8PB 3WS6C 4F9LA 1BOGA 2DDQL 3PGDB 2FJHA 3V7AE 2WWKO 3EOYG 4N0FA 1FNEA 2WINA 2X4RB 4P2QD 4U6XB 2GJ6D 5E8EB 2AJXH 2Z93A 3F5WB 3SPVB 4QTIH 4NN7B 5FAAA 3QQ4A 5GRUL 1IAII 2AK4D 1YJDC 3WJLC 2EDHA 3ZHLA 3HR5B 5J1AB 4XPAH 4AEIH 2NNAA 1Z9LA 1Q0YL 4PJBA 4QF1B 3SDDB 3CD4A 1J8HA 4X7TB 2XWTA 4TTGA 5J12C 1TJHL 2D03L 5CWSB 4FNLH 2NXZC 2XKNB 3T65B 1HWGB 3TCXA 4HAGA 4JB9H 1CL7I 1WV7T 5TE7H 3ULVC 3TFKD 5JHDE 5F7EH 2UWEA 4E41B 3EYOB 15C8H 3VGBA 1MI5B 3QJHA 2BOCB 5I18L 3O4LA 2Q7YA 5KZCB 3CZFB 5SWSB 3X3FH 2CRIA 4ELKB 1P9MC 1SYVA 1YC8A 3DTXB 4I13B 5IHUH 3S35H 5CGYC 3HPJA 4UDTA 5CSZB 3VXSA 5ELIA 3PHOA 4K9EC 3OX8A 3G5VB 1IEHA 1FFQA 2V9RA 4AG4L 4F8TA 1JGVL 1CICC 2AV7B 3CVIL 1FVEB 1AQKH 1DQLH 3MXVH 5F6HJ 4BSWA 1KB5A 3CFEB 5IJVB 3F12A 4I48A 4OV6F 4ZFFA 2VISB 3V0VB 3V4PL 4ZD3L 1T1XB 3SCMC 1IAIM 4I0PA 4CN6A 1YJDL 1PG7L 3LKNA 1IGJA 5E4EB 4AEFA 5EBLA 5JZ7C 3QZWG 5B8CA 3GMRB 5E8OB 2R9HC 1KV3A 3W39B 4W81A 3MFFB 2DLHA 5D1QD 4Y1AB 4YDKH 1RIVL 1AKJB 1SVCP 3L3JB 4FTVE 1F00I 2PCPB 2W9DL 3DROA 4TVPE 3FQRB 2HVKB 5CEXA 4QRSA 2NY5H 5IBTL 5DMIH 3BGMB 4N0UE 2BCKA 2VXVH 3CCHA 1M71B 4XNYH 3ULVL 2IAMC 2E9JA 3GIVA 1BJ1H 2PR4H 1IGFH 1A1MA 2F5BL 1DE4B 3TIEB 4J3TA 4QXTB 3QEUB 4JLRA 4OFIA 4QNPF 5GGRY 3LVEA 4RA0C 3QUMB 5IEKB 1FZOA 1MIEL 5M94B 5FYKL 1V3LA 4JFYB 1DLFL 1FZMA 5EBMA 4K9EL 1ZV5A 3H9HB 4R7NA 5LWYH 5CSBA 2YMXH 5C0GB 1YQVH 3CFKA 4GAFB 1YMHA 4ONGH 2Z8SA 1CGSH 3S97C 2EH8L 2PYFB 3TWCH 4EIGB 1BX2A 1N0XH 4K94C 3DUSB 1UM6H 2BSTB 3I75A 4ZOAA 2KUTA 4FQ1H 1J8HD 5I1DB 1YN7B 5DJ8A 4X80L 4NRYB 4WHYG 1NSNL 1CFQA 2I9LB 4LSPL 2FJFB 1A1NB 2Y23A 5EN2B 2JB5L 4C56E 3V5HB 2Z92B 5EOTA 2VQUA 5KVDL 4ODXB 1YEFH 1I75A 3C6SB 2NY0B 2QQNH 4ZUWB 4JKMA 4N0CC 2XTJD 4GKNB 4KTDL 43CAA 3KPTA 4QYOB 1FL3B 3BMWA 1X4ZA 4UT7H 5IMMA 4JAMB 5IVZA 3V7AG 4MAYA 5E5MA 3PJSB 4Z7UB 4XPBH 4ZFGL 5DRNB 3MJ7B 1S9XB 2OQJA 4UDUB 4XP1L 3MRBB 4HLJA 4RCAA 1OTUD 3GBLA 1BVLB 4U1MA 3VXSD 1KT2B 1WAAF 3LRSA 1KTDA 1EEZB 4Z7UF 1L7IH 1HDMB 4XNUL 2AJYH 3GHEH 3T0EE 1MNUH 2MKWA 3O6FB 4CUCA 5I71C 1RZJH 1LEGA 3A6OA 3GMNB 3WMSA 4L9LC 4F57L 4G7YL 1X5ZA 3MOQA 1S8DA 4DKFL 3QA3A 3MFGB 4H0HB 2AGJH 2BK8A 3OKDA 5IMLA 4I0PD 3B2UC 5D8JH 3KXFA 3LIZL 1LEKA 4QRRA 4QT5B 3HAEG 5EU7C 3B9VA 5KVMC 4OCWH 4G3YL 1V8HA 3STLB 3BP7A 1OW0A 2YN3A 5ID1A 4ZTPL 5EU6B 1R5VA 3FT3A 4ONHA 2C7UA 2GY5A 3HZMA 2LU4A 4MLIA 3V6FA 4Z7NF 1JPGA 2EEDA 3DYPA 4EN3B 5GGTH 3HE7C 4CW1B 5EUKB 1G6RH 4NP4L 3FB6B 2FR4B 5C9JB 3DVGA 4TOYH 1XIWC 3BP5B 5GSVB 3D3VB 5F3HA 9CGTA 2IQAB 5IB3A 1CQYA 3L7FB 4CJ0A 1TJGL 1QKZH 2OR9H 1A6TB 4LSUL 2DRUA 4U6HA 4LLQB 5GRWA 4PG9B 1IVLA 4PIRF 5CEZH 4S1DD 1LK2B 1G9NL 2DQEH 3QHTC 1V5JA 3TNMA 2AK1H 3ECBB 1LEIA 4OCXL 1FG9C 3FRUA 2VLKE 1C5DB 4GS7B 5T1DL 2OTWA 3CFDB 4E41D 1YA5A 1J7VR 1HK6A 1PZ5A 1D5BA 3TVMC 1JHTB 4Y4FC 2DIAA 4CU6A 2GTZA 2V2TA 3QDMB 1XF4B 3L1OH 1WWBX 5EOCL 5LCVH 3U6RB 3L3KB 4ZSOE 3GHBL 4PJHB 1A3LH 3HE6B 4YXLL 4GG6B 2YPVL 1OY3B 4P4KB 5DJXA 3BKML 4PGDB 1FPTH 4N8PA 4PJHF 2R4SL 1AH1A 2FIRT 3PV6A 1KPUA 1I1YA 4R4NC 4GG6F 1O5DT 5BMFL 5GS1A 4CBPA 4KFZC 1BFSA 3D18A 3SO3C 3SKNB 2UZIL 5IKCA 4LLYA 5K9JH 3VA6A 1U8MB 1EERB 4O58H 4TSCL 3BZFA 2PTTA 4NKOA 1PY9A 4R90H 3EYFB 3WUZA 3RX8A 1J5OL 4J12A 3ARUA 4OGXL 2QADC 5LG1A 1JE6A 2QHRH 1TLKA 3UYOD 1WICA 3RWFA 3PP3K 2JELL 1RZFL 2GAZA 3MV8B 2X4UA 3QI9C 3QDGA 4LCWE 4WV1C 3IXTB 2ZSVB 3MV11 3VD7A 4GXUM 5B22A 3BKCH 4XMKH 4BZ2H 5TDNA 2LFGA 5F1IB 1U92B 5FGRA 2WAHA 5C09E 1RJLB 4ZPTA 5CFHA 1ZA3B 5IQ9B 4HFWB 1PX3A 4KQ4L 3MJ6A 4XCCL 2GHWB 4UB0H 1E6OH 2FEEL 1P4BH 3LEYL 4EEEA 3NFNA 1GGBL 2WBWB 5AZEH 2LQRA 4DFHA 4PGEA 35C8L 1Q1JL 3WLWD 1INQA 1PFCA 3CIQA 2FGWL 4C54A 3WD5L 1SMAA 3DETD 1MCPL 3O8XB 3RAJH 4EI6B 1CFSB 4G6FB 1A3RH 4U1KB 3PG2A 2J8UE 3ZE1F 4E0RA 1S9YB 4XB7A 1BWWA 3A67L 1LO2H 4E5XB 2FL5A 3LN4A 1U8LA 1NAML 2BERA 5JW5B 1IFHL 3BMVA 3WFCL 4DAGH 5C08B 2BMKA 3SE8H 1T1ZB 3OAUL 1KN4H 4X6FA 4M9OA 5EIVA 3GMQA 1IAKB 1ZHBA 1J11A 3PUCA 2W65B 2HG5B 3VRIA 5DK0B 3BEWA 1MLBA 1RK1A 5L7XH 3GSQA 2ZOLA 5BVJA 1N6QL 1XCQA 2VKWA 4HK3N 3RGVA 1GC1H 4YBHA 3BSZH 5DRZA 3B3IB 4E42A 4PGBA 1Q9KB 5GJSH 2W0LA 1MAKA 5INDA 3O6FD 2J6EH 2X9WA 4YQXL 4R0LB 1NBZA 1QLRA 3P4LA 4MNQA 4ZNEE 2YWZA 2V2XA 4RAUB 1GOFA 4HJ0D 4G6AC 5BQ7A 1AR1C 2ICWI 5IOPA 1KN2H 2BRQA 4AT6B 4Q2ZB 4JCMA 1JGDA 1E4XH 4JFQB 4XI5D 3FQUA 5LGJB 1XGYH 2WWMC 2CKBH 3ZDYE 2PNDA 3P40A 1V3KA 1ZGLM 3IDIB 3MJ9A 1KJ3H 1P4LB 1P84J 3UZEA 1EFXB 1U41A 2EE9A 4DQOL 3QDJB 1IM9A 4GXVL 4LRNL 4XPHH 4EN3D 5EORH 5HHOB 3WN5B 1CBVL 3QDGD 4XBEH 3BPNB 1UXWA 4Y4KC 5CMAB 1I8IA 2NY6B 2UV3A 5HPMA 5JMOC 3W2DL 4OD2B 5B38B 1HSBB 2YKLH 1EBAA 1KJMB 1T20B 2DIJA 5IQ7H 1H8SA 2V5TA 2ZCLL 2HH0L 3KDMB 4HGMA 3KPSB 5SX4H 4N0UB 4HPYH 3L3DA 4GOSA 4APQC 2EYRB 5MHSE 5BO1L 2NY4D 4P0DA 1ZT7A 4UV7H 1TVHA 4OZFB 2A2QT 1ZS8A 5I0ZA 2JTDA 1CD9B 1M6OB 4X7FC 1E0OB 2ZG2A 3I3DA 1TFHA 4KJPD 1RUKL 3KYKH 1AFVH 3OJDA 4YE4H 2R0WH 4RQQA 2GW5A 3QUYB 1K4DA 1B4JL 4MXWH 2NCMA 3GI9L 1KJVB 3JV4A 2B5IC 1EEQA 4YDVB 3S96A 3DV4B 1YEKL 2CK0H 4PJGA 1HHHB 4RRPG 2R23A 2R15A 3JWOC 4FXKA 5A3ID 4FQHA 5SWZE 1DFBH 1X5GA 3HE6D 3AY4C 1TETH 3MRFA 4JFDB 4JRXE 4XBPB 4EUPH 5HYFA 3VGFA 3WL9A 2FYYB 4Q9CA 3RWEB 1T66D 5LQBL 3RGVD 4GO6B 3CLEH 3VWKC 3OXSA 4MCYB 3PDOA 3RBGA 1S7RA 2AV1B 4U1GB 4X4YA 1QYGL 3RPKA 2P24B 4PV8A 2G75A 4MNQD 1OGTB 1VPOL 3V4UH 2DIBA 2RBLA 3QQ9D 5E6IA 5TJWK 4BQ8A 2HMIC 4HWEH 2HJFB 1RMFL 3U4BH 2YPKA 2DQFB 5EU3B 4OQTL 2Q6WB 2EDYA 1MRDL 1X5KA 3Q6FB 2IF7A 5B4MC 2R1YA 1WT5A 2KPNA 1YEDB 4RMTA 4QOKB 2BHYA 2XNAA 1FNSL 4QXGL 1IM9D 1OLZA 4LAQH 4YHYC 1ZWIA 4X6BB 4OGAC 3JWOL 2P42B 1DBJL 3BP4B 1JV5A 3KAAA 5F7KC 5ESVB 2AI0H 1F6AB 1CD8A 2CDEA 4P9MH 3NIDE 1BMGA 1JWSB 4S2SA 2ITDA 3P30L 4I77L 1HYSC 4LMQI 3RWDB 1RZKH 1D7FA 3FHAA 2OXHA 5AD0B 4KKCD 4PLKC 5DF0A 3F65A 3T3PF 2XYCA 3FO1B 4OFDA 4DEPB 3X12B 4P46C 2QSCH 4C59B 2AJXL 4JFFE 1HHJA 3OR7A 4J3SA 4QTIL 5HI4C 5GJTH 4FS0A 5DVMA 1KB9K 3RJDA 2E3VA 5I76B 1EGJH 2BXZA 4K23H 1T5WA 4XPAL 4AEIL 4LHJB 4H26B 1OB1B 1FFOB 4PRHD 3Q5YA 1RK0B 5KOVC 3V4VH 5HYIA 4FNLL 1S7WA 3OMZA 2A73B 4JDTH 2NY5C 2EDWA 2HRPH 1W72A 3VWJB 2A6DB 5ITFA 1TZGH 2UYLB 4JB9L 2X4TA 5TE7L 4JM2B 1CXKA 4LK4A 3LKPA 4JR9L 5F7EL 5CD3B 1BVKA 5ABDE 4BZ1H 3Q48A 15C8L 1ORSA 5ESQB 4GUPA 1Z9SA 2VLJE 2J8HA 4K07A 4KMQA 4LBEB 3X3FL 5LXGH 4JM2F 2B39A 3INUH 1XF3A 5IHUL 3BN9C 3S35L 3HS0A 5I1CH 4FXGB 2R0ZH 1JHKH 2YD3A 3ZYOA 2IFFH 3KNBB 2PW2B 3L7EA 2VR5A 2PO6C 3BQUB 5JR1H 4ZSOB 1AQKL 1DQLL 3MXVL 4JPIB 1K4CB 5BZDA 1ZXQA 1DVFA 2A38A 1OGAA 5E6ID 4M6NH 1JYXA 3ZT7A 2GCYB 3OJ2C 5T1KB 3BZ4B 1S7UA 2ZNXA 1AO7B 4M7LH 3UJJH 2G60H 3CPLA 4L8BA 1AIFB 1D9KA 5EB9A 5CLTA 2BX5A 4FQ2H 1MWAA 3KPPB 1IGMH 4WHTB 5HY9A 4LIQE 4YDKL 3PWUA 4PGCA 1MCEA 5C0AB 2NY1B 4S0SD 3S4SG 4JJHA 3HZKB 4GFTB 2NY5L 2ORBH 1MJJB 3GRWH 5DMIL 4WTZA 4M61A 1JYNA 1D6EA 1BZ9B 5I19H 5D2NA 2VXVL 4LLUA 1U93B 3L3HB 4HX1B 1A7RH 4H20H 1XZ0A 4U0RB 4XNYL 5ETUB 1O0VA 4LCWB 3X11B 2GFBB 3LHPH 3BHBB 1GIGH 2PR4L 1IGFL 4IMKC 5EZLA 3VCLA 4XAKE 1MHEA 3SDYH 1T7VA 2BNUA 5TDPB 4ELMA 3TIDA 2XRAH 4KKLD 2X5PA 1EDQA 1RZJC 1A4KB 5LWYL 1PKOA 2YMXL 1T3FB 3UROR 2YA1A 3CNKA 4K3JH 1YQVL 1JGUH 3JV5A 4MJ5A 4ONGL 2EIZA 3FQTB 1CGSL 5EFIA 4PS4H 5BCAA 3TWCL 1N0XL 4WU5B 4ODWA 4WFEE 5EZJB 1UM6L 3F7PC 1ZLWH 1T22A 2FHCA 2EIBA 1DANU 4H5SB 2DLIA 4FQ1L 1DEEA 2HRLA 5MEQB 4YHLH 2V5MA 1AHWC 3BWUC 1G7HB 5C0BE 3QPQD 4P4RA 1R3KA 4PPTA 3ARZA 4PR5A 3WHE1 3EJYD 1OD9A 5ANMA 1YEFL 2AKRA 2XFXB 3ARTA 4F33A 2QQNL 4M7LT 2V2WB 2IGFH 4LAJH 5DZOA 3DGGB 3MUJA 4HWZB 4WU7B 4UT7L 1FO0B 3FONB 1NGYB 5EO0A 3KYNA 1PJ9A 1KB5H 3ZE0E 4XPBL 3OWEA 4X6DE 1DJSA 1JYVA 1J9CT 2L7JA 2C1PA 5IHBA 3UAJC 3HRZA 3IF1B 1BPVA 1L7IL 4NSKB 5AEAA 3I3EA 3LKRA 2W9EH 2AJYL 3GHEL 1AD9A 1IQDB 1DVFD 1MNUL 5DJ0B 4YFLF 5IVXE 4JGJA 1RZJL 3VFMA 1OGAD 4GKZA 2R1WA 1GGCH 4UZGA 3AAZA 2AGJL 5D8JL 5DJCA 3ZDZF 2G2RA 3ILQC 4RISH 1OTSC 1D9KD 4MD4B 3D69A 3VGDA 1AC0A 3DMMD 1MJ7H 4OCWL 2X4PA 1B4RA 2NY7H 3KWWB 3RVUC 5GGVY 3IJSA 4G5ZL 2DI8A 3EHBD 4X4MA 4Z7WA 4UUJA 3G5XA 4CJ1A 1IL1B 2WUCH 4RFOH 3ZDYF 3UO1H 1V7MH 5DEGB 5GGTL 1EPFA 2BY2A 2VN7A 2FD6H 1G6RL 1ERNA 5DS8A 1TZHA 1KENH 1DEDA 4TOYL 1CQKA 3IJHB 5HTSA 3G08B 3PP3H 4NO5A 3BPOC 2EC9U 3HTLX 4V1DA 2P5WE 4JFEA 2F54E 5CHNA 1QKZL 2OR9L 1R24B 2GTWB 4N9GA 5DK2B 6CGTA 5HHPB 1F4AA 3VH8G 5D1ZA 1U8QA 5CEZL 2XN9E 2DM2A 1RSFA 2DQEL 3BEVA 2ED7A 4PJXA 2AK1L 4MVBD 5D7KE 4YDJB 4G42B 4CGTA 1VFAA 1WK0A 2VITA 4GH7B 3EYUH 3RDTC 1U8NB 2ZUVA 4G43A 1WFTA 4RFNB 3O9WB 3UPRB 3AM8A 4W6YB 4OZHB 3GSWB 5DTFA 4D0CB 2IANE 5I1EH 5C6WH 5CJQH 5J7CC 2EH7H 1J1OH 4HEME 4HZLA 3O4OB 3TYFB 3MNWA 1QA9A 4OZHF 2ZCHH 2VE6B 3VFWA 3GZKA 1XGQB 3L1OL 2IPUG 2FATH 4IIQA 2P8LB 5LCVL 4MJIA 5SWZB 5BOPA 1NUNB 1CYGA 4H88H 2EZ0D 4BFIB 2R29H 5JHLL 1A3LL 4R26H 4IRSA 1Q9LB 3IDMA 4QGTA 1D5MB 2FHBA 2XT1B 1FPTL 2ICES 5K9QI 4N9OB 1T21A 3IFOA 1UWXH 1I7TB 4MQXC 2HJKA 3WNLA 3U4AA 4PJIE 5CUSH 4AENA 3QHFH 3SDXB 2PN5A 4L4VD 5K9JL 2V7NA 5CIPA 4WEMB 5EO9B 1KCRH 3ARGC 4O58L 3O2WH 3TESA 4NQEB 2N7BA 2Y5TB 4YIQA 3SDXF 2VZ3A 3SDAA 2ICWJ 2E6QA 4R90L 5C0AD 1RJZA 3OHXA 3FB7B 3RY5A 3LKSA 2LVCA 4QRPA 5FYKE 1X5LA 3MRJB 1A22B 5KS9B 3X17A 1E4JA 2QHRL 5BS0E 3RBSA 3MO1A 4L1HA 3MOAH 5DJ2B 5F1KC 2Z4QA 4LHUG 5TGBB 5KS9F 2I9TA 1RJYA 4FQPA 1MH5B 3IVKA 3BKCL 1KNOA 1MLCB 4XMKL 3ES6A 4BZ2L 5J4MA 3BOVA 2E7MA 1K2DB 3RUGE 1T04B 3UTTA 2C1OA 1PQZA 1C16B 3WS3B 2ITCB 2GT9A 1M05B 4OIIH 3DX7A 5BV7H 4UB0L 1E6OL 2I5YH 1XCTB 3G5YA 1ZHNA 3MYJB 1P4BL 4Y19B 5GS2D 2W60A 4TN9A 2NQCA 5IW3A 3FQXB 5AZEL 3BI9X 4OZIA 4UTBH 1F45A 2ZSWB 2F53E 1LO3H 4V1DD 3JV0A 4JFED 1EO7A 1F8TH 3QYCA 4B7LA 1N6VA 4NQDA 4Q74A 3STZB 2RFXB 3QP3A 3RAJL 3DV6A 4JCLA 4R97B 5D1ZD 2R1XB 4N90D 1A3RL 1X6NA 1NGWA 2WWKT 4KK8D 1F4YH 5F9DC 1UENA 1LO2L 2JJTA 3VRJB 2ZG3A 3IU3A 2FX8H 3SGEI 2OZ4A 3MMEB 4DAGL 4DVBB 4PFEA 3SE8L 4KXZH 5KJRH 1QBLH 3RX7A 4AIOA 4IBLT 1KN4L 4JQXA 3UTZB 2C9AA 4FP8H 2W9LA 2H45A 3LMJH 4WWKA